4QY5A

Crystal structures of chimeric beta-lactamase ctem-19m showing different conformations
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM,Beta-lactamase PSE-4
total genus 91
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qy5A00
4OPYA 2HDQA 4HEFA 1KE4A 5HAQA 5E2EA 2RCXA 4BJPA 3OC2A 4S2NA 1NRFA 2G2WA 3NI9A 2P9VA 4FD8A 5CGWA 5GLAA 5F83A 3Q7VA 4Z9QA 3IWQA 5CXWA 4HBUA 4EBLA 5HL1A 5M18A 2ZC3B 1IEMA 2BG1A 2ZQDA 5CECA 5HW3A 3VSLA 1RGZA 1PI4A 1BLSA 2B5RA 4OVDA 3LCEA 4UAAA 1TDGA 4OQHA 2Z2MB 4S2NC 4JF5A 3W8KA 4QJGA 1DJAA 1JTDA 1ES5A 1E3UA 4RX2A 3ZGAB 4C3QA 3ZG7B 3Q7ZA 5CHUA 5CERA 1CEGA 1YLZA 5CTNA 1K4FA 1L0FA 3G31A 2PU2A 2VGKA 1SDNA 1N9BA 4CPKA 4OONA 4DF6A 4IEDA 4Y0TA 3RXWA 2HP6A 4RYEA 3SH9A 1MBLA 4KZ9A 1K6RA 1Q2PA 4JF4A 4LCMA 1L2SA 4YINA 1N4OA 3QNCA 5TFQA 4PMAA 1PW8A 2Y2NA 5D3OA 4JPMA 4PM6A 5FSRA 1MXOA 1YM1A 5GHYA 4PM5A 3N8RA 4E6WA 1K38A 2WUQA 1YMSA 2XGNA 5A91A 3GRJA 5KSHA 2J9PA 5EVID 3UE3A 1GHIA 1JTGA 3M2JA 3V50A 4QU3A 4DXCA 3MZDA 5EVIB 2WADA 3HLEA 4X68A 2JC7A 3CZDA 4E3NA 4EBNA 3E2KA 3VP4A 2DNSA 4NETA 3W4OA 1MWRA 3O3VA 1KVMA 4BD1A 3WS0A 5GLCA 1O7EA 2Y91A 3BFCA 4C6YA 1I5QA 3ITBA 5FI7A 2WKIA 3NCKA 4K0WA 1CK3A 1LI9A 1W8QA 1WYCA 4DRTA 4QB8A 4WMCD 1K25A 4KZ3A 2XK1A 1L0EA 4WBGA 4OOMA 4S2PA 1BLHA 3Q1FA 2WZZA 3MXRA 4P85A 1RGYA 3UPPA 5M1AA 1K4EA 2XQZA 1U60A 1XA7A 3BECA 1KDWA 2ZM2A 1BZAA 3N7WA 3FZCA 4OPZA 1FCNA 2Y2MA 2ZC4B 3OCLA 5FA7A 2EFXA 1LHYA 3HL9A 2Y59A 2EXAA 3MKFA 2V2FF 4S2KA 4O7DA 5E2HA 4KQRA 5FAOA 1JWZA 4PM9A 4KENB 4OP8A 4S2IA 4WELA 3ZNYA 4ZJ3A 2WZXA 2A3UA 3HLWA 5FQKA 1FSYA 4XUZA 1KGEA 5FATA 4WZ4A 3S1YA 4N9KA 3IH9A 3RXXA 4OQGA 4E3IA 1BT5A 4MBHA 3VMAA 1OMEA 1IYQA 4GOGA 4KZBA 5DTTA 4DE1A 5A92A 1CEFA 1FQGA 2X71A 5FQMA 3PBQA 4ZJ1A 1ONGA 3G2YA 3WS1A 4LV0A 1LLBA 2C5WB 4FH2A 3GVBA 4WEJA 1W5DA 3B3XA 3E2LA 3OPLA 1W79A 3WRTA 1W8YA 4BD0A 4KG5A 4GB7A 4B88A 4UA6A 1HD8A 3MKEA 5EE8A 5FI2A 4LCLA 2XR0A 4X69A 2PBYA 3FKWA 2EX9A 4U0XA 2H10A 1RP5A 2OLVA 1KVLA 2EFUA 3HLCA 4Y7PA 1BULA 3DWKA 3IH8A 1YLJA 2IWDA 3N8LA 4MNRA 1XXMA 2ZQCA 1FCOA 1VQQA 2OV5A 4OOYA 3SOIA 1BSGA 2EX8A 3SH8A 4Q8IA 5DVAA 1SKFA 1I2SA 2IWBA 4DE2A 2FFYA 3JYIA 5CRFA 3FKVA 1ALQA 1ONHA 5TGFA 3IXBA 4IBXA 4JXSA 5G18A 2ZM0A 4S2LA 4LV3A 4Y0UA 2Y2HA 3FWLA 3HLDA 3IF5A 3RJUA 1EWZA 2ZM8A 5EUAA 3A3EA 3C4PA 1BLCA 1ESIA 5FAQA 5A93A 1ZC2A 1Q2QA 4NK3A 5IHVA 1KGGA 4P0MA 5CTMA 1FR6A 5DF9A 1WE4A 3AGFA 1S0WA 1XX2A 4YFMA 1KE3A 3D4FA 4KZAA 5HARA 1CI8A 2QZ6A 4X6TA 3C7VA 4ZAMA 1XP4A 4K91A 4OP5A 3GV9A 3GSGA 1Z6FA 4BL3A 2WGIA 1HZOA 2X01A 3G4PA 5M19A 1IELA 3BFFA 4A5RA 4GN2A 4GNUA 1K57A 3OZHA 4OKPA 2BLSA 2EX6A 1XA1A 3TG9A 1NZOA 3C4OA 4DDSA 2ZLYA 1TVFA 3BFDA 2Z2LB 4IVKA 3NY4A 4M3KA 3C7UA 2WKHA 3HUNA 5L2FA 3VP3A 5JYOA 4X53A 3BLSA 3ZDJA 1H8YA 1M40A 5FI6A 3OCNA 2Y2OA 3UO9A 4QY6A 3ZG9B 3BYDA 3FYZA 1PZPA 4EQIA 3PBNA 4ZTKA 4DDYA 4OLGA 5CHJA 3G34A 1XGJA 2Y4AA 1NYMA 1PI5A 3AGEA 4C75A 4D2OA 4P87A 1FR1A 1IKGA 2XH9A 1KDSA 2ZC7A 3UDIA 3VP2A 4KG2A 2H0YA 2WYXA 1GHMA 3HUOA 3LY3A 1MKIA 2JCHA 3VP0A 2XD5A 4S2MA 4DKIA 2ZQAA 2R9WA 3MFDA 2ZJ9A 4OPQA 4Y0OA 1KGFA 1BUEA 2ZMAA 4KZ8A 2JE5A 3BEBA 4HBTA 4MBKA 3VOYA 1K55A 2HDSA 2JBFA 3BRMA 1ES4A 1JVJA 2XLNA 1L0DA 4LV2A 1K54A 4K0XA 2J9OA 5E2FA 1BLPA 1EI5A 3G32A 4PM8A 4X56A 4JXGA 4XUXA 2Q9MA 4U0TA 5FQJA 2Y2GA 1NY0A 1E25A 4MBFA 3W4PA 5GHXA 3WWXA 3M2KA 2V1ZA 1H8ZA 1K55C 2I72A 1O07A 4EWFA 4WMCA 5BOHA 1PIOA 2WKEA 4OOLA 3HVFA 3ZVTA 1KE0A 4FSFA 4JLFA 2WGWB 1SHVA 1QMEA 1PZOA 4KG6A 4QY5A 2OSUA 3Q81A 1ERMA 3MXSA 3TSGA 4JXVA 4R3BA 4H8RA 3ITAA 1EROA 3CG5A 3G30A 4IVIA 4LENA 5DF8A 1IKIA 3PBTA 3Q07A 1HVBA 1DJBA 2H5SA 3S4XA 3VP1A 2A49A 3HBRA 5FDHA 1PYYA 4ZJ2A 5CGSA 3ZVWA 1H5XA 4E6XA 4EUZA 5HX9A 2XF3A 4R4SA 3I7JA 1XGIA 4PM7A 5AQ9A 4KZ5A 1J9MA 4E3MA 2Y2QA 4KQOA 4R3JA 4ID4A 4KQQA 5AQ7A 3UDFA 4R23A 2HDUA 4ZDXA 2Y2IA 1LI0A 3VOZA 3PBOA 3V3SA 4DE0A 2ZQ7A 1CI9A 1K54C 1HTZA 2XD1A 2HDRA 3PTEA 5AQAA 3ZCZA 1RCJA 5F1GA 1IYOA 2WAEA 1I2WA 1NJ4A 3M6HA 5FAPA 1E4DA 1LL9A 4WM9A 1SDEA 3WRZA 5KSCA 2R9XA 3LEZA 1IYSA 4FCFA 4HESA 3PAGA 2ZQ9A 1FSWA 2ZD8A 1PWDA 3FV7A 1ESUA 4QHCA 3ZNTA 4MLLA 1GA9A 4WZ5C 1MWSA 1K56D 3GQZA 4S2JA 5FQQA 4X55A 3G35A 3BFGA 3V39A 2OLUA 3MZEA 1K57C 1MY8A 3LY4A 4JF6A 3N4IA 4E3JA 5GLDA 3HUMA 2IWCA 3P98A 3GTCA 5GHZA 3ZG5A 1K6SA 4GKUA 3HLGA 5FQ9A 2RL3A 1PWGA 5DTKA 2XDMA 4ZBEA 1JWPA 2PU4A 3WS4A 3V3RA 4JXWA 5EVIC 5CEDA 3OPPA 5CGXA 5EECA 1MWUA 4GD6A 3EQVA 3EQUA 1YLWA 3PBRA 4LV1A 3A3DA 2HPBA 2H0TA 4RVAA 1GCEA 3UDXA 3UPNA 3UE1A 5U47A 5HAPA 4DXBA 3O88A 3HLBA 3SH7A 1K56A 3PAEA 3WS2A 1E3UD 4JBFA 3SS3A 5FASA 3UE0A 4UHUA 3ZG0A 3ISGA 1MPLA 2P74A 3NIAA 5HAIA 1Y54A 1DJCA 3NBLA 5DF7A 2UWXA 1QMFA 3UN7A 5F82A 1G68A 3ZG8B 3IXGA 1PW1A 5KMWA 5E2GA 5EVLA 2FFFB 3UY6A 3IWIA 1JWVA 1NYYA 3O86A 4S2OA 2Y2JA 4OLDA 3HLFA 3MBZA 4B4ZA 4OQIA 4P6BA 1MWTA 1WYBA 3C5AA 1GA0A 3V5MA 3GR2A 1TEMA 1SCWA 2HP9A 3BFEA 3IF6B 3IXHA 2V20A 4E3KA 2E8IA 2GDNA 5CHMA 1YT4A 2EX2A 1NZUA 1ZG4A 2Y2KA 4MEZA 1FOFA 2X02A 1BTLA 3DW0A 2DRWA 2Y2LA 4UA7A 4XXRA 5EVIA 1YQSA 1XPBA 5I94A 1GHPA 4RA7A 4EBPA 3GMWA 4IBRA 3NDEA 3OPHA 4PPRA 4N1HA 3IHAA 3Q82A 3ZHHA 4BENA 4JKTA 2QPNA 4FH4A 3IF6A 4UA9A 2Q9NA 4QD4A 5TR7A 4E3LA 3W4QA 4KZ6A 2G2UA 2XFTA 5JYPA 1G6AA 3IWOA 3N6IA 1ES2A 3IT9A 4N1XA 4KZ4A 3LO7A 4OQ0A 3TOIA 1W7FA 5DTSA 2ZC5B 3WS5A 2ZQ8A 4GDNA 3VSKA 2XFSA 5J8XA 3IF6C 3N8SA 1L0GA 1FCMA 1ZKJA 1NXYA 2DCFA 5GLBA 4OH0A 4RX3A 4BL2A 3UPOA 3A3JA 4CJNA 5KZHA 2WGWA 4BLMA 1ES3A 4N9LA 1AXBA 4OPRA 3BM6A 1TDLA 5EOOA 5FQIA 4R4RA 5GL9A 3NC8A 3A3IA 3PBSA 4GDBA 5EPHA 1S6RA 2WK0A 2P9VB 3QNBA 3O87A 2Y2PA 4B4XA 3Q7VB 1XKZA 4WEKA 3VFHA 3SS5A 2CC1A 1DY6A 3P09A 3QHYA 3M6BA 3DTMA 5EOEA 2HP5A 4GD8A 5AQBA 1ZG6A 4R0QA 2VGJA 3S22A 1M6KA 3VFFA 4F94A 5A90A 1ERQA 2QMIA 3UNWA 2C6WB 3CJMA 2J7VA 4GZBA 1YLPA 2Y55A 3BLMA 3HREA 2J8YA 1LL5A 5E43A 4N92A 3AGDA 4R1GA 3IQAA 4E3OA 5CEBA 3IHBA 4EV4A 1VM1A 5F1FA 3CMZA 3IXDA 1C3BA 4BQMA 5HFOA 1PWCA 4U3TA 4KZ7A 1YLYA 2XEPA 3G2ZA 3MZFA 4WYYA 3ZFZA 3SS4A 2ZC6B 3NDGA 3OPRA 1YMXA 3DWZA 4L0LA 2EXBA 4DE3A 2WAFA 1YLTA 2WGVA 1IYPA 3A3FA 4WZ5A
chains in the Genus database with same CATH superfamily
4OPYA 3FPVA 1NRFA 2P9VA 3Q7VA 4HBUA 3BY8A 5CECA 5HW3A 5HPFA 2YKHA 1F2KA 1PI4A 4UAAA 2GZAA 4JF5A 1ES5A 1YSQA 5CHUA 4WF0A 3G31A 2PU2A 4OONA 2V1AA 2O9CA 4IEDA 2LB9A 4PKYG 2FZ0A 3RXWA 5DJTA 4RYEA 1MBLA 4LCMA 4EQ1A 1L2SA 3LEQA 4YINA 1N4OA 2CMNA 2Y2NA 2WKPA 5IS1A 1TS0A 1K38A 3ULFA 1YMSA 2XGNA 1XJ3A 2J9PA 5HZHA 3MZDA 5EVIB 3HLEA 3QP4A 4E3NA 2JC7A 4HNBA 4EBNA 4ME4A 1KVMA 3F1PA 1I5QA 5FI7A 3NCKA 1XJ2A 2VV8A 1WYCA 4QB8A 3IS2A 3K3CA 1L0EA 3KYQA 4I3IA 4S2PA 4HP4A 3MXRA 1V9YA 1XA7A 2ZM2A 3OBFA 3FZCA 3U4LP 1FCNA 2Y2MA 4ARZA 2V9AA 2EFXA 3HL9A 2EXAA 4S2KA 4Y3IA 4KQRA 4EESA 1JWZA 4KENB 3LFVA 5FATA 3CHWP 3GDIA 3B47A 1VEUB 1OMEA 2X71A 5FQMA 1OPXA 3E4OA 5AVEA 4WEJA 3B3XA 4BD0A 4GB7A 4LCLA 3BQAA 4X69A 3MFXA 2H10A 2OLVA 2EFUA 4Y7PA 3QP8A 1XXMA 1T1BA 2B02A 4HJ4A 2EX8A 2Y8HA 5DVAA 1SKFA 2J3WA 3K3DA 1V9ZA 2PD7A 4PAUA 3JYIA 1IOUA 2ZOIA 3LI9A 2WKRA 4B9OA 5TBMB 3S7PA 3LIAA 3IF5A 3RJUA 1EWZA 3A3EA 3T4KA 3C4PA 1BLCA 1ESIA 4Q0HA 1ZC2A 2B18A 2O9BA 4NK3A 3MQQA 1KGGA 5CTMA 2AVXA 5DF9A 5HARA 2QZ6A 3C7VA 4K91A 5FEGA 5I5LA 4Y17A 3O5YA 4A5RA 1KOUA 2Z6DA 3OZHA 4OKPA 2EX6A 3C4OA 1ZHHB 2ZL1A 2Z2LB 5IU1A 5G4YA 3HJIA 2XROA 2WKHA 4X53A 3ZDJA 3OCNA 3T4SA 3BYDA 1PZPA 1PI5A 3BY9A 3MF0A 3T1XA 1IKGA 1G6OA 1KDSA 4KG2A 4Q0IA 2HJ9C 4S2MA 1T1CA 2ZJ9A 3L7HA 1Z09A 4MBKA 3VOYA 2B95A 3R7WB 1K55A 1UGUA 1ES4A 1ACFA 1K54A 2UV0E 5F6AA 3G32A 4XUXA 5FQJA 2Y2GA 1NY0A 4MBFA 3WWXA 2YKFA 3M2KA 2EWVA 1O07A 3KSHA 4WMCA 1PIOA 2WKEA 2W1RA 3HVFA 1QMEA 1PZOA 3Q81A 4IUHA 3MR0A 4XT2A 1EROA 4IVIA 1IKIA 2H5SA 2A49A 4ZJ2A 4E6XA 5HX9A 2XF3A 1XGIA 1J9MA 4KQOA 4KUOA 3UDFA 4KQQA 2Y2IA 3UB9A 1CI9A 1HTZA 2VV6A 4IJGA 3CI6A 1YAXA 1SDEA 4HIAA 1FSWA 2ZD8A 4QHCA 3ZNTA 4HI4A 1MWSA 1K56D 3GQZA 3G35A 2Q0OA 2VZWA 3PHYA 4O0PA 1MY8A 2PYPA 3CPTA 3GTCA 5GHZA 5CX7A 3HLGA 3T1QB 4M4XA 5DTKA 2JKRM 2G7UA 1IFQA 4JXWA 5EVIC 3F1OA 4GD6A 4HP9A 3DAVA 4L9GA 3A3DA 2H0TA 3UB5P 3UDXA 3HLBA 3PR6A 1D1JA 3WS2A 2QKPA 4UEYA 3ZG0A 2PRFA 3CAXA 1Y54A 3UN7A 3BJNA 5KMWA 4S2OA 1MWTA 1WYBA 3D9YA 5DKKA 3DTIA 1YKDA 3V5MA 1EW0A 4JGQA 3BFEA 4E3KA 2E8IA 3FG8A 1FOFA 2KDKA 4YNRA 3S7QA 4UA7A 3CWFA 1D06A 4RA7A 2VJWA 3VV4A 4FH4A 4PHTA 3LYXA 3W4QA 1XJ4A 4EU0A 2G2UA 1T19A 1OTAA 3IWOA 4LRZE 3RH8B 3LO7A 1W7FA 3QP6A 2ZQ8A 5HDDA 4HJ3A 2KX6A 2XFSA 5KIZA 1VHMA 3UPOA 4RX3A 4CJNA 5KZHA 4BLMA 1AXBA 2PHYA 4F3LA 2JKRI 5GL9A 3NC8A 3PBSA 1XKZA 4WEKA 3T4OA 1S1YA 3P09A 1LL8A 3M6BA 3DTMA 3BW6A 1ZG6A 4EEUA 1ERQA 1OTEA 1DP8A 4MN6A 4CLCE 1LT0A 3JPUA 4EXOA 5CEBA 3IHBA 4BQMA 1PWCA 2PBDP 4U3TA 4EUVA 4R6LA 1OTBA 4L0LA 1YLTA 2WGVA 1IYPA 3A3FA 1KE4A 5E2EA 4BJPA 4FD8A 5CGWA 4II7A 1F98A 3IWQA 4Z9QA 5CXWA 2M7VA 5M18A 2ZC3B 1IEMA 2BG1A 2L4RA 2QYBA 3VSLA 4LLOB 4OVDA 3LCEA 2W0NA 4OQHA 5HWVA 2Z2MB 4S2NC 3W8KA 3CLOA 4WL9A 4C3QA 1CEGA 1S4SA 2L1MA 5CTNA 1P0ZA 5DKLA 4GJ4A 4CLCB 3LR0A 4Z1WA 5TFQA 5D3OA 4JPMA 4PM6A 5FSRA 5GHYA 1YM1A 4PM5A 1H0MA 2WUQA 3F1NA 3KSIA 3GRJA 5KSHA 3UE3A 4DXCA 3V50A 3CPTB 4X68A 3CZDA 3H82A 3E2KA 3VP4A 1MWRA 1CJFA 4BD1A 2ZOHA 3LI8A 5K5BA 2O9AA 3BFCA 4C6YA 2W27A 4LGWA 2WKIA 3KYEA 4K0WA 4MMNA 4ETZA 3SZTA 5DFXA 3UPPA 1K4EA 2XQZA 1PFLA 3T1RA 1BZAA 2ZC4B 4DJ3A 2Y59A 3MKFA 4O7DA 4OP8A 4S2IA 3ZNYA 2WZXA 2OAQ1 1FSYA 4XUZA 3GECA 3NOPC 5HPIA 4N9KA 4OQGA 4H6JB 1IYQA 4GOGA 5DTTA 4DE1A 2VA0A 3PBQA 3WS1A 3HCYA 1W5DA 3OPLA 1W8YA 3QP5A 4KG5A 4UA6A 1HD8A 3MKEA 2PBYA 3IBJA 2QJ7A 3HLCA 1KVLA 2OWJA 1BULA 1FCOA 1VQQA 2OV5A 3SOIA 4Q8IA 3SH8A 4JGPA 1I2SA 3FKVA 1ALQA 1ONHA 2EWWA 5G18A 2ZM0A 4LV3A 3HLDA 2ZM8A 2ACGA 1FR6A 3C2WA 4NXFA 1KE3A 4X6TA 4Y2FA 4ZAMA 1XP4A 2HF6A 3UB7A 4Y13A 3G6OA 5M19A 1IELA 3MMHA 4GN2A 4GNUA 5L8MA 2V0WA 2BLSA 4GLQA 1NZOA 4LRYC 2INWA 1P9WA 4M3KA 4I5SA 4WUJA 4HOIA 2WKQA 4QY6A 3R7WA 3FYZA 3LR3A 1STZA 3PBNA 4ZTKA 5CHJA 3G34A 2Y4AA 3AGEA 2M1CA 4C75A 3C38A 4X1LA 1YPRA 2K31A 3H7WA 4PKYA 3UDIA 2H0YA 2WYXA 3LY3A 3VP0A 2XD5A 3TJZC 4Y0OA 3BEBA 2HDSA 3BRMA 3LIBA 4LV2A 1L0DA 5E2FA 1GSXA 2Q9MA 2H28A 3E4PA 2I72A 5BOHA 5HWTA 1KE0A 4FSFA 4JLFA 1SHVA 2P08A 4MN5A 2K2NA 3NOTC 3NULA 5HSQA 1GSWA 1H5XA 2QJ5A 1G28A 3I7JA 5AQ9A 4ARZB 2HDUA 1LI0A 3VOZA 1VETA 3PBOA 5G4ZA 2XD1A 5AQAA 3LR4A 5F1GA 1IYOA 3M6HA 3WRZA 4FCFA 3PAGA 1X0OA 3A0SA 1GA9A 4HH2A 4DN0A 4E3JA 5HL6A 4G3VA 3P98A 1TS7A 1K6SA 4GKUA 4NKPA 2O0YA 5FQ9A 2RL3A 1VB6A 1JWPA 2PU4A 3V3RA 3IX4A 3OPPA 1MWUA 3PBRA 2PAVP 1TD5A 4O8GA 3UPNA 5HAPA 4DXBA 3PAEA 1E3UD 1ODVA 3V67A 5FASA 4KQDA 2JKTM 5HAIA 5F82A 1G68A 3IXGA 5E2GA 5EVLA 3IWIA 1NYYA 3HLFA 3MBZA 1BYWA 5HWWA 4P6BA 4BBUA 1GA0A 3GR2A 3T50A 3IF6B 2OAP1 2GDNA 1YT4A 2EX2A 4Y15A 3MXQA 2EA9A 1YQSA 4MCWA 5I94A 1GHPA 4EBPA 2DMWA 3MS6A 4UA9A 2VGLS 4E3LA 1G6AA 1ES2A 3TOIA 5DTSA 2ZC5B 4GDNA 3VSKA 5J8XA 3IF6C 3N8SA 1L0GA 3BWLA 1OTIA 2DCFA 5GLBA 1ES3A 3BM6A 5EOOA 3FPWA 5FQIA 2M7UA 3SW1A 5EPHA 1XJ6A 3A3IA 4L9FA 2WK0A 2P9VB 1VETB 3QHYA 3ZVWA 3F1PB 3CITA 3S22A 2VGJA 3KO6A 3VFFA 3UNWA 1OJ5A 1YLPA 2Y55A 3BLMA 3HREA 1LSXA 3LGOA 1LL5A 4N92A 4R1GA 3IQAA 4E3OA 3VOLA 2JHEA 2Z6CA 1PNEA 3SS4A 2ZC6B 3OPRA 1YMXA 4CQHA 1T18A 4HHDA 2HDQA 4HEFA 1OJGA 2RCXA 3OC2A 4S2NA 2G2WA 3P01A 5GLAA 1TS8A 2W3DA 3E4QA 4EBLA 2A2LA 4EERA 2ZBBA 1BLSA 2B5RA 2NUTC 4YOFA 4WLAA 4GW9A 4RX2A 3ZGAB 4MN7A 3F1OB 3TE8A 5CERA 1L0FA 2VGKA 1SDNA 2PD8A 3HJKA 3KSFA 4Y0TA 3SH9A 1Q2PA 4PMAA 3UMDA 5A91A 3ZYTA 5EVID 1GHIA 1JTGA 3M2JA 4QU3A 5DJUA 2WADA 3NJAA 4O01A 5F69A 2DNSA 3W4OA 5C5KA 3O3VA 2D01A 3WS0A 4JGOA 4EETB 4X1MA 1TF1A 1W8QA 4WMCD 4WBGA 1BLHA 2VX8A 2WZZA 1LSVA 1RGYA 1YSPA 5M1AA 3QP1A 1N9OA 1KDWA 3N7WA 3MQOA 5FA7A 1LHYA 3T4JA 3KYZA 4I3AA 5E2HA 4B93A 5FAOA 4PM9A 4WELA 4HQAA 2QHKA 2A3UA 5EM1A 2V1BA 2XA7M 3LICA 5FQKA 1KGEA 4IHQA 4WZ4A 4E3IA 1BT5A 4MBHA 3VMAA 1OT9A 4KZBA 5A92A 1J3WA 1CEFA 1FQGA 1S67L 1G5UA 3G2YA 1LLBA 4FH2A 5L07A 3E2LA 3WRTA 1FILA 5EE8A 5FI2A 2XR0A 4NXGA 1PRQA 2EX9A 4U0XA 3T1SA 1XFNA 1L3LA 3EEAA 3IH8A 2ZQCA 3NECA 5TJJA 2IWBA 2FFYA 5CRFA 4GHIA 5TGFA 4IBXA 4S2LA 4K08A 4Y0UA 2Y2HA 1FIKA 5EUAA 5EVEA 5FAQA 3E0YA 1H3QA 1Q2QA 5F5YA 2VK3A 5EV0A 5DFYA 3JVUA 3D4FA 4YFMA 2GNXA 1TS6A 4OP5A 1XFQA 3T4TA 3GV9A 1Z6FA 4BL3A 5HD3A 2WGIA 2X01A 3G4PA 1UWPX 1K57A 4I38A 5J4EA 1P97A 4P6ZM 2PR5A 3TG9A 4UQIS 2E8JA 4DDSA 2ZLYA 3B42A 3BFDA 4IVKA 3E98A 4G3KA 3C7UA 3HUNA 5JYOA 3BLSA 4DMZA 1H8YA 1M40A 3UO9A 4LRXC 1NYMA 4HJ6A 4ZRRA 4P87A 2XH9A 2ZC7A 3VP2A 3HUOA 1HLUP 2JCHA 4DKIA 2ZQAA 1CF0A 2R9WA 4OPQA 1BUEA 4CLCD 4HBTA 2JBFA 2XLNA 1SKOA 4K0XA 1BLPA 4DJ2A 4E04A 4X56A 4PM8A 2I9VA 4U0TA 5GHXA 4IUKA 2VLGA 1H8ZA 1ZTUA 3NOUC 3UMEA 3ZVTA 5F68A 2WGWB 4KG6A 4QY5A 3MXSA 1AWIA 3U2AA 3TSGA 3CG5A 4LENA 2HJEA 3Q07A 3VP1A 3HBRA 2O99A 4EUZA 2W1TB 2PDRA 2VKSA 4PM7A 3A0RA 4KZ5A 4E3MA 4ZDXA 5AQ7A 4ID4A 4R23A 2A24B 5TBMA 3V3SA 2ZQ7A 2HDRA 1I2WA 2QWSA 1NJ4A 5FAPA 2W1TA 1E4DA 4WM9A 3LEZA 2XSSA 1PWDA 3PYPA 1DP9A 4S2JA 1NRJA 3BFGA 3V39A 3MZEA 1MC0A 5J7EA 4JF6A 3N4IA 5GLDA 2BTFP 1WA9A 1MZUA 3WS4A 1K0KA 5EECA 5CGXA 4LV1A 3IS2B 4RVAA 2J3TC 5MC7A 5U47A 3SH7A 1K56A 2VV7A 1F9IA 2KOIA 3KSGA 4UHUA 3ISGA 1MPLA 3NIAA 1DRMA 1DJCA 3NBLA 5DF7A 3CUEC 3UY6A 2FFFB 4I39A 3O86A 4OLDA 2J3TD 3JVVA 4G3WA 3C5AA 4EEPA 1SCWA 2HP9A 1VEUA 2VGLM 3IXHA 3EWKA 4NEED 3LIFA 1NZUA 1ZG4A 4MEZA 3DW0A 4BBVA 2Y2LA 4XXRA 5EVIA 1XPBA 2ZMFA 3B33A 3GMWA 4IBRA 3NDEA 3OPHA 4N1HA 3IHAA 4BENA 3LIEA 4Q0JA 3IF6A 5TR7A 2LB5A 1D7EA 3TRCA 2IA2A 2KLIA 3N6IA 3IT9A 4OQ0A 3WS5A 5L10A 4EW7A 1N9LA 4CLCC 1ZKJA 4BL2A 3A3JA 3R4KA 3TW8A 4OPRA 1TDLA 1MKMA 4R4RA 4GDBA 3O87A 1F5MA 4B4XA 2GJ3A 3Q7VB 4BWIA 1DY6A 5AQBA 4R0QA 4F94A 3LR5A 1W63M 4GZBA 2D02A 3AGDA 1VM1A 5F1FA 3CMZA 5IT5A 3IXDA 5HFOA 4KZ7A 3KX0X 1YLYA 3G2ZA 3ZFZA 1N9NA 1P9RA 2WAFA 4GS9A 2MJ6A 3NHQA 5HAQA 3NI9A 5F83A 5HL1A 4LFUA 2ZQDA 5A8BA 4X25A 1RGZA 3CUEA 1A0KA 2W3EA 1TDGA 2PT7A 5LBRA 2VEAA 4QJGA 1DJAA 1JTDA 1E3UA 3ZG7B 3Q7ZA 1YLZA 1K4FA 1N9BA 4CPKA 2W3FA 4DF6A 4NG2A 2HP6A 3P7NA 2HZ5A 5FL3A 4KZ9A 3QP2A 5EM0A 1K6RA 4JF4A 4ESPA 3QNCA 1PW8A 1MXOA 3N8RA 4E6WA 3D72A 2OWHA 2K7SA 4NETA 1NWZA 2W3HA 4H6JA 5GLCA 1O7EA 2Y91A 3DBAA 3W2ZA 3ITBA 2P04A 1CK3A 1LI9A 3H9WA 4DRTA 1K25A 2JKGA 2PYRA 4KZ3A 2XK1A 4OOMA 2XA7S 3Q1FA 4P85A 1U60A 4GS9B 3BECA 1W63Q 4OPZA 3OCLA 1JNUA 3T12B 2V2FF 4ZJ3A 2V8FA 1S4RA 3HLWA 1OT6A 1GSVA 3S1YA 3IH9A 3RXXA 4ZJ1A 1OTDA 1ONGA 4LV0A 2C5WB 4FOFA 3GVBA 1W79A 2Y79A 4B88A 3FKWA 1RP5A 2XRNA 3T4LA 3DWKA 1S66L 1YLJA 2IWDA 3N8LA 4MNRA 5L09A 4OOYA 1SKOB 1BSGA 3FC7A 4DE2A 3D3OA 2A24A 1S1ZA 3IXBA 4JXSA 4YWZA 2PR6A 4BBTA 3FWLA 4KUKA 4P6ZS 4NXBA 5A93A 4F3LB 4UQIM 5IHVA 4P0MA 1WE4A 3AGFA 1S0WA 1XX2A 4HH3A 3EEHA 4KZAA 1CI8A 3GSGA 1HZOA 3BFFA 3DTKA 1Y28A 1XA1A 4D60A 1Y4OA 1TVFA 1SZVA 2FH5A 3NY4A 2V8CA 5L2FA 3VP3A 2J80A 3EOIA 5FI6A 2Y2OA 3ZG9B 4R70A 4EQIA 3S7NA 4DDYA 4OLGA 3IBRA 1XGJA 3UE6A 4D2OA 3C8CA 1FR1A 4MDZA 1GHMA 1MKIA 3MSHA 3MFDA 1KGFA 3RTYA 2ZMAA 4KZ8A 2JE5A 1T1AA 2V0UA 4I3JA 5AJGA 1JVJA 2J9OA 5HDCA 2NUPC 1EI5A 4JXGA 1E25A 3W4PA 2V1ZA 3K2NA 1K55C 4EWFA 3ICYA 3S7OA 4ETXA 4OOLA 3MJQA 2OSUA 1ERMA 3MQ0A 4RQ9A 4JXVA 4R3BA 4H8RA 3ITAA 3H82B 3L9KA 3G30A 3A0VA 5DF8A 3PBTA 1HVBA 1DJBA 3S4XA 2P7JA 1DP6A 5FDHA 1PYYA 5CGSA 4R4SA 2GX5A 2JKFA 4GCZA 2Y2QA 4R3JA 4QWOA 4DE0A 1K54C 3PTEA 3ZCZA 1RCJA 3UB6A 2WAEA 1NLZA 3EGDC 1LL9A 5KSCA 2R9XA 1IYSA 4HESA 2ZQ9A 3BQ8A 3FV7A 1ESUA 4MLLA 4WZ5C 5FQQA 4X55A 2OLUA 2R78A 2ZMVA 1K57C 3IX3A 4FUWA 3LY4A 3HUMA 5J3WA 2IWCA 3ZG5A 5HD5A 1LSWA 3ZQ5A 1PWGA 2XDMA 4ZBEA 5AVFA 5CEDA 3EQVA 3EQUA 1YLWA 4QPRA 2HPBA 1GCEA 3UE1A 3O88A 4JBFA 3SS3A 3UE0A 4NXEA 1UWNX 2P74A 3ZG8B 2UWXA 1QMFA 3H7WB 4JGRA 1PW1A 4CLCA 1JWVA 5FDSA 4B4ZA 2Y2JA 3VE4A 2HGVA 4OQIA 4FTXA 3LIDA 1TEMA 3PXPA 2L0WA 2HV1A 2V20A 5CHMA 2Y2KA 2X02A 1BTLA 2DRWA 3VE3A 4PPRA 3ZHHA 3Q82A 4JKTA 2QPNA 3IX8A 5EFWA 3RFBA 2Q9NA 3OLOA 4QD4A 5HDSA 4KZ6A 2XFTA 4L9EA 5JYPA 2ZL1B 2W3GA 4AFIA 4N1XA 4KZ4A 2JN7A 3OOVA 1FCMA 4Y5FA 1NXYA 4OH0A 3C30A 2WGWA 4LPZA 3LUQA 4N9LA 4R3AA 4HY8A 1S6RA 3QNBA 2Y2PA 4XT2B 3VFHA 2BASA 3SS5A 1H8MA 1NLYA 2CC1A 3EGXC 5EOEA 4R38A 1CQAA 4WN5A 2HP5A 4GD8A 5A90A 1M6KA 2QMIA 2C6WB 3CJMA 3UB8A 2J7VA 2J8YA 5E43A 5FEFA 4EV4A 3T4QA 3F1NB 1C3BA 2JKTI 3DTEA 2XEPA 3MZFA 4WYYA 4GHIB 3NDGA 4BMWA 3DWZA 2EXBA 4DE3A 2OOLA 4WZ5A
chains in the Genus database with same CATH topology
4OPYA 2HDQA 4HEFA 1KE4A 5HAQA 5E2EA 2RCXA 4BJPA 3OC2A 4S2NA 1NRFA 2G2WA 3NI9A 2P9VA 4FD8A 5CGWA 5GLAA 5F83A 3Q7VA 4Z9QA 3IWQA 5CXWA 4HBUA 4EBLA 5HL1A 5M18A 2ZC3B 1IEMA 2BG1A 2ZQDA 5CECA 5HW3A 3VSLA 1RGZA 1PI4A 1BLSA 2B5RA 4OVDA 3LCEA 4UAAA 1TDGA 4OQHA 2Z2MB 4S2NC 4JF5A 3W8KA 4QJGA 1DJAA 1JTDA 1ES5A 1E3UA 4RX2A 3ZGAB 4C3QA 3ZG7B 3Q7ZA 5CHUA 5CERA 1CEGA 1YLZA 5CTNA 1K4FA 1L0FA 3G31A 2PU2A 2VGKA 1SDNA 1N9BA 4CPKA 4OONA 4DF6A 4IEDA 4Y0TA 3RXWA 2HP6A 4RYEA 3SH9A 1MBLA 4KZ9A 1K6RA 1Q2PA 4JF4A 4LCMA 1L2SA 4YINA 1N4OA 3QNCA 5TFQA 4PMAA 1PW8A 2Y2NA 5D3OA 4JPMA 4PM6A 5FSRA 1MXOA 1YM1A 5GHYA 4PM5A 3N8RA 4E6WA 1K38A 2WUQA 1YMSA 2XGNA 5A91A 3GRJA 5KSHA 2J9PA 5EVID 3UE3A 1GHIA 1JTGA 3M2JA 3V50A 4QU3A 4DXCA 3MZDA 5EVIB 2WADA 3HLEA 4X68A 2JC7A 3CZDA 4E3NA 4EBNA 3E2KA 3VP4A 2DNSA 4NETA 3W4OA 1MWRA 3O3VA 1KVMA 4BD1A 3WS0A 5GLCA 1O7EA 2Y91A 3BFCA 4C6YA 1I5QA 3ITBA 5FI7A 2WKIA 3NCKA 4K0WA 1CK3A 1LI9A 1W8QA 1WYCA 4DRTA 4QB8A 4WMCD 1K25A 4KZ3A 2XK1A 1L0EA 4WBGA 4OOMA 4S2PA 1BLHA 3Q1FA 2WZZA 3MXRA 4P85A 1RGYA 3UPPA 5M1AA 1K4EA 2XQZA 1U60A 1XA7A 3BECA 1KDWA 2ZM2A 1BZAA 3N7WA 3FZCA 4OPZA 1FCNA 2Y2MA 2ZC4B 3OCLA 5FA7A 2EFXA 1LHYA 3HL9A 2Y59A 2EXAA 3MKFA 2V2FF 4S2KA 4O7DA 5E2HA 4KQRA 5FAOA 1JWZA 4PM9A 4KENB 4OP8A 4S2IA 4WELA 3ZNYA 4ZJ3A 2WZXA 2A3UA 3HLWA 5FQKA 1FSYA 4XUZA 1KGEA 5FATA 4WZ4A 3S1YA 4N9KA 3IH9A 3RXXA 4OQGA 4E3IA 1BT5A 4MBHA 3VMAA 1OMEA 1IYQA 4GOGA 4KZBA 5DTTA 4DE1A 5A92A 1CEFA 1FQGA 2X71A 5FQMA 3PBQA 4ZJ1A 1ONGA 3G2YA 3WS1A 4LV0A 1LLBA 2C5WB 4FH2A 3GVBA 4WEJA 1W5DA 3B3XA 3E2LA 3OPLA 1W79A 3WRTA 1W8YA 4BD0A 4KG5A 4GB7A 4B88A 4UA6A 1HD8A 3MKEA 5EE8A 5FI2A 4LCLA 2XR0A 4X69A 2PBYA 3FKWA 2EX9A 4U0XA 2H10A 1RP5A 2OLVA 1KVLA 2EFUA 3HLCA 4Y7PA 1BULA 3DWKA 3IH8A 1YLJA 2IWDA 3N8LA 4MNRA 1XXMA 2ZQCA 1FCOA 1VQQA 2OV5A 4OOYA 3SOIA 1BSGA 2EX8A 3SH8A 4Q8IA 5DVAA 1SKFA 1I2SA 2IWBA 4DE2A 2FFYA 3JYIA 5CRFA 3FKVA 1ALQA 1ONHA 5TGFA 3IXBA 4IBXA 4JXSA 5G18A 2ZM0A 4S2LA 4LV3A 4Y0UA 2Y2HA 3FWLA 3HLDA 3IF5A 3RJUA 1EWZA 2ZM8A 5EUAA 3A3EA 3C4PA 1BLCA 1ESIA 5FAQA 5A93A 1ZC2A 1Q2QA 4NK3A 5IHVA 1KGGA 4P0MA 5CTMA 1FR6A 5DF9A 1WE4A 3AGFA 1S0WA 1XX2A 4YFMA 1KE3A 3D4FA 4KZAA 5HARA 1CI8A 2QZ6A 4X6TA 3C7VA 4ZAMA 1XP4A 4K91A 4OP5A 3GV9A 3GSGA 1Z6FA 4BL3A 2WGIA 1HZOA 2X01A 3G4PA 5M19A 1IELA 3BFFA 4A5RA 4GN2A 4GNUA 1K57A 3OZHA 4OKPA 2BLSA 2EX6A 1XA1A 3TG9A 1NZOA 3C4OA 4DDSA 2ZLYA 1TVFA 3BFDA 2Z2LB 4IVKA 3NY4A 4M3KA 3C7UA 2WKHA 3HUNA 5L2FA 3VP3A 5JYOA 4X53A 3BLSA 3ZDJA 1H8YA 1M40A 5FI6A 3OCNA 2Y2OA 3UO9A 4QY6A 3ZG9B 3BYDA 3FYZA 1PZPA 4EQIA 3PBNA 4ZTKA 4DDYA 4OLGA 5CHJA 3G34A 1XGJA 2Y4AA 1NYMA 1PI5A 3AGEA 4C75A 4D2OA 4P87A 1FR1A 1IKGA 2XH9A 1KDSA 2ZC7A 3UDIA 3VP2A 4KG2A 2H0YA 2WYXA 1GHMA 3HUOA 3LY3A 1MKIA 2JCHA 3VP0A 2XD5A 4S2MA 4DKIA 2ZQAA 2R9WA 3MFDA 2ZJ9A 4OPQA 4Y0OA 1KGFA 1BUEA 2ZMAA 4KZ8A 2JE5A 3BEBA 4HBTA 4MBKA 3VOYA 1K55A 2HDSA 2JBFA 3BRMA 1ES4A 1JVJA 2XLNA 1L0DA 4LV2A 1K54A 4K0XA 2J9OA 5E2FA 1BLPA 1EI5A 3G32A 4PM8A 4X56A 4JXGA 4XUXA 2Q9MA 4U0TA 5FQJA 2Y2GA 1NY0A 1E25A 4MBFA 3W4PA 5GHXA 3WWXA 3M2KA 2V1ZA 1H8ZA 1K55C 2I72A 1O07A 4EWFA 4WMCA 5BOHA 1PIOA 2WKEA 4OOLA 3HVFA 3ZVTA 1KE0A 4FSFA 4JLFA 2WGWB 1SHVA 1QMEA 1PZOA 4KG6A 4QY5A 2OSUA 3Q81A 1ERMA 3MXSA 3TSGA 4JXVA 4R3BA 4H8RA 3ITAA 1EROA 3CG5A 3G30A 4IVIA 4LENA 5DF8A 1IKIA 3PBTA 3Q07A 1HVBA 1DJBA 2H5SA 3S4XA 3VP1A 2A49A 3HBRA 5FDHA 1PYYA 4ZJ2A 5CGSA 3ZVWA 1H5XA 4E6XA 4EUZA 5HX9A 2XF3A 4R4SA 3I7JA 1XGIA 4PM7A 5AQ9A 4KZ5A 1J9MA 4E3MA 2Y2QA 4KQOA 4R3JA 4ID4A 4KQQA 5AQ7A 3UDFA 4R23A 2HDUA 4ZDXA 2Y2IA 1LI0A 3VOZA 3PBOA 3V3SA 4DE0A 2ZQ7A 1CI9A 1K54C 1HTZA 2XD1A 2HDRA 3PTEA 5AQAA 3ZCZA 1RCJA 5F1GA 1IYOA 2WAEA 1I2WA 1NJ4A 3M6HA 5FAPA 1E4DA 1LL9A 4WM9A 1SDEA 3WRZA 5KSCA 2R9XA 3LEZA 1IYSA 4FCFA 4HESA 3PAGA 2ZQ9A 1FSWA 2ZD8A 1PWDA 3FV7A 1ESUA 4QHCA 3ZNTA 4MLLA 1GA9A 4WZ5C 1MWSA 1K56D 3GQZA 4S2JA 5FQQA 4X55A 3G35A 3BFGA 3V39A 2OLUA 3MZEA 1K57C 1MY8A 3LY4A 4JF6A 3N4IA 4E3JA 5GLDA 3HUMA 2IWCA 3P98A 3GTCA 5GHZA 3ZG5A 1K6SA 4GKUA 3HLGA 5FQ9A 2RL3A 1PWGA 5DTKA 2XDMA 4ZBEA 1JWPA 2PU4A 3WS4A 3V3RA 4JXWA 5EVIC 5CEDA 3OPPA 5CGXA 5EECA 1MWUA 4GD6A 3EQVA 3EQUA 1YLWA 3PBRA 4LV1A 3A3DA 2HPBA 2H0TA 4RVAA 1GCEA 3UDXA 3UPNA 3UE1A 5U47A 5HAPA 4DXBA 3O88A 3HLBA 3SH7A 1K56A 3PAEA 3WS2A 1E3UD 4JBFA 3SS3A 5FASA 3UE0A 4UHUA 3ZG0A 3ISGA 1MPLA 2P74A 3NIAA 5HAIA 1Y54A 1DJCA 3NBLA 5DF7A 2UWXA 1QMFA 3UN7A 5F82A 1G68A 3ZG8B 3IXGA 1PW1A 5KMWA 5E2GA 5EVLA 2FFFB 3UY6A 3IWIA 1JWVA 1NYYA 3O86A 4S2OA 2Y2JA 4OLDA 3HLFA 3MBZA 4B4ZA 4OQIA 4P6BA 1MWTA 1WYBA 3C5AA 1GA0A 3V5MA 3GR2A 1TEMA 1SCWA 2HP9A 3BFEA 3IF6B 3IXHA 2V20A 4E3KA 2E8IA 2GDNA 5CHMA 1YT4A 2EX2A 1NZUA 1ZG4A 2Y2KA 4MEZA 1FOFA 2X02A 1BTLA 3DW0A 2DRWA 2Y2LA 4UA7A 4XXRA 5EVIA 1YQSA 1XPBA 5I94A 1GHPA 4RA7A 4EBPA 3GMWA 4IBRA 3NDEA 3OPHA 4PPRA 4N1HA 3IHAA 3Q82A 3ZHHA 4BENA 4JKTA 2QPNA 4FH4A 3IF6A 4UA9A 2Q9NA 4QD4A 5TR7A 4E3LA 3W4QA 4KZ6A 2G2UA 2XFTA 5JYPA 1G6AA 3IWOA 3N6IA 1ES2A 3IT9A 4N1XA 4KZ4A 3LO7A 4OQ0A 3TOIA 1W7FA 5DTSA 2ZC5B 3WS5A 2ZQ8A 4GDNA 3VSKA 2XFSA 5J8XA 3IF6C 3N8SA 1L0GA 1FCMA 1ZKJA 1NXYA 2DCFA 5GLBA 4OH0A 4RX3A 4BL2A 3UPOA 3A3JA 4CJNA 5KZHA 2WGWA 4BLMA 1ES3A 4N9LA 1AXBA 4OPRA 3BM6A 1TDLA 5EOOA 5FQIA 4R4RA 5GL9A 3NC8A 3A3IA 3PBSA 4GDBA 5EPHA 1S6RA 2WK0A 2P9VB 3QNBA 3O87A 2Y2PA 4B4XA 3Q7VB 1XKZA 4WEKA 3VFHA 3SS5A 2CC1A 1DY6A 3P09A 3QHYA 3M6BA 3DTMA 5EOEA 2HP5A 4GD8A 5AQBA 1ZG6A 4R0QA 2VGJA 3S22A 1M6KA 3VFFA 4F94A 5A90A 1ERQA 2QMIA 3UNWA 2C6WB 3CJMA 2J7VA 4GZBA 1YLPA 2Y55A 3BLMA 3HREA 2J8YA 1LL5A 5E43A 4N92A 3AGDA 4R1GA 3IQAA 4E3OA 5CEBA 3IHBA 4EV4A 1VM1A 5F1FA 3CMZA 3IXDA 1C3BA 4BQMA 5HFOA 1PWCA 4U3TA 4KZ7A 1YLYA 2XEPA 3G2ZA 3MZFA 4WYYA 3ZFZA 3SS4A 2ZC6B 3NDGA 3OPRA 1YMXA 3DWZA 4L0LA 2EXBA 4DE3A 2WAFA 1YLTA 2WGVA 1IYPA 3A3FA 4WZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPY A;  2HDQ A;  4HEF A;  1KE4 A;  5HAQ A;  5E2E A;  2RCX A;  4BJP A;  3OC2 A;  4S2N A;  1NRF A;  2G2W A;  3NI9 A;  2P9V A;  4FD8 A;  5CGW A;  5GLA A;  5F83 A;  3Q7V A;  4Z9Q A;  3IWQ A;  5CXW A;  4HBU A;  4EBL A;  5HL1 A;  5M18 A;  2ZC3 B;  1IEM A;  2BG1 A;  2ZQD A;  5CEC A;  5HW3 A;  3VSL A;  1RGZ A;  1PI4 A;  1BLS A;  2B5R A;  4OVD A;  3LCE A;  4UAA A;  1TDG A;  4OQH A;  2Z2M B;  4S2N C;  4JF5 A;  3W8K A;  4QJG A;  1DJA A;  1JTD A;  1ES5 A;  1E3U A;  4RX2 A;  3ZGA B;  4C3Q A;  3ZG7 B;  3Q7Z A;  5CHU A;  5CER A;  1CEG A;  1YLZ A;  5CTN A;  1K4F A;  1L0F A;  3G31 A;  2PU2 A;  2VGK A;  1SDN A;  1N9B A;  4CPK A;  4OON A;  4DF6 A;  4IED A;  4Y0T A;  3RXW A;  2HP6 A;  4RYE A;  3SH9 A;  1MBL A;  4KZ9 A;  1K6R A;  1Q2P A;  4JF4 A;  4LCM A;  1L2S A;  4YIN A;  1N4O A;  3QNC A;  5TFQ A;  4PMA A;  1PW8 A;  2Y2N A;  5D3O A;  4JPM A;  4PM6 A;  5FSR A;  1MXO A;  1YM1 A;  5GHY A;  4PM5 A;  3N8R A;  4E6W A;  1K38 A;  2WUQ A;  1YMS A;  2XGN A;  5A91 A;  3GRJ A;  5KSH A;  2J9P A;  5EVI D;  3UE3 A;  1GHI A;  1JTG A;  3M2J A;  3V50 A;  4QU3 A;  4DXC A;  3MZD A;  5EVI B;  2WAD A;  3HLE A;  4X68 A;  2JC7 A;  3CZD A;  4E3N A;  4EBN A;  3E2K A;  3VP4 A;  2DNS A;  4NET A;  3W4O A;  1MWR A;  3O3V A;  1KVM A;  4BD1 A;  3WS0 A;  5GLC A;  1O7E A;  2Y91 A;  3BFC A;  4C6Y A;  1I5Q A;  3ITB A;  5FI7 A;  2WKI A;  3NCK A;  4K0W A;  1CK3 A;  1LI9 A;  1W8Q A;  1WYC A;  4DRT A;  4QB8 A;  4WMC D;  1K25 A;  4KZ3 A;  2XK1 A;  1L0E A;  4WBG A;  4OOM A;  4S2P A;  1BLH A;  3Q1F A;  2WZZ A;  3MXR A;  4P85 A;  1RGY A;  3UPP A;  5M1A A;  1K4E A;  2XQZ A;  1U60 A;  1XA7 A;  3BEC A;  1KDW A;  2ZM2 A;  1BZA A;  3N7W A;  3FZC A;  4OPZ A;  1FCN A;  2Y2M A;  2ZC4 B;  3OCL A;  5FA7 A;  2EFX A;  1LHY A;  3HL9 A;  2Y59 A;  2EXA A;  3MKF A;  2V2F F;  4S2K A;  4O7D A;  5E2H A;  4KQR A;  5FAO A;  1JWZ A;  4PM9 A;  4KEN B;  4OP8 A;  4S2I A;  4WEL A;  3ZNY A;  4ZJ3 A;  2WZX A;  2A3U A;  3HLW A;  5FQK A;  1FSY A;  4XUZ A;  1KGE A;  5FAT A;  4WZ4 A;  3S1Y A;  4N9K A;  3IH9 A;  3RXX A;  4OQG A;  4E3I A;  1BT5 A;  4MBH A;  3VMA A;  1OME A;  1IYQ A;  4GOG A;  4KZB A;  5DTT A;  4DE1 A;  5A92 A;  1CEF A;  1FQG A;  2X71 A;  5FQM A;  3PBQ A;  4ZJ1 A;  1ONG A;  3G2Y A;  3WS1 A;  4LV0 A;  1LLB A;  2C5W B;  4FH2 A;  3GVB A;  4WEJ A;  1W5D A;  3B3X A;  3E2L A;  3OPL A;  1W79 A;  3WRT A;  1W8Y A;  4BD0 A;  4KG5 A;  4GB7 A;  4B88 A;  4UA6 A;  1HD8 A;  3MKE A;  5EE8 A;  5FI2 A;  4LCL A;  2XR0 A;  4X69 A;  2PBY A;  3FKW A;  2EX9 A;  4U0X A;  2H10 A;  1RP5 A;  2OLV A;  1KVL A;  2EFU A;  3HLC A;  4Y7P A;  1BUL A;  3DWK A;  3IH8 A;  1YLJ A;  2IWD A;  3N8L A;  4MNR A;  1XXM A;  2ZQC A;  1FCO A;  1VQQ A;  2OV5 A;  4OOY A;  3SOI A;  1BSG A;  2EX8 A;  3SH8 A;  4Q8I A;  5DVA A;  1SKF A;  1I2S A;  2IWB A;  4DE2 A;  2FFY A;  3JYI A;  5CRF A;  3FKV A;  1ALQ A;  1ONH A;  5TGF A;  3IXB A;  4IBX A;  4JXS A;  5G18 A;  2ZM0 A;  4S2L A;  4LV3 A;  4Y0U A;  2Y2H A;  3FWL A;  3HLD A;  3IF5 A;  3RJU A;  1EWZ A;  2ZM8 A;  5EUA A;  3A3E A;  3C4P A;  1BLC A;  1ESI A;  5FAQ A;  5A93 A;  1ZC2 A;  1Q2Q A;  4NK3 A;  5IHV A;  1KGG A;  4P0M A;  5CTM A;  1FR6 A;  5DF9 A;  1WE4 A;  3AGF A;  1S0W A;  1XX2 A;  4YFM A;  1KE3 A;  3D4F A;  4KZA A;  5HAR A;  1CI8 A;  2QZ6 A;  4X6T A;  3C7V A;  4ZAM A;  1XP4 A;  4K91 A;  4OP5 A;  3GV9 A;  3GSG A;  1Z6F A;  4BL3 A;  2WGI A;  1HZO A;  2X01 A;  3G4P A;  5M19 A;  1IEL A;  3BFF A;  4A5R A;  4GN2 A;  4GNU A;  1K57 A;  3OZH A;  4OKP A;  2BLS A;  2EX6 A;  1XA1 A;  3TG9 A;  1NZO A;  3C4O A;  4DDS A;  2ZLY A;  1TVF A;  3BFD A;  2Z2L B;  4IVK A;  3NY4 A;  4M3K A;  3C7U A;  2WKH A;  3HUN A;  5L2F A;  3VP3 A;  5JYO A;  4X53 A;  3BLS A;  3ZDJ A;  1H8Y A;  1M40 A;  5FI6 A;  3OCN A;  2Y2O A;  3UO9 A;  4QY6 A;  3ZG9 B;  3BYD A;  3FYZ A;  1PZP A;  4EQI A;  3PBN A;  4ZTK A;  4DDY A;  4OLG A;  5CHJ A;  3G34 A;  1XGJ A;  2Y4A A;  1NYM A;  1PI5 A;  3AGE A;  4C75 A;  4D2O A;  4P87 A;  1FR1 A;  1IKG A;  2XH9 A;  1KDS A;  2ZC7 A;  3UDI A;  3VP2 A;  4KG2 A;  2H0Y A;  2WYX A;  1GHM A;  3HUO A;  3LY3 A;  1MKI A;  2JCH A;  3VP0 A;  2XD5 A;  4S2M A;  4DKI A;  2ZQA A;  2R9W A;  3MFD A;  2ZJ9 A;  4OPQ A;  4Y0O A;  1KGF A;  1BUE A;  2ZMA A;  4KZ8 A;  2JE5 A;  3BEB A;  4HBT A;  4MBK A;  3VOY A;  1K55 A;  2HDS A;  2JBF A;  3BRM A;  1ES4 A;  1JVJ A;  2XLN A;  1L0D A;  4LV2 A;  1K54 A;  4K0X A;  2J9O A;  5E2F A;  1BLP A;  1EI5 A;  3G32 A;  4PM8 A;  4X56 A;  4JXG A;  4XUX A;  2Q9M A;  4U0T A;  5FQJ A;  2Y2G A;  1NY0 A;  1E25 A;  4MBF A;  3W4P A;  5GHX A;  3WWX A;  3M2K A;  2V1Z A;  1H8Z A;  1K55 C;  2I72 A;  1O07 A;  4EWF A;  4WMC A;  5BOH A;  1PIO A;  2WKE A;  4OOL A;  3HVF A;  3ZVT A;  1KE0 A;  4FSF A;  4JLF A;  2WGW B;  1SHV A;  1QME A;  1PZO A;  4KG6 A;  4QY5 A;  2OSU A;  3Q81 A;  1ERM A;  3MXS A;  3TSG A;  4JXV A;  4R3B A;  4H8R A;  3ITA A;  1ERO A;  3CG5 A;  3G30 A;  4IVI A;  4LEN A;  5DF8 A;  1IKI A;  3PBT A;  3Q07 A;  1HVB A;  1DJB A;  2H5S A;  3S4X A;  3VP1 A;  2A49 A;  3HBR A;  5FDH A;  1PYY A;  4ZJ2 A;  5CGS A;  3ZVW A;  1H5X A;  4E6X A;  4EUZ A;  5HX9 A;  2XF3 A;  4R4S A;  3I7J A;  1XGI A;  4PM7 A;  5AQ9 A;  4KZ5 A;  1J9M A;  4E3M A;  2Y2Q A;  4KQO A;  4R3J A;  4ID4 A;  4KQQ A;  5AQ7 A;  3UDF A;  4R23 A;  2HDU A;  4ZDX A;  2Y2I A;  1LI0 A;  3VOZ A;  3PBO A;  3V3S A;  4DE0 A;  2ZQ7 A;  1CI9 A;  1K54 C;  1HTZ A;  2XD1 A;  2HDR A;  3PTE A;  5AQA A;  3ZCZ A;  1RCJ A;  5F1G A;  1IYO A;  2WAE A;  1I2W A;  1NJ4 A;  3M6H A;  5FAP A;  1E4D A;  1LL9 A;  4WM9 A;  1SDE A;  3WRZ A;  5KSC A;  2R9X A;  3LEZ A;  1IYS A;  4FCF A;  4HES A;  3PAG A;  2ZQ9 A;  1FSW A;  2ZD8 A;  1PWD A;  3FV7 A;  1ESU A;  4QHC A;  3ZNT A;  4MLL A;  1GA9 A;  4WZ5 C;  1MWS A;  1K56 D;  3GQZ A;  4S2J A;  5FQQ A;  4X55 A;  3G35 A;  3BFG A;  3V39 A;  2OLU A;  3MZE A;  1K57 C;  1MY8 A;  3LY4 A;  4JF6 A;  3N4I A;  4E3J A;  5GLD A;  3HUM A;  2IWC A;  3P98 A;  3GTC A;  5GHZ A;  3ZG5 A;  1K6S A;  4GKU A;  3HLG A;  5FQ9 A;  2RL3 A;  1PWG A;  5DTK A;  2XDM A;  4ZBE A;  1JWP A;  2PU4 A;  3WS4 A;  3V3R A;  4JXW A;  5EVI C;  5CED A;  3OPP A;  5CGX A;  5EEC A;  1MWU A;  4GD6 A;  3EQV A;  3EQU A;  1YLW A;  3PBR A;  4LV1 A;  3A3D A;  2HPB A;  2H0T A;  4RVA A;  1GCE A;  3UDX A;  3UPN A;  3UE1 A;  5U47 A;  5HAP A;  4DXB A;  3O88 A;  3HLB A;  3SH7 A;  1K56 A;  3PAE A;  3WS2 A;  1E3U D;  4JBF A;  3SS3 A;  5FAS A;  3UE0 A;  4UHU A;  3ZG0 A;  3ISG A;  1MPL A;  2P74 A;  3NIA A;  5HAI A;  1Y54 A;  1DJC A;  3NBL A;  5DF7 A;  2UWX A;  1QMF A;  3UN7 A;  5F82 A;  1G68 A;  3ZG8 B;  3IXG A;  1PW1 A;  5KMW A;  5E2G A;  5EVL A;  2FFF B;  3UY6 A;  3IWI A;  1JWV A;  1NYY A;  3O86 A;  4S2O A;  2Y2J A;  4OLD A;  3HLF A;  3MBZ A;  4B4Z A;  4OQI A;  4P6B A;  1MWT A;  1WYB A;  3C5A A;  1GA0 A;  3V5M A;  3GR2 A;  1TEM A;  1SCW A;  2HP9 A;  3BFE A;  3IF6 B;  3IXH A;  2V20 A;  4E3K A;  2E8I A;  2GDN A;  5CHM A;  1YT4 A;  2EX2 A;  1NZU A;  1ZG4 A;  2Y2K A;  4MEZ A;  1FOF A;  2X02 A;  1BTL A;  3DW0 A;  2DRW A;  2Y2L A;  4UA7 A;  4XXR A;  5EVI A;  1YQS A;  1XPB A;  5I94 A;  1GHP A;  4RA7 A;  4EBP A;  3GMW A;  4IBR A;  3NDE A;  3OPH A;  4PPR A;  4N1H A;  3IHA A;  3Q82 A;  3ZHH A;  4BEN A;  4JKT A;  2QPN A;  4FH4 A;  3IF6 A;  4UA9 A;  2Q9N A;  4QD4 A;  5TR7 A;  4E3L A;  3W4Q A;  4KZ6 A;  2G2U A;  2XFT A;  5JYP A;  1G6A A;  3IWO A;  3N6I A;  1ES2 A;  3IT9 A;  4N1X A;  4KZ4 A;  3LO7 A;  4OQ0 A;  3TOI A;  1W7F A;  5DTS A;  2ZC5 B;  3WS5 A;  2ZQ8 A;  4GDN A;  3VSK A;  2XFS A;  5J8X A;  3IF6 C;  3N8S A;  1L0G A;  1FCM A;  1ZKJ A;  1NXY A;  2DCF A;  5GLB A;  4OH0 A;  4RX3 A;  4BL2 A;  3UPO A;  3A3J A;  4CJN A;  5KZH A;  2WGW A;  4BLM A;  1ES3 A;  4N9L A;  1AXB A;  4OPR A;  3BM6 A;  1TDL A;  5EOO A;  5FQI A;  4R4R A;  5GL9 A;  3NC8 A;  3A3I A;  3PBS A;  4GDB A;  5EPH A;  1S6R A;  2WK0 A;  2P9V B;  3QNB A;  3O87 A;  2Y2P A;  4B4X A;  3Q7V B;  1XKZ A;  4WEK A;  3VFH A;  3SS5 A;  2CC1 A;  1DY6 A;  3P09 A;  3QHY A;  3M6B A;  3DTM A;  5EOE A;  2HP5 A;  4GD8 A;  5AQB A;  1ZG6 A;  4R0Q A;  2VGJ A;  3S22 A;  1M6K A;  3VFF A;  4F94 A;  5A90 A;  1ERQ A;  2QMI A;  3UNW A;  2C6W B;  3CJM A;  2J7V A;  4GZB A;  1YLP A;  2Y55 A;  3BLM A;  3HRE A;  2J8Y A;  1LL5 A;  5E43 A;  4N92 A;  3AGD A;  4R1G A;  3IQA A;  4E3O A;  5CEB A;  3IHB A;  4EV4 A;  1VM1 A;  5F1F A;  3CMZ A;  3IXD A;  1C3B A;  4BQM A;  5HFO A;  1PWC A;  4U3T A;  4KZ7 A;  1YLY A;  2XEP A;  3G2Z A;  3MZF A;  4WYY A;  3ZFZ A;  3SS4 A;  2ZC6 B;  3NDG A;  3OPR A;  1YMX A;  3DWZ A;  4L0L A;  2EXB A;  4DE3 A;  2WAF A;  1YLT A;  2WGV A;  1IYP A;  3A3F A;  4WZ5 A; 
#chains in the Genus database with same CATH topology
 4OPY A;  3FPV A;  1NRF A;  2P9V A;  3Q7V A;  4HBU A;  3BY8 A;  5CEC A;  5HW3 A;  5HPF A;  2YKH A;  1F2K A;  1PI4 A;  4UAA A;  2GZA A;  4JF5 A;  1ES5 A;  1YSQ A;  5CHU A;  4WF0 A;  3G31 A;  2PU2 A;  4OON A;  2V1A A;  2O9C A;  4IED A;  2LB9 A;  4PKY G;  2FZ0 A;  3RXW A;  5DJT A;  4RYE A;  1MBL A;  4LCM A;  4EQ1 A;  1L2S A;  3LEQ A;  4YIN A;  1N4O A;  2CMN A;  2Y2N A;  2WKP A;  5IS1 A;  1TS0 A;  1K38 A;  3ULF A;  1YMS A;  2XGN A;  1XJ3 A;  2J9P A;  5HZH A;  3MZD A;  5EVI B;  3HLE A;  3QP4 A;  4E3N A;  2JC7 A;  4HNB A;  4EBN A;  4ME4 A;  1KVM A;  3F1P A;  1I5Q A;  5FI7 A;  3NCK A;  1XJ2 A;  2VV8 A;  1WYC A;  4QB8 A;  3IS2 A;  3K3C A;  1L0E A;  3KYQ A;  4I3I A;  4S2P A;  4HP4 A;  3MXR A;  1V9Y A;  1XA7 A;  2ZM2 A;  3OBF A;  3FZC A;  3U4L P;  1FCN A;  2Y2M A;  4ARZ A;  2V9A A;  2EFX A;  3HL9 A;  2EXA A;  4S2K A;  4Y3I A;  4KQR A;  4EES A;  1JWZ A;  4KEN B;  3LFV A;  5FAT A;  3CHW P;  3GDI A;  3B47 A;  1VEU B;  1OME A;  2X71 A;  5FQM A;  1OPX A;  3E4O A;  5AVE A;  4WEJ A;  3B3X A;  4BD0 A;  4GB7 A;  4LCL A;  3BQA A;  4X69 A;  3MFX A;  2H10 A;  2OLV A;  2EFU A;  4Y7P A;  3QP8 A;  1XXM A;  1T1B A;  2B02 A;  4HJ4 A;  2EX8 A;  2Y8H A;  5DVA A;  1SKF A;  2J3W A;  3K3D A;  1V9Z A;  2PD7 A;  4PAU A;  3JYI A;  1IOU A;  2ZOI A;  3LI9 A;  2WKR A;  4B9O A;  5TBM B;  3S7P A;  3LIA A;  3IF5 A;  3RJU A;  1EWZ A;  3A3E A;  3T4K A;  3C4P A;  1BLC A;  1ESI A;  4Q0H A;  1ZC2 A;  2B18 A;  2O9B A;  4NK3 A;  3MQQ A;  1KGG A;  5CTM A;  2AVX A;  5DF9 A;  5HAR A;  2QZ6 A;  3C7V A;  4K91 A;  5FEG A;  5I5L A;  4Y17 A;  3O5Y A;  4A5R A;  1KOU A;  2Z6D A;  3OZH A;  4OKP A;  2EX6 A;  3C4O A;  1ZHH B;  2ZL1 A;  2Z2L B;  5IU1 A;  5G4Y A;  3HJI A;  2XRO A;  2WKH A;  4X53 A;  3ZDJ A;  3OCN A;  3T4S A;  3BYD A;  1PZP A;  1PI5 A;  3BY9 A;  3MF0 A;  3T1X A;  1IKG A;  1G6O A;  1KDS A;  4KG2 A;  4Q0I A;  2HJ9 C;  4S2M A;  1T1C A;  2ZJ9 A;  3L7H A;  1Z09 A;  4MBK A;  3VOY A;  2B95 A;  3R7W B;  1K55 A;  1UGU A;  1ES4 A;  1ACF A;  1K54 A;  2UV0 E;  5F6A A;  3G32 A;  4XUX A;  5FQJ A;  2Y2G A;  1NY0 A;  4MBF A;  3WWX A;  2YKF A;  3M2K A;  2EWV A;  1O07 A;  3KSH A;  4WMC A;  1PIO A;  2WKE A;  2W1R A;  3HVF A;  1QME A;  1PZO A;  3Q81 A;  4IUH A;  3MR0 A;  4XT2 A;  1ERO A;  4IVI A;  1IKI A;  2H5S A;  2A49 A;  4ZJ2 A;  4E6X A;  5HX9 A;  2XF3 A;  1XGI A;  1J9M A;  4KQO A;  4KUO A;  3UDF A;  4KQQ A;  2Y2I A;  3UB9 A;  1CI9 A;  1HTZ A;  2VV6 A;  4IJG A;  3CI6 A;  1YAX A;  1SDE A;  4HIA A;  1FSW A;  2ZD8 A;  4QHC A;  3ZNT A;  4HI4 A;  1MWS A;  1K56 D;  3GQZ A;  3G35 A;  2Q0O A;  2VZW A;  3PHY A;  4O0P A;  1MY8 A;  2PYP A;  3CPT A;  3GTC A;  5GHZ A;  5CX7 A;  3HLG A;  3T1Q B;  4M4X A;  5DTK A;  2JKR M;  2G7U A;  1IFQ A;  4JXW A;  5EVI C;  3F1O A;  4GD6 A;  4HP9 A;  3DAV A;  4L9G A;  3A3D A;  2H0T A;  3UB5 P;  3UDX A;  3HLB A;  3PR6 A;  1D1J A;  3WS2 A;  2QKP A;  4UEY A;  3ZG0 A;  2PRF A;  3CAX A;  1Y54 A;  3UN7 A;  3BJN A;  5KMW A;  4S2O A;  1MWT A;  1WYB A;  3D9Y A;  5DKK A;  3DTI A;  1YKD A;  3V5M A;  1EW0 A;  4JGQ A;  3BFE A;  4E3K A;  2E8I A;  3FG8 A;  1FOF A;  2KDK A;  4YNR A;  3S7Q A;  4UA7 A;  3CWF A;  1D06 A;  4RA7 A;  2VJW A;  3VV4 A;  4FH4 A;  4PHT A;  3LYX A;  3W4Q A;  1XJ4 A;  4EU0 A;  2G2U A;  1T19 A;  1OTA A;  3IWO A;  4LRZ E;  3RH8 B;  3LO7 A;  1W7F A;  3QP6 A;  2ZQ8 A;  5HDD A;  4HJ3 A;  2KX6 A;  2XFS A;  5KIZ A;  1VHM A;  3UPO A;  4RX3 A;  4CJN A;  5KZH A;  4BLM A;  1AXB A;  2PHY A;  4F3L A;  2JKR I;  5GL9 A;  3NC8 A;  3PBS A;  1XKZ A;  4WEK A;  3T4O A;  1S1Y A;  3P09 A;  1LL8 A;  3M6B A;  3DTM A;  3BW6 A;  1ZG6 A;  4EEU A;  1ERQ A;  1OTE A;  1DP8 A;  4MN6 A;  4CLC E;  1LT0 A;  3JPU A;  4EXO A;  5CEB A;  3IHB A;  4BQM A;  1PWC A;  2PBD P;  4U3T A;  4EUV A;  4R6L A;  1OTB A;  4L0L A;  1YLT A;  2WGV A;  1IYP A;  3A3F A;  1KE4 A;  5E2E A;  4BJP A;  4FD8 A;  5CGW A;  4II7 A;  1F98 A;  3IWQ A;  4Z9Q A;  5CXW A;  2M7V A;  5M18 A;  2ZC3 B;  1IEM A;  2BG1 A;  2L4R A;  2QYB A;  3VSL A;  4LLO B;  4OVD A;  3LCE A;  2W0N A;  4OQH A;  5HWV A;  2Z2M B;  4S2N C;  3W8K A;  3CLO A;  4WL9 A;  4C3Q A;  1CEG A;  1S4S A;  2L1M A;  5CTN A;  1P0Z A;  5DKL A;  4GJ4 A;  4CLC B;  3LR0 A;  4Z1W A;  5TFQ A;  5D3O A;  4JPM A;  4PM6 A;  5FSR A;  5GHY A;  1YM1 A;  4PM5 A;  1H0M A;  2WUQ A;  3F1N A;  3KSI A;  3GRJ A;  5KSH A;  3UE3 A;  4DXC A;  3V50 A;  3CPT B;  4X68 A;  3CZD A;  3H82 A;  3E2K A;  3VP4 A;  1MWR A;  1CJF A;  4BD1 A;  2ZOH A;  3LI8 A;  5K5B A;  2O9A A;  3BFC A;  4C6Y A;  2W27 A;  4LGW A;  2WKI A;  3KYE A;  4K0W A;  4MMN A;  4ETZ A;  3SZT A;  5DFX A;  3UPP A;  1K4E A;  2XQZ A;  1PFL A;  3T1R A;  1BZA A;  2ZC4 B;  4DJ3 A;  2Y59 A;  3MKF A;  4O7D A;  4OP8 A;  4S2I A;  3ZNY A;  2WZX A;  2OAQ 1;  1FSY A;  4XUZ A;  3GEC A;  3NOP C;  5HPI A;  4N9K A;  4OQG A;  4H6J B;  1IYQ A;  4GOG A;  5DTT A;  4DE1 A;  2VA0 A;  3PBQ A;  3WS1 A;  3HCY A;  1W5D A;  3OPL A;  1W8Y A;  3QP5 A;  4KG5 A;  4UA6 A;  1HD8 A;  3MKE A;  2PBY A;  3IBJ A;  2QJ7 A;  3HLC A;  1KVL A;  2OWJ A;  1BUL A;  1FCO A;  1VQQ A;  2OV5 A;  3SOI A;  4Q8I A;  3SH8 A;  4JGP A;  1I2S A;  3FKV A;  1ALQ A;  1ONH A;  2EWW A;  5G18 A;  2ZM0 A;  4LV3 A;  3HLD A;  2ZM8 A;  2ACG A;  1FR6 A;  3C2W A;  4NXF A;  1KE3 A;  4X6T A;  4Y2F A;  4ZAM A;  1XP4 A;  2HF6 A;  3UB7 A;  4Y13 A;  3G6O A;  5M19 A;  1IEL A;  3MMH A;  4GN2 A;  4GNU A;  5L8M A;  2V0W A;  2BLS A;  4GLQ A;  1NZO A;  4LRY C;  2INW A;  1P9W A;  4M3K A;  4I5S A;  4WUJ A;  4HOI A;  2WKQ A;  4QY6 A;  3R7W A;  3FYZ A;  3LR3 A;  1STZ A;  3PBN A;  4ZTK A;  5CHJ A;  3G34 A;  2Y4A A;  3AGE A;  2M1C A;  4C75 A;  3C38 A;  4X1L A;  1YPR A;  2K31 A;  3H7W A;  4PKY A;  3UDI A;  2H0Y A;  2WYX A;  3LY3 A;  3VP0 A;  2XD5 A;  3TJZ C;  4Y0O A;  3BEB A;  2HDS A;  3BRM A;  3LIB A;  4LV2 A;  1L0D A;  5E2F A;  1GSX A;  2Q9M A;  2H28 A;  3E4P A;  2I72 A;  5BOH A;  5HWT A;  1KE0 A;  4FSF A;  4JLF A;  1SHV A;  2P08 A;  4MN5 A;  2K2N A;  3NOT C;  3NUL A;  5HSQ A;  1GSW A;  1H5X A;  2QJ5 A;  1G28 A;  3I7J A;  5AQ9 A;  4ARZ B;  2HDU A;  1LI0 A;  3VOZ A;  1VET A;  3PBO A;  5G4Z A;  2XD1 A;  5AQA A;  3LR4 A;  5F1G A;  1IYO A;  3M6H A;  3WRZ A;  4FCF A;  3PAG A;  1X0O A;  3A0S A;  1GA9 A;  4HH2 A;  4DN0 A;  4E3J A;  5HL6 A;  4G3V A;  3P98 A;  1TS7 A;  1K6S A;  4GKU A;  4NKP A;  2O0Y A;  5FQ9 A;  2RL3 A;  1VB6 A;  1JWP A;  2PU4 A;  3V3R A;  3IX4 A;  3OPP A;  1MWU A;  3PBR A;  2PAV P;  1TD5 A;  4O8G A;  3UPN A;  5HAP A;  4DXB A;  3PAE A;  1E3U D;  1ODV A;  3V67 A;  5FAS A;  4KQD A;  2JKT M;  5HAI A;  5F82 A;  1G68 A;  3IXG A;  5E2G A;  5EVL A;  3IWI A;  1NYY A;  3HLF A;  3MBZ A;  1BYW A;  5HWW A;  4P6B A;  4BBU A;  1GA0 A;  3GR2 A;  3T50 A;  3IF6 B;  2OAP 1;  2GDN A;  1YT4 A;  2EX2 A;  4Y15 A;  3MXQ A;  2EA9 A;  1YQS A;  4MCW A;  5I94 A;  1GHP A;  4EBP A;  2DMW A;  3MS6 A;  4UA9 A;  2VGL S;  4E3L A;  1G6A A;  1ES2 A;  3TOI A;  5DTS A;  2ZC5 B;  4GDN A;  3VSK A;  5J8X A;  3IF6 C;  3N8S A;  1L0G A;  3BWL A;  1OTI A;  2DCF A;  5GLB A;  1ES3 A;  3BM6 A;  5EOO A;  3FPW A;  5FQI A;  2M7U A;  3SW1 A;  5EPH A;  1XJ6 A;  3A3I A;  4L9F A;  2WK0 A;  2P9V B;  1VET B;  3QHY A;  3ZVW A;  3F1P B;  3CIT A;  3S22 A;  2VGJ A;  3KO6 A;  3VFF A;  3UNW A;  1OJ5 A;  1YLP A;  2Y55 A;  3BLM A;  3HRE A;  1LSX A;  3LGO A;  1LL5 A;  4N92 A;  4R1G A;  3IQA A;  4E3O A;  3VOL A;  2JHE A;  2Z6C A;  1PNE A;  3SS4 A;  2ZC6 B;  3OPR A;  1YMX A;  4CQH A;  1T18 A;  4HHD A;  2HDQ A;  4HEF A;  1OJG A;  2RCX A;  3OC2 A;  4S2N A;  2G2W A;  3P01 A;  5GLA A;  1TS8 A;  2W3D A;  3E4Q A;  4EBL A;  2A2L A;  4EER A;  2ZBB A;  1BLS A;  2B5R A;  2NUT C;  4YOF A;  4WLA A;  4GW9 A;  4RX2 A;  3ZGA B;  4MN7 A;  3F1O B;  3TE8 A;  5CER A;  1L0F A;  2VGK A;  1SDN A;  2PD8 A;  3HJK A;  3KSF A;  4Y0T A;  3SH9 A;  1Q2P A;  4PMA A;  3UMD A;  5A91 A;  3ZYT A;  5EVI D;  1GHI A;  1JTG A;  3M2J A;  4QU3 A;  5DJU A;  2WAD A;  3NJA A;  4O01 A;  5F69 A;  2DNS A;  3W4O A;  5C5K A;  3O3V A;  2D01 A;  3WS0 A;  4JGO A;  4EET B;  4X1M A;  1TF1 A;  1W8Q A;  4WMC D;  4WBG A;  1BLH A;  2VX8 A;  2WZZ A;  1LSV A;  1RGY A;  1YSP A;  5M1A A;  3QP1 A;  1N9O A;  1KDW A;  3N7W A;  3MQO A;  5FA7 A;  1LHY A;  3T4J A;  3KYZ A;  4I3A A;  5E2H A;  4B93 A;  5FAO A;  4PM9 A;  4WEL A;  4HQA A;  2QHK A;  2A3U A;  5EM1 A;  2V1B A;  2XA7 M;  3LIC A;  5FQK A;  1KGE A;  4IHQ A;  4WZ4 A;  4E3I A;  1BT5 A;  4MBH A;  3VMA A;  1OT9 A;  4KZB A;  5A92 A;  1J3W A;  1CEF A;  1FQG A;  1S67 L;  1G5U A;  3G2Y A;  1LLB A;  4FH2 A;  5L07 A;  3E2L A;  3WRT A;  1FIL A;  5EE8 A;  5FI2 A;  2XR0 A;  4NXG A;  1PRQ A;  2EX9 A;  4U0X A;  3T1S A;  1XFN A;  1L3L A;  3EEA A;  3IH8 A;  2ZQC A;  3NEC A;  5TJJ A;  2IWB A;  2FFY A;  5CRF A;  4GHI A;  5TGF A;  4IBX A;  4S2L A;  4K08 A;  4Y0U A;  2Y2H A;  1FIK A;  5EUA A;  5EVE A;  5FAQ A;  3E0Y A;  1H3Q A;  1Q2Q A;  5F5Y A;  2VK3 A;  5EV0 A;  5DFY A;  3JVU A;  3D4F A;  4YFM A;  2GNX A;  1TS6 A;  4OP5 A;  1XFQ A;  3T4T A;  3GV9 A;  1Z6F A;  4BL3 A;  5HD3 A;  2WGI A;  2X01 A;  3G4P A;  1UWP X;  1K57 A;  4I38 A;  5J4E A;  1P97 A;  4P6Z M;  2PR5 A;  3TG9 A;  4UQI S;  2E8J A;  4DDS A;  2ZLY A;  3B42 A;  3BFD A;  4IVK A;  3E98 A;  4G3K A;  3C7U A;  3HUN A;  5JYO A;  3BLS A;  4DMZ A;  1H8Y A;  1M40 A;  3UO9 A;  4LRX C;  1NYM A;  4HJ6 A;  4ZRR A;  4P87 A;  2XH9 A;  2ZC7 A;  3VP2 A;  3HUO A;  1HLU P;  2JCH A;  4DKI A;  2ZQA A;  1CF0 A;  2R9W A;  4OPQ A;  1BUE A;  4CLC D;  4HBT A;  2JBF A;  2XLN A;  1SKO A;  4K0X A;  1BLP A;  4DJ2 A;  4E04 A;  4X56 A;  4PM8 A;  2I9V A;  4U0T A;  5GHX A;  4IUK A;  2VLG A;  1H8Z A;  1ZTU A;  3NOU C;  3UME A;  3ZVT A;  5F68 A;  2WGW B;  4KG6 A;  4QY5 A;  3MXS A;  1AWI A;  3U2A A;  3TSG A;  3CG5 A;  4LEN A;  2HJE A;  3Q07 A;  3VP1 A;  3HBR A;  2O99 A;  4EUZ A;  2W1T B;  2PDR A;  2VKS A;  4PM7 A;  3A0R A;  4KZ5 A;  4E3M A;  4ZDX A;  5AQ7 A;  4ID4 A;  4R23 A;  2A24 B;  5TBM A;  3V3S A;  2ZQ7 A;  2HDR A;  1I2W A;  2QWS A;  1NJ4 A;  5FAP A;  2W1T A;  1E4D A;  4WM9 A;  3LEZ A;  2XSS A;  1PWD A;  3PYP A;  1DP9 A;  4S2J A;  1NRJ A;  3BFG A;  3V39 A;  3MZE A;  1MC0 A;  5J7E A;  4JF6 A;  3N4I A;  5GLD A;  2BTF P;  1WA9 A;  1MZU A;  3WS4 A;  1K0K A;  5EEC A;  5CGX A;  4LV1 A;  3IS2 B;  4RVA A;  2J3T C;  5MC7 A;  5U47 A;  3SH7 A;  1K56 A;  2VV7 A;  1F9I A;  2KOI A;  3KSG A;  4UHU A;  3ISG A;  1MPL A;  3NIA A;  1DRM A;  1DJC A;  3NBL A;  5DF7 A;  3CUE C;  3UY6 A;  2FFF B;  4I39 A;  3O86 A;  4OLD A;  2J3T D;  3JVV A;  4G3W A;  3C5A A;  4EEP A;  1SCW A;  2HP9 A;  1VEU A;  2VGL M;  3IXH A;  3EWK A;  4NEE D;  3LIF A;  1NZU A;  1ZG4 A;  4MEZ A;  3DW0 A;  4BBV A;  2Y2L A;  4XXR A;  5EVI A;  1XPB A;  2ZMF A;  3B33 A;  3GMW A;  4IBR A;  3NDE A;  3OPH A;  4N1H A;  3IHA A;  4BEN A;  3LIE A;  4Q0J A;  3IF6 A;  5TR7 A;  2LB5 A;  1D7E A;  3TRC A;  2IA2 A;  2KLI A;  3N6I A;  3IT9 A;  4OQ0 A;  3WS5 A;  5L10 A;  4EW7 A;  1N9L A;  4CLC C;  1ZKJ A;  4BL2 A;  3A3J A;  3R4K A;  3TW8 A;  4OPR A;  1TDL A;  1MKM A;  4R4R A;  4GDB A;  3O87 A;  1F5M A;  4B4X A;  2GJ3 A;  3Q7V B;  4BWI A;  1DY6 A;  5AQB A;  4R0Q A;  4F94 A;  3LR5 A;  1W63 M;  4GZB A;  2D02 A;  3AGD A;  1VM1 A;  5F1F A;  3CMZ A;  5IT5 A;  3IXD A;  5HFO A;  4KZ7 A;  3KX0 X;  1YLY A;  3G2Z A;  3ZFZ A;  1N9N A;  1P9R A;  2WAF A;  4GS9 A;  2MJ6 A;  3NHQ A;  5HAQ A;  3NI9 A;  5F83 A;  5HL1 A;  4LFU A;  2ZQD A;  5A8B A;  4X25 A;  1RGZ A;  3CUE A;  1A0K A;  2W3E A;  1TDG A;  2PT7 A;  5LBR A;  2VEA A;  4QJG A;  1DJA A;  1JTD A;  1E3U A;  3ZG7 B;  3Q7Z A;  1YLZ A;  1K4F A;  1N9B A;  4CPK A;  2W3F A;  4DF6 A;  4NG2 A;  2HP6 A;  3P7N A;  2HZ5 A;  5FL3 A;  4KZ9 A;  3QP2 A;  5EM0 A;  1K6R A;  4JF4 A;  4ESP A;  3QNC A;  1PW8 A;  1MXO A;  3N8R A;  4E6W A;  3D72 A;  2OWH A;  2K7S A;  4NET A;  1NWZ A;  2W3H A;  4H6J A;  5GLC A;  1O7E A;  2Y91 A;  3DBA A;  3W2Z A;  3ITB A;  2P04 A;  1CK3 A;  1LI9 A;  3H9W A;  4DRT A;  1K25 A;  2JKG A;  2PYR A;  4KZ3 A;  2XK1 A;  4OOM A;  2XA7 S;  3Q1F A;  4P85 A;  1U60 A;  4GS9 B;  3BEC A;  1W63 Q;  4OPZ A;  3OCL A;  1JNU A;  3T12 B;  2V2F F;  4ZJ3 A;  2V8F A;  1S4R A;  3HLW A;  1OT6 A;  1GSV A;  3S1Y A;  3IH9 A;  3RXX A;  4ZJ1 A;  1OTD A;  1ONG A;  4LV0 A;  2C5W B;  4FOF A;  3GVB A;  1W79 A;  2Y79 A;  4B88 A;  3FKW A;  1RP5 A;  2XRN A;  3T4L A;  3DWK A;  1S66 L;  1YLJ A;  2IWD A;  3N8L A;  4MNR A;  5L09 A;  4OOY A;  1SKO B;  1BSG A;  3FC7 A;  4DE2 A;  3D3O A;  2A24 A;  1S1Z A;  3IXB A;  4JXS A;  4YWZ A;  2PR6 A;  4BBT A;  3FWL A;  4KUK A;  4P6Z S;  4NXB A;  5A93 A;  4F3L B;  4UQI M;  5IHV A;  4P0M A;  1WE4 A;  3AGF A;  1S0W A;  1XX2 A;  4HH3 A;  3EEH A;  4KZA A;  1CI8 A;  3GSG A;  1HZO A;  3BFF A;  3DTK A;  1Y28 A;  1XA1 A;  4D60 A;  1Y4O A;  1TVF A;  1SZV A;  2FH5 A;  3NY4 A;  2V8C A;  5L2F A;  3VP3 A;  2J80 A;  3EOI A;  5FI6 A;  2Y2O A;  3ZG9 B;  4R70 A;  4EQI A;  3S7N A;  4DDY A;  4OLG A;  3IBR A;  1XGJ A;  3UE6 A;  4D2O A;  3C8C A;  1FR1 A;  4MDZ A;  1GHM A;  1MKI A;  3MSH A;  3MFD A;  1KGF A;  3RTY A;  2ZMA A;  4KZ8 A;  2JE5 A;  1T1A A;  2V0U A;  4I3J A;  5AJG A;  1JVJ A;  2J9O A;  5HDC A;  2NUP C;  1EI5 A;  4JXG A;  1E25 A;  3W4P A;  2V1Z A;  3K2N A;  1K55 C;  4EWF A;  3ICY A;  3S7O A;  4ETX A;  4OOL A;  3MJQ A;  2OSU A;  1ERM A;  3MQ0 A;  4RQ9 A;  4JXV A;  4R3B A;  4H8R A;  3ITA A;  3H82 B;  3L9K A;  3G30 A;  3A0V A;  5DF8 A;  3PBT A;  1HVB A;  1DJB A;  3S4X A;  2P7J A;  1DP6 A;  5FDH A;  1PYY A;  5CGS A;  4R4S A;  2GX5 A;  2JKF A;  4GCZ A;  2Y2Q A;  4R3J A;  4QWO A;  4DE0 A;  1K54 C;  3PTE A;  3ZCZ A;  1RCJ A;  3UB6 A;  2WAE A;  1NLZ A;  3EGD C;  1LL9 A;  5KSC A;  2R9X A;  1IYS A;  4HES A;  2ZQ9 A;  3BQ8 A;  3FV7 A;  1ESU A;  4MLL A;  4WZ5 C;  5FQQ A;  4X55 A;  2OLU A;  2R78 A;  2ZMV A;  1K57 C;  3IX3 A;  4FUW A;  3LY4 A;  3HUM A;  5J3W A;  2IWC A;  3ZG5 A;  5HD5 A;  1LSW A;  3ZQ5 A;  1PWG A;  2XDM A;  4ZBE A;  5AVF A;  5CED A;  3EQV A;  3EQU A;  1YLW A;  4QPR A;  2HPB A;  1GCE A;  3UE1 A;  3O88 A;  4JBF A;  3SS3 A;  3UE0 A;  4NXE A;  1UWN X;  2P74 A;  3ZG8 B;  2UWX A;  1QMF A;  3H7W B;  4JGR A;  1PW1 A;  4CLC A;  1JWV A;  5FDS A;  4B4Z A;  2Y2J A;  3VE4 A;  2HGV A;  4OQI A;  4FTX A;  3LID A;  1TEM A;  3PXP A;  2L0W A;  2HV1 A;  2V20 A;  5CHM A;  2Y2K A;  2X02 A;  1BTL A;  2DRW A;  3VE3 A;  4PPR A;  3ZHH A;  3Q82 A;  4JKT A;  2QPN A;  3IX8 A;  5EFW A;  3RFB A;  2Q9N A;  3OLO A;  4QD4 A;  5HDS A;  4KZ6 A;  2XFT A;  4L9E A;  5JYP A;  2ZL1 B;  2W3G A;  4AFI A;  4N1X A;  4KZ4 A;  2JN7 A;  3OOV A;  1FCM A;  4Y5F A;  1NXY A;  4OH0 A;  3C30 A;  2WGW A;  4LPZ A;  3LUQ A;  4N9L A;  4R3A A;  4HY8 A;  1S6R A;  3QNB A;  2Y2P A;  4XT2 B;  3VFH A;  2BAS A;  3SS5 A;  1H8M A;  1NLY A;  2CC1 A;  3EGX C;  5EOE A;  4R38 A;  1CQA A;  4WN5 A;  2HP5 A;  4GD8 A;  5A90 A;  1M6K A;  2QMI A;  2C6W B;  3CJM A;  3UB8 A;  2J7V A;  2J8Y A;  5E43 A;  5FEF A;  4EV4 A;  3T4Q A;  3F1N B;  1C3B A;  2JKT I;  3DTE A;  2XEP A;  3MZF A;  4WYY A;  4GHI B;  3NDG A;  4BMW A;  3DWZ A;  2EXB A;  4DE3 A;  2OOL A;  4WZ5 A; 
#chains in the Genus database with same CATH homology
 4OPY A;  2HDQ A;  4HEF A;  1KE4 A;  5HAQ A;  5E2E A;  2RCX A;  4BJP A;  3OC2 A;  4S2N A;  1NRF A;  2G2W A;  3NI9 A;  2P9V A;  4FD8 A;  5CGW A;  5GLA A;  5F83 A;  3Q7V A;  4Z9Q A;  3IWQ A;  5CXW A;  4HBU A;  4EBL A;  5HL1 A;  5M18 A;  2ZC3 B;  1IEM A;  2BG1 A;  2ZQD A;  5CEC A;  5HW3 A;  3VSL A;  1RGZ A;  1PI4 A;  1BLS A;  2B5R A;  4OVD A;  3LCE A;  4UAA A;  1TDG A;  4OQH A;  2Z2M B;  4S2N C;  4JF5 A;  3W8K A;  4QJG A;  1DJA A;  1JTD A;  1ES5 A;  1E3U A;  4RX2 A;  3ZGA B;  4C3Q A;  3ZG7 B;  3Q7Z A;  5CHU A;  5CER A;  1CEG A;  1YLZ A;  5CTN A;  1K4F A;  1L0F A;  3G31 A;  2PU2 A;  2VGK A;  1SDN A;  1N9B A;  4CPK A;  4OON A;  4DF6 A;  4IED A;  4Y0T A;  3RXW A;  2HP6 A;  4RYE A;  3SH9 A;  1MBL A;  4KZ9 A;  1K6R A;  1Q2P A;  4JF4 A;  4LCM A;  1L2S A;  4YIN A;  1N4O A;  3QNC A;  5TFQ A;  4PMA A;  1PW8 A;  2Y2N A;  5D3O A;  4JPM A;  4PM6 A;  5FSR A;  1MXO A;  1YM1 A;  5GHY A;  4PM5 A;  3N8R A;  4E6W A;  1K38 A;  2WUQ A;  1YMS A;  2XGN A;  5A91 A;  3GRJ A;  5KSH A;  2J9P A;  5EVI D;  3UE3 A;  1GHI A;  1JTG A;  3M2J A;  3V50 A;  4QU3 A;  4DXC A;  3MZD A;  5EVI B;  2WAD A;  3HLE A;  4X68 A;  2JC7 A;  3CZD A;  4E3N A;  4EBN A;  3E2K A;  3VP4 A;  2DNS A;  4NET A;  3W4O A;  1MWR A;  3O3V A;  1KVM A;  4BD1 A;  3WS0 A;  5GLC A;  1O7E A;  2Y91 A;  3BFC A;  4C6Y A;  1I5Q A;  3ITB A;  5FI7 A;  2WKI A;  3NCK A;  4K0W A;  1CK3 A;  1LI9 A;  1W8Q A;  1WYC A;  4DRT A;  4QB8 A;  4WMC D;  1K25 A;  4KZ3 A;  2XK1 A;  1L0E A;  4WBG A;  4OOM A;  4S2P A;  1BLH A;  3Q1F A;  2WZZ A;  3MXR A;  4P85 A;  1RGY A;  3UPP A;  5M1A A;  1K4E A;  2XQZ A;  1U60 A;  1XA7 A;  3BEC A;  1KDW A;  2ZM2 A;  1BZA A;  3N7W A;  3FZC A;  4OPZ A;  1FCN A;  2Y2M A;  2ZC4 B;  3OCL A;  5FA7 A;  2EFX A;  1LHY A;  3HL9 A;  2Y59 A;  2EXA A;  3MKF A;  2V2F F;  4S2K A;  4O7D A;  5E2H A;  4KQR A;  5FAO A;  1JWZ A;  4PM9 A;  4KEN B;  4OP8 A;  4S2I A;  4WEL A;  3ZNY A;  4ZJ3 A;  2WZX A;  2A3U A;  3HLW A;  5FQK A;  1FSY A;  4XUZ A;  1KGE A;  5FAT A;  4WZ4 A;  3S1Y A;  4N9K A;  3IH9 A;  3RXX A;  4OQG A;  4E3I A;  1BT5 A;  4MBH A;  3VMA A;  1OME A;  1IYQ A;  4GOG A;  4KZB A;  5DTT A;  4DE1 A;  5A92 A;  1CEF A;  1FQG A;  2X71 A;  5FQM A;  3PBQ A;  4ZJ1 A;  1ONG A;  3G2Y A;  3WS1 A;  4LV0 A;  1LLB A;  2C5W B;  4FH2 A;  3GVB A;  4WEJ A;  1W5D A;  3B3X A;  3E2L A;  3OPL A;  1W79 A;  3WRT A;  1W8Y A;  4BD0 A;  4KG5 A;  4GB7 A;  4B88 A;  4UA6 A;  1HD8 A;  3MKE A;  5EE8 A;  5FI2 A;  4LCL A;  2XR0 A;  4X69 A;  2PBY A;  3FKW A;  2EX9 A;  4U0X A;  2H10 A;  1RP5 A;  2OLV A;  1KVL A;  2EFU A;  3HLC A;  4Y7P A;  1BUL A;  3DWK A;  3IH8 A;  1YLJ A;  2IWD A;  3N8L A;  4MNR A;  1XXM A;  2ZQC A;  1FCO A;  1VQQ A;  2OV5 A;  4OOY A;  3SOI A;  1BSG A;  2EX8 A;  3SH8 A;  4Q8I A;  5DVA A;  1SKF A;  1I2S A;  2IWB A;  4DE2 A;  2FFY A;  3JYI A;  5CRF A;  3FKV A;  1ALQ A;  1ONH A;  5TGF A;  3IXB A;  4IBX A;  4JXS A;  5G18 A;  2ZM0 A;  4S2L A;  4LV3 A;  4Y0U A;  2Y2H A;  3FWL A;  3HLD A;  3IF5 A;  3RJU A;  1EWZ A;  2ZM8 A;  5EUA A;  3A3E A;  3C4P A;  1BLC A;  1ESI A;  5FAQ A;  5A93 A;  1ZC2 A;  1Q2Q A;  4NK3 A;  5IHV A;  1KGG A;  4P0M A;  5CTM A;  1FR6 A;  5DF9 A;  1WE4 A;  3AGF A;  1S0W A;  1XX2 A;  4YFM A;  1KE3 A;  3D4F A;  4KZA A;  5HAR A;  1CI8 A;  2QZ6 A;  4X6T A;  3C7V A;  4ZAM A;  1XP4 A;  4K91 A;  4OP5 A;  3GV9 A;  3GSG A;  1Z6F A;  4BL3 A;  2WGI A;  1HZO A;  2X01 A;  3G4P A;  5M19 A;  1IEL A;  3BFF A;  4A5R A;  4GN2 A;  4GNU A;  1K57 A;  3OZH A;  4OKP A;  2BLS A;  2EX6 A;  1XA1 A;  3TG9 A;  1NZO A;  3C4O A;  4DDS A;  2ZLY A;  1TVF A;  3BFD A;  2Z2L B;  4IVK A;  3NY4 A;  4M3K A;  3C7U A;  2WKH A;  3HUN A;  5L2F A;  3VP3 A;  5JYO A;  4X53 A;  3BLS A;  3ZDJ A;  1H8Y A;  1M40 A;  5FI6 A;  3OCN A;  2Y2O A;  3UO9 A;  4QY6 A;  3ZG9 B;  3BYD A;  3FYZ A;  1PZP A;  4EQI A;  3PBN A;  4ZTK A;  4DDY A;  4OLG A;  5CHJ A;  3G34 A;  1XGJ A;  2Y4A A;  1NYM A;  1PI5 A;  3AGE A;  4C75 A;  4D2O A;  4P87 A;  1FR1 A;  1IKG A;  2XH9 A;  1KDS A;  2ZC7 A;  3UDI A;  3VP2 A;  4KG2 A;  2H0Y A;  2WYX A;  1GHM A;  3HUO A;  3LY3 A;  1MKI A;  2JCH A;  3VP0 A;  2XD5 A;  4S2M A;  4DKI A;  2ZQA A;  2R9W A;  3MFD A;  2ZJ9 A;  4OPQ A;  4Y0O A;  1KGF A;  1BUE A;  2ZMA A;  4KZ8 A;  2JE5 A;  3BEB A;  4HBT A;  4MBK A;  3VOY A;  1K55 A;  2HDS A;  2JBF A;  3BRM A;  1ES4 A;  1JVJ A;  2XLN A;  1L0D A;  4LV2 A;  1K54 A;  4K0X A;  2J9O A;  5E2F A;  1BLP A;  1EI5 A;  3G32 A;  4PM8 A;  4X56 A;  4JXG A;  4XUX A;  2Q9M A;  4U0T A;  5FQJ A;  2Y2G A;  1NY0 A;  1E25 A;  4MBF A;  3W4P A;  5GHX A;  3WWX A;  3M2K A;  2V1Z A;  1H8Z A;  1K55 C;  2I72 A;  1O07 A;  4EWF A;  4WMC A;  5BOH A;  1PIO A;  2WKE A;  4OOL A;  3HVF A;  3ZVT A;  1KE0 A;  4FSF A;  4JLF A;  2WGW B;  1SHV A;  1QME A;  1PZO A;  4KG6 A;  4QY5 A;  2OSU A;  3Q81 A;  1ERM A;  3MXS A;  3TSG A;  4JXV A;  4R3B A;  4H8R A;  3ITA A;  1ERO A;  3CG5 A;  3G30 A;  4IVI A;  4LEN A;  5DF8 A;  1IKI A;  3PBT A;  3Q07 A;  1HVB A;  1DJB A;  2H5S A;  3S4X A;  3VP1 A;  2A49 A;  3HBR A;  5FDH A;  1PYY A;  4ZJ2 A;  5CGS A;  3ZVW A;  1H5X A;  4E6X A;  4EUZ A;  5HX9 A;  2XF3 A;  4R4S A;  3I7J A;  1XGI A;  4PM7 A;  5AQ9 A;  4KZ5 A;  1J9M A;  4E3M A;  2Y2Q A;  4KQO A;  4R3J A;  4ID4 A;  4KQQ A;  5AQ7 A;  3UDF A;  4R23 A;  2HDU A;  4ZDX A;  2Y2I A;  1LI0 A;  3VOZ A;  3PBO A;  3V3S A;  4DE0 A;  2ZQ7 A;  1CI9 A;  1K54 C;  1HTZ A;  2XD1 A;  2HDR A;  3PTE A;  5AQA A;  3ZCZ A;  1RCJ A;  5F1G A;  1IYO A;  2WAE A;  1I2W A;  1NJ4 A;  3M6H A;  5FAP A;  1E4D A;  1LL9 A;  4WM9 A;  1SDE A;  3WRZ A;  5KSC A;  2R9X A;  3LEZ A;  1IYS A;  4FCF A;  4HES A;  3PAG A;  2ZQ9 A;  1FSW A;  2ZD8 A;  1PWD A;  3FV7 A;  1ESU A;  4QHC A;  3ZNT A;  4MLL A;  1GA9 A;  4WZ5 C;  1MWS A;  1K56 D;  3GQZ A;  4S2J A;  5FQQ A;  4X55 A;  3G35 A;  3BFG A;  3V39 A;  2OLU A;  3MZE A;  1K57 C;  1MY8 A;  3LY4 A;  4JF6 A;  3N4I A;  4E3J A;  5GLD A;  3HUM A;  2IWC A;  3P98 A;  3GTC A;  5GHZ A;  3ZG5 A;  1K6S A;  4GKU A;  3HLG A;  5FQ9 A;  2RL3 A;  1PWG A;  5DTK A;  2XDM A;  4ZBE A;  1JWP A;  2PU4 A;  3WS4 A;  3V3R A;  4JXW A;  5EVI C;  5CED A;  3OPP A;  5CGX A;  5EEC A;  1MWU A;  4GD6 A;  3EQV A;  3EQU A;  1YLW A;  3PBR A;  4LV1 A;  3A3D A;  2HPB A;  2H0T A;  4RVA A;  1GCE A;  3UDX A;  3UPN A;  3UE1 A;  5U47 A;  5HAP A;  4DXB A;  3O88 A;  3HLB A;  3SH7 A;  1K56 A;  3PAE A;  3WS2 A;  1E3U D;  4JBF A;  3SS3 A;  5FAS A;  3UE0 A;  4UHU A;  3ZG0 A;  3ISG A;  1MPL A;  2P74 A;  3NIA A;  5HAI A;  1Y54 A;  1DJC A;  3NBL A;  5DF7 A;  2UWX A;  1QMF A;  3UN7 A;  5F82 A;  1G68 A;  3ZG8 B;  3IXG A;  1PW1 A;  5KMW A;  5E2G A;  5EVL A;  2FFF B;  3UY6 A;  3IWI A;  1JWV A;  1NYY A;  3O86 A;  4S2O A;  2Y2J A;  4OLD A;  3HLF A;  3MBZ A;  4B4Z A;  4OQI A;  4P6B A;  1MWT A;  1WYB A;  3C5A A;  1GA0 A;  3V5M A;  3GR2 A;  1TEM A;  1SCW A;  2HP9 A;  3BFE A;  3IF6 B;  3IXH A;  2V20 A;  4E3K A;  2E8I A;  2GDN A;  5CHM A;  1YT4 A;  2EX2 A;  1NZU A;  1ZG4 A;  2Y2K A;  4MEZ A;  1FOF A;  2X02 A;  1BTL A;  3DW0 A;  2DRW A;  2Y2L A;  4UA7 A;  4XXR A;  5EVI A;  1YQS A;  1XPB A;  5I94 A;  1GHP A;  4RA7 A;  4EBP A;  3GMW A;  4IBR A;  3NDE A;  3OPH A;  4PPR A;  4N1H A;  3IHA A;  3Q82 A;  3ZHH A;  4BEN A;  4JKT A;  2QPN A;  4FH4 A;  3IF6 A;  4UA9 A;  2Q9N A;  4QD4 A;  5TR7 A;  4E3L A;  3W4Q A;  4KZ6 A;  2G2U A;  2XFT A;  5JYP A;  1G6A A;  3IWO A;  3N6I A;  1ES2 A;  3IT9 A;  4N1X A;  4KZ4 A;  3LO7 A;  4OQ0 A;  3TOI A;  1W7F A;  5DTS A;  2ZC5 B;  3WS5 A;  2ZQ8 A;  4GDN A;  3VSK A;  2XFS A;  5J8X A;  3IF6 C;  3N8S A;  1L0G A;  1FCM A;  1ZKJ A;  1NXY A;  2DCF A;  5GLB A;  4OH0 A;  4RX3 A;  4BL2 A;  3UPO A;  3A3J A;  4CJN A;  5KZH A;  2WGW A;  4BLM A;  1ES3 A;  4N9L A;  1AXB A;  4OPR A;  3BM6 A;  1TDL A;  5EOO A;  5FQI A;  4R4R A;  5GL9 A;  3NC8 A;  3A3I A;  3PBS A;  4GDB A;  5EPH A;  1S6R A;  2WK0 A;  2P9V B;  3QNB A;  3O87 A;  2Y2P A;  4B4X A;  3Q7V B;  1XKZ A;  4WEK A;  3VFH A;  3SS5 A;  2CC1 A;  1DY6 A;  3P09 A;  3QHY A;  3M6B A;  3DTM A;  5EOE A;  2HP5 A;  4GD8 A;  5AQB A;  1ZG6 A;  4R0Q A;  2VGJ A;  3S22 A;  1M6K A;  3VFF A;  4F94 A;  5A90 A;  1ERQ A;  2QMI A;  3UNW A;  2C6W B;  3CJM A;  2J7V A;  4GZB A;  1YLP A;  2Y55 A;  3BLM A;  3HRE A;  2J8Y A;  1LL5 A;  5E43 A;  4N92 A;  3AGD A;  4R1G A;  3IQA A;  4E3O A;  5CEB A;  3IHB A;  4EV4 A;  1VM1 A;  5F1F A;  3CMZ A;  3IXD A;  1C3B A;  4BQM A;  5HFO A;  1PWC A;  4U3T A;  4KZ7 A;  1YLY A;  2XEP A;  3G2Z A;  3MZF A;  4WYY A;  3ZFZ A;  3SS4 A;  2ZC6 B;  3NDG A;  3OPR A;  1YMX A;  3DWZ A;  4L0L A;  2EXB A;  4DE3 A;  2WAF A;  1YLT A;  2WGV A;  1IYP A;  3A3F A;  4WZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...