4QY5A

Crystal structures of chimeric beta-lactamase ctem-19m showing different conformations
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM,Beta-lactamase PSE-4
total genus 91
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qy5A00
4C75A 3ZCZA 4E3OA 1XKZA 2EX8A 5A91A 2PU4A 2A3UA 1I5QA 2P9VA 5L2FA 4OLGA 4UHUA 1W79A 3PBRA 4JPMA 3MKFA 2FFYA 1EWZA 1HD8A 3BYDA 2ZMAA 1J9MA 5CRFA 4RX3A 3NI9A 3G31A 1VQQA 3WS5A 3ZG5A 1XX2A 1YLJA 1MBLA 4RVAA 3IWQA 4R23A 4JF6A 4QY6A 3W4QA 1K4FA 1K54C 5KZHA 1QMFA 1XA1A 3Q07A 2V20A 5EE8A 4S2PA 1SHVA 3S1YA 1PZPA 5DF8A 1BLHA 3IT9A 4LV2A 4WM9A 2PBYA 3IXDA 4WELA 3JYIA 1CI8A 3Q7VB 3DWKA 2H5SA 3WWXA 3LY3A 3OPHA 4E6WA 3MKEA 4WZ4A 3P98A 4QB8A 4EUZA 5FQMA 3FZCA 5CHUA 3MBZA 3N7WA 4KZ5A 1NZOA 3C7UA 2EXAA 2WZXA 2VGJA 5FAOA 4K0XA 1WYBA 2HDUA 3V5MA 4QY5A 4KG2A 1YLYA 3BFGA 3MXRA 3WS1A 1K6SA 4KQOA 2HP5A 3VP3A 3ZG7B 1FCOA 4ZDXA 3S4XA 4JF4A 5CECA 5A90A 2XK1A 3Q1FA 1K57A 2Y2JA 1TVFA 3FKVA 5F1GA 1YT4A 4EV4A 2WGWA 1LLBA 2G2WA 3HUOA 3BM6A 2HDQA 4BL3A 4Y0UA 4MLLA 1XA7A 4Y7PA 4BQMA 4E6XA 5CEBA 5CTNA 3G30A 5CEDA 3UO9A 1SCWA 3PAEA 4Y0TA 4X55A 5GLAA 4JXGA 3LCEA 4KZ8A 1IYSA 1ES3A 3E2LA 2WGVA 4GNUA 4FH4A 4ZAMA 2IWCA 2Y2GA 4U3TA 4B88A 3HUNA 1YMSA 3UDXA 1PWCA 3QNBA 5F1FA 5HFOA 5DTKA 1KDSA 2WK0A 4KENB 5CGXA 1M6KA 3PAGA 4BD1A 3BFEA 3IHBA 3VFFA 1SKFA 4N1XA 3UN7A 2ZLYA 1S0WA 4OPRA 5U47A 1BSGA 2R9WA 4CPKA 2XGNA 2XEPA 3OCLA 5EVIC 1LI0A 2XFSA 5M18A 1MWTA 1CI9A 1YLWA 3OPPA 3A3EA 4WZ5C 3SH9A 1ERQA 3IQAA 4BLMA 4EBLA 3HLFA 4DXBA 1GHPA 3S22A 3OC2A 5GL9A 4GZBA 3ZVTA 5AQ7A 1HTZA 3MZFA 4C3QA 4WEKA 2ZQCA 5FQIA 1BZAA 2ZM2A 3HLDA 4GD8A 4X6TA 2JBFA 1KE4A 5KSHA 1G6AA 5GLBA 4OQGA 4UA6A 1BTLA 3M2JA 4R3JA 5F83A 4EBPA 4Q8IA 4DDYA 1KDWA 1TEMA 3G4PA 3N8LA 1GCEA 3W8KA 1PI4A 4FCFA 3VP0A 2RCXA 4UAAA 5I94A 3C4PA 5JYPA 1M40A 1ZG4A 3BLSA 2EFXA 3G35A 1CEGA 4E3MA 3IH8A 4OQHA 3Q7ZA 3PBNA 4YFMA 4X56A 1BLSA 4LV1A 3AGDA 5TR7A 1YM1A 5HARA 1JWVA 3M2KA 4KZBA 1KVLA 2HP6A 2PU2A 4JKTA 3NDEA 3EQUA 3VP4A 2ZJ9A 5GHYA 2HDRA 4N92A 4A5RA 1RGYA 5GHXA 1RGZA 2XD5A 2EX9A 4P0MA 2A49A 4OOLA 5EECA 5GHZA 1K57C 3ZG0A 3V39A 2Y2IA 2EXBA 3FYZA 4XXRA 4PPRA 3VP2A 2Y2HA 3MZEA 1S6RA 2J7VA 2RL3A 1W7FA 3SOIA 3W4OA 3C5AA 4S2OA 5EOOA 3O87A 2J8YA 5CGSA 1LI9A 1PW8A 3O88A 4DF6A 1MWUA 4PM6A 4OQ0A 4DDSA 1IKGA 4DKIA 3M6HA 4PM5A 3WRZA 5HL1A 2Y2LA 5GLDA 1E25A 5DF9A 1U60A 2JC7A 4BL2A 2ZQ7A 2X71A 4H8RA 5HAPA 1KGEA 4GKUA 1L0EA 4GD6A 4OPZA 1ZG6A 2XFTA 2XF3A 1ES2A 3DWZA 4GB7A 3UE3A 4NETA 4R3BA 1PIOA 4OONA 2Y2KA 3A3JA 1MWSA 2OV5A 3VFHA 2C6WB 1K55C 3LEZA 2IWBA 4KG5A 4KZ4A 3W4PA 4NK3A 1K54A 1TDLA 1LL5A 1PYYA 2ZC4B 4GN2A 1Y54A 3BFCA 3IXBA 4IEDA 5EVLA 4ZTKA 1NYMA 3NCKA 3GTCA 5M19A 5E2HA 3HLBA 5AQAA 3E2KA 4HBTA 1BT5A 4Z9QA 4IBRA 1E3UA 5CERA 2OLUA 1LL9A 3G2YA 4LENA 3IWOA 1K55A 4MEZA 1YLZA 2EFUA 1G68A 3A3FA 2Y55A 3Q82A 5CXWA 4EQIA 1GHIA 3NC8A 3SH8A 4OOMA 3HLGA 4OVDA 4WEJA 3PBOA 2WYXA 3AGEA 2CC1A 3NIAA 3WS0A 4DE0A 2WAEA 4OQIA 2Q9NA 4KZ7A 1N4OA 3GV9A 5DVAA 1L0DA 4OKPA 3UDFA 1Q2QA 5E43A 5EVIB 3SS5A 3UPPA 1FR1A 5HX9A 2XD1A 1K56A 3N4IA 4S2LA 2WGIA 2Y2MA 4WMCD 1WE4A 1SDEA 3WS2A 2FFFB 2R9XA 4ID4A 1BLCA 5M1AA 2ZD8A 5JYOA 1YLPA 3GSGA 3IXHA 4D2OA 3IF6B 5FDHA 1MPLA 5KMWA 1BULA 4S2JA 3SS3A 4BD0A 3PBSA 3RJUA 4N9LA 1KVMA 5FAQA 2E8IA 3RXXA 4DE3A 2VGKA 3IWIA 1K4EA 4RX2A 2OSUA 1ONGA 1OMEA 4X69A 5FATA 3PBQA 4OP8A 1IYQA 2P9VB 2HP9A 5A92A 1FCMA 5BOHA 1XPBA 3IF6C 5FAPA 4PM7A 3BEBA 1YLTA 4XUZA 5E2FA 4FH2A 4LV3A 2HDSA 5AQBA 2XQZA 3IHAA 4DE1A 5FSRA 3N6IA 4GOGA 3HREA 1L2SA 4HEFA 3IH9A 2J9OA 3OPRA 3A3DA 5EOEA 1KGFA 2WKHA 4ZJ2A 3MZDA 4EWFA 1H5XA 3GQZA 4R1GA 3FKWA 3UNWA 3FWLA 3MXSA 1WYCA 5DTTA 3P09A 4R4SA 1FCNA 5EVID 4XUXA 1RCJA 1ERMA 1ESUA 4IVKA 3ITAA 3CJMA 4B4ZA 3OPLA 3G34A 2WAFA 3B3XA 3GR2A 1MY8A 1QMEA 5EPHA 2WGWB 3WS4A 1CK3A 4R0QA 2G2UA 3G32A 5FI7A 3HLEA 1BUEA 4MBHA 3HLWA 4WZ5A 1XXMA 2WADA 1FOFA 3HL9A 4S2NC 4LCMA 5E2GA 1SDNA 2P74A 2ZC7A 1KGGA 5FQKA 4KQRA 1DY6A 1L0FA 2OLVA 3VMAA 5FASA 1IELA 4BENA 3HVFA 3Q81A 3MFDA 4X53A 1K6RA 3O86A 3C7VA 3HUMA 2WZZA 2Z2LB 3UPOA 4S2NA 2JCHA 3G2ZA 1IKIA 3PBTA 4PM8A 4F94A 3Q7VA 2ZC3B 3LY4A 1O07A 1LHYA 1KE3A 4MBKA 4JLFA 2WKEA 1N9BA 4OOYA 4QJGA 1PWGA 4K0WA 4OPYA 1NXYA 4U0XA 4L0LA 3RXWA 3TOIA 2QZ6A 3V3SA 3NDGA 3C4OA 1ESIA 1DJAA 1O7EA 4ZBEA 1VM1A 3ZGAB 3A3IA 1NJ4A 3UPNA 5HW3A 2QPNA 3HLCA 2XLNA 3DW0A 4K91A 5CHMA 1W8YA 3QNCA 1TDGA 4RYEA 5EUAA 3N8SA 4OLDA 1HZOA 5CTMA 1Z6FA 1C3BA 3VSKA 3DTMA 2WKIA 3UY6A 3ZG9B 3ZVWA 1ZKJA 3IF6A 1PI5A 3EQVA 5FI2A 2Y4AA 1W5DA 3ISGA 3GVBA 4ZJ1A 4IVIA 4HESA 3ZNTA 3NY4A 2B5RA 4E3KA 4E3IA 1Q2PA 1XP4A 4E3NA 4UA9A 3V50A 4KZ3A 3NBLA 1I2SA 1K56D 2ZM0A 1FSYA 3BLMA 4BJPA 1IYOA 3ITBA 5HAQA 1K38A 5EVIA 1YQSA 2JE5A 1JWZA 5TGFA 2ZQ9A 2H0YA 1ES4A 3VP1A 1RP5A 2Y2OA 3ZHHA 4M3KA 4KZ6A 3VSLA 4PMAA 2V1ZA 3SH7A 2Y2PA 2ZQ8A 3V3RA 3QHYA 4O7DA 4QHCA 4S2KA 4QU3A 5FI6A 5KSCA 2GDNA 4UA7A 3OCNA 2ZM8A 4E3JA 1MXOA 2ZC5B 1CEFA 4LCLA 1PWDA 1I2WA 3PTEA 3WRTA 4EBNA 2DCFA 3BECA 5FA7A 2Y59A 1L0GA 5FQJA 2Z2MB 5IHVA 2ZC6B 5F82A 4DXCA 2ZQAA 4GDNA 4JXVA 1MKIA 4JBFA 4QD4A 1KE0A 2EX6A 4JXWA 4YINA 3ZFZA 4R4RA 3UDIA 4FD8A 2Y2QA 4S2MA 1JTDA 1FR6A 1GHMA 3IXGA 1E4DA 1IEMA 3GMWA 3CMZA 5FQ9A 2X01A 1ES5A 4E3LA 4S2IA 1DJCA 4DRTA 4B4XA 5CHJA 1NY0A 4JXSA 1PZOA 1XGIA 1AXBA 1JVJA 2Y91A 4HBUA 3M6BA 4GDBA 3ZG8B 4P87A 3N8RA 1EI5A 3OZHA 1NZUA 4N9KA 4PM9A 2BLSA 1K25A 1ONHA 1JTGA 4FSFA 4P85A 4CJNA 1ZC2A 4JF5A 4KZAA 2HPBA 1YMXA 2EX2A 4WMCA 5DTSA 1EROA 4KZ9A 3IF5A 2H0TA 1GA0A 1IYPA 1H8ZA 3BRMA 3BFDA 2H10A 3CG5A 4OPQA 3UE1A 2V2FF 1XGJA 3VOZA 2I72A 2IWDA 3FV7A 5CGWA 4WBGA 2C5WB 5DF7A 4OH0A 2Y2NA 5G18A 3LO7A 1MWRA 4P6BA 5AQ9A 3D4FA 2QMIA 3ZDJA 5E2EA 4WYYA 4X68A 4ZJ3A 1NRFA 3GRJA 3ZNYA 4OP5A 4KQQA 2UWXA 4LV0A 1FQGA 1GA9A 3O3VA 3HBRA 4N1HA 5A93A 2BG1A 1PW1A 3I7JA 4U0TA 5GLCA 1JWPA 1ALQA 2Q9MA 2ZQDA 4KG6A 3VOYA 3AGFA 4DE2A 1E3UD 2J9PA 2X02A 5J8XA 2XDMA 1NYYA 4IBXA 4MBFA 4Y0OA 3SS4A 2DRWA 3UE0A 1H8YA 1HVBA 2XR0A 1DJBA 4RA7A 3TSGA 5HAIA 5TFQA 4MNRA 2DNSA 3CZDA 1W8QA 3BFFA 5D3OA 2XH9A 1BLPA 4C6YA 1FSWA 5FQQA 2WUQA 3TG9A
chains in the Genus database with same CATH superfamily
3L9KA 2GX5A 1N9NA 2PU4A 1W79A 2DMWA 1EWZA 3MFXA 1J9MA 5IT5A 3G31A 5HD5A 4RVAA 1SKOB 5KZHA 1QMFA 3Q07A 3IX3A 5DF8A 3ULFA 1LSXA 4EUZA 5FQMA 3DAVA 1V9ZA 3N7WA 2R78A 2WKQA 4D60A 4H6JB 3V5MA 4K0XA 4QY5A 4KG2A 1YLYA 4KQOA 3ZG7B 4NKPA 1PNEA 3BQAA 5CECA 4O01A 1K57A 2Y2JA 5F1GA 3E4PA 1H0MA 4BL3A 3HUOA 5CEBA 4Y0UA 5CEDA 3CITA 4Y0TA 5GLAA 4JGQA 4JXGA 3T4KA 3E2LA 1OTIA 4WF0A 3UDXA 3CHWP 3IBRA 4KENB 1M6KA 5HD3A 4II7A 5U47A 1YPRA 4CPKA 2XGNA 2XEPA 3F1NA 3G6OA 5EVIC 5M18A 3UMEA 4NXGA 3GECA 4WZ5C 3IQAA 4ETZA 4JGOA 3ZYTA 4DXBA 2V0UA 3OC2A 5GL9A 3MZFA 2EA9A 3TW8A 2ZM2A 4GD8A 4X6TA 1KE4A 5GLBA 4OQGA 2KDKA 2V8CA 1GCEA 4FCFA 1M40A 2QYBA 4X56A 5HWTA 3M2KA 4KZBA 2A24A 2ZJ9A 1RGYA 5GHXA 1RGZA 2EX9A 4HJ6A 4OOLA 3ZG0A 1HLUP 3FYZA 4XXRA 1V9YA 4PPRA 3MZEA 2K7SA 2J7VA 2H28A 1W7FA 3W4OA 3C5AA 1NRJA 4DDSA 4PM5A 1VETB 2INWA 2ZQ7A 2X71A 4NXBA 2XA7S 1L0EA 4GD6A 1ZG6A 2XFTA 1ES2A 2KOIA 4R3BA 1PIOA 1XJ2A 1MWSA 3QP4A 1K55C 2JHEA 1DP6A 4GHIA 4GN2A 1Y54A 3IXBA 4ZTKA 2XA7M 1S1ZA 4HBTA 4IBRA 5CERA 3IWOA 2EFUA 3A3FA 2JKRM 1A0KA 4EQIA 3NC8A 4OOMA 2OAQ1 3GDIA 4Y15A 3GV9A 1L0DA 4OKPA 5HX9A 3MR0A 2Y2MA 4WMCD 3LIAA 3TRCA 3HJIA 5M1AA 3D9YA 5JYOA 1YLPA 4EESA 5KMWA 4ARZB 4S2JA 4N9LA 3RTYA 2VGKA 1S4SA 2OSUA 3ICYA 3P7NA 4HIAA 4OP8A 2HP9A 3BJNA 1FCMA 5BOHA 3H7WA 4PM7A 4XUZA 5E2FA 4LV3A 2HDSA 4HOIA 3IHAA 2HZ5A 3N6IA 4GOGA 5F68A 4XT2A 2GJ3A 4HEFA 2WKHA 1H5XA 3GQZA 4ETXA 3FKWA 3FWLA 1FCNA 3E0YA 4MMNA 3VE3A 4IVKA 1UGUA 4X1LA 1QMEA 3B47A 4R0QA 3HLWA 1XXMA 4E04A 1VEUA 3HL9A 1H3QA 1SDNA 2ZC7A 3IBJA 2OLVA 1IELA 4PKYA 3RH8B 1BYWA 3C7VA 5F69A 3HUMA 2WZZA 4S2NA 3G2ZA 1IKIA 3PBTA 4PM8A 3SZTA 2WKEA 3EGXC 4X1MA 4K0WA 4L0LA 3TOIA 1DJAA 3LFVA 3UPNA 2XRNA 2A24B 5FDSA 4K91A 1W8YA 4R3AA 4RYEA 5EUAA 2PR5A 4KQDA 2Y79A 3DTMA 3ZG9B 3ZVWA 3LR0A 2Y4AA 3ISGA 4ZJ1A 4HESA 4E3NA 1XP4A 3V50A 1LSVA 3BWLA 4BJPA 2V1AA 2I9VA 1ES4A 3VP1A 4YOFA 3ZHHA 4KUOA 4PMAA 3SH7A 3LYXA 4QHCA 4S2KA 4QU3A 3OCNA 2ZM8A 3BY8A 4E3JA 2VGLS 2ZC5B 1DP9A 1I2WA 4EBNA 5FA7A 1L0GA 1UWPX 4DXCA 1MKMA 4R4RA 3UB8A 1IEMA 5HDCA 3T4SA 4S2IA 1DJCA 4DRTA 4B4XA 1XGIA 1AXBA 4HBUA 4CLCC 2HF6A 5J3WA 3N8RA 1EI5A 1P97A 5AVEA 4PM9A 2BLSA 4CJNA 4KZAA 4WMCA 5DTSA 1EROA 1P9WA 1H8ZA 4ZRRA 3BRMA 2H10A 4OPQA 4MDZA 3VOZA 3FG8A 4DJ3A 2C5WB 4RQ9A 3UMDA 3DBAA 3H82B 4WYYA 1K0KA 4X68A 1NRFA 4ZJ3A 5FEGA 2UWXA 1D7EA 4WUJA 4LV0A 1NLZA 3MQOA 1OTEA 2BG1A 1PW1A 4U0TA 4Q0HA 5GLCA 1JWPA 1ALQA 3E98A 3KX0X 4KG6A 4EEUA 3VOYA 4DE2A 2J9PA 2X02A 3NJAA 1NYYA 4MBFA 4Y0OA 3SS4A 3UE0A 1DJBA 4RA7A 4I3JA 3CZDA 2A2LA 2WUQA 2ZMFA 4IUKA 3TG9A 4E3OA 1OT9A 2EX8A 2JKFA 5A91A 4I38A 4CLCD 3S7OA 2V0WA 3LIEA 2FFYA 3BYDA 1LSWA 1VQQA 1OTBA 3WS5A 1UWNX 3T4OA 4JF6A 4QY6A 3PYPA 2ZOHA 1XA1A 2V20A 4S2PA 2J3TD 3S1YA 1BLHA 3IT9A 1CI8A 3Q7VB 3FPWA 5IU1A 3LY3A 3BY9A 3MBZA 5C5KA 3T1SA 2HDUA 3MXRA 4GCZA 2HP5A 4ZDXA 3LEQA 5A90A 4EV4A 1YT4A 2WGWA 1H8MA 3KSHA 2HDQA 4NXEA 3UO9A 1SCWA 3PAEA 4HH2A 2NUTC 4ZAMA 2IWCA 2Y2GA 4B88A 2B02A 3JVVA 2W1TA 3DTKA 1FILA 5F1FA 1KDSA 4DJ2A 3PAGA 5J7EA 2G7UA 3UN7A 5J4EA 2ZLYA 4OPRA 1BSGA 2R9WA 3DTEA 4Y13A 1LI0A 2XFSA 4UQIS 1MWTA 1PFLA 3F1PB 3OPPA 2Z6CA 3A3EA 5DKLA 2PD8A 3SH9A 1ERQA 1ACFA 4EBLA 4R38A 4GZBA 3ZVTA 2O9CA 4C3QA 4WEKA 5FQIA 2JBFA 5KSHA 4EERA 5F83A 4EBPA 1GSXA 1TEMA 3G4PA 4HP9A 1CJFA 3BW6A 4UAAA 3G35A 4E3MA 3KSIA 2Q0OA 3MS6A 5HARA 2E8JA 2HP6A 2PU2A 4JKTA 3NDEA 3EQUA 3C2WA 1G6OA 1P9RA 5GHYA 4A5RA 3QP2A 4P0MA 3KSGA 5GHZA 4EEPA 3H82A 5FEFA 4I3IA 1OT6A 5EOOA 3O87A 2FH5A 1OTAA 3M6HA 2W3HA 3WRZA 1U60A 4GKUA 2VV7A 2XF3A 3VE4A 4MN6A 2JKRI 1W63Q 4KG5A 1K54A 1LL5A 1PYYA 4H6JA 1TS7A 3NCKA 4ESPA 3E2KA 1BT5A 4FTXA 1E3UA 4GW9A 4MEZA 3Q82A 2Y55A 5CXWA 2VLGA 4PKYG 3HLGA 3R7WB 3PBOA 1TS6A 2CC1A 3NIAA 1Y28A 3WS0A 2WAEA 1N4OA 3UDFA 2O99A 2IA2A 5EVIB 1FR1A 2XD1A 3T4LA 1WA9A 2JKGA 2WGIA 4S2LA 1F5MA 2VV6A 2OAP1 2M1CA 2R9XA 3LIBA 3ZQ5A 3GSGA 3H7WB 3IXHA 1MPLA 3KO6A 5L8MA 3PBSA 3RJUA 3T50A 2E8IA 3RXXA 4DE3A 3NOPC 3PXPA 1OMEA 5FATA 3PBQA 1DRMA 1IYQA 2P9VB 2V9AA 5A92A 3TJZC 2PRFA 5AQBA 2BTFP 5FSRA 2GZAA 3T12B 4EXOA 3R4KA 2W1TB 1KGFA 3UB9A 1T1CA 4GJ4A 5HZHA 2NUPC 3UNWA 4LRXC 3MXSA 1S66L 5EVID 4LRZE 1ERMA 1ESUA 3CPTB 1P0ZA 2WAFA 3GR2A 1J3WA 3WS4A 3O5YA 2PDRA 1TS0A 2G2UA 5FI7A 3HLEA 1BUEA 4MBHA 4HHDA 4HP4A 2VX8A 5DJTA 4P6ZS 5FQKA 3VMAA 4BENA 3HVFA 3Q81A 4Q0JA 1K6RA 3O86A 4I3AA 2Z2LB 5EM1A 1EW0A 3LY4A 1OJ5A 4OPYA 3RXWA 5LBRA 1YSPA 3V3SA 3C4OA 1O7EA 1VM1A 1NJ4A 5HW3A 4GS9A 2XLNA 2KX6A 4MCWA 1VHMA 1T1BA 3NOUC 1HZOA 2VK3A 3UY6A 3U2AA 2OOLA 3UB5P 2B5RA 4E3IA 3JPUA 1I2SA 2ZM0A 5HAQA 3ITBA 5IS1A 1YQSA 2JE5A 5TGFA 2ZQ9A 2H0YA 1RP5A 2Y2OA 2OWJA 3QHYA 3E4OA 5KSCA 4UA7A 4O0PA 3T1RA 1XFNA 4LCLA 2O9BA 1OJGA 4LRYC 4HJ4A 3BECA 2Y59A 2EWWA 5FQJA 5IHVA 4JXVA 3ZFZA 4YINA 1CF0A 3NOTC 4FD8A 1JTDA 3IXGA 3CMZA 5FQ9A 4I5SA 2Y91A 2GNXA 3QP6A 3LIFA 3RFBA 4N9KA 4FSFA 4JF5A 1S67L 3LR5A 2LB5A 3IS2A 1LL8A 4YNRA 4L9GA 1XGJA 2I72A 3FV7A 4OH0A 3LO7A 2QMIA 5E2EA 3GRJA 1VEUB 4KQQA 1FQGA 3HBRA 3W2ZA 5A93A 3I7JA 2Q9MA 3AGFA 4EW7A 2L0WA 1F2KA 2J3WA 1HVBA 2XR0A 4MNRA 2DNSA 3OOVA 5D3OA 2XH9A 1ONGA 1BLPA 1FSWA 4C6YA 1YAXA 2OWHA 3HCYA 4C75A 3ZCZA 4CLCB 1XKZA 4NXFA 4HQAA 4DMZA 1I5QA 2P9VA 5L2FA 4OLGA 4BWIA 3PBRA 3MKFA 1KOUA 3NI9A 2L1MA 3ZG5A 3IX8A 2KLIA 3IWQA 4R23A 3UB7A 1K4FA 1K54C 5EE8A 4WL9A 3F1NB 1SHVA 1PZPA 1SZVA 4LV2A 1T19A 4WM9A 3F1PA 2ZMVA 3MF0A 3DWKA 4EUVA 4E6WA 4WZ4A 2HJEA 4QB8A 2Y8HA 4K08A 1NZOA 4GLQA 2WZXA 2VGJA 5FAOA 2BASA 3BFGA 3WS1A 3VP3A 4JGPA 3NULA 3R7WA 3S7NA 2PBDP 3IS2B 2XK1A 3Q1FA 1LLBA 2G2WA 4E6XA 4MLLA 4Y7PA 4BQMA 4MN5A 3G30A 1ES3A 4FH4A 3MMHA 1YMSA 3LIDA 3QNBA 2PD7A 5HFOA 5DTKA 4GHIB 5CGXA 1STZA 1SKFA 3H9WA 1CI9A 1G28A 2EWVA 3EEHA 2V8FA 5AQ7A 3SW1A 4BBTA 4YWZA 1BZAA 3T1QB 2V1BA 3HLDA 4UA6A 1BTLA 3M2JA 4R3JA 4WLAA 4DDYA 1IFQA 2RCXA 5I94A 3C4PA 5JYPA 2HV1A 2JN7A 1CEGA 3IH8A 5CX7A 3Q7ZA 3PBNA 4YFMA 5TR7A 1YM1A 1KVLA 3LICA 2K31A 1OPXA 2XD5A 2A49A 3T4TA 5EECA 3V39A 1S6RA 4ME4A 3SOIA 2AVXA 4S2OA 2J8YA 5CGSA 1LI9A 3O88A 1T1AA 1MWUA 4DKIA 1IKGA 1E25A 4GS9B 2PYRA 4BL2A 1KGEA 4OPZA 4GB7A 3UE3A 4OONA 3KYZA 1IOUA 3A3JA 2L4RA 2OV5A 2C6WB 2IWBA 4HNBA 4KZ4A 3W4PA 2ZL1B 2O9AA 4NK3A 1TDLA 1XJ4A 5G4YA 2ZC4B 3BFCA 2W3DA 4IEDA 3GTCA 5E2HA 3D3OA 4Z9QA 3G2YA 4LENA 3SH8A 4EU0A 4Q0IA 2UV0E 1W63M 1D06A 2Q9NA 4NEED 4O8GA 5EVEA 3SS5A 4R70A 3UPPA 4JGRA 4EETB 1WE4A 4NG2A 1SDEA 3WS2A 2FFFB 4ID4A 1BLCA 3EOIA 1NWZA 4D2OA 2LB9A 1BULA 3SS3A 4BD0A 3MSHA 4FUWA 1KVMA 4HI4A 1AWIA 5F6AA 3IWIA 1K4EA 4RX2A 1Z09A 4B9OA 3MQ0A 2JKTI 1PRQA 1XPBA 5FAPA 2P04A 4FH2A 5HSQA 2XQZA 3JVUA 3K2NA 3OPRA 3A3DA 4FOFA 4ZJ2A 4EQ1A 4EWFA 2Z6DA 4R1GA 4HH3A 1WYCA 3P09A 1ZHHB 3CJMA 3OPLA 1YKDA 5EPHA 2WGWB 1ZTUA 1Y4OA 3CI6A 3G32A 5DFXA 3K3DA 4LCMA 5E2GA 1KGGA 1DY6A 5DKKA 1L0FA 5FASA 3CUEC 3QP1A 3UPOA 2VV8A 2PAVP 5L07A 4F94A 3Q7VA 2ZC3B 1KE3A 4MBKA 4JLFA 4OOYA 2XSSA 4QWOA 1PWGA 4U0XA 2QZ6A 5HPFA 5MC7A 3A3IA 2QPNA 2D01A 3D72A 2HGVA 4M4XA 5CHMA 1NLYA 3QNCA 2M7UA 5HWWA 4OLDA 5CTMA 1C3BA 1ZKJA 3IF6A 1PI5A 3EQVA 5FI2A 3LGOA 4CLCE 4WN5A 3GVBA 3MXQA 4IVIA 3ZNTA 4E3KA 1Q2PA 2W3GA 1K56D 3MQQA 3BLMA 1IYOA 5HWVA 1K38A 3OLOA 4M3KA 3VSLA 2V1ZA 2W1RA 2Y2PA 2ZQ8A 3V3RA 4O7DA 2VEAA 1S4RA 5FI6A 5TBMA 2GDNA 3MJQA 1F98A 1MXOA 1CEFA 2QKPA 3WRTA 3V67A 2Z2MB 2O0YA 2ZQAA 4GDNA 4B93A 1MKIA 4JBFA 1KE0A 3VV4A 3UDIA 4S2MA 4F3LB 5HDSA 1E4DA 3GMWA 2VGLM 1NY0A 4JXSA 1PZOA 3ZG8B 4P87A 4CQHA 5A8BA 3S7QA 1NZUA 3BQ8A 1K25A 2EX2A 5FL3A 3IF5A 2H0TA 1GA0A 1JNUA 3BFDA 3UE1A 1VB6A 2IWDA 3KSFA 4WBGA 5DF7A 1TS8A 5HPIA 3T4QA 3D4FA 5K5BA 3ZNYA 2J80A 4N1HA 3CPTA 3U4LP 4R6LA 2M7VA 3C30A 5DFYA 5J8XA 2DRWA 1H8YA 5HAIA 3QP8A 1W8QA 2WYXA 5FQQA 4KZ7A 5L09A 2A3UA 3KYEA 3LUQA 4UHUA 4JPMA 1HD8A 2ZMAA 3LR4A 5CRFA 4RX3A 1XX2A 1YLJA 1MBLA 5EV0A 3EWKA 2W27A 3W4QA 3UE6A 3FC7A 4CLCA 2PBYA 3B33A 3IXDA 4WELA 3JYIA 2H5SA 3WWXA 3OPHA 3MKEA 3P98A 3FZCA 3LI8A 5CHUA 4KZ5A 3C7UA 2HJ9C 5AJGA 5HDDA 1G5UA 2EXAA 3IX4A 5EM0A 1WYBA 1FIKA 2ZL1A 1N9LA 4LFUA 1K6SA 1FCOA 4KUKA 2ACGA 3S4XA 3E4QA 4JF4A 2JKTM 4BBVA 1TVFA 3FKVA 3BM6A 1GSVA 1XA7A 5CTNA 3CAXA 4X55A 3LCEA 4KZ8A 1IYSA 2WGVA 4GNUA 4U3TA 3HUNA 2D02A 4Y3IA 1PWCA 4PHTA 2YKFA 4L9FA 2QJ5A 2WK0A 4BD1A 2PR6A 3BFEA 3IHBA 3VFFA 4N1XA 1S0WA 1F9IA 2B95A 3OCLA 1OTDA 1YLWA 1XJ3A 2FZ0A 4BLMA 3HLFA 1GHPA 3S22A 2ZOIA 1HTZA 1L3LA 2ZQCA 1G6AA 4Q8IA 4Y17A 1KDWA 3N8LA 4XT2B 3W8KA 1PI4A 3VP0A 1ZG4A 3BLSA 2EFXA 4OQHA 1ODVA 1BLSA 4LV1A 3AGDA 1JWVA 1T18A 5KIZA 4LGWA 4ARZA 3VP4A 2WKRA 2HDRA 4N92A 1K57C 2Y2IA 2EXBA 3VP2A 2Y2HA 3EEAA 2RL3A 4UEYA 1XFQA 1CQAA 1PW8A 4DF6A 4BBUA 4PM6A 2W0NA 4OQ0A 5EFWA 5HL1A 2Y2LA 5GLDA 5DF9A 2JC7A 4H8RA 5HAPA 2ZBBA 2PHYA 3DWZA 4NETA 4P6ZM 2Y2KA 2W3FA 4IJGA 3VFHA 4BMWA 1D1JA 3LEZA 4LLOB 1XJ6A 2QJ7A 2P7JA 4G3WA 5EVLA 1NYMA 5M19A 3HLBA 5AQAA 3DTIA 3QP5A 2OLUA 1LL9A 3KYQA 2VKSA 1K55A 1YLZA 1G68A 2MJ6A 4Z1WA 1GHIA 4OVDA 4WEJA 1X0OA 4IUHA 3AGEA 4DE0A 4OQIA 5DVAA 3CUEA 1Q2QA 5E43A 3T4JA 4MN7A 2WKPA 1K56A 3FPVA 3N4IA 2YKHA 3LI9A 4LPZA 2ZD8A 3IF6B 5FDHA 2QWSA 3C8CA 4QPRA 5FAQA 4Y5FA 3CLOA 2XROA 4X69A 3PHYA 4HY8A 1GSWA 3IF6C 5I5LA 3F1OB 3BEBA 1YLTA 4DE1A 1DP8A 1MZUA 3HREA 1L2SA 3IH9A 2J9OA 5EOEA 4PAUA 3B42A 3MZDA 2VZWA 3L7HA 3NHQA 5DTTA 4R4SA 4XUXA 1RCJA 3ITAA 4B4ZA 2J3TC 3G34A 3B3XA 1MY8A 4HJ3A 1CK3A 5AVFA 3K3CA 5L10A 3HJKA 4WZ5A 3S7PA 2WADA 1FOFA 4S2NC 2P74A 3CWFA 4KQRA 4G3KA 1VETA 4X53A 3MFDA 4I39A 2CMNA 5HL6A 2JCHA 1O07A 1LHYA 1LT0A 2PT7A 1N9BA 4QJGA 3A0RA 1NXYA 3OBFA 3NDGA 1ESIA 4ZBEA 3ZGAB 1N9OA 3HLCA 4L9EA 3DW0A 5G4ZA 5TBMB 1TDGA 3A0VA 3N8SA 3VOLA 1Z6FA 2VJWA 3VSKA 2WKIA 2W3EA 1W5DA 3TE8A 3NECA 1TF1A 3NY4A 5DJUA 1SKOA 4UA9A 4KZ3A 3NBLA 2PYPA 1FSYA 1MC0A 3F1OA 5EVIA 1JWZA 3C38A 3T1XA 4IHQA 4KZ6A 2QHKA 2P08A 1PWDA 3PTEA 2DCFA 3A0SA 2ZC6B 5F82A 4QD4A 4JXWA 2EX6A 3UB6A 2Y2QA 1FR6A 1GHMA 2X01A 1ES5A 4E3LA 3EGDC 5CHJA 2K2NA 1JVJA 3M6BA 4GDBA 3P01A 5F5YA 3PR6A 3OZHA 4G3VA 4AFIA 1ONHA 1JTGA 4P85A 1ZC2A 2HPBA 1YMXA 4KZ9A 1IYPA 3CG5A 2V2FF 5CGWA 2Y2NA 5G18A 1MWRA 4P6BA 5AQ9A 4DN0A 3ZDJA 4Y2FA 4UQIM 4OP5A 4X25A 2B18A 3O3VA 1GA9A 3LR3A 1S1YA 2ZQDA 2VA0A 1E3UD 4F3LA 2XDMA 4IBXA 1TD5A 1YSQA 5TJJA 3TSGA 5TFQA 3BFFA
chains in the Genus database with same CATH topology
4C75A 3ZCZA 4E3OA 1XKZA 2EX8A 5A91A 2PU4A 2A3UA 1I5QA 2P9VA 5L2FA 4OLGA 4UHUA 1W79A 3PBRA 4JPMA 3MKFA 2FFYA 1EWZA 1HD8A 3BYDA 2ZMAA 1J9MA 5CRFA 4RX3A 3NI9A 3G31A 1VQQA 3WS5A 3ZG5A 1XX2A 1YLJA 1MBLA 4RVAA 3IWQA 4R23A 4JF6A 4QY6A 3W4QA 1K4FA 1K54C 5KZHA 1QMFA 1XA1A 3Q07A 2V20A 5EE8A 4S2PA 1SHVA 3S1YA 1PZPA 5DF8A 1BLHA 3IT9A 4LV2A 4WM9A 2PBYA 3IXDA 4WELA 3JYIA 1CI8A 3Q7VB 3DWKA 2H5SA 3WWXA 3LY3A 3OPHA 4E6WA 3MKEA 4WZ4A 3P98A 4QB8A 4EUZA 5FQMA 3FZCA 5CHUA 3MBZA 3N7WA 4KZ5A 1NZOA 3C7UA 2EXAA 2WZXA 2VGJA 5FAOA 4K0XA 1WYBA 2HDUA 3V5MA 4QY5A 4KG2A 1YLYA 3BFGA 3MXRA 3WS1A 1K6SA 4KQOA 2HP5A 3VP3A 3ZG7B 1FCOA 4ZDXA 3S4XA 4JF4A 5CECA 5A90A 2XK1A 3Q1FA 1K57A 2Y2JA 1TVFA 3FKVA 5F1GA 1YT4A 4EV4A 2WGWA 1LLBA 2G2WA 3HUOA 3BM6A 2HDQA 4BL3A 4Y0UA 4MLLA 1XA7A 4Y7PA 4BQMA 4E6XA 5CEBA 5CTNA 3G30A 5CEDA 3UO9A 1SCWA 3PAEA 4Y0TA 4X55A 5GLAA 4JXGA 3LCEA 4KZ8A 1IYSA 1ES3A 3E2LA 2WGVA 4GNUA 4FH4A 4ZAMA 2IWCA 2Y2GA 4U3TA 4B88A 3HUNA 1YMSA 3UDXA 1PWCA 3QNBA 5F1FA 5HFOA 5DTKA 1KDSA 2WK0A 4KENB 5CGXA 1M6KA 3PAGA 4BD1A 3BFEA 3IHBA 3VFFA 1SKFA 4N1XA 3UN7A 2ZLYA 1S0WA 4OPRA 5U47A 1BSGA 2R9WA 4CPKA 2XGNA 2XEPA 3OCLA 5EVIC 1LI0A 2XFSA 5M18A 1MWTA 1CI9A 1YLWA 3OPPA 3A3EA 4WZ5C 3SH9A 1ERQA 3IQAA 4BLMA 4EBLA 3HLFA 4DXBA 1GHPA 3S22A 3OC2A 5GL9A 4GZBA 3ZVTA 5AQ7A 1HTZA 3MZFA 4C3QA 4WEKA 2ZQCA 5FQIA 1BZAA 2ZM2A 3HLDA 4GD8A 4X6TA 2JBFA 1KE4A 5KSHA 1G6AA 5GLBA 4OQGA 4UA6A 1BTLA 3M2JA 4R3JA 5F83A 4EBPA 4Q8IA 4DDYA 1KDWA 1TEMA 3G4PA 3N8LA 1GCEA 3W8KA 1PI4A 4FCFA 3VP0A 2RCXA 4UAAA 5I94A 3C4PA 5JYPA 1M40A 1ZG4A 3BLSA 2EFXA 3G35A 1CEGA 4E3MA 3IH8A 4OQHA 3Q7ZA 3PBNA 4YFMA 4X56A 1BLSA 4LV1A 3AGDA 5TR7A 1YM1A 5HARA 1JWVA 3M2KA 4KZBA 1KVLA 2HP6A 2PU2A 4JKTA 3NDEA 3EQUA 3VP4A 2ZJ9A 5GHYA 2HDRA 4N92A 4A5RA 1RGYA 5GHXA 1RGZA 2XD5A 2EX9A 4P0MA 2A49A 4OOLA 5EECA 5GHZA 1K57C 3ZG0A 3V39A 2Y2IA 2EXBA 3FYZA 4XXRA 4PPRA 3VP2A 2Y2HA 3MZEA 1S6RA 2J7VA 2RL3A 1W7FA 3SOIA 3W4OA 3C5AA 4S2OA 5EOOA 3O87A 2J8YA 5CGSA 1LI9A 1PW8A 3O88A 4DF6A 1MWUA 4PM6A 4OQ0A 4DDSA 1IKGA 4DKIA 3M6HA 4PM5A 3WRZA 5HL1A 2Y2LA 5GLDA 1E25A 5DF9A 1U60A 2JC7A 4BL2A 2ZQ7A 2X71A 4H8RA 5HAPA 1KGEA 4GKUA 1L0EA 4GD6A 4OPZA 1ZG6A 2XFTA 2XF3A 1ES2A 3DWZA 4GB7A 3UE3A 4NETA 4R3BA 1PIOA 4OONA 2Y2KA 3A3JA 1MWSA 2OV5A 3VFHA 2C6WB 1K55C 3LEZA 2IWBA 4KG5A 4KZ4A 3W4PA 4NK3A 1K54A 1TDLA 1LL5A 1PYYA 2ZC4B 4GN2A 1Y54A 3BFCA 3IXBA 4IEDA 5EVLA 4ZTKA 1NYMA 3NCKA 3GTCA 5M19A 5E2HA 3HLBA 5AQAA 3E2KA 4HBTA 1BT5A 4Z9QA 4IBRA 1E3UA 5CERA 2OLUA 1LL9A 3G2YA 4LENA 3IWOA 1K55A 4MEZA 1YLZA 2EFUA 1G68A 3A3FA 2Y55A 3Q82A 5CXWA 4EQIA 1GHIA 3NC8A 3SH8A 4OOMA 3HLGA 4OVDA 4WEJA 3PBOA 2WYXA 3AGEA 2CC1A 3NIAA 3WS0A 4DE0A 2WAEA 4OQIA 2Q9NA 4KZ7A 1N4OA 3GV9A 5DVAA 1L0DA 4OKPA 3UDFA 1Q2QA 5E43A 5EVIB 3SS5A 3UPPA 1FR1A 5HX9A 2XD1A 1K56A 3N4IA 4S2LA 2WGIA 2Y2MA 4WMCD 1WE4A 1SDEA 3WS2A 2FFFB 2R9XA 4ID4A 1BLCA 5M1AA 2ZD8A 5JYOA 1YLPA 3GSGA 3IXHA 4D2OA 3IF6B 5FDHA 1MPLA 5KMWA 1BULA 4S2JA 3SS3A 4BD0A 3PBSA 3RJUA 4N9LA 1KVMA 5FAQA 2E8IA 3RXXA 4DE3A 2VGKA 3IWIA 1K4EA 4RX2A 2OSUA 1ONGA 1OMEA 4X69A 5FATA 3PBQA 4OP8A 1IYQA 2P9VB 2HP9A 5A92A 1FCMA 5BOHA 1XPBA 3IF6C 5FAPA 4PM7A 3BEBA 1YLTA 4XUZA 5E2FA 4FH2A 4LV3A 2HDSA 5AQBA 2XQZA 3IHAA 4DE1A 5FSRA 3N6IA 4GOGA 3HREA 1L2SA 4HEFA 3IH9A 2J9OA 3OPRA 3A3DA 5EOEA 1KGFA 2WKHA 4ZJ2A 3MZDA 4EWFA 1H5XA 3GQZA 4R1GA 3FKWA 3UNWA 3FWLA 3MXSA 1WYCA 5DTTA 3P09A 4R4SA 1FCNA 5EVID 4XUXA 1RCJA 1ERMA 1ESUA 4IVKA 3ITAA 3CJMA 4B4ZA 3OPLA 3G34A 2WAFA 3B3XA 3GR2A 1MY8A 1QMEA 5EPHA 2WGWB 3WS4A 1CK3A 4R0QA 2G2UA 3G32A 5FI7A 3HLEA 1BUEA 4MBHA 3HLWA 4WZ5A 1XXMA 2WADA 1FOFA 3HL9A 4S2NC 4LCMA 5E2GA 1SDNA 2P74A 2ZC7A 1KGGA 5FQKA 4KQRA 1DY6A 1L0FA 2OLVA 3VMAA 5FASA 1IELA 4BENA 3HVFA 3Q81A 3MFDA 4X53A 1K6RA 3O86A 3C7VA 3HUMA 2WZZA 2Z2LB 3UPOA 4S2NA 2JCHA 3G2ZA 1IKIA 3PBTA 4PM8A 4F94A 3Q7VA 2ZC3B 3LY4A 1O07A 1LHYA 1KE3A 4MBKA 4JLFA 2WKEA 1N9BA 4OOYA 4QJGA 1PWGA 4K0WA 4OPYA 1NXYA 4U0XA 4L0LA 3RXWA 3TOIA 2QZ6A 3V3SA 3NDGA 3C4OA 1ESIA 1DJAA 1O7EA 4ZBEA 1VM1A 3ZGAB 3A3IA 1NJ4A 3UPNA 5HW3A 2QPNA 3HLCA 2XLNA 3DW0A 4K91A 5CHMA 1W8YA 3QNCA 1TDGA 4RYEA 5EUAA 3N8SA 4OLDA 1HZOA 5CTMA 1Z6FA 1C3BA 3VSKA 3DTMA 2WKIA 3UY6A 3ZG9B 3ZVWA 1ZKJA 3IF6A 1PI5A 3EQVA 5FI2A 2Y4AA 1W5DA 3ISGA 3GVBA 4ZJ1A 4IVIA 4HESA 3ZNTA 3NY4A 2B5RA 4E3KA 4E3IA 1Q2PA 1XP4A 4E3NA 4UA9A 3V50A 4KZ3A 3NBLA 1I2SA 1K56D 2ZM0A 1FSYA 3BLMA 4BJPA 1IYOA 3ITBA 5HAQA 1K38A 5EVIA 1YQSA 2JE5A 1JWZA 5TGFA 2ZQ9A 2H0YA 1ES4A 3VP1A 1RP5A 2Y2OA 3ZHHA 4M3KA 4KZ6A 3VSLA 4PMAA 2V1ZA 3SH7A 2Y2PA 2ZQ8A 3V3RA 3QHYA 4O7DA 4QHCA 4S2KA 4QU3A 5FI6A 5KSCA 2GDNA 4UA7A 3OCNA 2ZM8A 4E3JA 1MXOA 2ZC5B 1CEFA 4LCLA 1PWDA 1I2WA 3PTEA 3WRTA 4EBNA 2DCFA 3BECA 5FA7A 2Y59A 1L0GA 5FQJA 2Z2MB 5IHVA 2ZC6B 5F82A 4DXCA 2ZQAA 4GDNA 4JXVA 1MKIA 4JBFA 4QD4A 1KE0A 2EX6A 4JXWA 4YINA 3ZFZA 4R4RA 3UDIA 4FD8A 2Y2QA 4S2MA 1JTDA 1FR6A 1GHMA 3IXGA 1E4DA 1IEMA 3GMWA 3CMZA 5FQ9A 2X01A 1ES5A 4E3LA 4S2IA 1DJCA 4DRTA 4B4XA 5CHJA 1NY0A 4JXSA 1PZOA 1XGIA 1AXBA 1JVJA 2Y91A 4HBUA 3M6BA 4GDBA 3ZG8B 4P87A 3N8RA 1EI5A 3OZHA 1NZUA 4N9KA 4PM9A 2BLSA 1K25A 1ONHA 1JTGA 4FSFA 4P85A 4CJNA 1ZC2A 4JF5A 4KZAA 2HPBA 1YMXA 2EX2A 4WMCA 5DTSA 1EROA 4KZ9A 3IF5A 2H0TA 1GA0A 1IYPA 1H8ZA 3BRMA 3BFDA 2H10A 3CG5A 4OPQA 3UE1A 2V2FF 1XGJA 3VOZA 2I72A 2IWDA 3FV7A 5CGWA 4WBGA 2C5WB 5DF7A 4OH0A 2Y2NA 5G18A 3LO7A 1MWRA 4P6BA 5AQ9A 3D4FA 2QMIA 3ZDJA 5E2EA 4WYYA 4X68A 4ZJ3A 1NRFA 3GRJA 3ZNYA 4OP5A 4KQQA 2UWXA 4LV0A 1FQGA 1GA9A 3O3VA 3HBRA 4N1HA 5A93A 2BG1A 1PW1A 3I7JA 4U0TA 5GLCA 1JWPA 1ALQA 2Q9MA 2ZQDA 4KG6A 3VOYA 3AGFA 4DE2A 1E3UD 2J9PA 2X02A 5J8XA 2XDMA 1NYYA 4IBXA 4MBFA 4Y0OA 3SS4A 2DRWA 3UE0A 1H8YA 1HVBA 2XR0A 1DJBA 4RA7A 3TSGA 5HAIA 5TFQA 4MNRA 2DNSA 3CZDA 1W8QA 3BFFA 5D3OA 2XH9A 1BLPA 4C6YA 1FSWA 5FQQA 2WUQA 3TG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C75 A;  3ZCZ A;  4E3O A;  1XKZ A;  2EX8 A;  5A91 A;  2PU4 A;  2A3U A;  1I5Q A;  2P9V A;  5L2F A;  4OLG A;  4UHU A;  1W79 A;  3PBR A;  4JPM A;  3MKF A;  2FFY A;  1EWZ A;  1HD8 A;  3BYD A;  2ZMA A;  1J9M A;  5CRF A;  4RX3 A;  3NI9 A;  3G31 A;  1VQQ A;  3WS5 A;  3ZG5 A;  1XX2 A;  1YLJ A;  1MBL A;  4RVA A;  3IWQ A;  4R23 A;  4JF6 A;  4QY6 A;  3W4Q A;  1K4F A;  1K54 C;  5KZH A;  1QMF A;  1XA1 A;  3Q07 A;  2V20 A;  5EE8 A;  4S2P A;  1SHV A;  3S1Y A;  1PZP A;  5DF8 A;  1BLH A;  3IT9 A;  4LV2 A;  4WM9 A;  2PBY A;  3IXD A;  4WEL A;  3JYI A;  1CI8 A;  3Q7V B;  3DWK A;  2H5S A;  3WWX A;  3LY3 A;  3OPH A;  4E6W A;  3MKE A;  4WZ4 A;  3P98 A;  4QB8 A;  4EUZ A;  5FQM A;  3FZC A;  5CHU A;  3MBZ A;  3N7W A;  4KZ5 A;  1NZO A;  3C7U A;  2EXA A;  2WZX A;  2VGJ A;  5FAO A;  4K0X A;  1WYB A;  2HDU A;  3V5M A;  4QY5 A;  4KG2 A;  1YLY A;  3BFG A;  3MXR A;  3WS1 A;  1K6S A;  4KQO A;  2HP5 A;  3VP3 A;  3ZG7 B;  1FCO A;  4ZDX A;  3S4X A;  4JF4 A;  5CEC A;  5A90 A;  2XK1 A;  3Q1F A;  1K57 A;  2Y2J A;  1TVF A;  3FKV A;  5F1G A;  1YT4 A;  4EV4 A;  2WGW A;  1LLB A;  2G2W A;  3HUO A;  3BM6 A;  2HDQ A;  4BL3 A;  4Y0U A;  4MLL A;  1XA7 A;  4Y7P A;  4BQM A;  4E6X A;  5CEB A;  5CTN A;  3G30 A;  5CED A;  3UO9 A;  1SCW A;  3PAE A;  4Y0T A;  4X55 A;  5GLA A;  4JXG A;  3LCE A;  4KZ8 A;  1IYS A;  1ES3 A;  3E2L A;  2WGV A;  4GNU A;  4FH4 A;  4ZAM A;  2IWC A;  2Y2G A;  4U3T A;  4B88 A;  3HUN A;  1YMS A;  3UDX A;  1PWC A;  3QNB A;  5F1F A;  5HFO A;  5DTK A;  1KDS A;  2WK0 A;  4KEN B;  5CGX A;  1M6K A;  3PAG A;  4BD1 A;  3BFE A;  3IHB A;  3VFF A;  1SKF A;  4N1X A;  3UN7 A;  2ZLY A;  1S0W A;  4OPR A;  5U47 A;  1BSG A;  2R9W A;  4CPK A;  2XGN A;  2XEP A;  3OCL A;  5EVI C;  1LI0 A;  2XFS A;  5M18 A;  1MWT A;  1CI9 A;  1YLW A;  3OPP A;  3A3E A;  4WZ5 C;  3SH9 A;  1ERQ A;  3IQA A;  4BLM A;  4EBL A;  3HLF A;  4DXB A;  1GHP A;  3S22 A;  3OC2 A;  5GL9 A;  4GZB A;  3ZVT A;  5AQ7 A;  1HTZ A;  3MZF A;  4C3Q A;  4WEK A;  2ZQC A;  5FQI A;  1BZA A;  2ZM2 A;  3HLD A;  4GD8 A;  4X6T A;  2JBF A;  1KE4 A;  5KSH A;  1G6A A;  5GLB A;  4OQG A;  4UA6 A;  1BTL A;  3M2J A;  4R3J A;  5F83 A;  4EBP A;  4Q8I A;  4DDY A;  1KDW A;  1TEM A;  3G4P A;  3N8L A;  1GCE A;  3W8K A;  1PI4 A;  4FCF A;  3VP0 A;  2RCX A;  4UAA A;  5I94 A;  3C4P A;  5JYP A;  1M40 A;  1ZG4 A;  3BLS A;  2EFX A;  3G35 A;  1CEG A;  4E3M A;  3IH8 A;  4OQH A;  3Q7Z A;  3PBN A;  4YFM A;  4X56 A;  1BLS A;  4LV1 A;  3AGD A;  5TR7 A;  1YM1 A;  5HAR A;  1JWV A;  3M2K A;  4KZB A;  1KVL A;  2HP6 A;  2PU2 A;  4JKT A;  3NDE A;  3EQU A;  3VP4 A;  2ZJ9 A;  5GHY A;  2HDR A;  4N92 A;  4A5R A;  1RGY A;  5GHX A;  1RGZ A;  2XD5 A;  2EX9 A;  4P0M A;  2A49 A;  4OOL A;  5EEC A;  5GHZ A;  1K57 C;  3ZG0 A;  3V39 A;  2Y2I A;  2EXB A;  3FYZ A;  4XXR A;  4PPR A;  3VP2 A;  2Y2H A;  3MZE A;  1S6R A;  2J7V A;  2RL3 A;  1W7F A;  3SOI A;  3W4O A;  3C5A A;  4S2O A;  5EOO A;  3O87 A;  2J8Y A;  5CGS A;  1LI9 A;  1PW8 A;  3O88 A;  4DF6 A;  1MWU A;  4PM6 A;  4OQ0 A;  4DDS A;  1IKG A;  4DKI A;  3M6H A;  4PM5 A;  3WRZ A;  5HL1 A;  2Y2L A;  5GLD A;  1E25 A;  5DF9 A;  1U60 A;  2JC7 A;  4BL2 A;  2ZQ7 A;  2X71 A;  4H8R A;  5HAP A;  1KGE A;  4GKU A;  1L0E A;  4GD6 A;  4OPZ A;  1ZG6 A;  2XFT A;  2XF3 A;  1ES2 A;  3DWZ A;  4GB7 A;  3UE3 A;  4NET A;  4R3B A;  1PIO A;  4OON A;  2Y2K A;  3A3J A;  1MWS A;  2OV5 A;  3VFH A;  2C6W B;  1K55 C;  3LEZ A;  2IWB A;  4KG5 A;  4KZ4 A;  3W4P A;  4NK3 A;  1K54 A;  1TDL A;  1LL5 A;  1PYY A;  2ZC4 B;  4GN2 A;  1Y54 A;  3BFC A;  3IXB A;  4IED A;  5EVL A;  4ZTK A;  1NYM A;  3NCK A;  3GTC A;  5M19 A;  5E2H A;  3HLB A;  5AQA A;  3E2K A;  4HBT A;  1BT5 A;  4Z9Q A;  4IBR A;  1E3U A;  5CER A;  2OLU A;  1LL9 A;  3G2Y A;  4LEN A;  3IWO A;  1K55 A;  4MEZ A;  1YLZ A;  2EFU A;  1G68 A;  3A3F A;  2Y55 A;  3Q82 A;  5CXW A;  4EQI A;  1GHI A;  3NC8 A;  3SH8 A;  4OOM A;  3HLG A;  4OVD A;  4WEJ A;  3PBO A;  2WYX A;  3AGE A;  2CC1 A;  3NIA A;  3WS0 A;  4DE0 A;  2WAE A;  4OQI A;  2Q9N A;  4KZ7 A;  1N4O A;  3GV9 A;  5DVA A;  1L0D A;  4OKP A;  3UDF A;  1Q2Q A;  5E43 A;  5EVI B;  3SS5 A;  3UPP A;  1FR1 A;  5HX9 A;  2XD1 A;  1K56 A;  3N4I A;  4S2L A;  2WGI A;  2Y2M A;  4WMC D;  1WE4 A;  1SDE A;  3WS2 A;  2FFF B;  2R9X A;  4ID4 A;  1BLC A;  5M1A A;  2ZD8 A;  5JYO A;  1YLP A;  3GSG A;  3IXH A;  4D2O A;  3IF6 B;  5FDH A;  1MPL A;  5KMW A;  1BUL A;  4S2J A;  3SS3 A;  4BD0 A;  3PBS A;  3RJU A;  4N9L A;  1KVM A;  5FAQ A;  2E8I A;  3RXX A;  4DE3 A;  2VGK A;  3IWI A;  1K4E A;  4RX2 A;  2OSU A;  1ONG A;  1OME A;  4X69 A;  5FAT A;  3PBQ A;  4OP8 A;  1IYQ A;  2P9V B;  2HP9 A;  5A92 A;  1FCM A;  5BOH A;  1XPB A;  3IF6 C;  5FAP A;  4PM7 A;  3BEB A;  1YLT A;  4XUZ A;  5E2F A;  4FH2 A;  4LV3 A;  2HDS A;  5AQB A;  2XQZ A;  3IHA A;  4DE1 A;  5FSR A;  3N6I A;  4GOG A;  3HRE A;  1L2S A;  4HEF A;  3IH9 A;  2J9O A;  3OPR A;  3A3D A;  5EOE A;  1KGF A;  2WKH A;  4ZJ2 A;  3MZD A;  4EWF A;  1H5X A;  3GQZ A;  4R1G A;  3FKW A;  3UNW A;  3FWL A;  3MXS A;  1WYC A;  5DTT A;  3P09 A;  4R4S A;  1FCN A;  5EVI D;  4XUX A;  1RCJ A;  1ERM A;  1ESU A;  4IVK A;  3ITA A;  3CJM A;  4B4Z A;  3OPL A;  3G34 A;  2WAF A;  3B3X A;  3GR2 A;  1MY8 A;  1QME A;  5EPH A;  2WGW B;  3WS4 A;  1CK3 A;  4R0Q A;  2G2U A;  3G32 A;  5FI7 A;  3HLE A;  1BUE A;  4MBH A;  3HLW A;  4WZ5 A;  1XXM A;  2WAD A;  1FOF A;  3HL9 A;  4S2N C;  4LCM A;  5E2G A;  1SDN A;  2P74 A;  2ZC7 A;  1KGG A;  5FQK A;  4KQR A;  1DY6 A;  1L0F A;  2OLV A;  3VMA A;  5FAS A;  1IEL A;  4BEN A;  3HVF A;  3Q81 A;  3MFD A;  4X53 A;  1K6R A;  3O86 A;  3C7V A;  3HUM A;  2WZZ A;  2Z2L B;  3UPO A;  4S2N A;  2JCH A;  3G2Z A;  1IKI A;  3PBT A;  4PM8 A;  4F94 A;  3Q7V A;  2ZC3 B;  3LY4 A;  1O07 A;  1LHY A;  1KE3 A;  4MBK A;  4JLF A;  2WKE A;  1N9B A;  4OOY A;  4QJG A;  1PWG A;  4K0W A;  4OPY A;  1NXY A;  4U0X A;  4L0L A;  3RXW A;  3TOI A;  2QZ6 A;  3V3S A;  3NDG A;  3C4O A;  1ESI A;  1DJA A;  1O7E A;  4ZBE A;  1VM1 A;  3ZGA B;  3A3I A;  1NJ4 A;  3UPN A;  5HW3 A;  2QPN A;  3HLC A;  2XLN A;  3DW0 A;  4K91 A;  5CHM A;  1W8Y A;  3QNC A;  1TDG A;  4RYE A;  5EUA A;  3N8S A;  4OLD A;  1HZO A;  5CTM A;  1Z6F A;  1C3B A;  3VSK A;  3DTM A;  2WKI A;  3UY6 A;  3ZG9 B;  3ZVW A;  1ZKJ A;  3IF6 A;  1PI5 A;  3EQV A;  5FI2 A;  2Y4A A;  1W5D A;  3ISG A;  3GVB A;  4ZJ1 A;  4IVI A;  4HES A;  3ZNT A;  3NY4 A;  2B5R A;  4E3K A;  4E3I A;  1Q2P A;  1XP4 A;  4E3N A;  4UA9 A;  3V50 A;  4KZ3 A;  3NBL A;  1I2S A;  1K56 D;  2ZM0 A;  1FSY A;  3BLM A;  4BJP A;  1IYO A;  3ITB A;  5HAQ A;  1K38 A;  5EVI A;  1YQS A;  2JE5 A;  1JWZ A;  5TGF A;  2ZQ9 A;  2H0Y A;  1ES4 A;  3VP1 A;  1RP5 A;  2Y2O A;  3ZHH A;  4M3K A;  4KZ6 A;  3VSL A;  4PMA A;  2V1Z A;  3SH7 A;  2Y2P A;  2ZQ8 A;  3V3R A;  3QHY A;  4O7D A;  4QHC A;  4S2K A;  4QU3 A;  5FI6 A;  5KSC A;  2GDN A;  4UA7 A;  3OCN A;  2ZM8 A;  4E3J A;  1MXO A;  2ZC5 B;  1CEF A;  4LCL A;  1PWD A;  1I2W A;  3PTE A;  3WRT A;  4EBN A;  2DCF A;  3BEC A;  5FA7 A;  2Y59 A;  1L0G A;  5FQJ A;  2Z2M B;  5IHV A;  2ZC6 B;  5F82 A;  4DXC A;  2ZQA A;  4GDN A;  4JXV A;  1MKI A;  4JBF A;  4QD4 A;  1KE0 A;  2EX6 A;  4JXW A;  4YIN A;  3ZFZ A;  4R4R A;  3UDI A;  4FD8 A;  2Y2Q A;  4S2M A;  1JTD A;  1FR6 A;  1GHM A;  3IXG A;  1E4D A;  1IEM A;  3GMW A;  3CMZ A;  5FQ9 A;  2X01 A;  1ES5 A;  4E3L A;  4S2I A;  1DJC A;  4DRT A;  4B4X A;  5CHJ A;  1NY0 A;  4JXS A;  1PZO A;  1XGI A;  1AXB A;  1JVJ A;  2Y91 A;  4HBU A;  3M6B A;  4GDB A;  3ZG8 B;  4P87 A;  3N8R A;  1EI5 A;  3OZH A;  1NZU A;  4N9K A;  4PM9 A;  2BLS A;  1K25 A;  1ONH A;  1JTG A;  4FSF A;  4P85 A;  4CJN A;  1ZC2 A;  4JF5 A;  4KZA A;  2HPB A;  1YMX A;  2EX2 A;  4WMC A;  5DTS A;  1ERO A;  4KZ9 A;  3IF5 A;  2H0T A;  1GA0 A;  1IYP A;  1H8Z A;  3BRM A;  3BFD A;  2H10 A;  3CG5 A;  4OPQ A;  3UE1 A;  2V2F F;  1XGJ A;  3VOZ A;  2I72 A;  2IWD A;  3FV7 A;  5CGW A;  4WBG A;  2C5W B;  5DF7 A;  4OH0 A;  2Y2N A;  5G18 A;  3LO7 A;  1MWR A;  4P6B A;  5AQ9 A;  3D4F A;  2QMI A;  3ZDJ A;  5E2E A;  4WYY A;  4X68 A;  4ZJ3 A;  1NRF A;  3GRJ A;  3ZNY A;  4OP5 A;  4KQQ A;  2UWX A;  4LV0 A;  1FQG A;  1GA9 A;  3O3V A;  3HBR A;  4N1H A;  5A93 A;  2BG1 A;  1PW1 A;  3I7J A;  4U0T A;  5GLC A;  1JWP A;  1ALQ A;  2Q9M A;  2ZQD A;  4KG6 A;  3VOY A;  3AGF A;  4DE2 A;  1E3U D;  2J9P A;  2X02 A;  5J8X A;  2XDM A;  1NYY A;  4IBX A;  4MBF A;  4Y0O A;  3SS4 A;  2DRW A;  3UE0 A;  1H8Y A;  1HVB A;  2XR0 A;  1DJB A;  4RA7 A;  3TSG A;  5HAI A;  5TFQ A;  4MNR A;  2DNS A;  3CZD A;  1W8Q A;  3BFF A;  5D3O A;  2XH9 A;  1BLP A;  4C6Y A;  1FSW A;  5FQQ A;  2WUQ A;  3TG9 A; 
#chains in the Genus database with same CATH topology
 3L9K A;  2GX5 A;  1N9N A;  2PU4 A;  1W79 A;  2DMW A;  1EWZ A;  3MFX A;  1J9M A;  5IT5 A;  3G31 A;  5HD5 A;  4RVA A;  1SKO B;  5KZH A;  1QMF A;  3Q07 A;  3IX3 A;  5DF8 A;  3ULF A;  1LSX A;  4EUZ A;  5FQM A;  3DAV A;  1V9Z A;  3N7W A;  2R78 A;  2WKQ A;  4D60 A;  4H6J B;  3V5M A;  4K0X A;  4QY5 A;  4KG2 A;  1YLY A;  4KQO A;  3ZG7 B;  4NKP A;  1PNE A;  3BQA A;  5CEC A;  4O01 A;  1K57 A;  2Y2J A;  5F1G A;  3E4P A;  1H0M A;  4BL3 A;  3HUO A;  5CEB A;  4Y0U A;  5CED A;  3CIT A;  4Y0T A;  5GLA A;  4JGQ A;  4JXG A;  3T4K A;  3E2L A;  1OTI A;  4WF0 A;  3UDX A;  3CHW P;  3IBR A;  4KEN B;  1M6K A;  5HD3 A;  4II7 A;  5U47 A;  1YPR A;  4CPK A;  2XGN A;  2XEP A;  3F1N A;  3G6O A;  5EVI C;  5M18 A;  3UME A;  4NXG A;  3GEC A;  4WZ5 C;  3IQA A;  4ETZ A;  4JGO A;  3ZYT A;  4DXB A;  2V0U A;  3OC2 A;  5GL9 A;  3MZF A;  2EA9 A;  3TW8 A;  2ZM2 A;  4GD8 A;  4X6T A;  1KE4 A;  5GLB A;  4OQG A;  2KDK A;  2V8C A;  1GCE A;  4FCF A;  1M40 A;  2QYB A;  4X56 A;  5HWT A;  3M2K A;  4KZB A;  2A24 A;  2ZJ9 A;  1RGY A;  5GHX A;  1RGZ A;  2EX9 A;  4HJ6 A;  4OOL A;  3ZG0 A;  1HLU P;  3FYZ A;  4XXR A;  1V9Y A;  4PPR A;  3MZE A;  2K7S A;  2J7V A;  2H28 A;  1W7F A;  3W4O A;  3C5A A;  1NRJ A;  4DDS A;  4PM5 A;  1VET B;  2INW A;  2ZQ7 A;  2X71 A;  4NXB A;  2XA7 S;  1L0E A;  4GD6 A;  1ZG6 A;  2XFT A;  1ES2 A;  2KOI A;  4R3B A;  1PIO A;  1XJ2 A;  1MWS A;  3QP4 A;  1K55 C;  2JHE A;  1DP6 A;  4GHI A;  4GN2 A;  1Y54 A;  3IXB A;  4ZTK A;  2XA7 M;  1S1Z A;  4HBT A;  4IBR A;  5CER A;  3IWO A;  2EFU A;  3A3F A;  2JKR M;  1A0K A;  4EQI A;  3NC8 A;  4OOM A;  2OAQ 1;  3GDI A;  4Y15 A;  3GV9 A;  1L0D A;  4OKP A;  5HX9 A;  3MR0 A;  2Y2M A;  4WMC D;  3LIA A;  3TRC A;  3HJI A;  5M1A A;  3D9Y A;  5JYO A;  1YLP A;  4EES A;  5KMW A;  4ARZ B;  4S2J A;  4N9L A;  3RTY A;  2VGK A;  1S4S A;  2OSU A;  3ICY A;  3P7N A;  4HIA A;  4OP8 A;  2HP9 A;  3BJN A;  1FCM A;  5BOH A;  3H7W A;  4PM7 A;  4XUZ A;  5E2F A;  4LV3 A;  2HDS A;  4HOI A;  3IHA A;  2HZ5 A;  3N6I A;  4GOG A;  5F68 A;  4XT2 A;  2GJ3 A;  4HEF A;  2WKH A;  1H5X A;  3GQZ A;  4ETX A;  3FKW A;  3FWL A;  1FCN A;  3E0Y A;  4MMN A;  3VE3 A;  4IVK A;  1UGU A;  4X1L A;  1QME A;  3B47 A;  4R0Q A;  3HLW A;  1XXM A;  4E04 A;  1VEU A;  3HL9 A;  1H3Q A;  1SDN A;  2ZC7 A;  3IBJ A;  2OLV A;  1IEL A;  4PKY A;  3RH8 B;  1BYW A;  3C7V A;  5F69 A;  3HUM A;  2WZZ A;  4S2N A;  3G2Z A;  1IKI A;  3PBT A;  4PM8 A;  3SZT A;  2WKE A;  3EGX C;  4X1M A;  4K0W A;  4L0L A;  3TOI A;  1DJA A;  3LFV A;  3UPN A;  2XRN A;  2A24 B;  5FDS A;  4K91 A;  1W8Y A;  4R3A A;  4RYE A;  5EUA A;  2PR5 A;  4KQD A;  2Y79 A;  3DTM A;  3ZG9 B;  3ZVW A;  3LR0 A;  2Y4A A;  3ISG A;  4ZJ1 A;  4HES A;  4E3N A;  1XP4 A;  3V50 A;  1LSV A;  3BWL A;  4BJP A;  2V1A A;  2I9V A;  1ES4 A;  3VP1 A;  4YOF A;  3ZHH A;  4KUO A;  4PMA A;  3SH7 A;  3LYX A;  4QHC A;  4S2K A;  4QU3 A;  3OCN A;  2ZM8 A;  3BY8 A;  4E3J A;  2VGL S;  2ZC5 B;  1DP9 A;  1I2W A;  4EBN A;  5FA7 A;  1L0G A;  1UWP X;  4DXC A;  1MKM A;  4R4R A;  3UB8 A;  1IEM A;  5HDC A;  3T4S A;  4S2I A;  1DJC A;  4DRT A;  4B4X A;  1XGI A;  1AXB A;  4HBU A;  4CLC C;  2HF6 A;  5J3W A;  3N8R A;  1EI5 A;  1P97 A;  5AVE A;  4PM9 A;  2BLS A;  4CJN A;  4KZA A;  4WMC A;  5DTS A;  1ERO A;  1P9W A;  1H8Z A;  4ZRR A;  3BRM A;  2H10 A;  4OPQ A;  4MDZ A;  3VOZ A;  3FG8 A;  4DJ3 A;  2C5W B;  4RQ9 A;  3UMD A;  3DBA A;  3H82 B;  4WYY A;  1K0K A;  4X68 A;  1NRF A;  4ZJ3 A;  5FEG A;  2UWX A;  1D7E A;  4WUJ A;  4LV0 A;  1NLZ A;  3MQO A;  1OTE A;  2BG1 A;  1PW1 A;  4U0T A;  4Q0H A;  5GLC A;  1JWP A;  1ALQ A;  3E98 A;  3KX0 X;  4KG6 A;  4EEU A;  3VOY A;  4DE2 A;  2J9P A;  2X02 A;  3NJA A;  1NYY A;  4MBF A;  4Y0O A;  3SS4 A;  3UE0 A;  1DJB A;  4RA7 A;  4I3J A;  3CZD A;  2A2L A;  2WUQ A;  2ZMF A;  4IUK A;  3TG9 A;  4E3O A;  1OT9 A;  2EX8 A;  2JKF A;  5A91 A;  4I38 A;  4CLC D;  3S7O A;  2V0W A;  3LIE A;  2FFY A;  3BYD A;  1LSW A;  1VQQ A;  1OTB A;  3WS5 A;  1UWN X;  3T4O A;  4JF6 A;  4QY6 A;  3PYP A;  2ZOH A;  1XA1 A;  2V20 A;  4S2P A;  2J3T D;  3S1Y A;  1BLH A;  3IT9 A;  1CI8 A;  3Q7V B;  3FPW A;  5IU1 A;  3LY3 A;  3BY9 A;  3MBZ A;  5C5K A;  3T1S A;  2HDU A;  3MXR A;  4GCZ A;  2HP5 A;  4ZDX A;  3LEQ A;  5A90 A;  4EV4 A;  1YT4 A;  2WGW A;  1H8M A;  3KSH A;  2HDQ A;  4NXE A;  3UO9 A;  1SCW A;  3PAE A;  4HH2 A;  2NUT C;  4ZAM A;  2IWC A;  2Y2G A;  4B88 A;  2B02 A;  3JVV A;  2W1T A;  3DTK A;  1FIL A;  5F1F A;  1KDS A;  4DJ2 A;  3PAG A;  5J7E A;  2G7U A;  3UN7 A;  5J4E A;  2ZLY A;  4OPR A;  1BSG A;  2R9W A;  3DTE A;  4Y13 A;  1LI0 A;  2XFS A;  4UQI S;  1MWT A;  1PFL A;  3F1P B;  3OPP A;  2Z6C A;  3A3E A;  5DKL A;  2PD8 A;  3SH9 A;  1ERQ A;  1ACF A;  4EBL A;  4R38 A;  4GZB A;  3ZVT A;  2O9C A;  4C3Q A;  4WEK A;  5FQI A;  2JBF A;  5KSH A;  4EER A;  5F83 A;  4EBP A;  1GSX A;  1TEM A;  3G4P A;  4HP9 A;  1CJF A;  3BW6 A;  4UAA A;  3G35 A;  4E3M A;  3KSI A;  2Q0O A;  3MS6 A;  5HAR A;  2E8J A;  2HP6 A;  2PU2 A;  4JKT A;  3NDE A;  3EQU A;  3C2W A;  1G6O A;  1P9R A;  5GHY A;  4A5R A;  3QP2 A;  4P0M A;  3KSG A;  5GHZ A;  4EEP A;  3H82 A;  5FEF A;  4I3I A;  1OT6 A;  5EOO A;  3O87 A;  2FH5 A;  1OTA A;  3M6H A;  2W3H A;  3WRZ A;  1U60 A;  4GKU A;  2VV7 A;  2XF3 A;  3VE4 A;  4MN6 A;  2JKR I;  1W63 Q;  4KG5 A;  1K54 A;  1LL5 A;  1PYY A;  4H6J A;  1TS7 A;  3NCK A;  4ESP A;  3E2K A;  1BT5 A;  4FTX A;  1E3U A;  4GW9 A;  4MEZ A;  3Q82 A;  2Y55 A;  5CXW A;  2VLG A;  4PKY G;  3HLG A;  3R7W B;  3PBO A;  1TS6 A;  2CC1 A;  3NIA A;  1Y28 A;  3WS0 A;  2WAE A;  1N4O A;  3UDF A;  2O99 A;  2IA2 A;  5EVI B;  1FR1 A;  2XD1 A;  3T4L A;  1WA9 A;  2JKG A;  2WGI A;  4S2L A;  1F5M A;  2VV6 A;  2OAP 1;  2M1C A;  2R9X A;  3LIB A;  3ZQ5 A;  3GSG A;  3H7W B;  3IXH A;  1MPL A;  3KO6 A;  5L8M A;  3PBS A;  3RJU A;  3T50 A;  2E8I A;  3RXX A;  4DE3 A;  3NOP C;  3PXP A;  1OME A;  5FAT A;  3PBQ A;  1DRM A;  1IYQ A;  2P9V B;  2V9A A;  5A92 A;  3TJZ C;  2PRF A;  5AQB A;  2BTF P;  5FSR A;  2GZA A;  3T12 B;  4EXO A;  3R4K A;  2W1T B;  1KGF A;  3UB9 A;  1T1C A;  4GJ4 A;  5HZH A;  2NUP C;  3UNW A;  4LRX C;  3MXS A;  1S66 L;  5EVI D;  4LRZ E;  1ERM A;  1ESU A;  3CPT B;  1P0Z A;  2WAF A;  3GR2 A;  1J3W A;  3WS4 A;  3O5Y A;  2PDR A;  1TS0 A;  2G2U A;  5FI7 A;  3HLE A;  1BUE A;  4MBH A;  4HHD A;  4HP4 A;  2VX8 A;  5DJT A;  4P6Z S;  5FQK A;  3VMA A;  4BEN A;  3HVF A;  3Q81 A;  4Q0J A;  1K6R A;  3O86 A;  4I3A A;  2Z2L B;  5EM1 A;  1EW0 A;  3LY4 A;  1OJ5 A;  4OPY A;  3RXW A;  5LBR A;  1YSP A;  3V3S A;  3C4O A;  1O7E A;  1VM1 A;  1NJ4 A;  5HW3 A;  4GS9 A;  2XLN A;  2KX6 A;  4MCW A;  1VHM A;  1T1B A;  3NOU C;  1HZO A;  2VK3 A;  3UY6 A;  3U2A A;  2OOL A;  3UB5 P;  2B5R A;  4E3I A;  3JPU A;  1I2S A;  2ZM0 A;  5HAQ A;  3ITB A;  5IS1 A;  1YQS A;  2JE5 A;  5TGF A;  2ZQ9 A;  2H0Y A;  1RP5 A;  2Y2O A;  2OWJ A;  3QHY A;  3E4O A;  5KSC A;  4UA7 A;  4O0P A;  3T1R A;  1XFN A;  4LCL A;  2O9B A;  1OJG A;  4LRY C;  4HJ4 A;  3BEC A;  2Y59 A;  2EWW A;  5FQJ A;  5IHV A;  4JXV A;  3ZFZ A;  4YIN A;  1CF0 A;  3NOT C;  4FD8 A;  1JTD A;  3IXG A;  3CMZ A;  5FQ9 A;  4I5S A;  2Y91 A;  2GNX A;  3QP6 A;  3LIF A;  3RFB A;  4N9K A;  4FSF A;  4JF5 A;  1S67 L;  3LR5 A;  2LB5 A;  3IS2 A;  1LL8 A;  4YNR A;  4L9G A;  1XGJ A;  2I72 A;  3FV7 A;  4OH0 A;  3LO7 A;  2QMI A;  5E2E A;  3GRJ A;  1VEU B;  4KQQ A;  1FQG A;  3HBR A;  3W2Z A;  5A93 A;  3I7J A;  2Q9M A;  3AGF A;  4EW7 A;  2L0W A;  1F2K A;  2J3W A;  1HVB A;  2XR0 A;  4MNR A;  2DNS A;  3OOV A;  5D3O A;  2XH9 A;  1ONG A;  1BLP A;  1FSW A;  4C6Y A;  1YAX A;  2OWH A;  3HCY A;  4C75 A;  3ZCZ A;  4CLC B;  1XKZ A;  4NXF A;  4HQA A;  4DMZ A;  1I5Q A;  2P9V A;  5L2F A;  4OLG A;  4BWI A;  3PBR A;  3MKF A;  1KOU A;  3NI9 A;  2L1M A;  3ZG5 A;  3IX8 A;  2KLI A;  3IWQ A;  4R23 A;  3UB7 A;  1K4F A;  1K54 C;  5EE8 A;  4WL9 A;  3F1N B;  1SHV A;  1PZP A;  1SZV A;  4LV2 A;  1T19 A;  4WM9 A;  3F1P A;  2ZMV A;  3MF0 A;  3DWK A;  4EUV A;  4E6W A;  4WZ4 A;  2HJE A;  4QB8 A;  2Y8H A;  4K08 A;  1NZO A;  4GLQ A;  2WZX A;  2VGJ A;  5FAO A;  2BAS A;  3BFG A;  3WS1 A;  3VP3 A;  4JGP A;  3NUL A;  3R7W A;  3S7N A;  2PBD P;  3IS2 B;  2XK1 A;  3Q1F A;  1LLB A;  2G2W A;  4E6X A;  4MLL A;  4Y7P A;  4BQM A;  4MN5 A;  3G30 A;  1ES3 A;  4FH4 A;  3MMH A;  1YMS A;  3LID A;  3QNB A;  2PD7 A;  5HFO A;  5DTK A;  4GHI B;  5CGX A;  1STZ A;  1SKF A;  3H9W A;  1CI9 A;  1G28 A;  2EWV A;  3EEH A;  2V8F A;  5AQ7 A;  3SW1 A;  4BBT A;  4YWZ A;  1BZA A;  3T1Q B;  2V1B A;  3HLD A;  4UA6 A;  1BTL A;  3M2J A;  4R3J A;  4WLA A;  4DDY A;  1IFQ A;  2RCX A;  5I94 A;  3C4P A;  5JYP A;  2HV1 A;  2JN7 A;  1CEG A;  3IH8 A;  5CX7 A;  3Q7Z A;  3PBN A;  4YFM A;  5TR7 A;  1YM1 A;  1KVL A;  3LIC A;  2K31 A;  1OPX A;  2XD5 A;  2A49 A;  3T4T A;  5EEC A;  3V39 A;  1S6R A;  4ME4 A;  3SOI A;  2AVX A;  4S2O A;  2J8Y A;  5CGS A;  1LI9 A;  3O88 A;  1T1A A;  1MWU A;  4DKI A;  1IKG A;  1E25 A;  4GS9 B;  2PYR A;  4BL2 A;  1KGE A;  4OPZ A;  4GB7 A;  3UE3 A;  4OON A;  3KYZ A;  1IOU A;  3A3J A;  2L4R A;  2OV5 A;  2C6W B;  2IWB A;  4HNB A;  4KZ4 A;  3W4P A;  2ZL1 B;  2O9A A;  4NK3 A;  1TDL A;  1XJ4 A;  5G4Y A;  2ZC4 B;  3BFC A;  2W3D A;  4IED A;  3GTC A;  5E2H A;  3D3O A;  4Z9Q A;  3G2Y A;  4LEN A;  3SH8 A;  4EU0 A;  4Q0I A;  2UV0 E;  1W63 M;  1D06 A;  2Q9N A;  4NEE D;  4O8G A;  5EVE A;  3SS5 A;  4R70 A;  3UPP A;  4JGR A;  4EET B;  1WE4 A;  4NG2 A;  1SDE A;  3WS2 A;  2FFF B;  4ID4 A;  1BLC A;  3EOI A;  1NWZ A;  4D2O A;  2LB9 A;  1BUL A;  3SS3 A;  4BD0 A;  3MSH A;  4FUW A;  1KVM A;  4HI4 A;  1AWI A;  5F6A A;  3IWI A;  1K4E A;  4RX2 A;  1Z09 A;  4B9O A;  3MQ0 A;  2JKT I;  1PRQ A;  1XPB A;  5FAP A;  2P04 A;  4FH2 A;  5HSQ A;  2XQZ A;  3JVU A;  3K2N A;  3OPR A;  3A3D A;  4FOF A;  4ZJ2 A;  4EQ1 A;  4EWF A;  2Z6D A;  4R1G A;  4HH3 A;  1WYC A;  3P09 A;  1ZHH B;  3CJM A;  3OPL A;  1YKD A;  5EPH A;  2WGW B;  1ZTU A;  1Y4O A;  3CI6 A;  3G32 A;  5DFX A;  3K3D A;  4LCM A;  5E2G A;  1KGG A;  1DY6 A;  5DKK A;  1L0F A;  5FAS A;  3CUE C;  3QP1 A;  3UPO A;  2VV8 A;  2PAV P;  5L07 A;  4F94 A;  3Q7V A;  2ZC3 B;  1KE3 A;  4MBK A;  4JLF A;  4OOY A;  2XSS A;  4QWO A;  1PWG A;  4U0X A;  2QZ6 A;  5HPF A;  5MC7 A;  3A3I A;  2QPN A;  2D01 A;  3D72 A;  2HGV A;  4M4X A;  5CHM A;  1NLY A;  3QNC A;  2M7U A;  5HWW A;  4OLD A;  5CTM A;  1C3B A;  1ZKJ A;  3IF6 A;  1PI5 A;  3EQV A;  5FI2 A;  3LGO A;  4CLC E;  4WN5 A;  3GVB A;  3MXQ A;  4IVI A;  3ZNT A;  4E3K A;  1Q2P A;  2W3G A;  1K56 D;  3MQQ A;  3BLM A;  1IYO A;  5HWV A;  1K38 A;  3OLO A;  4M3K A;  3VSL A;  2V1Z A;  2W1R A;  2Y2P A;  2ZQ8 A;  3V3R A;  4O7D A;  2VEA A;  1S4R A;  5FI6 A;  5TBM A;  2GDN A;  3MJQ A;  1F98 A;  1MXO A;  1CEF A;  2QKP A;  3WRT A;  3V67 A;  2Z2M B;  2O0Y A;  2ZQA A;  4GDN A;  4B93 A;  1MKI A;  4JBF A;  1KE0 A;  3VV4 A;  3UDI A;  4S2M A;  4F3L B;  5HDS A;  1E4D A;  3GMW A;  2VGL M;  1NY0 A;  4JXS A;  1PZO A;  3ZG8 B;  4P87 A;  4CQH A;  5A8B A;  3S7Q A;  1NZU A;  3BQ8 A;  1K25 A;  2EX2 A;  5FL3 A;  3IF5 A;  2H0T A;  1GA0 A;  1JNU A;  3BFD A;  3UE1 A;  1VB6 A;  2IWD A;  3KSF A;  4WBG A;  5DF7 A;  1TS8 A;  5HPI A;  3T4Q A;  3D4F A;  5K5B A;  3ZNY A;  2J80 A;  4N1H A;  3CPT A;  3U4L P;  4R6L A;  2M7V A;  3C30 A;  5DFY A;  5J8X A;  2DRW A;  1H8Y A;  5HAI A;  3QP8 A;  1W8Q A;  2WYX A;  5FQQ A;  4KZ7 A;  5L09 A;  2A3U A;  3KYE A;  3LUQ A;  4UHU A;  4JPM A;  1HD8 A;  2ZMA A;  3LR4 A;  5CRF A;  4RX3 A;  1XX2 A;  1YLJ A;  1MBL A;  5EV0 A;  3EWK A;  2W27 A;  3W4Q A;  3UE6 A;  3FC7 A;  4CLC A;  2PBY A;  3B33 A;  3IXD A;  4WEL A;  3JYI A;  2H5S A;  3WWX A;  3OPH A;  3MKE A;  3P98 A;  3FZC A;  3LI8 A;  5CHU A;  4KZ5 A;  3C7U A;  2HJ9 C;  5AJG A;  5HDD A;  1G5U A;  2EXA A;  3IX4 A;  5EM0 A;  1WYB A;  1FIK A;  2ZL1 A;  1N9L A;  4LFU A;  1K6S A;  1FCO A;  4KUK A;  2ACG A;  3S4X A;  3E4Q A;  4JF4 A;  2JKT M;  4BBV A;  1TVF A;  3FKV A;  3BM6 A;  1GSV A;  1XA7 A;  5CTN A;  3CAX A;  4X55 A;  3LCE A;  4KZ8 A;  1IYS A;  2WGV A;  4GNU A;  4U3T A;  3HUN A;  2D02 A;  4Y3I A;  1PWC A;  4PHT A;  2YKF A;  4L9F A;  2QJ5 A;  2WK0 A;  4BD1 A;  2PR6 A;  3BFE A;  3IHB A;  3VFF A;  4N1X A;  1S0W A;  1F9I A;  2B95 A;  3OCL A;  1OTD A;  1YLW A;  1XJ3 A;  2FZ0 A;  4BLM A;  3HLF A;  1GHP A;  3S22 A;  2ZOI A;  1HTZ A;  1L3L A;  2ZQC A;  1G6A A;  4Q8I A;  4Y17 A;  1KDW A;  3N8L A;  4XT2 B;  3W8K A;  1PI4 A;  3VP0 A;  1ZG4 A;  3BLS A;  2EFX A;  4OQH A;  1ODV A;  1BLS A;  4LV1 A;  3AGD A;  1JWV A;  1T18 A;  5KIZ A;  4LGW A;  4ARZ A;  3VP4 A;  2WKR A;  2HDR A;  4N92 A;  1K57 C;  2Y2I A;  2EXB A;  3VP2 A;  2Y2H A;  3EEA A;  2RL3 A;  4UEY A;  1XFQ A;  1CQA A;  1PW8 A;  4DF6 A;  4BBU A;  4PM6 A;  2W0N A;  4OQ0 A;  5EFW A;  5HL1 A;  2Y2L A;  5GLD A;  5DF9 A;  2JC7 A;  4H8R A;  5HAP A;  2ZBB A;  2PHY A;  3DWZ A;  4NET A;  4P6Z M;  2Y2K A;  2W3F A;  4IJG A;  3VFH A;  4BMW A;  1D1J A;  3LEZ A;  4LLO B;  1XJ6 A;  2QJ7 A;  2P7J A;  4G3W A;  5EVL A;  1NYM A;  5M19 A;  3HLB A;  5AQA A;  3DTI A;  3QP5 A;  2OLU A;  1LL9 A;  3KYQ A;  2VKS A;  1K55 A;  1YLZ A;  1G68 A;  2MJ6 A;  4Z1W A;  1GHI A;  4OVD A;  4WEJ A;  1X0O A;  4IUH A;  3AGE A;  4DE0 A;  4OQI A;  5DVA A;  3CUE A;  1Q2Q A;  5E43 A;  3T4J A;  4MN7 A;  2WKP A;  1K56 A;  3FPV A;  3N4I A;  2YKH A;  3LI9 A;  4LPZ A;  2ZD8 A;  3IF6 B;  5FDH A;  2QWS A;  3C8C A;  4QPR A;  5FAQ A;  4Y5F A;  3CLO A;  2XRO A;  4X69 A;  3PHY A;  4HY8 A;  1GSW A;  3IF6 C;  5I5L A;  3F1O B;  3BEB A;  1YLT A;  4DE1 A;  1DP8 A;  1MZU A;  3HRE A;  1L2S A;  3IH9 A;  2J9O A;  5EOE A;  4PAU A;  3B42 A;  3MZD A;  2VZW A;  3L7H A;  3NHQ A;  5DTT A;  4R4S A;  4XUX A;  1RCJ A;  3ITA A;  4B4Z A;  2J3T C;  3G34 A;  3B3X A;  1MY8 A;  4HJ3 A;  1CK3 A;  5AVF A;  3K3C A;  5L10 A;  3HJK A;  4WZ5 A;  3S7P A;  2WAD A;  1FOF A;  4S2N C;  2P74 A;  3CWF A;  4KQR A;  4G3K A;  1VET A;  4X53 A;  3MFD A;  4I39 A;  2CMN A;  5HL6 A;  2JCH A;  1O07 A;  1LHY A;  1LT0 A;  2PT7 A;  1N9B A;  4QJG A;  3A0R A;  1NXY A;  3OBF A;  3NDG A;  1ESI A;  4ZBE A;  3ZGA B;  1N9O A;  3HLC A;  4L9E A;  3DW0 A;  5G4Z A;  5TBM B;  1TDG A;  3A0V A;  3N8S A;  3VOL A;  1Z6F A;  2VJW A;  3VSK A;  2WKI A;  2W3E A;  1W5D A;  3TE8 A;  3NEC A;  1TF1 A;  3NY4 A;  5DJU A;  1SKO A;  4UA9 A;  4KZ3 A;  3NBL A;  2PYP A;  1FSY A;  1MC0 A;  3F1O A;  5EVI A;  1JWZ A;  3C38 A;  3T1X A;  4IHQ A;  4KZ6 A;  2QHK A;  2P08 A;  1PWD A;  3PTE A;  2DCF A;  3A0S A;  2ZC6 B;  5F82 A;  4QD4 A;  4JXW A;  2EX6 A;  3UB6 A;  2Y2Q A;  1FR6 A;  1GHM A;  2X01 A;  1ES5 A;  4E3L A;  3EGD C;  5CHJ A;  2K2N A;  1JVJ A;  3M6B A;  4GDB A;  3P01 A;  5F5Y A;  3PR6 A;  3OZH A;  4G3V A;  4AFI A;  1ONH A;  1JTG A;  4P85 A;  1ZC2 A;  2HPB A;  1YMX A;  4KZ9 A;  1IYP A;  3CG5 A;  2V2F F;  5CGW A;  2Y2N A;  5G18 A;  1MWR A;  4P6B A;  5AQ9 A;  4DN0 A;  3ZDJ A;  4Y2F A;  4UQI M;  4OP5 A;  4X25 A;  2B18 A;  3O3V A;  1GA9 A;  3LR3 A;  1S1Y A;  2ZQD A;  2VA0 A;  1E3U D;  4F3L A;  2XDM A;  4IBX A;  1TD5 A;  1YSQ A;  5TJJ A;  3TSG A;  5TFQ A;  3BFF A; 
#chains in the Genus database with same CATH homology
 4C75 A;  3ZCZ A;  4E3O A;  1XKZ A;  2EX8 A;  5A91 A;  2PU4 A;  2A3U A;  1I5Q A;  2P9V A;  5L2F A;  4OLG A;  4UHU A;  1W79 A;  3PBR A;  4JPM A;  3MKF A;  2FFY A;  1EWZ A;  1HD8 A;  3BYD A;  2ZMA A;  1J9M A;  5CRF A;  4RX3 A;  3NI9 A;  3G31 A;  1VQQ A;  3WS5 A;  3ZG5 A;  1XX2 A;  1YLJ A;  1MBL A;  4RVA A;  3IWQ A;  4R23 A;  4JF6 A;  4QY6 A;  3W4Q A;  1K4F A;  1K54 C;  5KZH A;  1QMF A;  1XA1 A;  3Q07 A;  2V20 A;  5EE8 A;  4S2P A;  1SHV A;  3S1Y A;  1PZP A;  5DF8 A;  1BLH A;  3IT9 A;  4LV2 A;  4WM9 A;  2PBY A;  3IXD A;  4WEL A;  3JYI A;  1CI8 A;  3Q7V B;  3DWK A;  2H5S A;  3WWX A;  3LY3 A;  3OPH A;  4E6W A;  3MKE A;  4WZ4 A;  3P98 A;  4QB8 A;  4EUZ A;  5FQM A;  3FZC A;  5CHU A;  3MBZ A;  3N7W A;  4KZ5 A;  1NZO A;  3C7U A;  2EXA A;  2WZX A;  2VGJ A;  5FAO A;  4K0X A;  1WYB A;  2HDU A;  3V5M A;  4QY5 A;  4KG2 A;  1YLY A;  3BFG A;  3MXR A;  3WS1 A;  1K6S A;  4KQO A;  2HP5 A;  3VP3 A;  3ZG7 B;  1FCO A;  4ZDX A;  3S4X A;  4JF4 A;  5CEC A;  5A90 A;  2XK1 A;  3Q1F A;  1K57 A;  2Y2J A;  1TVF A;  3FKV A;  5F1G A;  1YT4 A;  4EV4 A;  2WGW A;  1LLB A;  2G2W A;  3HUO A;  3BM6 A;  2HDQ A;  4BL3 A;  4Y0U A;  4MLL A;  1XA7 A;  4Y7P A;  4BQM A;  4E6X A;  5CEB A;  5CTN A;  3G30 A;  5CED A;  3UO9 A;  1SCW A;  3PAE A;  4Y0T A;  4X55 A;  5GLA A;  4JXG A;  3LCE A;  4KZ8 A;  1IYS A;  1ES3 A;  3E2L A;  2WGV A;  4GNU A;  4FH4 A;  4ZAM A;  2IWC A;  2Y2G A;  4U3T A;  4B88 A;  3HUN A;  1YMS A;  3UDX A;  1PWC A;  3QNB A;  5F1F A;  5HFO A;  5DTK A;  1KDS A;  2WK0 A;  4KEN B;  5CGX A;  1M6K A;  3PAG A;  4BD1 A;  3BFE A;  3IHB A;  3VFF A;  1SKF A;  4N1X A;  3UN7 A;  2ZLY A;  1S0W A;  4OPR A;  5U47 A;  1BSG A;  2R9W A;  4CPK A;  2XGN A;  2XEP A;  3OCL A;  5EVI C;  1LI0 A;  2XFS A;  5M18 A;  1MWT A;  1CI9 A;  1YLW A;  3OPP A;  3A3E A;  4WZ5 C;  3SH9 A;  1ERQ A;  3IQA A;  4BLM A;  4EBL A;  3HLF A;  4DXB A;  1GHP A;  3S22 A;  3OC2 A;  5GL9 A;  4GZB A;  3ZVT A;  5AQ7 A;  1HTZ A;  3MZF A;  4C3Q A;  4WEK A;  2ZQC A;  5FQI A;  1BZA A;  2ZM2 A;  3HLD A;  4GD8 A;  4X6T A;  2JBF A;  1KE4 A;  5KSH A;  1G6A A;  5GLB A;  4OQG A;  4UA6 A;  1BTL A;  3M2J A;  4R3J A;  5F83 A;  4EBP A;  4Q8I A;  4DDY A;  1KDW A;  1TEM A;  3G4P A;  3N8L A;  1GCE A;  3W8K A;  1PI4 A;  4FCF A;  3VP0 A;  2RCX A;  4UAA A;  5I94 A;  3C4P A;  5JYP A;  1M40 A;  1ZG4 A;  3BLS A;  2EFX A;  3G35 A;  1CEG A;  4E3M A;  3IH8 A;  4OQH A;  3Q7Z A;  3PBN A;  4YFM A;  4X56 A;  1BLS A;  4LV1 A;  3AGD A;  5TR7 A;  1YM1 A;  5HAR A;  1JWV A;  3M2K A;  4KZB A;  1KVL A;  2HP6 A;  2PU2 A;  4JKT A;  3NDE A;  3EQU A;  3VP4 A;  2ZJ9 A;  5GHY A;  2HDR A;  4N92 A;  4A5R A;  1RGY A;  5GHX A;  1RGZ A;  2XD5 A;  2EX9 A;  4P0M A;  2A49 A;  4OOL A;  5EEC A;  5GHZ A;  1K57 C;  3ZG0 A;  3V39 A;  2Y2I A;  2EXB A;  3FYZ A;  4XXR A;  4PPR A;  3VP2 A;  2Y2H A;  3MZE A;  1S6R A;  2J7V A;  2RL3 A;  1W7F A;  3SOI A;  3W4O A;  3C5A A;  4S2O A;  5EOO A;  3O87 A;  2J8Y A;  5CGS A;  1LI9 A;  1PW8 A;  3O88 A;  4DF6 A;  1MWU A;  4PM6 A;  4OQ0 A;  4DDS A;  1IKG A;  4DKI A;  3M6H A;  4PM5 A;  3WRZ A;  5HL1 A;  2Y2L A;  5GLD A;  1E25 A;  5DF9 A;  1U60 A;  2JC7 A;  4BL2 A;  2ZQ7 A;  2X71 A;  4H8R A;  5HAP A;  1KGE A;  4GKU A;  1L0E A;  4GD6 A;  4OPZ A;  1ZG6 A;  2XFT A;  2XF3 A;  1ES2 A;  3DWZ A;  4GB7 A;  3UE3 A;  4NET A;  4R3B A;  1PIO A;  4OON A;  2Y2K A;  3A3J A;  1MWS A;  2OV5 A;  3VFH A;  2C6W B;  1K55 C;  3LEZ A;  2IWB A;  4KG5 A;  4KZ4 A;  3W4P A;  4NK3 A;  1K54 A;  1TDL A;  1LL5 A;  1PYY A;  2ZC4 B;  4GN2 A;  1Y54 A;  3BFC A;  3IXB A;  4IED A;  5EVL A;  4ZTK A;  1NYM A;  3NCK A;  3GTC A;  5M19 A;  5E2H A;  3HLB A;  5AQA A;  3E2K A;  4HBT A;  1BT5 A;  4Z9Q A;  4IBR A;  1E3U A;  5CER A;  2OLU A;  1LL9 A;  3G2Y A;  4LEN A;  3IWO A;  1K55 A;  4MEZ A;  1YLZ A;  2EFU A;  1G68 A;  3A3F A;  2Y55 A;  3Q82 A;  5CXW A;  4EQI A;  1GHI A;  3NC8 A;  3SH8 A;  4OOM A;  3HLG A;  4OVD A;  4WEJ A;  3PBO A;  2WYX A;  3AGE A;  2CC1 A;  3NIA A;  3WS0 A;  4DE0 A;  2WAE A;  4OQI A;  2Q9N A;  4KZ7 A;  1N4O A;  3GV9 A;  5DVA A;  1L0D A;  4OKP A;  3UDF A;  1Q2Q A;  5E43 A;  5EVI B;  3SS5 A;  3UPP A;  1FR1 A;  5HX9 A;  2XD1 A;  1K56 A;  3N4I A;  4S2L A;  2WGI A;  2Y2M A;  4WMC D;  1WE4 A;  1SDE A;  3WS2 A;  2FFF B;  2R9X A;  4ID4 A;  1BLC A;  5M1A A;  2ZD8 A;  5JYO A;  1YLP A;  3GSG A;  3IXH A;  4D2O A;  3IF6 B;  5FDH A;  1MPL A;  5KMW A;  1BUL A;  4S2J A;  3SS3 A;  4BD0 A;  3PBS A;  3RJU A;  4N9L A;  1KVM A;  5FAQ A;  2E8I A;  3RXX A;  4DE3 A;  2VGK A;  3IWI A;  1K4E A;  4RX2 A;  2OSU A;  1ONG A;  1OME A;  4X69 A;  5FAT A;  3PBQ A;  4OP8 A;  1IYQ A;  2P9V B;  2HP9 A;  5A92 A;  1FCM A;  5BOH A;  1XPB A;  3IF6 C;  5FAP A;  4PM7 A;  3BEB A;  1YLT A;  4XUZ A;  5E2F A;  4FH2 A;  4LV3 A;  2HDS A;  5AQB A;  2XQZ A;  3IHA A;  4DE1 A;  5FSR A;  3N6I A;  4GOG A;  3HRE A;  1L2S A;  4HEF A;  3IH9 A;  2J9O A;  3OPR A;  3A3D A;  5EOE A;  1KGF A;  2WKH A;  4ZJ2 A;  3MZD A;  4EWF A;  1H5X A;  3GQZ A;  4R1G A;  3FKW A;  3UNW A;  3FWL A;  3MXS A;  1WYC A;  5DTT A;  3P09 A;  4R4S A;  1FCN A;  5EVI D;  4XUX A;  1RCJ A;  1ERM A;  1ESU A;  4IVK A;  3ITA A;  3CJM A;  4B4Z A;  3OPL A;  3G34 A;  2WAF A;  3B3X A;  3GR2 A;  1MY8 A;  1QME A;  5EPH A;  2WGW B;  3WS4 A;  1CK3 A;  4R0Q A;  2G2U A;  3G32 A;  5FI7 A;  3HLE A;  1BUE A;  4MBH A;  3HLW A;  4WZ5 A;  1XXM A;  2WAD A;  1FOF A;  3HL9 A;  4S2N C;  4LCM A;  5E2G A;  1SDN A;  2P74 A;  2ZC7 A;  1KGG A;  5FQK A;  4KQR A;  1DY6 A;  1L0F A;  2OLV A;  3VMA A;  5FAS A;  1IEL A;  4BEN A;  3HVF A;  3Q81 A;  3MFD A;  4X53 A;  1K6R A;  3O86 A;  3C7V A;  3HUM A;  2WZZ A;  2Z2L B;  3UPO A;  4S2N A;  2JCH A;  3G2Z A;  1IKI A;  3PBT A;  4PM8 A;  4F94 A;  3Q7V A;  2ZC3 B;  3LY4 A;  1O07 A;  1LHY A;  1KE3 A;  4MBK A;  4JLF A;  2WKE A;  1N9B A;  4OOY A;  4QJG A;  1PWG A;  4K0W A;  4OPY A;  1NXY A;  4U0X A;  4L0L A;  3RXW A;  3TOI A;  2QZ6 A;  3V3S A;  3NDG A;  3C4O A;  1ESI A;  1DJA A;  1O7E A;  4ZBE A;  1VM1 A;  3ZGA B;  3A3I A;  1NJ4 A;  3UPN A;  5HW3 A;  2QPN A;  3HLC A;  2XLN A;  3DW0 A;  4K91 A;  5CHM A;  1W8Y A;  3QNC A;  1TDG A;  4RYE A;  5EUA A;  3N8S A;  4OLD A;  1HZO A;  5CTM A;  1Z6F A;  1C3B A;  3VSK A;  3DTM A;  2WKI A;  3UY6 A;  3ZG9 B;  3ZVW A;  1ZKJ A;  3IF6 A;  1PI5 A;  3EQV A;  5FI2 A;  2Y4A A;  1W5D A;  3ISG A;  3GVB A;  4ZJ1 A;  4IVI A;  4HES A;  3ZNT A;  3NY4 A;  2B5R A;  4E3K A;  4E3I A;  1Q2P A;  1XP4 A;  4E3N A;  4UA9 A;  3V50 A;  4KZ3 A;  3NBL A;  1I2S A;  1K56 D;  2ZM0 A;  1FSY A;  3BLM A;  4BJP A;  1IYO A;  3ITB A;  5HAQ A;  1K38 A;  5EVI A;  1YQS A;  2JE5 A;  1JWZ A;  5TGF A;  2ZQ9 A;  2H0Y A;  1ES4 A;  3VP1 A;  1RP5 A;  2Y2O A;  3ZHH A;  4M3K A;  4KZ6 A;  3VSL A;  4PMA A;  2V1Z A;  3SH7 A;  2Y2P A;  2ZQ8 A;  3V3R A;  3QHY A;  4O7D A;  4QHC A;  4S2K A;  4QU3 A;  5FI6 A;  5KSC A;  2GDN A;  4UA7 A;  3OCN A;  2ZM8 A;  4E3J A;  1MXO A;  2ZC5 B;  1CEF A;  4LCL A;  1PWD A;  1I2W A;  3PTE A;  3WRT A;  4EBN A;  2DCF A;  3BEC A;  5FA7 A;  2Y59 A;  1L0G A;  5FQJ A;  2Z2M B;  5IHV A;  2ZC6 B;  5F82 A;  4DXC A;  2ZQA A;  4GDN A;  4JXV A;  1MKI A;  4JBF A;  4QD4 A;  1KE0 A;  2EX6 A;  4JXW A;  4YIN A;  3ZFZ A;  4R4R A;  3UDI A;  4FD8 A;  2Y2Q A;  4S2M A;  1JTD A;  1FR6 A;  1GHM A;  3IXG A;  1E4D A;  1IEM A;  3GMW A;  3CMZ A;  5FQ9 A;  2X01 A;  1ES5 A;  4E3L A;  4S2I A;  1DJC A;  4DRT A;  4B4X A;  5CHJ A;  1NY0 A;  4JXS A;  1PZO A;  1XGI A;  1AXB A;  1JVJ A;  2Y91 A;  4HBU A;  3M6B A;  4GDB A;  3ZG8 B;  4P87 A;  3N8R A;  1EI5 A;  3OZH A;  1NZU A;  4N9K A;  4PM9 A;  2BLS A;  1K25 A;  1ONH A;  1JTG A;  4FSF A;  4P85 A;  4CJN A;  1ZC2 A;  4JF5 A;  4KZA A;  2HPB A;  1YMX A;  2EX2 A;  4WMC A;  5DTS A;  1ERO A;  4KZ9 A;  3IF5 A;  2H0T A;  1GA0 A;  1IYP A;  1H8Z A;  3BRM A;  3BFD A;  2H10 A;  3CG5 A;  4OPQ A;  3UE1 A;  2V2F F;  1XGJ A;  3VOZ A;  2I72 A;  2IWD A;  3FV7 A;  5CGW A;  4WBG A;  2C5W B;  5DF7 A;  4OH0 A;  2Y2N A;  5G18 A;  3LO7 A;  1MWR A;  4P6B A;  5AQ9 A;  3D4F A;  2QMI A;  3ZDJ A;  5E2E A;  4WYY A;  4X68 A;  4ZJ3 A;  1NRF A;  3GRJ A;  3ZNY A;  4OP5 A;  4KQQ A;  2UWX A;  4LV0 A;  1FQG A;  1GA9 A;  3O3V A;  3HBR A;  4N1H A;  5A93 A;  2BG1 A;  1PW1 A;  3I7J A;  4U0T A;  5GLC A;  1JWP A;  1ALQ A;  2Q9M A;  2ZQD A;  4KG6 A;  3VOY A;  3AGF A;  4DE2 A;  1E3U D;  2J9P A;  2X02 A;  5J8X A;  2XDM A;  1NYY A;  4IBX A;  4MBF A;  4Y0O A;  3SS4 A;  2DRW A;  3UE0 A;  1H8Y A;  1HVB A;  2XR0 A;  1DJB A;  4RA7 A;  3TSG A;  5HAI A;  5TFQ A;  4MNR A;  2DNS A;  3CZD A;  1W8Q A;  3BFF A;  5D3O A;  2XH9 A;  1BLP A;  4C6Y A;  1FSW A;  5FQQ A;  2WUQ A;  3TG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...