4QY5A

Crystal structures of chimeric beta-lactamase ctem-19m showing different conformations
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM,Beta-lactamase PSE-4
publication title Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 91
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qy5A00
3GMWA 4YINA 4MLLA 2ZQ9A 1ZG6A 3MZEA 1S6RA 3UY6A 1K55A 1FCOA 4S2JA 2ZM0A 2P9VB 4KG2A 2WUQA 1MY8A 2ZQ8A 3LY3A 3RJUA 3N4IA 1XA7A 4IVIA 2DNSA 4EV4A 4S2PA 4UA6A 4Q8IA 1N9BA 3BYDA 5HAIA 4B4XA 1K6RA 3HREA 2HP9A 1K54C 5GL9A 3NI9A 5JYOA 1GCEA 3ZG8B 4FH2A 2ZC7A 1RGYA 3NIAA 3QHYA 3IF6C 1DJBA 1DY6A 5FQJA 2VGJA 1LL9A 1VM1A 3BEBA 3PAGA 4LENA 4PMAA 2X01A 4MBFA 5DTKA 1ONGA 4E3OA 1PZPA 1K54A 4Z9QA 2XF3A 4DXCA 4FH4A 1I2SA 3ZVTA 3A3JA 3IF6A 3V39A 1FCMA 2WGWA 1FSWA 1XX2A 1SCWA 3HUMA 3IHAA 4PPRA 5CTMA 2IWBA 4BLMA 3IHBA 5DTSA 4B88A 3UE1A 2PBYA 3WS0A 4HEFA 1YLJA 2J9PA 4YFMA 4BENA 3AGEA 2Y2LA 3G2YA 4GNUA 4JPMA 3SS4A 2HDUA 5F1GA 1ZG4A 3IH9A 5TR7A 4IBXA 4JXWA 4JXVA 3WS5A 4K91A 3IQAA 3ZG7B 1KE4A 1WYCA 4WMCA 5HARA 4QJGA 4OONA 3M6BA 2WZXA 3ZFZA 2JE5A 3C4OA 4M3KA 3VOYA 2J7VA 2XLNA 3UN7A 4PM8A 4GB7A 1MWSA 5I94A 1BUEA 1IELA 1S0WA 5CHUA 5EVIB 1XGJA 4BL2A 4X68A 1ALQA 3SOIA 4KQQA 1BLSA 2JBFA 3IWOA 3IF5A 4U0XA 4WM9A 3PBSA 1PW1A 4WBGA 5DTTA 1KDWA 1GHIA 3PAEA 1YM1A 2ZQ7A 1YLYA 2HPBA 4KZBA 3MZFA 4LV3A 1KDSA 4UHUA 4WZ4A 2V1ZA 1Q2PA 3G30A 4S2NA 4P6BA 4OP8A 3HL9A 1DJCA 5M1AA 5TGFA 1BULA 1NZOA 1PWGA 3BFGA 4Y7PA 3C4PA 3UPOA 3UDXA 1NY0A 3NC8A 4OQIA 2V2FF 3V3SA 4RVAA 3MKFA 3VOZA 5FAPA 2G2UA 4GKUA 1IKGA 3V50A 1YMXA 3IXHA 4WELA 4E3MA 5EVIA 4ZTKA 1RCJA 4R23A 5FQMA 4EWFA 1GA0A 1ESIA 2H10A 3NBLA 1FR1A 3UO9A 3ZVWA 4IVKA 1KVMA 2Y55A 4D2OA 4MBKA 4KG6A 2GDNA 1O7EA 1RP5A 4OOLA 1K6SA 2CC1A 3ISGA 1BZAA 3M2KA 4OP5A 4XXRA 4BQMA 4DE3A 1JWVA 1KGFA 1W8QA 1MWTA 3FWLA 2ZQDA 3G4PA 2WKEA 4ID4A 4OLDA 2XGNA 4E3JA 4P85A 3GVBA 4LCMA 2EX6A 3G2ZA 5E2HA 2BG1A 1ES3A 3P98A 4X69A 2H0YA 4KZ4A 3PBQA 3C7UA 2PU4A 4PM9A 1SDNA 3WRTA 4BJPA 4DE1A 5KMWA 5FDHA 3A3DA 5CEBA 1NYYA 2A49A 1TEMA 2BLSA 2X02A 1L0FA 4KENB 4LV0A 3IWQA 3N7WA 3ITBA 1MWUA 3AGFA 3PTEA 4JXGA 1H8YA 2XH9A 5HAPA 1K55C 5FQKA 4E3NA 4JF4A 5E43A 3QNBA 1CEFA 4RX2A 1W5DA 5CTNA 3M2JA 4NETA 3BLMA 3ZG9B 3HLBA 1LL5A 3N8RA 5FI2A 1ES2A 4WYYA 3SS5A 3OC2A 3BFCA 4KZ5A 5CRFA 3E2KA 3W4PA 1MKIA 1YQSA 3D4FA 3G32A 2DRWA 4KZ8A 4P87A 1W8YA 5EE8A 5EOEA 1NRFA 4R1GA 1H5XA 3G34A 5E2EA 3OCLA 2Y2OA 3NY4A 1VQQA 3UPPA 1PYYA 1K56A 3W4OA 3HLDA 1Q2QA 2Y4AA 4ZBEA 3S4XA 1HTZA 2WADA 3WS2A 1K57A 1ERQA 4BD0A 4N1XA 2JCHA 3DWKA 3MXSA 5CEDA 5DF9A 4OQGA 4N1HA 3O86A 1MPLA 4OQ0A 1MBLA 4P0MA 4WZ5A 1HVBA 3BM6A 4U0TA 2ZC4B 4Y0OA 3C7VA 1EWZA 3ZNYA 3HLEA 5EVLA 3LCEA 3HLWA 2QPNA 3S1YA 3BLSA 2XEPA 1NJ4A 2IWDA 4EUZA 3IXGA 2Y2MA 2R9XA 3Q07A 2ZJ9A 4KG5A 3PBTA 3IXBA 4R3BA 5FATA 4KQRA 3VP1A 1L0DA 4R4SA 4LCLA 5CGSA 4QB8A 2Y2IA 5HFOA 1E4DA 2J8YA 3UE0A 3UPNA 3FZCA 4HBTA 3N8SA 3OZHA 2JC7A 4RYEA 3FYZA 4EBNA 2WKHA 2HDQA 4OVDA 3OCNA 1Y54A 2Q9MA 1K25A 3ZGAB 3BFEA 3CG5A 1IYQA 3OPLA 4C6YA 2B5RA 2FFFB 3ZHHA 1XKZA 1W79A 2WZZA 5FQIA 3SH8A 2Z2MB 1ES5A 1WE4A 2R9WA 5AQ7A 4S2NC 3GSGA 4E6XA 4UA7A 3C5AA 2H0TA 4O7DA 3HLFA 1ZC2A 4MBHA 4JF5A 4FCFA 2QMIA 4PM6A 1BT5A 4QHCA 5HAQA 3MZDA 3O87A 2XD5A 2Y2QA 4QD4A 3VSKA 4R3JA 1IYOA 1GA9A 4H8RA 2EXAA 3G31A 1FQGA 3Q7VB 3GTCA 4DF6A 1ES4A 3PBOA 3JYIA 4GZBA 5J8XA 2Y2HA 3S22A 2WKIA 4GDNA 4K0XA 1W7FA 5EVIC 1K4FA 2EFXA 2WK0A 3Q82A 5HX9A 1LLBA 4EBPA 5TFQA 4JLFA 2WGIA 5AQAA 4DXBA 1BLHA 4JXSA 1O07A 4GN2A 4CPKA 2Y2NA 3HLGA 5FI6A 4S2LA 3BECA 3DTMA 4KZ6A 4X53A 4XUZA 5DF8A 4OH0A 2Z2LB 1KE0A 1GHPA 1E3UA 4ZJ1A 4DDSA 1JVJA 2HP6A 3Q1FA 4LV1A 4OQHA 3MBZA 1L0EA 2ZQAA 3IT9A 4EBLA 3O88A 2E8IA 1JTGA 3BFDA 3LO7A 4QU3A 5F83A 4CJNA 1EI5A 1IYSA 1TDGA 3AGDA 2C6WB 1SHVA 4UA9A 4OKPA 5CECA 2C5WB 3DWZA 5CHJA 5CXWA 4S2IA 2ZM8A 4LV2A 3W4QA 1KVLA 3Q7VA 1PIOA 5FA7A 4N9KA 2X71A 1H8ZA 3UDIA 1YMSA 3GRJA 1NYMA 2Y59A 5E2GA 4UAAA 4JBFA 2XR0A 3N8LA 3HUNA 4RX3A 1XA1A 1TDLA 3B3XA 1IKIA 4PM7A 1MWRA 4OLGA 2OSUA 1LI9A 2UWXA 1PWCA 3TSGA 2P74A 3ZG0A 4S2MA 4PM5A 4HESA 2EXBA 4S2KA 3VMAA 4X55A 3E2LA 2WAEA 3Q81A 4E3IA 4E3LA 1MXOA 1RGZA 2ZMAA 4DDYA 1N4OA 4GD8A 5A90A 5A91A 4U3TA 1IYPA 5DF7A 1K57C 1M40A 3UNWA 1L0GA 1YLWA 4OPYA 1KGGA 4WMCD 4X56A 5GLAA 3EQVA 4MNRA 1YLTA 4EQIA 2EX8A 4NK3A 4A5RA 1PWDA 4WZ5C 3HVFA 2HDSA 1JTDA 3CJMA 3VSLA 2FFYA 3NDGA 3RXXA 5L2FA 4IBRA 4MEZA 1HD8A 4WEKA 1LHYA 3A3EA 1G68A 4X6TA 3ZDJA 3UE3A 5GLBA 4KZ7A 5E2FA 1ERMA 4S2OA 1LI0A 3GQZA 1PI5A 5DVAA 2EFUA 2ZM2A 3NCKA 5CGWA 3SH9A 5HW3A 4FD8A 2OLVA 1QMFA 5GHZA 1I5QA 1C3BA 4N92A 1G6AA 1BLCA 4QY6A 2ZC6B 4Y0TA 1XGIA 2EX2A 5KSCA 3VP4A 3ZCZA 3A3IA 2XFSA 4R4RA 3NDEA 1DJAA 3CZDA 3PBNA 5FAQA 1BSGA 1JWZA 5EOOA 3V3RA 5HL1A 3UDFA 1XPBA 1PI4A 2Y2PA 2HDRA 5KSHA 4OPRA 5EVID 3QNCA 4B4ZA 2ZD8A 4C75A 1E3UD 3HUOA 4KQOA 2EX9A 4DE0A 5AQBA 3TOIA 3IWIA 2Q9NA 2XQZA 3PBRA 2IWCA 2Y91A 4XUXA 2ZC3B 3WS1A 3VP3A 2P9VA 2Y2GA 3M6HA 3BRMA 1EROA 2G2WA 4OPZA 3GV9A 4OOMA 5CGXA 5IHVA 2ZQCA 2VGKA 4KZ3A 2RCXA 5CHMA 2RL3A 4QY5A 3FKWA 1WYBA 4ZJ3A 5GLCA 5KZHA 5U47A 3MXRA 1M6KA 3OPPA 4OOYA 2J9OA 3I7JA 4F94A 3WS4A 3OPHA 3W8KA 3FKVA 4KZ9A 3TG9A 1K38A 4FSFA 3G35A 5FSRA 1J9MA 1SDEA 1FR6A 4BL3A 1FCNA 4R0QA 3WRZA 3OPRA 5EECA 1YT4A 1CEGA 3O3VA 5AQ9A 5EUAA 5FASA 3VFHA 5G18A 2HP5A 2V20A 3SS3A 5A92A 4IEDA 1ONHA 3GR2A 1OMEA 1ZKJA 2DCFA 2Y2KA 3P09A 5F82A 1NZUA 1I2WA 3LEZA 5CERA 4RA7A 3DW0A 1SKFA 1BLPA 5BOHA 1L2SA 2OLUA 2PU2A 2XFTA 3CMZA 4GD6A 2WAFA 1CI9A 3A3FA 1K56D 3N6IA 1ESUA 1E25A 4GOGA 1BTLA 4GDBA 5F1FA 5EPHA 1CI8A 4JF6A 4ZAMA 2WGVA 4WEJA 1CK3A 1YLZA 2ZLYA 1K4EA 1PZOA 4OPQA 3MKEA 1XP4A 1GHMA 5GHYA 2I72A 4HBUA 3VP2A 4E3KA 5M19A 1FOFA 4KZAA 1U60A 3HLCA 5JYPA 1PW8A 4K0WA 3V5MA 3ZG5A 4C3QA 1FSYA 2XDMA 5FQ9A 2WYXA 3IH8A 3SH7A 3ZNTA 3ITAA 4E6WA 1YLPA 3BFFA 1NXYA 2ZC5B 4Y0UA 3FV7A 3LY4A 5FI7A 1IEMA 5D3OA 2H5SA 2Y2JA 3MFDA 4L0LA 3RXWA 1Z6FA 2A3UA 2XD1A 2QZ6A 3WWXA 1TVFA 4ZJ2A 2XK1A 1KGEA 5FQQA 4N9LA 5FAOA 4DRTA 1XXMA 4DKIA 4ZDXA 1HZOA 3HBRA 3IF6B 5GHXA 3Q7ZA 5GLDA 4BD1A 2WGWB 1JWPA 1KE3A 5M18A 3VP0A 1QMEA 4DE2A 1AXBA 3EQUA 3VFFA 4JKTA 5A93A 3IXDA 2OV5A
chains in the Genus database with same CATH superfamily
2V9AA 2ZQ9A 3MZEA 1FCOA 2P9VB 2PYPA 2ZOHA 3VE4A 3KSFA 2ZQ8A 3LY3A 3RJUA 1XA7A 4MN7A 1DP9A 1A0KA 3HREA 2QJ5A 1GCEA 4I39A 3ZG8B 4FH2A 4GHIB 1RGYA 3NIAA 3SW1A 2X01A 4MBFA 2PT7A 1ONGA 5CX7A 2XF3A 4FH4A 3V39A 2WGWA 1FSWA 5CTMA 4PPRA 3TJZC 4BLMA 1S67L 5DTSA 4B88A 3WS0A 2PBYA 2K7SA 4HEFA 2NUTC 5F1GA 4BMWA 4LGWA 2AVXA 1ZG4A 5TR7A 3WS5A 1WYCA 4WMCA 4OONA 2WZXA 2JE5A 3VOYA 2VV7A 4PM8A 4GB7A 1IELA 5EVIB 1XGJA 4BL2A 5HD5A 3IWOA 2O0YA 2ZQ7A 4KZBA 4LV3A 4GCZA 1MC0A 4OP8A 4G3WA 4Q0JA 4IHQA 3BFGA 4Y7PA 3T4JA 5FEFA 2FH5A 4OQIA 4GS9A 1BYWA 3VOZA 3V50A 2KDKA 1RCJA 4D2OA 3DTKA 3ZVWA 3MS6A 1O7EA 4OOLA 3T4LA 2JKRI 1JWVA 1KGFA 3FWLA 2ZQDA 2VLGA 2WKEA 4ID4A 4E3JA 3QP4A 5L07A 2PU4A 4PM9A 3WRTA 5CEBA 2BLSA 2X02A 1Z09A 3LR0A 3UMDA 3ITBA 1H8YA 3MF0A 4RX2A 5CTNA 3KX0X 1ES2A 3VOLA 1TS8A 3SS5A 2ZL1A 3D4FA 5EOEA 4R1GA 5FL3A 3CITA 3FPVA 2ZMFA 1UGUA 5K5BA 3W4OA 2Y4AA 3LEQA 3MXSA 2NUPC 5CEDA 4N1HA 4ZRRA 2W3FA 2XA7S 4P0MA 5F68A 4X1LA 3C7VA 3ZNYA 1OT9A 2QPNA 2XEPA 5FDSA 4EUZA 2GX5A 1W63M 1JNUA 2ZJ9A 4KQRA 5C5KA 4R4SA 4LCLA 2J8YA 5EV0A 3CLOA 3FYZA 4EBNA 1Y54A 2Q9MA 4CLCA 3OPLA 5DFXA 2B5RA 4IUHA 3ZHHA 5FQIA 4MCWA 2R9WA 5F6AA 4UA7A 3C5AA 4H6JB 4JF5A 2W27A 3H9WA 1BT5A 2XD5A 3VSKA 2B02A 4H8RA 2EXAA 5LBRA 1FQGA 3P7NA 2HV1A 2WKIA 3KSHA 4K0XA 4NXEA 1K4FA 3Q82A 3E4PA 4JLFA 3HLGA 1F2KA 4OH0A 2Z2LB 2FZ0A 4DDSA 3Q1FA 4LV1A 3EEHA 2JKRM 5F83A 4HQAA 4ARZA 4CJNA 1EI5A 4UA9A 1Y4OA 3DWZA 5AJGA 5J4EA 2D01A 5FA7A 1WA9A 3GRJA 1T19A 5E2GA 1PNEA 4RX3A 2JN7A 1TDLA 1PWCA 4S2MA 4HESA 4S2KA 4EW7A 3Q81A 4E3IA 4E3LA 5HPFA 2ZMAA 3UB9A 2V8CA 5A90A 1XJ3A 2EWWA 1K57C 2XSSA 3UNWA 4KUOA 1L0GA 1YLTA 4ME4A 3MMHA 4NK3A 4WZ5C 3E0YA 1JTDA 3CJMA 2FFYA 3NDGA 5L2FA 1HD8A 2ZMVA 2W3GA 1DRMA 4X6TA 4D60A 1MKMA 4S2OA 1D1JA 3QP5A 3LI9A 4UQIM 5DVAA 2J3TD 5HW3A 4FD8A 1QMFA 4F3LA 1SKOA 1BLCA 3LIFA 4Y0TA 3V67A 2XFSA 3S7QA 4R4RA 1GSXA 1LSXA 2INWA 1SZVA 3MJQA 1V9ZA 1IFQA 3RH8B 3UDFA 2HJEA 1VETB 4HH3A 5EVID 2A24A 3S7OA 1E3UD 3HUOA 2EX9A 3LIAA 5AQBA 3TOIA 2Q9NA 4HHDA 3PBRA 2IWCA 2Y91A 4XUXA 5DJTA 3T1XA 3JVVA 2HGVA 3LR3A 3MFXA 2VGKA 2WKPA 3CAXA 4QY5A 1WYBA 4ZJ3A 5KZHA 5HWVA 3PXPA 5A8BA 4F94A 1K0KA 2PD7A 3LFVA 3FKVA 3TG9A 4FSFA 5FSRA 3G35A 4NXGA 1SDEA 1GSWA 4BL3A 2HJ9C 1FCNA 5EUAA 3LICA 3VFHA 2V20A 2W3DA 5A92A 2DCFA 3B42A 2P04A 5HSQA 5BOHA 5EM0A 3GECA 4GD6A 3FG8A 2WAFA 2ZBBA 1K56D 3T4SA 1CI8A 4ZAMA 2IA2A 1PZOA 5M19A 2I72A 2JKFA 4E3KA 4KZAA 4C3QA 3ZNTA 1YLPA 4PKYG 5G4ZA 1MZUA 1IEMA 5L09A 4LRXC 2H28A 3LI8A 4YWZA 1KGEA 4B93A 4DRTA 4P6ZS 4HJ3A 4YNRA 3HBRA 5GLDA 5GHXA 1KE3A 1QMEA 3EQUA 2OV5A 3GDIA 1S6RA 3UY6A 1K55A 4S2JA 2ZM0A 4KG2A 4DJ2A 3N4IA 4UA6A 4Q8IA 5HAIA 4B4XA 5GL9A 1IOUA 4JGPA 4WF0A 4LENA 5DTKA 1K54A 5HD3A 3QP2A 1I2SA 3A3JA 3IF6A 1FIKA 1S4SA 3IHBA 4WUJA 4JPMA 4GNUA 2HDUA 4Y13A 2GZAA 4JXVA 3ZFZA 3C4OA 1BUEA 4GHIA 1OJGA 2KLIA 3DTEA 5TJJA 4BWIA 3IF5A 1NLYA 1PW1A 5DTTA 5EFWA 3MQQA 1YLYA 3MZFA 4UHUA 1Q2PA 3G30A 5M1AA 5TGFA 1BULA 3E4QA 1PWGA 3C4PA 3UDXA 1NY0A 1CF0A 3NECA 3NC8A 3MSHA 1P9RA 3V3SA 3MKFA 2KX6A 1YMXA 3KYQA 4WELA 3A0RA 5EVIA 3MXQA 1GA0A 1ESIA 1FR1A 4MBKA 4KG6A 2GDNA 3ISGA 4DE3A 1W8QA 3U4LP 3G4PA 3A0VA 4LCMA 2EX6A 2BG1A 4LFUA 3UB8A 1OT6A 5FDHA 2A49A 1L0FA 4KENB 2EWVA 3AGFA 3CUEA 2XH9A 3QNBA 1VEUB 1W5DA 3ZG9B 3BLMA 4XT2B 4ESPA 2QYBA 2A2LA 5FI2A 3OC2A 4Y5FA 3BFCA 4HOIA 4LRZE 4YOFA 1MKIA 1YQSA 4KZ8A 2DRWA 3NOPC 3H7WB 5E2EA 4R38A 4WN5A 4AFIA 1K56A 3HLDA 1Q2QA 4ZBEA 3DAVA 3KO6A 3O86A 4OQ0A 4U0TA 2ZC4B 4LRYC 4Y0OA 3UB6A 3HLWA 3S1YA 3BLSA 3IXGA 4NG2A 4KG5A 3PBTA 5FATA 1L0DA 1E4DA 4CLCE 4HIAA 2WKHA 3BWLA 4HJ6A 1K25A 2CMNA 3BFEA 4C6YA 2WZZA 4FTXA 3SH8A 2Z2MB 5AQ7A 4S2NC 5J3WA 1TF1A 4L9GA 2JKGA 4O7DA 5AVFA 4PM6A 3CHWP 5MC7A 4R3JA 1IYOA 1GA9A 4IJGA 3HCYA 5J8XA 3S22A 4GDNA 4FOFA 2LB5A 2EFXA 5TFQA 1BLHA 4L9EA 1TD5A 4JXSA 5HL6A 5DJUA 1GHPA 4B9OA 1JVJA 3MBZA 3O88A 2E8IA 5AVEA 4H6JA 1TDGA 3AGDA 1CJFA 1SHVA 5CECA 2C5WB 4I38A 4MN6A 3MQOA 5CXWA 3H82B 4LV2A 1KVLA 4N9KA 2X71A 4DMZA 4JBFA 3HJKA 3N8LA 2XR0A 3HUNA 1XA1A 1MWRA 4OLGA 1DP6A 1LI9A 2OSUA 1XFQA 4FUWA 3KSGA 2BASA 1MXOA 4GD8A 4U3TA 5IT5A 1IYPA 3KYZA 4X1MA 2W1RA 5GLAA 1KGGA 3UB7A 2HF6A 2HDSA 4MEZA 4WEKA 1G68A 3ZDJA 1ERMA 3GQZA 1PI5A 1OTIA 3S7PA 3PYPA 3SH9A 1I5QA 1TS6A 2ZC6B 2ACGA 2OWJA 3T1QB 3NOUC 5KSCA 4G3VA 3VP4A 3ZCZA 3PR6A 3NDEA 1DJAA 2O9BA 1BSGA 1YPRA 2PR5A 3IX3A 1PI4A 2Y2PA 4UEYA 1XJ4A 2HDRA 4JGRA 3QNCA 4DE0A 1YSPA 1T18A 2QJ7A 3BW6A 1EROA 4OPZA 3BQ8A 5IHVA 2ZQCA 4NEED 2RCXA 3FKWA 1P9WA 3UE6A 3MXRA 4O01A 3I7JA 3WS4A 3ZQ5A 4MMNA 4UQIS 3R7WB 3C2WA 1J9MA 3K3DA 1FR6A 3IS2B 5HZHA 5L8MA 3OPRA 5EECA 1CEGA 1VETA 2HP5A 3F1NB 1NZUA 3LEZA 5CERA 4RA7A 1H0MA 1SKFA 1BLPA 1TS0A 2J80A 2OLUA 2XFTA 1ESUA 1E25A 3HJIA 4GOGA 3LUQA 4GDBA 5F1FA 4R6LA 2VK3A 5EPHA 4JF6A 2ZLYA 4HY8A 5GHYA 4HBUA 4Y3IA 3HLCA 4K0WA 3ZG5A 2XDMA 2XA7M 4E6WA 1NXYA 5DFYA 4Y0UA 4EEUA 4L0LA 5EM1A 1Z6FA 2XD1A 3T50A 4ZJ2A 2PDRA 2XK1A 3C38A 2PYRA 2VGLS 3G6OA 4I3IA 4ZDXA 1HZOA 2W0NA 1JWPA 3CPTB 4Q0IA 1F98A 1G28A 5A93A 4EEPA 2PD8A 3D72A 1LSVA 2QWSA 3IBRA 4CQHA 4EV4A 2DNSA 1S66L 1K54C 5JYOA 2XRNA 2ZC7A 1STZA 3QHYA 5TBMB 3IF6C 5FQJA 1LL9A 3PAGA 1J3WA 3FC7A 5HWTA 4E3OA 1PZPA 1P0ZA 4Z9QA 4DXCA 2Z6DA 3ZVTA 3HUMA 1SCWA 3IHAA 4BBVA 1YLJA 2J9PA 4BENA 3OOVA 3SS4A 1YKDA 3F1PB 5KIZA 3IH9A 4JXWA 3RTYA 4K91A 3IQAA 1KE4A 3M6BA 1MWSA 4EETB 3L7HA 5CHUA 4X68A 3SOIA 1T1BA 2JBFA 3BQAA 4R3AA 3PBSA 3LR4A 1KDWA 3PAEA 1YM1A 1OTEA 1KDSA 1HLUP 4WZ4A 2V0UA 4IUKA 4P6BA 1DJCA 3K2NA 3EOIA 4EU0A 2UV0E 2V8FA 3UPOA 4RVAA 5FAPA 4GKUA 4ETZA 3IXHA 4ZTKA 4R23A 5FQMA 3NBLA 2H10A 3UO9A 4IVKA 1KVMA 1XFNA 3E98A 1K6SA 3OBFA 3E4OA 3M2KA 4OP5A 1MWTA 4P85A 3JVUA 3G2ZA 3P98A 1ES3A 2H0YA 2JKTM 4KZ4A 3T1SA 3C7UA 1SDNA 1VHMA 4EESA 5KMWA 3A3DA 3IX8A 4GW9A 1TEMA 3LYXA 2LB9A 3IWQA 4GLQA 4JXGA 4JF4A 1CEFA 2VZWA 3M2JA 4NETA 1LL5A 3N8RA 2OAQ1 4WYYA 4KZ5A 3W4PA 3D3OA 4DJ3A 3G32A 1W8YA 4MN5A 3OCLA 2Y2OA 3NY4A 3WS2A 3S4XA 1HTZA 1K57A 1NRJA 1ERQA 4BD0A 5DF9A 1MBLA 4WZ5A 1HVBA 3NOTC 3HLEA 5EVLA 3LCEA 2QHKA 3NJAA 1NJ4A 2IWDA 2Y2MA 2YKFA 1VEUA 2R9XA 3DBAA 3Q07A 4XT2A 2WKRA 4QB8A 3LR5A 2Y2IA 5HFOA 3UE0A 1X0OA 1F5MA 3B33A 5F5YA 3FZCA 4HBTA 3H7WA 3OZHA 4RYEA 4OVDA 3OCNA 2FFFB 2OWHA 1OTDA 2EA9A 3T4KA 3GSGA 4HNBA 2H0TA 3HLFA 1ZC2A 4MBHA 4FCFA 1XJ2A 4QHCA 4HH2A 3O87A 3G31A 3Q7VB 1ES4A 3W2ZA 3PBOA 4GZBA 2Y2HA 1LT0A 1W7FA 2WK0A 1LLBA 5AQAA 4GN2A 5FI6A 4S2LA 3BECA 5DF8A 1E3UA 4ZJ1A 1L0EA 3LO7A 4PHTA 3K3CA 1IYSA 4OKPA 5CHJA 4S2IA 2ZM8A 1GSVA 1H8ZA 3EWKA 4WL9A 4LPZA 3T4OA 4UAAA 3KYEA 4PM7A 3B3XA 3ULFA 1IKIA 1NWZA 3ZG0A 4PM5A 2EXBA 4ETXA 4X55A 2WAEA 5HDSA 1UWNX 1N9NA 1N4OA 5A91A 4K08A 2G7UA 5DF7A 1YLWA 4X56A 3EQVA 4G3KA 4EQIA 1OTBA 4A5RA 4DN0A 3HVFA 3VSLA 3RXXA 3H82A 2PHYA 1LHYA 3UE3A 3F1OA 1G5UA 1LI0A 2D02A 3NCKA 1C3BA 1CQAA 4QY6A 5G4YA 5F69A 3NHQA 1XGIA 3LIDA 4CLCC 3ZYTA 1JWZA 3V3RA 5HL1A 1XPBA 2B95A 5KSHA 4OPRA 2ZD8A 4C75A 2XQZA 2W1TB 2ZC3B 3WS1A 3VP3A 3M6HA 3BRMA 3A0SA 3GV9A 4OOMA 3TE8A 1LSWA 1OTAA 4KZ9A 4X25A 4R0QA 2M7VA 3WRZA 5I5LA 4JGQA 5AQ9A 5FASA 3IBJA 1ONHA 3GR2A 2Y2KA 3P09A 2J3WA 1H3QA 3CMZA 2PU2A 4PAUA 4Y2FA 2P7JA 4WEJA 2WGVA 1CK3A 1YLZA 4HP9A 3VP2A 1D7EA 3F1OB 1U60A 1PW8A 5FEGA 2W3EA 5FQ9A 2WYXA 3IH8A 3BFFA 3R7WA 3LY4A 5FI7A 3IS2A 3MFDA 4LLOB 2A3UA 3F1NA 1G6OA 5FQQA 4R70A 4N9LA 1XXMA 4DKIA 3VV4A 2Y79A 4BD1A 1NLZA 3Q7ZA 2WGWB 3LGOA 5M18A 3VP0A 4DE2A 1AXBA 3VFFA 5IS1A 3GMWA 4YINA 4MLLA 3MR0A 1ZG6A 2WUQA 1MY8A 4IVIA 3KSIA 4S2PA 4WLAA 1N9BA 3BYDA 1K6RA 2HP9A 3NI9A 1DJBA 1DY6A 2VGJA 2V1AA 1VM1A 3BEBA 4PMAA 3FPWA 5EVEA 2VV6A 4QWOA 4MDZA 1FCMA 1XX2A 4L9FA 3CPTA 2IWBA 1FILA 2I9VA 3UE1A 4YFMA 3AGEA 2Y2LA 3G2YA 4KQDA 4JGOA 4IBXA 3T12B 4GS9B 4Y15A 2O9CA 4II7A 3ZG7B 5HARA 4QJGA 1ODVA 4M3KA 3U2AA 2J7VA 2XLNA 1YSQA 3UN7A 5I94A 1S0WA 2ZOIA 5TBMA 1ALQA 4KQQA 1BLSA 4U0XA 1Y28A 4WM9A 2OOLA 4WBGA 1GHIA 3EGDC 2HPBA 2V1ZA 2VJWA 4S2NA 1ZHHB 3HL9A 4EUVA 3F1PA 1XJ6A 1NZOA 3T4QA 2BTFP 2V2FF 4Z1WA 2G2UA 2JHEA 1IKGA 2PRFA 3CWFA 4QPRA 4E3MA 3BY8A 4EWFA 2VX8A 2Y55A 2ZL1B 3QP8A 3R4KA 1RP5A 2CC1A 1BZAA 4XXRA 1YAXA 4OLDA 2XGNA 4EXOA 3GVBA 5L10A 3TW8A 5E2HA 4X69A 2B18A 2JKTI 4I3AA 3PBQA 4BJPA 4DE1A 1N9OA 1DP8A 1NYYA 5DKLA 4LV0A 2GNXA 3N7WA 1MWUA 3PTEA 5HAPA 1K55C 3B47A 5FQKA 5E43A 4E3NA 4O8GA 5DKKA 3HLBA 1D06A 2L1MA 1ACFA 2MJ6A 5IU1A 1S1YA 4Q0HA 5CRFA 3E2KA 5EE8A 4P87A 3T4TA 5HDDA 1NRFA 4HP4A 1H5XA 3G34A 4NXBA 3QP6A 1VQQA 2Z6CA 3UPPA 1PYYA 2V0WA 3QP1A 4CLCB 2WADA 3NULA 4N1XA 3RFBA 2JCHA 3DWKA 4OQGA 3O5YA 4KUKA 1MPLA 4EQ1A 3BM6A 1EWZA 2K2NA 2VV8A 3EGXC 3PHYA 5J7EA 3IXBA 3L9KA 4R3BA 4Y17A 3TRCA 1OJ5A 3VP1A 5CGSA 3UPNA 3P01A 4PKYA 3N8SA 2JC7A 2HDQA 1L3LA 3ZGAB 3CG5A 1IYQA 1XKZA 1W79A 2J3TC 1ES5A 1WE4A 3C30A 4E6XA 4ARZB 3MQ0A 2O9AA 2QMIA 5HAQA 3MZDA 1ZTUA 2Y2QA 4QD4A 2HZ5A 3GTCA 4DF6A 4I3JA 3JYIA 3SZTA 1UWPX 5EVIC 1H8MA 5HX9A 2VGLM 3VE3A 4EBPA 4DXBA 2WGIA 2L0WA 3OLOA 1O07A 2P08A 4CPKA 2Y2NA 3UMEA 3DTMA 4KZ6A 4XUZA 2O99A 4X53A 1KE0A 2HP6A 4OQHA 1KOUA 2ZQAA 3IT9A 4EBLA 1JTGA 1OPXA 3BFDA 4QU3A 2L4RA 4M4XA 3UB5P 2C6WB 3LIEA 2DMWA 4NXFA 3W4QA 3CUEC 3Q7VA 1PIOA 3JPUA 1YMSA 3UDIA 1NYMA 2Y59A 4E04A 2UWXA 1P97A 3TSGA 2P74A 3VMAA 3E2LA 4F3LB 1SKOB 1RGZA 4DDYA 3BJNA 2OAP1 5HWWA 1PFLA 1M40A 2VA0A 4WMCD 4OPYA 4MNRA 2EX8A 2QKPA 1PWDA 4IBRA 2A24B 3A3EA 5GLBA 2VEAA 4KZ7A 5E2FA 2PR6A 2EFUA 2ZM2A 5CGWA 2OLVA 5GHZA 1T1AA 3DTIA 4N92A 2WKQA 1G6AA 2EX2A 1PRQA 3A3IA 1S1ZA 3CI6A 3C8CA 4I5SA 3CZDA 3PBNA 5FAQA 5EOOA 4GJ4A 1V9YA 1LL8A 3EEAA 4B4ZA 4KQOA 3IWIA 2V1BA 2P9VA 2Y2GA 2K31A 2G2WA 5CGXA 2Y8HA 4KZ3A 5CHMA 2RL3A 1S4RA 5GLCA 3BY9A 5U47A 1VB6A 1M6KA 3OPPA 4OOYA 2J9OA 1W63Q 2GJ3A 3OPHA 3W8KA 4O0PA 4P6ZM 1EW0A 1K38A 2W3HA 1F9IA 1YT4A 3IX4A 3O3VA 5G18A 3SS3A 4EERA 4IEDA 2PAVP 1OMEA 1ZKJA 5F82A 2XROA 1I2WA 2VKSA 3LIBA 3DW0A 2W1TA 1L2SA 4NKPA 1CI9A 3A3FA 3N6IA 2E8JA 1BTLA 4OPQA 1K4EA 3MKEA 1TS7A 1XP4A 1GHMA 2M1CA 4BBUA 1FOFA 5JYPA 1N9LA 3V5MA 4HJ4A 1FSYA 5HDCA 2KOIA 3SH7A 3ITAA 3T1RA 2YKHA 3S7NA 3ICYA 2ZC5B 1T1CA 3FV7A 5D3OA 2H5SA 2Y2JA 3RXWA 2QZ6A 3WWXA 1TVFA 2R78A 2Q0OA 5HPIA 3D9YA 4BBTA 4RQ9A 5FAOA 1AWIA 2PBDP 3IF6B 4CLCD 4HI4A 4JKTA 3IXDA 2M7UA 4BQMA
chains in the Genus database with same CATH topology
3GMWA 4YINA 4MLLA 2ZQ9A 1ZG6A 3MZEA 1S6RA 3UY6A 1K55A 1FCOA 4S2JA 2ZM0A 2P9VB 4KG2A 2WUQA 1MY8A 2ZQ8A 3LY3A 3RJUA 3N4IA 1XA7A 4IVIA 2DNSA 4EV4A 4S2PA 4UA6A 4Q8IA 1N9BA 3BYDA 5HAIA 4B4XA 1K6RA 3HREA 2HP9A 1K54C 5GL9A 3NI9A 5JYOA 1GCEA 3ZG8B 4FH2A 2ZC7A 1RGYA 3NIAA 3QHYA 3IF6C 1DJBA 1DY6A 5FQJA 2VGJA 1LL9A 1VM1A 3BEBA 3PAGA 4LENA 4PMAA 2X01A 4MBFA 5DTKA 1ONGA 4E3OA 1PZPA 1K54A 4Z9QA 2XF3A 4DXCA 4FH4A 1I2SA 3ZVTA 3A3JA 3IF6A 3V39A 1FCMA 2WGWA 1FSWA 1XX2A 1SCWA 3HUMA 3IHAA 4PPRA 5CTMA 2IWBA 4BLMA 3IHBA 5DTSA 4B88A 3UE1A 2PBYA 3WS0A 4HEFA 1YLJA 2J9PA 4YFMA 4BENA 3AGEA 2Y2LA 3G2YA 4GNUA 4JPMA 3SS4A 2HDUA 5F1GA 1ZG4A 3IH9A 5TR7A 4IBXA 4JXWA 4JXVA 3WS5A 4K91A 3IQAA 3ZG7B 1KE4A 1WYCA 4WMCA 5HARA 4QJGA 4OONA 3M6BA 2WZXA 3ZFZA 2JE5A 3C4OA 4M3KA 3VOYA 2J7VA 2XLNA 3UN7A 4PM8A 4GB7A 1MWSA 5I94A 1BUEA 1IELA 1S0WA 5CHUA 5EVIB 1XGJA 4BL2A 4X68A 1ALQA 3SOIA 4KQQA 1BLSA 2JBFA 3IWOA 3IF5A 4U0XA 4WM9A 3PBSA 1PW1A 4WBGA 5DTTA 1KDWA 1GHIA 3PAEA 1YM1A 2ZQ7A 1YLYA 2HPBA 4KZBA 3MZFA 4LV3A 1KDSA 4UHUA 4WZ4A 2V1ZA 1Q2PA 3G30A 4S2NA 4P6BA 4OP8A 3HL9A 1DJCA 5M1AA 5TGFA 1BULA 1NZOA 1PWGA 3BFGA 4Y7PA 3C4PA 3UPOA 3UDXA 1NY0A 3NC8A 4OQIA 2V2FF 3V3SA 4RVAA 3MKFA 3VOZA 5FAPA 2G2UA 4GKUA 1IKGA 3V50A 1YMXA 3IXHA 4WELA 4E3MA 5EVIA 4ZTKA 1RCJA 4R23A 5FQMA 4EWFA 1GA0A 1ESIA 2H10A 3NBLA 1FR1A 3UO9A 3ZVWA 4IVKA 1KVMA 2Y55A 4D2OA 4MBKA 4KG6A 2GDNA 1O7EA 1RP5A 4OOLA 1K6SA 2CC1A 3ISGA 1BZAA 3M2KA 4OP5A 4XXRA 4BQMA 4DE3A 1JWVA 1KGFA 1W8QA 1MWTA 3FWLA 2ZQDA 3G4PA 2WKEA 4ID4A 4OLDA 2XGNA 4E3JA 4P85A 3GVBA 4LCMA 2EX6A 3G2ZA 5E2HA 2BG1A 1ES3A 3P98A 4X69A 2H0YA 4KZ4A 3PBQA 3C7UA 2PU4A 4PM9A 1SDNA 3WRTA 4BJPA 4DE1A 5KMWA 5FDHA 3A3DA 5CEBA 1NYYA 2A49A 1TEMA 2BLSA 2X02A 1L0FA 4KENB 4LV0A 3IWQA 3N7WA 3ITBA 1MWUA 3AGFA 3PTEA 4JXGA 1H8YA 2XH9A 5HAPA 1K55C 5FQKA 4E3NA 4JF4A 5E43A 3QNBA 1CEFA 4RX2A 1W5DA 5CTNA 3M2JA 4NETA 3BLMA 3ZG9B 3HLBA 1LL5A 3N8RA 5FI2A 1ES2A 4WYYA 3SS5A 3OC2A 3BFCA 4KZ5A 5CRFA 3E2KA 3W4PA 1MKIA 1YQSA 3D4FA 3G32A 2DRWA 4KZ8A 4P87A 1W8YA 5EE8A 5EOEA 1NRFA 4R1GA 1H5XA 3G34A 5E2EA 3OCLA 2Y2OA 3NY4A 1VQQA 3UPPA 1PYYA 1K56A 3W4OA 3HLDA 1Q2QA 2Y4AA 4ZBEA 3S4XA 1HTZA 2WADA 3WS2A 1K57A 1ERQA 4BD0A 4N1XA 2JCHA 3DWKA 3MXSA 5CEDA 5DF9A 4OQGA 4N1HA 3O86A 1MPLA 4OQ0A 1MBLA 4P0MA 4WZ5A 1HVBA 3BM6A 4U0TA 2ZC4B 4Y0OA 3C7VA 1EWZA 3ZNYA 3HLEA 5EVLA 3LCEA 3HLWA 2QPNA 3S1YA 3BLSA 2XEPA 1NJ4A 2IWDA 4EUZA 3IXGA 2Y2MA 2R9XA 3Q07A 2ZJ9A 4KG5A 3PBTA 3IXBA 4R3BA 5FATA 4KQRA 3VP1A 1L0DA 4R4SA 4LCLA 5CGSA 4QB8A 2Y2IA 5HFOA 1E4DA 2J8YA 3UE0A 3UPNA 3FZCA 4HBTA 3N8SA 3OZHA 2JC7A 4RYEA 3FYZA 4EBNA 2WKHA 2HDQA 4OVDA 3OCNA 1Y54A 2Q9MA 1K25A 3ZGAB 3BFEA 3CG5A 1IYQA 3OPLA 4C6YA 2B5RA 2FFFB 3ZHHA 1XKZA 1W79A 2WZZA 5FQIA 3SH8A 2Z2MB 1ES5A 1WE4A 2R9WA 5AQ7A 4S2NC 3GSGA 4E6XA 4UA7A 3C5AA 2H0TA 4O7DA 3HLFA 1ZC2A 4MBHA 4JF5A 4FCFA 2QMIA 4PM6A 1BT5A 4QHCA 5HAQA 3MZDA 3O87A 2XD5A 2Y2QA 4QD4A 3VSKA 4R3JA 1IYOA 1GA9A 4H8RA 2EXAA 3G31A 1FQGA 3Q7VB 3GTCA 4DF6A 1ES4A 3PBOA 3JYIA 4GZBA 5J8XA 2Y2HA 3S22A 2WKIA 4GDNA 4K0XA 1W7FA 5EVIC 1K4FA 2EFXA 2WK0A 3Q82A 5HX9A 1LLBA 4EBPA 5TFQA 4JLFA 2WGIA 5AQAA 4DXBA 1BLHA 4JXSA 1O07A 4GN2A 4CPKA 2Y2NA 3HLGA 5FI6A 4S2LA 3BECA 3DTMA 4KZ6A 4X53A 4XUZA 5DF8A 4OH0A 2Z2LB 1KE0A 1GHPA 1E3UA 4ZJ1A 4DDSA 1JVJA 2HP6A 3Q1FA 4LV1A 4OQHA 3MBZA 1L0EA 2ZQAA 3IT9A 4EBLA 3O88A 2E8IA 1JTGA 3BFDA 3LO7A 4QU3A 5F83A 4CJNA 1EI5A 1IYSA 1TDGA 3AGDA 2C6WB 1SHVA 4UA9A 4OKPA 5CECA 2C5WB 3DWZA 5CHJA 5CXWA 4S2IA 2ZM8A 4LV2A 3W4QA 1KVLA 3Q7VA 1PIOA 5FA7A 4N9KA 2X71A 1H8ZA 3UDIA 1YMSA 3GRJA 1NYMA 2Y59A 5E2GA 4UAAA 4JBFA 2XR0A 3N8LA 3HUNA 4RX3A 1XA1A 1TDLA 3B3XA 1IKIA 4PM7A 1MWRA 4OLGA 2OSUA 1LI9A 2UWXA 1PWCA 3TSGA 2P74A 3ZG0A 4S2MA 4PM5A 4HESA 2EXBA 4S2KA 3VMAA 4X55A 3E2LA 2WAEA 3Q81A 4E3IA 4E3LA 1MXOA 1RGZA 2ZMAA 4DDYA 1N4OA 4GD8A 5A90A 5A91A 4U3TA 1IYPA 5DF7A 1K57C 1M40A 3UNWA 1L0GA 1YLWA 4OPYA 1KGGA 4WMCD 4X56A 5GLAA 3EQVA 4MNRA 1YLTA 4EQIA 2EX8A 4NK3A 4A5RA 1PWDA 4WZ5C 3HVFA 2HDSA 1JTDA 3CJMA 3VSLA 2FFYA 3NDGA 3RXXA 5L2FA 4IBRA 4MEZA 1HD8A 4WEKA 1LHYA 3A3EA 1G68A 4X6TA 3ZDJA 3UE3A 5GLBA 4KZ7A 5E2FA 1ERMA 4S2OA 1LI0A 3GQZA 1PI5A 5DVAA 2EFUA 2ZM2A 3NCKA 5CGWA 3SH9A 5HW3A 4FD8A 2OLVA 1QMFA 5GHZA 1I5QA 1C3BA 4N92A 1G6AA 1BLCA 4QY6A 2ZC6B 4Y0TA 1XGIA 2EX2A 5KSCA 3VP4A 3ZCZA 3A3IA 2XFSA 4R4RA 3NDEA 1DJAA 3CZDA 3PBNA 5FAQA 1BSGA 1JWZA 5EOOA 3V3RA 5HL1A 3UDFA 1XPBA 1PI4A 2Y2PA 2HDRA 5KSHA 4OPRA 5EVID 3QNCA 4B4ZA 2ZD8A 4C75A 1E3UD 3HUOA 4KQOA 2EX9A 4DE0A 5AQBA 3TOIA 3IWIA 2Q9NA 2XQZA 3PBRA 2IWCA 2Y91A 4XUXA 2ZC3B 3WS1A 3VP3A 2P9VA 2Y2GA 3M6HA 3BRMA 1EROA 2G2WA 4OPZA 3GV9A 4OOMA 5CGXA 5IHVA 2ZQCA 2VGKA 4KZ3A 2RCXA 5CHMA 2RL3A 4QY5A 3FKWA 1WYBA 4ZJ3A 5GLCA 5KZHA 5U47A 3MXRA 1M6KA 3OPPA 4OOYA 2J9OA 3I7JA 4F94A 3WS4A 3OPHA 3W8KA 3FKVA 4KZ9A 3TG9A 1K38A 4FSFA 3G35A 5FSRA 1J9MA 1SDEA 1FR6A 4BL3A 1FCNA 4R0QA 3WRZA 3OPRA 5EECA 1YT4A 1CEGA 3O3VA 5AQ9A 5EUAA 5FASA 3VFHA 5G18A 2HP5A 2V20A 3SS3A 5A92A 4IEDA 1ONHA 3GR2A 1OMEA 1ZKJA 2DCFA 2Y2KA 3P09A 5F82A 1NZUA 1I2WA 3LEZA 5CERA 4RA7A 3DW0A 1SKFA 1BLPA 5BOHA 1L2SA 2OLUA 2PU2A 2XFTA 3CMZA 4GD6A 2WAFA 1CI9A 3A3FA 1K56D 3N6IA 1ESUA 1E25A 4GOGA 1BTLA 4GDBA 5F1FA 5EPHA 1CI8A 4JF6A 4ZAMA 2WGVA 4WEJA 1CK3A 1YLZA 2ZLYA 1K4EA 1PZOA 4OPQA 3MKEA 1XP4A 1GHMA 5GHYA 2I72A 4HBUA 3VP2A 4E3KA 5M19A 1FOFA 4KZAA 1U60A 3HLCA 5JYPA 1PW8A 4K0WA 3V5MA 3ZG5A 4C3QA 1FSYA 2XDMA 5FQ9A 2WYXA 3IH8A 3SH7A 3ZNTA 3ITAA 4E6WA 1YLPA 3BFFA 1NXYA 2ZC5B 4Y0UA 3FV7A 3LY4A 5FI7A 1IEMA 5D3OA 2H5SA 2Y2JA 3MFDA 4L0LA 3RXWA 1Z6FA 2A3UA 2XD1A 2QZ6A 3WWXA 1TVFA 4ZJ2A 2XK1A 1KGEA 5FQQA 4N9LA 5FAOA 4DRTA 1XXMA 4DKIA 4ZDXA 1HZOA 3HBRA 3IF6B 5GHXA 3Q7ZA 5GLDA 4BD1A 2WGWB 1JWPA 1KE3A 5M18A 3VP0A 1QMEA 4DE2A 1AXBA 3EQUA 3VFFA 4JKTA 5A93A 3IXDA 2OV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMW A;  4YIN A;  4MLL A;  2ZQ9 A;  1ZG6 A;  3MZE A;  1S6R A;  3UY6 A;  1K55 A;  1FCO A;  4S2J A;  2ZM0 A;  2P9V B;  4KG2 A;  2WUQ A;  1MY8 A;  2ZQ8 A;  3LY3 A;  3RJU A;  3N4I A;  1XA7 A;  4IVI A;  2DNS A;  4EV4 A;  4S2P A;  4UA6 A;  4Q8I A;  1N9B A;  3BYD A;  5HAI A;  4B4X A;  1K6R A;  3HRE A;  2HP9 A;  1K54 C;  5GL9 A;  3NI9 A;  5JYO A;  1GCE A;  3ZG8 B;  4FH2 A;  2ZC7 A;  1RGY A;  3NIA A;  3QHY A;  3IF6 C;  1DJB A;  1DY6 A;  5FQJ A;  2VGJ A;  1LL9 A;  1VM1 A;  3BEB A;  3PAG A;  4LEN A;  4PMA A;  2X01 A;  4MBF A;  5DTK A;  1ONG A;  4E3O A;  1PZP A;  1K54 A;  4Z9Q A;  2XF3 A;  4DXC A;  4FH4 A;  1I2S A;  3ZVT A;  3A3J A;  3IF6 A;  3V39 A;  1FCM A;  2WGW A;  1FSW A;  1XX2 A;  1SCW A;  3HUM A;  3IHA A;  4PPR A;  5CTM A;  2IWB A;  4BLM A;  3IHB A;  5DTS A;  4B88 A;  3UE1 A;  2PBY A;  3WS0 A;  4HEF A;  1YLJ A;  2J9P A;  4YFM A;  4BEN A;  3AGE A;  2Y2L A;  3G2Y A;  4GNU A;  4JPM A;  3SS4 A;  2HDU A;  5F1G A;  1ZG4 A;  3IH9 A;  5TR7 A;  4IBX A;  4JXW A;  4JXV A;  3WS5 A;  4K91 A;  3IQA A;  3ZG7 B;  1KE4 A;  1WYC A;  4WMC A;  5HAR A;  4QJG A;  4OON A;  3M6B A;  2WZX A;  3ZFZ A;  2JE5 A;  3C4O A;  4M3K A;  3VOY A;  2J7V A;  2XLN A;  3UN7 A;  4PM8 A;  4GB7 A;  1MWS A;  5I94 A;  1BUE A;  1IEL A;  1S0W A;  5CHU A;  5EVI B;  1XGJ A;  4BL2 A;  4X68 A;  1ALQ A;  3SOI A;  4KQQ A;  1BLS A;  2JBF A;  3IWO A;  3IF5 A;  4U0X A;  4WM9 A;  3PBS A;  1PW1 A;  4WBG A;  5DTT A;  1KDW A;  1GHI A;  3PAE A;  1YM1 A;  2ZQ7 A;  1YLY A;  2HPB A;  4KZB A;  3MZF A;  4LV3 A;  1KDS A;  4UHU A;  4WZ4 A;  2V1Z A;  1Q2P A;  3G30 A;  4S2N A;  4P6B A;  4OP8 A;  3HL9 A;  1DJC A;  5M1A A;  5TGF A;  1BUL A;  1NZO A;  1PWG A;  3BFG A;  4Y7P A;  3C4P A;  3UPO A;  3UDX A;  1NY0 A;  3NC8 A;  4OQI A;  2V2F F;  3V3S A;  4RVA A;  3MKF A;  3VOZ A;  5FAP A;  2G2U A;  4GKU A;  1IKG A;  3V50 A;  1YMX A;  3IXH A;  4WEL A;  4E3M A;  5EVI A;  4ZTK A;  1RCJ A;  4R23 A;  5FQM A;  4EWF A;  1GA0 A;  1ESI A;  2H10 A;  3NBL A;  1FR1 A;  3UO9 A;  3ZVW A;  4IVK A;  1KVM A;  2Y55 A;  4D2O A;  4MBK A;  4KG6 A;  2GDN A;  1O7E A;  1RP5 A;  4OOL A;  1K6S A;  2CC1 A;  3ISG A;  1BZA A;  3M2K A;  4OP5 A;  4XXR A;  4BQM A;  4DE3 A;  1JWV A;  1KGF A;  1W8Q A;  1MWT A;  3FWL A;  2ZQD A;  3G4P A;  2WKE A;  4ID4 A;  4OLD A;  2XGN A;  4E3J A;  4P85 A;  3GVB A;  4LCM A;  2EX6 A;  3G2Z A;  5E2H A;  2BG1 A;  1ES3 A;  3P98 A;  4X69 A;  2H0Y A;  4KZ4 A;  3PBQ A;  3C7U A;  2PU4 A;  4PM9 A;  1SDN A;  3WRT A;  4BJP A;  4DE1 A;  5KMW A;  5FDH A;  3A3D A;  5CEB A;  1NYY A;  2A49 A;  1TEM A;  2BLS A;  2X02 A;  1L0F A;  4KEN B;  4LV0 A;  3IWQ A;  3N7W A;  3ITB A;  1MWU A;  3AGF A;  3PTE A;  4JXG A;  1H8Y A;  2XH9 A;  5HAP A;  1K55 C;  5FQK A;  4E3N A;  4JF4 A;  5E43 A;  3QNB A;  1CEF A;  4RX2 A;  1W5D A;  5CTN A;  3M2J A;  4NET A;  3BLM A;  3ZG9 B;  3HLB A;  1LL5 A;  3N8R A;  5FI2 A;  1ES2 A;  4WYY A;  3SS5 A;  3OC2 A;  3BFC A;  4KZ5 A;  5CRF A;  3E2K A;  3W4P A;  1MKI A;  1YQS A;  3D4F A;  3G32 A;  2DRW A;  4KZ8 A;  4P87 A;  1W8Y A;  5EE8 A;  5EOE A;  1NRF A;  4R1G A;  1H5X A;  3G34 A;  5E2E A;  3OCL A;  2Y2O A;  3NY4 A;  1VQQ A;  3UPP A;  1PYY A;  1K56 A;  3W4O A;  3HLD A;  1Q2Q A;  2Y4A A;  4ZBE A;  3S4X A;  1HTZ A;  2WAD A;  3WS2 A;  1K57 A;  1ERQ A;  4BD0 A;  4N1X A;  2JCH A;  3DWK A;  3MXS A;  5CED A;  5DF9 A;  4OQG A;  4N1H A;  3O86 A;  1MPL A;  4OQ0 A;  1MBL A;  4P0M A;  4WZ5 A;  1HVB A;  3BM6 A;  4U0T A;  2ZC4 B;  4Y0O A;  3C7V A;  1EWZ A;  3ZNY A;  3HLE A;  5EVL A;  3LCE A;  3HLW A;  2QPN A;  3S1Y A;  3BLS A;  2XEP A;  1NJ4 A;  2IWD A;  4EUZ A;  3IXG A;  2Y2M A;  2R9X A;  3Q07 A;  2ZJ9 A;  4KG5 A;  3PBT A;  3IXB A;  4R3B A;  5FAT A;  4KQR A;  3VP1 A;  1L0D A;  4R4S A;  4LCL A;  5CGS A;  4QB8 A;  2Y2I A;  5HFO A;  1E4D A;  2J8Y A;  3UE0 A;  3UPN A;  3FZC A;  4HBT A;  3N8S A;  3OZH A;  2JC7 A;  4RYE A;  3FYZ A;  4EBN A;  2WKH A;  2HDQ A;  4OVD A;  3OCN A;  1Y54 A;  2Q9M A;  1K25 A;  3ZGA B;  3BFE A;  3CG5 A;  1IYQ A;  3OPL A;  4C6Y A;  2B5R A;  2FFF B;  3ZHH A;  1XKZ A;  1W79 A;  2WZZ A;  5FQI A;  3SH8 A;  2Z2M B;  1ES5 A;  1WE4 A;  2R9W A;  5AQ7 A;  4S2N C;  3GSG A;  4E6X A;  4UA7 A;  3C5A A;  2H0T A;  4O7D A;  3HLF A;  1ZC2 A;  4MBH A;  4JF5 A;  4FCF A;  2QMI A;  4PM6 A;  1BT5 A;  4QHC A;  5HAQ A;  3MZD A;  3O87 A;  2XD5 A;  2Y2Q A;  4QD4 A;  3VSK A;  4R3J A;  1IYO A;  1GA9 A;  4H8R A;  2EXA A;  3G31 A;  1FQG A;  3Q7V B;  3GTC A;  4DF6 A;  1ES4 A;  3PBO A;  3JYI A;  4GZB A;  5J8X A;  2Y2H A;  3S22 A;  2WKI A;  4GDN A;  4K0X A;  1W7F A;  5EVI C;  1K4F A;  2EFX A;  2WK0 A;  3Q82 A;  5HX9 A;  1LLB A;  4EBP A;  5TFQ A;  4JLF A;  2WGI A;  5AQA A;  4DXB A;  1BLH A;  4JXS A;  1O07 A;  4GN2 A;  4CPK A;  2Y2N A;  3HLG A;  5FI6 A;  4S2L A;  3BEC A;  3DTM A;  4KZ6 A;  4X53 A;  4XUZ A;  5DF8 A;  4OH0 A;  2Z2L B;  1KE0 A;  1GHP A;  1E3U A;  4ZJ1 A;  4DDS A;  1JVJ A;  2HP6 A;  3Q1F A;  4LV1 A;  4OQH A;  3MBZ A;  1L0E A;  2ZQA A;  3IT9 A;  4EBL A;  3O88 A;  2E8I A;  1JTG A;  3BFD A;  3LO7 A;  4QU3 A;  5F83 A;  4CJN A;  1EI5 A;  1IYS A;  1TDG A;  3AGD A;  2C6W B;  1SHV A;  4UA9 A;  4OKP A;  5CEC A;  2C5W B;  3DWZ A;  5CHJ A;  5CXW A;  4S2I A;  2ZM8 A;  4LV2 A;  3W4Q A;  1KVL A;  3Q7V A;  1PIO A;  5FA7 A;  4N9K A;  2X71 A;  1H8Z A;  3UDI A;  1YMS A;  3GRJ A;  1NYM A;  2Y59 A;  5E2G A;  4UAA A;  4JBF A;  2XR0 A;  3N8L A;  3HUN A;  4RX3 A;  1XA1 A;  1TDL A;  3B3X A;  1IKI A;  4PM7 A;  1MWR A;  4OLG A;  2OSU A;  1LI9 A;  2UWX A;  1PWC A;  3TSG A;  2P74 A;  3ZG0 A;  4S2M A;  4PM5 A;  4HES A;  2EXB A;  4S2K A;  3VMA A;  4X55 A;  3E2L A;  2WAE A;  3Q81 A;  4E3I A;  4E3L A;  1MXO A;  1RGZ A;  2ZMA A;  4DDY A;  1N4O A;  4GD8 A;  5A90 A;  5A91 A;  4U3T A;  1IYP A;  5DF7 A;  1K57 C;  1M40 A;  3UNW A;  1L0G A;  1YLW A;  4OPY A;  1KGG A;  4WMC D;  4X56 A;  5GLA A;  3EQV A;  4MNR A;  1YLT A;  4EQI A;  2EX8 A;  4NK3 A;  4A5R A;  1PWD A;  4WZ5 C;  3HVF A;  2HDS A;  1JTD A;  3CJM A;  3VSL A;  2FFY A;  3NDG A;  3RXX A;  5L2F A;  4IBR A;  4MEZ A;  1HD8 A;  4WEK A;  1LHY A;  3A3E A;  1G68 A;  4X6T A;  3ZDJ A;  3UE3 A;  5GLB A;  4KZ7 A;  5E2F A;  1ERM A;  4S2O A;  1LI0 A;  3GQZ A;  1PI5 A;  5DVA A;  2EFU A;  2ZM2 A;  3NCK A;  5CGW A;  3SH9 A;  5HW3 A;  4FD8 A;  2OLV A;  1QMF A;  5GHZ A;  1I5Q A;  1C3B A;  4N92 A;  1G6A A;  1BLC A;  4QY6 A;  2ZC6 B;  4Y0T A;  1XGI A;  2EX2 A;  5KSC A;  3VP4 A;  3ZCZ A;  3A3I A;  2XFS A;  4R4R A;  3NDE A;  1DJA A;  3CZD A;  3PBN A;  5FAQ A;  1BSG A;  1JWZ A;  5EOO A;  3V3R A;  5HL1 A;  3UDF A;  1XPB A;  1PI4 A;  2Y2P A;  2HDR A;  5KSH A;  4OPR A;  5EVI D;  3QNC A;  4B4Z A;  2ZD8 A;  4C75 A;  1E3U D;  3HUO A;  4KQO A;  2EX9 A;  4DE0 A;  5AQB A;  3TOI A;  3IWI A;  2Q9N A;  2XQZ A;  3PBR A;  2IWC A;  2Y91 A;  4XUX A;  2ZC3 B;  3WS1 A;  3VP3 A;  2P9V A;  2Y2G A;  3M6H A;  3BRM A;  1ERO A;  2G2W A;  4OPZ A;  3GV9 A;  4OOM A;  5CGX A;  5IHV A;  2ZQC A;  2VGK A;  4KZ3 A;  2RCX A;  5CHM A;  2RL3 A;  4QY5 A;  3FKW A;  1WYB A;  4ZJ3 A;  5GLC A;  5KZH A;  5U47 A;  3MXR A;  1M6K A;  3OPP A;  4OOY A;  2J9O A;  3I7J A;  4F94 A;  3WS4 A;  3OPH A;  3W8K A;  3FKV A;  4KZ9 A;  3TG9 A;  1K38 A;  4FSF A;  3G35 A;  5FSR A;  1J9M A;  1SDE A;  1FR6 A;  4BL3 A;  1FCN A;  4R0Q A;  3WRZ A;  3OPR A;  5EEC A;  1YT4 A;  1CEG A;  3O3V A;  5AQ9 A;  5EUA A;  5FAS A;  3VFH A;  5G18 A;  2HP5 A;  2V20 A;  3SS3 A;  5A92 A;  4IED A;  1ONH A;  3GR2 A;  1OME A;  1ZKJ A;  2DCF A;  2Y2K A;  3P09 A;  5F82 A;  1NZU A;  1I2W A;  3LEZ A;  5CER A;  4RA7 A;  3DW0 A;  1SKF A;  1BLP A;  5BOH A;  1L2S A;  2OLU A;  2PU2 A;  2XFT A;  3CMZ A;  4GD6 A;  2WAF A;  1CI9 A;  3A3F A;  1K56 D;  3N6I A;  1ESU A;  1E25 A;  4GOG A;  1BTL A;  4GDB A;  5F1F A;  5EPH A;  1CI8 A;  4JF6 A;  4ZAM A;  2WGV A;  4WEJ A;  1CK3 A;  1YLZ A;  2ZLY A;  1K4E A;  1PZO A;  4OPQ A;  3MKE A;  1XP4 A;  1GHM A;  5GHY A;  2I72 A;  4HBU A;  3VP2 A;  4E3K A;  5M19 A;  1FOF A;  4KZA A;  1U60 A;  3HLC A;  5JYP A;  1PW8 A;  4K0W A;  3V5M A;  3ZG5 A;  4C3Q A;  1FSY A;  2XDM A;  5FQ9 A;  2WYX A;  3IH8 A;  3SH7 A;  3ZNT A;  3ITA A;  4E6W A;  1YLP A;  3BFF A;  1NXY A;  2ZC5 B;  4Y0U A;  3FV7 A;  3LY4 A;  5FI7 A;  1IEM A;  5D3O A;  2H5S A;  2Y2J A;  3MFD A;  4L0L A;  3RXW A;  1Z6F A;  2A3U A;  2XD1 A;  2QZ6 A;  3WWX A;  1TVF A;  4ZJ2 A;  2XK1 A;  1KGE A;  5FQQ A;  4N9L A;  5FAO A;  4DRT A;  1XXM A;  4DKI A;  4ZDX A;  1HZO A;  3HBR A;  3IF6 B;  5GHX A;  3Q7Z A;  5GLD A;  4BD1 A;  2WGW B;  1JWP A;  1KE3 A;  5M18 A;  3VP0 A;  1QME A;  4DE2 A;  1AXB A;  3EQU A;  3VFF A;  4JKT A;  5A93 A;  3IXD A;  2OV5 A; 
#chains in the Genus database with same CATH topology
 2V9A A;  2ZQ9 A;  3MZE A;  1FCO A;  2P9V B;  2PYP A;  2ZOH A;  3VE4 A;  3KSF A;  2ZQ8 A;  3LY3 A;  3RJU A;  1XA7 A;  4MN7 A;  1DP9 A;  1A0K A;  3HRE A;  2QJ5 A;  1GCE A;  4I39 A;  3ZG8 B;  4FH2 A;  4GHI B;  1RGY A;  3NIA A;  3SW1 A;  2X01 A;  4MBF A;  2PT7 A;  1ONG A;  5CX7 A;  2XF3 A;  4FH4 A;  3V39 A;  2WGW A;  1FSW A;  5CTM A;  4PPR A;  3TJZ C;  4BLM A;  1S67 L;  5DTS A;  4B88 A;  3WS0 A;  2PBY A;  2K7S A;  4HEF A;  2NUT C;  5F1G A;  4BMW A;  4LGW A;  2AVX A;  1ZG4 A;  5TR7 A;  3WS5 A;  1WYC A;  4WMC A;  4OON A;  2WZX A;  2JE5 A;  3VOY A;  2VV7 A;  4PM8 A;  4GB7 A;  1IEL A;  5EVI B;  1XGJ A;  4BL2 A;  5HD5 A;  3IWO A;  2O0Y A;  2ZQ7 A;  4KZB A;  4LV3 A;  4GCZ A;  1MC0 A;  4OP8 A;  4G3W A;  4Q0J A;  4IHQ A;  3BFG A;  4Y7P A;  3T4J A;  5FEF A;  2FH5 A;  4OQI A;  4GS9 A;  1BYW A;  3VOZ A;  3V50 A;  2KDK A;  1RCJ A;  4D2O A;  3DTK A;  3ZVW A;  3MS6 A;  1O7E A;  4OOL A;  3T4L A;  2JKR I;  1JWV A;  1KGF A;  3FWL A;  2ZQD A;  2VLG A;  2WKE A;  4ID4 A;  4E3J A;  3QP4 A;  5L07 A;  2PU4 A;  4PM9 A;  3WRT A;  5CEB A;  2BLS A;  2X02 A;  1Z09 A;  3LR0 A;  3UMD A;  3ITB A;  1H8Y A;  3MF0 A;  4RX2 A;  5CTN A;  3KX0 X;  1ES2 A;  3VOL A;  1TS8 A;  3SS5 A;  2ZL1 A;  3D4F A;  5EOE A;  4R1G A;  5FL3 A;  3CIT A;  3FPV A;  2ZMF A;  1UGU A;  5K5B A;  3W4O A;  2Y4A A;  3LEQ A;  3MXS A;  2NUP C;  5CED A;  4N1H A;  4ZRR A;  2W3F A;  2XA7 S;  4P0M A;  5F68 A;  4X1L A;  3C7V A;  3ZNY A;  1OT9 A;  2QPN A;  2XEP A;  5FDS A;  4EUZ A;  2GX5 A;  1W63 M;  1JNU A;  2ZJ9 A;  4KQR A;  5C5K A;  4R4S A;  4LCL A;  2J8Y A;  5EV0 A;  3CLO A;  3FYZ A;  4EBN A;  1Y54 A;  2Q9M A;  4CLC A;  3OPL A;  5DFX A;  2B5R A;  4IUH A;  3ZHH A;  5FQI A;  4MCW A;  2R9W A;  5F6A A;  4UA7 A;  3C5A A;  4H6J B;  4JF5 A;  2W27 A;  3H9W A;  1BT5 A;  2XD5 A;  3VSK A;  2B02 A;  4H8R A;  2EXA A;  5LBR A;  1FQG A;  3P7N A;  2HV1 A;  2WKI A;  3KSH A;  4K0X A;  4NXE A;  1K4F A;  3Q82 A;  3E4P A;  4JLF A;  3HLG A;  1F2K A;  4OH0 A;  2Z2L B;  2FZ0 A;  4DDS A;  3Q1F A;  4LV1 A;  3EEH A;  2JKR M;  5F83 A;  4HQA A;  4ARZ A;  4CJN A;  1EI5 A;  4UA9 A;  1Y4O A;  3DWZ A;  5AJG A;  5J4E A;  2D01 A;  5FA7 A;  1WA9 A;  3GRJ A;  1T19 A;  5E2G A;  1PNE A;  4RX3 A;  2JN7 A;  1TDL A;  1PWC A;  4S2M A;  4HES A;  4S2K A;  4EW7 A;  3Q81 A;  4E3I A;  4E3L A;  5HPF A;  2ZMA A;  3UB9 A;  2V8C A;  5A90 A;  1XJ3 A;  2EWW A;  1K57 C;  2XSS A;  3UNW A;  4KUO A;  1L0G A;  1YLT A;  4ME4 A;  3MMH A;  4NK3 A;  4WZ5 C;  3E0Y A;  1JTD A;  3CJM A;  2FFY A;  3NDG A;  5L2F A;  1HD8 A;  2ZMV A;  2W3G A;  1DRM A;  4X6T A;  4D60 A;  1MKM A;  4S2O A;  1D1J A;  3QP5 A;  3LI9 A;  4UQI M;  5DVA A;  2J3T D;  5HW3 A;  4FD8 A;  1QMF A;  4F3L A;  1SKO A;  1BLC A;  3LIF A;  4Y0T A;  3V67 A;  2XFS A;  3S7Q A;  4R4R A;  1GSX A;  1LSX A;  2INW A;  1SZV A;  3MJQ A;  1V9Z A;  1IFQ A;  3RH8 B;  3UDF A;  2HJE A;  1VET B;  4HH3 A;  5EVI D;  2A24 A;  3S7O A;  1E3U D;  3HUO A;  2EX9 A;  3LIA A;  5AQB A;  3TOI A;  2Q9N A;  4HHD A;  3PBR A;  2IWC A;  2Y91 A;  4XUX A;  5DJT A;  3T1X A;  3JVV A;  2HGV A;  3LR3 A;  3MFX A;  2VGK A;  2WKP A;  3CAX A;  4QY5 A;  1WYB A;  4ZJ3 A;  5KZH A;  5HWV A;  3PXP A;  5A8B A;  4F94 A;  1K0K A;  2PD7 A;  3LFV A;  3FKV A;  3TG9 A;  4FSF A;  5FSR A;  3G35 A;  4NXG A;  1SDE A;  1GSW A;  4BL3 A;  2HJ9 C;  1FCN A;  5EUA A;  3LIC A;  3VFH A;  2V20 A;  2W3D A;  5A92 A;  2DCF A;  3B42 A;  2P04 A;  5HSQ A;  5BOH A;  5EM0 A;  3GEC A;  4GD6 A;  3FG8 A;  2WAF A;  2ZBB A;  1K56 D;  3T4S A;  1CI8 A;  4ZAM A;  2IA2 A;  1PZO A;  5M19 A;  2I72 A;  2JKF A;  4E3K A;  4KZA A;  4C3Q A;  3ZNT A;  1YLP A;  4PKY G;  5G4Z A;  1MZU A;  1IEM A;  5L09 A;  4LRX C;  2H28 A;  3LI8 A;  4YWZ A;  1KGE A;  4B93 A;  4DRT A;  4P6Z S;  4HJ3 A;  4YNR A;  3HBR A;  5GLD A;  5GHX A;  1KE3 A;  1QME A;  3EQU A;  2OV5 A;  3GDI A;  1S6R A;  3UY6 A;  1K55 A;  4S2J A;  2ZM0 A;  4KG2 A;  4DJ2 A;  3N4I A;  4UA6 A;  4Q8I A;  5HAI A;  4B4X A;  5GL9 A;  1IOU A;  4JGP A;  4WF0 A;  4LEN A;  5DTK A;  1K54 A;  5HD3 A;  3QP2 A;  1I2S A;  3A3J A;  3IF6 A;  1FIK A;  1S4S A;  3IHB A;  4WUJ A;  4JPM A;  4GNU A;  2HDU A;  4Y13 A;  2GZA A;  4JXV A;  3ZFZ A;  3C4O A;  1BUE A;  4GHI A;  1OJG A;  2KLI A;  3DTE A;  5TJJ A;  4BWI A;  3IF5 A;  1NLY A;  1PW1 A;  5DTT A;  5EFW A;  3MQQ A;  1YLY A;  3MZF A;  4UHU A;  1Q2P A;  3G30 A;  5M1A A;  5TGF A;  1BUL A;  3E4Q A;  1PWG A;  3C4P A;  3UDX A;  1NY0 A;  1CF0 A;  3NEC A;  3NC8 A;  3MSH A;  1P9R A;  3V3S A;  3MKF A;  2KX6 A;  1YMX A;  3KYQ A;  4WEL A;  3A0R A;  5EVI A;  3MXQ A;  1GA0 A;  1ESI A;  1FR1 A;  4MBK A;  4KG6 A;  2GDN A;  3ISG A;  4DE3 A;  1W8Q A;  3U4L P;  3G4P A;  3A0V A;  4LCM A;  2EX6 A;  2BG1 A;  4LFU A;  3UB8 A;  1OT6 A;  5FDH A;  2A49 A;  1L0F A;  4KEN B;  2EWV A;  3AGF A;  3CUE A;  2XH9 A;  3QNB A;  1VEU B;  1W5D A;  3ZG9 B;  3BLM A;  4XT2 B;  4ESP A;  2QYB A;  2A2L A;  5FI2 A;  3OC2 A;  4Y5F A;  3BFC A;  4HOI A;  4LRZ E;  4YOF A;  1MKI A;  1YQS A;  4KZ8 A;  2DRW A;  3NOP C;  3H7W B;  5E2E A;  4R38 A;  4WN5 A;  4AFI A;  1K56 A;  3HLD A;  1Q2Q A;  4ZBE A;  3DAV A;  3KO6 A;  3O86 A;  4OQ0 A;  4U0T A;  2ZC4 B;  4LRY C;  4Y0O A;  3UB6 A;  3HLW A;  3S1Y A;  3BLS A;  3IXG A;  4NG2 A;  4KG5 A;  3PBT A;  5FAT A;  1L0D A;  1E4D A;  4CLC E;  4HIA A;  2WKH A;  3BWL A;  4HJ6 A;  1K25 A;  2CMN A;  3BFE A;  4C6Y A;  2WZZ A;  4FTX A;  3SH8 A;  2Z2M B;  5AQ7 A;  4S2N C;  5J3W A;  1TF1 A;  4L9G A;  2JKG A;  4O7D A;  5AVF A;  4PM6 A;  3CHW P;  5MC7 A;  4R3J A;  1IYO A;  1GA9 A;  4IJG A;  3HCY A;  5J8X A;  3S22 A;  4GDN A;  4FOF A;  2LB5 A;  2EFX A;  5TFQ A;  1BLH A;  4L9E A;  1TD5 A;  4JXS A;  5HL6 A;  5DJU A;  1GHP A;  4B9O A;  1JVJ A;  3MBZ A;  3O88 A;  2E8I A;  5AVE A;  4H6J A;  1TDG A;  3AGD A;  1CJF A;  1SHV A;  5CEC A;  2C5W B;  4I38 A;  4MN6 A;  3MQO A;  5CXW A;  3H82 B;  4LV2 A;  1KVL A;  4N9K A;  2X71 A;  4DMZ A;  4JBF A;  3HJK A;  3N8L A;  2XR0 A;  3HUN A;  1XA1 A;  1MWR A;  4OLG A;  1DP6 A;  1LI9 A;  2OSU A;  1XFQ A;  4FUW A;  3KSG A;  2BAS A;  1MXO A;  4GD8 A;  4U3T A;  5IT5 A;  1IYP A;  3KYZ A;  4X1M A;  2W1R A;  5GLA A;  1KGG A;  3UB7 A;  2HF6 A;  2HDS A;  4MEZ A;  4WEK A;  1G68 A;  3ZDJ A;  1ERM A;  3GQZ A;  1PI5 A;  1OTI A;  3S7P A;  3PYP A;  3SH9 A;  1I5Q A;  1TS6 A;  2ZC6 B;  2ACG A;  2OWJ A;  3T1Q B;  3NOU C;  5KSC A;  4G3V A;  3VP4 A;  3ZCZ A;  3PR6 A;  3NDE A;  1DJA A;  2O9B A;  1BSG A;  1YPR A;  2PR5 A;  3IX3 A;  1PI4 A;  2Y2P A;  4UEY A;  1XJ4 A;  2HDR A;  4JGR A;  3QNC A;  4DE0 A;  1YSP A;  1T18 A;  2QJ7 A;  3BW6 A;  1ERO A;  4OPZ A;  3BQ8 A;  5IHV A;  2ZQC A;  4NEE D;  2RCX A;  3FKW A;  1P9W A;  3UE6 A;  3MXR A;  4O01 A;  3I7J A;  3WS4 A;  3ZQ5 A;  4MMN A;  4UQI S;  3R7W B;  3C2W A;  1J9M A;  3K3D A;  1FR6 A;  3IS2 B;  5HZH A;  5L8M A;  3OPR A;  5EEC A;  1CEG A;  1VET A;  2HP5 A;  3F1N B;  1NZU A;  3LEZ A;  5CER A;  4RA7 A;  1H0M A;  1SKF A;  1BLP A;  1TS0 A;  2J80 A;  2OLU A;  2XFT A;  1ESU A;  1E25 A;  3HJI A;  4GOG A;  3LUQ A;  4GDB A;  5F1F A;  4R6L A;  2VK3 A;  5EPH A;  4JF6 A;  2ZLY A;  4HY8 A;  5GHY A;  4HBU A;  4Y3I A;  3HLC A;  4K0W A;  3ZG5 A;  2XDM A;  2XA7 M;  4E6W A;  1NXY A;  5DFY A;  4Y0U A;  4EEU A;  4L0L A;  5EM1 A;  1Z6F A;  2XD1 A;  3T50 A;  4ZJ2 A;  2PDR A;  2XK1 A;  3C38 A;  2PYR A;  2VGL S;  3G6O A;  4I3I A;  4ZDX A;  1HZO A;  2W0N A;  1JWP A;  3CPT B;  4Q0I A;  1F98 A;  1G28 A;  5A93 A;  4EEP A;  2PD8 A;  3D72 A;  1LSV A;  2QWS A;  3IBR A;  4CQH A;  4EV4 A;  2DNS A;  1S66 L;  1K54 C;  5JYO A;  2XRN A;  2ZC7 A;  1STZ A;  3QHY A;  5TBM B;  3IF6 C;  5FQJ A;  1LL9 A;  3PAG A;  1J3W A;  3FC7 A;  5HWT A;  4E3O A;  1PZP A;  1P0Z A;  4Z9Q A;  4DXC A;  2Z6D A;  3ZVT A;  3HUM A;  1SCW A;  3IHA A;  4BBV A;  1YLJ A;  2J9P A;  4BEN A;  3OOV A;  3SS4 A;  1YKD A;  3F1P B;  5KIZ A;  3IH9 A;  4JXW A;  3RTY A;  4K91 A;  3IQA A;  1KE4 A;  3M6B A;  1MWS A;  4EET B;  3L7H A;  5CHU A;  4X68 A;  3SOI A;  1T1B A;  2JBF A;  3BQA A;  4R3A A;  3PBS A;  3LR4 A;  1KDW A;  3PAE A;  1YM1 A;  1OTE A;  1KDS A;  1HLU P;  4WZ4 A;  2V0U A;  4IUK A;  4P6B A;  1DJC A;  3K2N A;  3EOI A;  4EU0 A;  2UV0 E;  2V8F A;  3UPO A;  4RVA A;  5FAP A;  4GKU A;  4ETZ A;  3IXH A;  4ZTK A;  4R23 A;  5FQM A;  3NBL A;  2H10 A;  3UO9 A;  4IVK A;  1KVM A;  1XFN A;  3E98 A;  1K6S A;  3OBF A;  3E4O A;  3M2K A;  4OP5 A;  1MWT A;  4P85 A;  3JVU A;  3G2Z A;  3P98 A;  1ES3 A;  2H0Y A;  2JKT M;  4KZ4 A;  3T1S A;  3C7U A;  1SDN A;  1VHM A;  4EES A;  5KMW A;  3A3D A;  3IX8 A;  4GW9 A;  1TEM A;  3LYX A;  2LB9 A;  3IWQ A;  4GLQ A;  4JXG A;  4JF4 A;  1CEF A;  2VZW A;  3M2J A;  4NET A;  1LL5 A;  3N8R A;  2OAQ 1;  4WYY A;  4KZ5 A;  3W4P A;  3D3O A;  4DJ3 A;  3G32 A;  1W8Y A;  4MN5 A;  3OCL A;  2Y2O A;  3NY4 A;  3WS2 A;  3S4X A;  1HTZ A;  1K57 A;  1NRJ A;  1ERQ A;  4BD0 A;  5DF9 A;  1MBL A;  4WZ5 A;  1HVB A;  3NOT C;  3HLE A;  5EVL A;  3LCE A;  2QHK A;  3NJA A;  1NJ4 A;  2IWD A;  2Y2M A;  2YKF A;  1VEU A;  2R9X A;  3DBA A;  3Q07 A;  4XT2 A;  2WKR A;  4QB8 A;  3LR5 A;  2Y2I A;  5HFO A;  3UE0 A;  1X0O A;  1F5M A;  3B33 A;  5F5Y A;  3FZC A;  4HBT A;  3H7W A;  3OZH A;  4RYE A;  4OVD A;  3OCN A;  2FFF B;  2OWH A;  1OTD A;  2EA9 A;  3T4K A;  3GSG A;  4HNB A;  2H0T A;  3HLF A;  1ZC2 A;  4MBH A;  4FCF A;  1XJ2 A;  4QHC A;  4HH2 A;  3O87 A;  3G31 A;  3Q7V B;  1ES4 A;  3W2Z A;  3PBO A;  4GZB A;  2Y2H A;  1LT0 A;  1W7F A;  2WK0 A;  1LLB A;  5AQA A;  4GN2 A;  5FI6 A;  4S2L A;  3BEC A;  5DF8 A;  1E3U A;  4ZJ1 A;  1L0E A;  3LO7 A;  4PHT A;  3K3C A;  1IYS A;  4OKP A;  5CHJ A;  4S2I A;  2ZM8 A;  1GSV A;  1H8Z A;  3EWK A;  4WL9 A;  4LPZ A;  3T4O A;  4UAA A;  3KYE A;  4PM7 A;  3B3X A;  3ULF A;  1IKI A;  1NWZ A;  3ZG0 A;  4PM5 A;  2EXB A;  4ETX A;  4X55 A;  2WAE A;  5HDS A;  1UWN X;  1N9N A;  1N4O A;  5A91 A;  4K08 A;  2G7U A;  5DF7 A;  1YLW A;  4X56 A;  3EQV A;  4G3K A;  4EQI A;  1OTB A;  4A5R A;  4DN0 A;  3HVF A;  3VSL A;  3RXX A;  3H82 A;  2PHY A;  1LHY A;  3UE3 A;  3F1O A;  1G5U A;  1LI0 A;  2D02 A;  3NCK A;  1C3B A;  1CQA A;  4QY6 A;  5G4Y A;  5F69 A;  3NHQ A;  1XGI A;  3LID A;  4CLC C;  3ZYT A;  1JWZ A;  3V3R A;  5HL1 A;  1XPB A;  2B95 A;  5KSH A;  4OPR A;  2ZD8 A;  4C75 A;  2XQZ A;  2W1T B;  2ZC3 B;  3WS1 A;  3VP3 A;  3M6H A;  3BRM A;  3A0S A;  3GV9 A;  4OOM A;  3TE8 A;  1LSW A;  1OTA A;  4KZ9 A;  4X25 A;  4R0Q A;  2M7V A;  3WRZ A;  5I5L A;  4JGQ A;  5AQ9 A;  5FAS A;  3IBJ A;  1ONH A;  3GR2 A;  2Y2K A;  3P09 A;  2J3W A;  1H3Q A;  3CMZ A;  2PU2 A;  4PAU A;  4Y2F A;  2P7J A;  4WEJ A;  2WGV A;  1CK3 A;  1YLZ A;  4HP9 A;  3VP2 A;  1D7E A;  3F1O B;  1U60 A;  1PW8 A;  5FEG A;  2W3E A;  5FQ9 A;  2WYX A;  3IH8 A;  3BFF A;  3R7W A;  3LY4 A;  5FI7 A;  3IS2 A;  3MFD A;  4LLO B;  2A3U A;  3F1N A;  1G6O A;  5FQQ A;  4R70 A;  4N9L A;  1XXM A;  4DKI A;  3VV4 A;  2Y79 A;  4BD1 A;  1NLZ A;  3Q7Z A;  2WGW B;  3LGO A;  5M18 A;  3VP0 A;  4DE2 A;  1AXB A;  3VFF A;  5IS1 A;  3GMW A;  4YIN A;  4MLL A;  3MR0 A;  1ZG6 A;  2WUQ A;  1MY8 A;  4IVI A;  3KSI A;  4S2P A;  4WLA A;  1N9B A;  3BYD A;  1K6R A;  2HP9 A;  3NI9 A;  1DJB A;  1DY6 A;  2VGJ A;  2V1A A;  1VM1 A;  3BEB A;  4PMA A;  3FPW A;  5EVE A;  2VV6 A;  4QWO A;  4MDZ A;  1FCM A;  1XX2 A;  4L9F A;  3CPT A;  2IWB A;  1FIL A;  2I9V A;  3UE1 A;  4YFM A;  3AGE A;  2Y2L A;  3G2Y A;  4KQD A;  4JGO A;  4IBX A;  3T12 B;  4GS9 B;  4Y15 A;  2O9C A;  4II7 A;  3ZG7 B;  5HAR A;  4QJG A;  1ODV A;  4M3K A;  3U2A A;  2J7V A;  2XLN A;  1YSQ A;  3UN7 A;  5I94 A;  1S0W A;  2ZOI A;  5TBM A;  1ALQ A;  4KQQ A;  1BLS A;  4U0X A;  1Y28 A;  4WM9 A;  2OOL A;  4WBG A;  1GHI A;  3EGD C;  2HPB A;  2V1Z A;  2VJW A;  4S2N A;  1ZHH B;  3HL9 A;  4EUV A;  3F1P A;  1XJ6 A;  1NZO A;  3T4Q A;  2BTF P;  2V2F F;  4Z1W A;  2G2U A;  2JHE A;  1IKG A;  2PRF A;  3CWF A;  4QPR A;  4E3M A;  3BY8 A;  4EWF A;  2VX8 A;  2Y55 A;  2ZL1 B;  3QP8 A;  3R4K A;  1RP5 A;  2CC1 A;  1BZA A;  4XXR A;  1YAX A;  4OLD A;  2XGN A;  4EXO A;  3GVB A;  5L10 A;  3TW8 A;  5E2H A;  4X69 A;  2B18 A;  2JKT I;  4I3A A;  3PBQ A;  4BJP A;  4DE1 A;  1N9O A;  1DP8 A;  1NYY A;  5DKL A;  4LV0 A;  2GNX A;  3N7W A;  1MWU A;  3PTE A;  5HAP A;  1K55 C;  3B47 A;  5FQK A;  5E43 A;  4E3N A;  4O8G A;  5DKK A;  3HLB A;  1D06 A;  2L1M A;  1ACF A;  2MJ6 A;  5IU1 A;  1S1Y A;  4Q0H A;  5CRF A;  3E2K A;  5EE8 A;  4P87 A;  3T4T A;  5HDD A;  1NRF A;  4HP4 A;  1H5X A;  3G34 A;  4NXB A;  3QP6 A;  1VQQ A;  2Z6C A;  3UPP A;  1PYY A;  2V0W A;  3QP1 A;  4CLC B;  2WAD A;  3NUL A;  4N1X A;  3RFB A;  2JCH A;  3DWK A;  4OQG A;  3O5Y A;  4KUK A;  1MPL A;  4EQ1 A;  3BM6 A;  1EWZ A;  2K2N A;  2VV8 A;  3EGX C;  3PHY A;  5J7E A;  3IXB A;  3L9K A;  4R3B A;  4Y17 A;  3TRC A;  1OJ5 A;  3VP1 A;  5CGS A;  3UPN A;  3P01 A;  4PKY A;  3N8S A;  2JC7 A;  2HDQ A;  1L3L A;  3ZGA B;  3CG5 A;  1IYQ A;  1XKZ A;  1W79 A;  2J3T C;  1ES5 A;  1WE4 A;  3C30 A;  4E6X A;  4ARZ B;  3MQ0 A;  2O9A A;  2QMI A;  5HAQ A;  3MZD A;  1ZTU A;  2Y2Q A;  4QD4 A;  2HZ5 A;  3GTC A;  4DF6 A;  4I3J A;  3JYI A;  3SZT A;  1UWP X;  5EVI C;  1H8M A;  5HX9 A;  2VGL M;  3VE3 A;  4EBP A;  4DXB A;  2WGI A;  2L0W A;  3OLO A;  1O07 A;  2P08 A;  4CPK A;  2Y2N A;  3UME A;  3DTM A;  4KZ6 A;  4XUZ A;  2O99 A;  4X53 A;  1KE0 A;  2HP6 A;  4OQH A;  1KOU A;  2ZQA A;  3IT9 A;  4EBL A;  1JTG A;  1OPX A;  3BFD A;  4QU3 A;  2L4R A;  4M4X A;  3UB5 P;  2C6W B;  3LIE A;  2DMW A;  4NXF A;  3W4Q A;  3CUE C;  3Q7V A;  1PIO A;  3JPU A;  1YMS A;  3UDI A;  1NYM A;  2Y59 A;  4E04 A;  2UWX A;  1P97 A;  3TSG A;  2P74 A;  3VMA A;  3E2L A;  4F3L B;  1SKO B;  1RGZ A;  4DDY A;  3BJN A;  2OAP 1;  5HWW A;  1PFL A;  1M40 A;  2VA0 A;  4WMC D;  4OPY A;  4MNR A;  2EX8 A;  2QKP A;  1PWD A;  4IBR A;  2A24 B;  3A3E A;  5GLB A;  2VEA A;  4KZ7 A;  5E2F A;  2PR6 A;  2EFU A;  2ZM2 A;  5CGW A;  2OLV A;  5GHZ A;  1T1A A;  3DTI A;  4N92 A;  2WKQ A;  1G6A A;  2EX2 A;  1PRQ A;  3A3I A;  1S1Z A;  3CI6 A;  3C8C A;  4I5S A;  3CZD A;  3PBN A;  5FAQ A;  5EOO A;  4GJ4 A;  1V9Y A;  1LL8 A;  3EEA A;  4B4Z A;  4KQO A;  3IWI A;  2V1B A;  2P9V A;  2Y2G A;  2K31 A;  2G2W A;  5CGX A;  2Y8H A;  4KZ3 A;  5CHM A;  2RL3 A;  1S4R A;  5GLC A;  3BY9 A;  5U47 A;  1VB6 A;  1M6K A;  3OPP A;  4OOY A;  2J9O A;  1W63 Q;  2GJ3 A;  3OPH A;  3W8K A;  4O0P A;  4P6Z M;  1EW0 A;  1K38 A;  2W3H A;  1F9I A;  1YT4 A;  3IX4 A;  3O3V A;  5G18 A;  3SS3 A;  4EER A;  4IED A;  2PAV P;  1OME A;  1ZKJ A;  5F82 A;  2XRO A;  1I2W A;  2VKS A;  3LIB A;  3DW0 A;  2W1T A;  1L2S A;  4NKP A;  1CI9 A;  3A3F A;  3N6I A;  2E8J A;  1BTL A;  4OPQ A;  1K4E A;  3MKE A;  1TS7 A;  1XP4 A;  1GHM A;  2M1C A;  4BBU A;  1FOF A;  5JYP A;  1N9L A;  3V5M A;  4HJ4 A;  1FSY A;  5HDC A;  2KOI A;  3SH7 A;  3ITA A;  3T1R A;  2YKH A;  3S7N A;  3ICY A;  2ZC5 B;  1T1C A;  3FV7 A;  5D3O A;  2H5S A;  2Y2J A;  3RXW A;  2QZ6 A;  3WWX A;  1TVF A;  2R78 A;  2Q0O A;  5HPI A;  3D9Y A;  4BBT A;  4RQ9 A;  5FAO A;  1AWI A;  2PBD P;  3IF6 B;  4CLC D;  4HI4 A;  4JKT A;  3IXD A;  2M7U A;  4BQM A; 
#chains in the Genus database with same CATH homology
 3GMW A;  4YIN A;  4MLL A;  2ZQ9 A;  1ZG6 A;  3MZE A;  1S6R A;  3UY6 A;  1K55 A;  1FCO A;  4S2J A;  2ZM0 A;  2P9V B;  4KG2 A;  2WUQ A;  1MY8 A;  2ZQ8 A;  3LY3 A;  3RJU A;  3N4I A;  1XA7 A;  4IVI A;  2DNS A;  4EV4 A;  4S2P A;  4UA6 A;  4Q8I A;  1N9B A;  3BYD A;  5HAI A;  4B4X A;  1K6R A;  3HRE A;  2HP9 A;  1K54 C;  5GL9 A;  3NI9 A;  5JYO A;  1GCE A;  3ZG8 B;  4FH2 A;  2ZC7 A;  1RGY A;  3NIA A;  3QHY A;  3IF6 C;  1DJB A;  1DY6 A;  5FQJ A;  2VGJ A;  1LL9 A;  1VM1 A;  3BEB A;  3PAG A;  4LEN A;  4PMA A;  2X01 A;  4MBF A;  5DTK A;  1ONG A;  4E3O A;  1PZP A;  1K54 A;  4Z9Q A;  2XF3 A;  4DXC A;  4FH4 A;  1I2S A;  3ZVT A;  3A3J A;  3IF6 A;  3V39 A;  1FCM A;  2WGW A;  1FSW A;  1XX2 A;  1SCW A;  3HUM A;  3IHA A;  4PPR A;  5CTM A;  2IWB A;  4BLM A;  3IHB A;  5DTS A;  4B88 A;  3UE1 A;  2PBY A;  3WS0 A;  4HEF A;  1YLJ A;  2J9P A;  4YFM A;  4BEN A;  3AGE A;  2Y2L A;  3G2Y A;  4GNU A;  4JPM A;  3SS4 A;  2HDU A;  5F1G A;  1ZG4 A;  3IH9 A;  5TR7 A;  4IBX A;  4JXW A;  4JXV A;  3WS5 A;  4K91 A;  3IQA A;  3ZG7 B;  1KE4 A;  1WYC A;  4WMC A;  5HAR A;  4QJG A;  4OON A;  3M6B A;  2WZX A;  3ZFZ A;  2JE5 A;  3C4O A;  4M3K A;  3VOY A;  2J7V A;  2XLN A;  3UN7 A;  4PM8 A;  4GB7 A;  1MWS A;  5I94 A;  1BUE A;  1IEL A;  1S0W A;  5CHU A;  5EVI B;  1XGJ A;  4BL2 A;  4X68 A;  1ALQ A;  3SOI A;  4KQQ A;  1BLS A;  2JBF A;  3IWO A;  3IF5 A;  4U0X A;  4WM9 A;  3PBS A;  1PW1 A;  4WBG A;  5DTT A;  1KDW A;  1GHI A;  3PAE A;  1YM1 A;  2ZQ7 A;  1YLY A;  2HPB A;  4KZB A;  3MZF A;  4LV3 A;  1KDS A;  4UHU A;  4WZ4 A;  2V1Z A;  1Q2P A;  3G30 A;  4S2N A;  4P6B A;  4OP8 A;  3HL9 A;  1DJC A;  5M1A A;  5TGF A;  1BUL A;  1NZO A;  1PWG A;  3BFG A;  4Y7P A;  3C4P A;  3UPO A;  3UDX A;  1NY0 A;  3NC8 A;  4OQI A;  2V2F F;  3V3S A;  4RVA A;  3MKF A;  3VOZ A;  5FAP A;  2G2U A;  4GKU A;  1IKG A;  3V50 A;  1YMX A;  3IXH A;  4WEL A;  4E3M A;  5EVI A;  4ZTK A;  1RCJ A;  4R23 A;  5FQM A;  4EWF A;  1GA0 A;  1ESI A;  2H10 A;  3NBL A;  1FR1 A;  3UO9 A;  3ZVW A;  4IVK A;  1KVM A;  2Y55 A;  4D2O A;  4MBK A;  4KG6 A;  2GDN A;  1O7E A;  1RP5 A;  4OOL A;  1K6S A;  2CC1 A;  3ISG A;  1BZA A;  3M2K A;  4OP5 A;  4XXR A;  4BQM A;  4DE3 A;  1JWV A;  1KGF A;  1W8Q A;  1MWT A;  3FWL A;  2ZQD A;  3G4P A;  2WKE A;  4ID4 A;  4OLD A;  2XGN A;  4E3J A;  4P85 A;  3GVB A;  4LCM A;  2EX6 A;  3G2Z A;  5E2H A;  2BG1 A;  1ES3 A;  3P98 A;  4X69 A;  2H0Y A;  4KZ4 A;  3PBQ A;  3C7U A;  2PU4 A;  4PM9 A;  1SDN A;  3WRT A;  4BJP A;  4DE1 A;  5KMW A;  5FDH A;  3A3D A;  5CEB A;  1NYY A;  2A49 A;  1TEM A;  2BLS A;  2X02 A;  1L0F A;  4KEN B;  4LV0 A;  3IWQ A;  3N7W A;  3ITB A;  1MWU A;  3AGF A;  3PTE A;  4JXG A;  1H8Y A;  2XH9 A;  5HAP A;  1K55 C;  5FQK A;  4E3N A;  4JF4 A;  5E43 A;  3QNB A;  1CEF A;  4RX2 A;  1W5D A;  5CTN A;  3M2J A;  4NET A;  3BLM A;  3ZG9 B;  3HLB A;  1LL5 A;  3N8R A;  5FI2 A;  1ES2 A;  4WYY A;  3SS5 A;  3OC2 A;  3BFC A;  4KZ5 A;  5CRF A;  3E2K A;  3W4P A;  1MKI A;  1YQS A;  3D4F A;  3G32 A;  2DRW A;  4KZ8 A;  4P87 A;  1W8Y A;  5EE8 A;  5EOE A;  1NRF A;  4R1G A;  1H5X A;  3G34 A;  5E2E A;  3OCL A;  2Y2O A;  3NY4 A;  1VQQ A;  3UPP A;  1PYY A;  1K56 A;  3W4O A;  3HLD A;  1Q2Q A;  2Y4A A;  4ZBE A;  3S4X A;  1HTZ A;  2WAD A;  3WS2 A;  1K57 A;  1ERQ A;  4BD0 A;  4N1X A;  2JCH A;  3DWK A;  3MXS A;  5CED A;  5DF9 A;  4OQG A;  4N1H A;  3O86 A;  1MPL A;  4OQ0 A;  1MBL A;  4P0M A;  4WZ5 A;  1HVB A;  3BM6 A;  4U0T A;  2ZC4 B;  4Y0O A;  3C7V A;  1EWZ A;  3ZNY A;  3HLE A;  5EVL A;  3LCE A;  3HLW A;  2QPN A;  3S1Y A;  3BLS A;  2XEP A;  1NJ4 A;  2IWD A;  4EUZ A;  3IXG A;  2Y2M A;  2R9X A;  3Q07 A;  2ZJ9 A;  4KG5 A;  3PBT A;  3IXB A;  4R3B A;  5FAT A;  4KQR A;  3VP1 A;  1L0D A;  4R4S A;  4LCL A;  5CGS A;  4QB8 A;  2Y2I A;  5HFO A;  1E4D A;  2J8Y A;  3UE0 A;  3UPN A;  3FZC A;  4HBT A;  3N8S A;  3OZH A;  2JC7 A;  4RYE A;  3FYZ A;  4EBN A;  2WKH A;  2HDQ A;  4OVD A;  3OCN A;  1Y54 A;  2Q9M A;  1K25 A;  3ZGA B;  3BFE A;  3CG5 A;  1IYQ A;  3OPL A;  4C6Y A;  2B5R A;  2FFF B;  3ZHH A;  1XKZ A;  1W79 A;  2WZZ A;  5FQI A;  3SH8 A;  2Z2M B;  1ES5 A;  1WE4 A;  2R9W A;  5AQ7 A;  4S2N C;  3GSG A;  4E6X A;  4UA7 A;  3C5A A;  2H0T A;  4O7D A;  3HLF A;  1ZC2 A;  4MBH A;  4JF5 A;  4FCF A;  2QMI A;  4PM6 A;  1BT5 A;  4QHC A;  5HAQ A;  3MZD A;  3O87 A;  2XD5 A;  2Y2Q A;  4QD4 A;  3VSK A;  4R3J A;  1IYO A;  1GA9 A;  4H8R A;  2EXA A;  3G31 A;  1FQG A;  3Q7V B;  3GTC A;  4DF6 A;  1ES4 A;  3PBO A;  3JYI A;  4GZB A;  5J8X A;  2Y2H A;  3S22 A;  2WKI A;  4GDN A;  4K0X A;  1W7F A;  5EVI C;  1K4F A;  2EFX A;  2WK0 A;  3Q82 A;  5HX9 A;  1LLB A;  4EBP A;  5TFQ A;  4JLF A;  2WGI A;  5AQA A;  4DXB A;  1BLH A;  4JXS A;  1O07 A;  4GN2 A;  4CPK A;  2Y2N A;  3HLG A;  5FI6 A;  4S2L A;  3BEC A;  3DTM A;  4KZ6 A;  4X53 A;  4XUZ A;  5DF8 A;  4OH0 A;  2Z2L B;  1KE0 A;  1GHP A;  1E3U A;  4ZJ1 A;  4DDS A;  1JVJ A;  2HP6 A;  3Q1F A;  4LV1 A;  4OQH A;  3MBZ A;  1L0E A;  2ZQA A;  3IT9 A;  4EBL A;  3O88 A;  2E8I A;  1JTG A;  3BFD A;  3LO7 A;  4QU3 A;  5F83 A;  4CJN A;  1EI5 A;  1IYS A;  1TDG A;  3AGD A;  2C6W B;  1SHV A;  4UA9 A;  4OKP A;  5CEC A;  2C5W B;  3DWZ A;  5CHJ A;  5CXW A;  4S2I A;  2ZM8 A;  4LV2 A;  3W4Q A;  1KVL A;  3Q7V A;  1PIO A;  5FA7 A;  4N9K A;  2X71 A;  1H8Z A;  3UDI A;  1YMS A;  3GRJ A;  1NYM A;  2Y59 A;  5E2G A;  4UAA A;  4JBF A;  2XR0 A;  3N8L A;  3HUN A;  4RX3 A;  1XA1 A;  1TDL A;  3B3X A;  1IKI A;  4PM7 A;  1MWR A;  4OLG A;  2OSU A;  1LI9 A;  2UWX A;  1PWC A;  3TSG A;  2P74 A;  3ZG0 A;  4S2M A;  4PM5 A;  4HES A;  2EXB A;  4S2K A;  3VMA A;  4X55 A;  3E2L A;  2WAE A;  3Q81 A;  4E3I A;  4E3L A;  1MXO A;  1RGZ A;  2ZMA A;  4DDY A;  1N4O A;  4GD8 A;  5A90 A;  5A91 A;  4U3T A;  1IYP A;  5DF7 A;  1K57 C;  1M40 A;  3UNW A;  1L0G A;  1YLW A;  4OPY A;  1KGG A;  4WMC D;  4X56 A;  5GLA A;  3EQV A;  4MNR A;  1YLT A;  4EQI A;  2EX8 A;  4NK3 A;  4A5R A;  1PWD A;  4WZ5 C;  3HVF A;  2HDS A;  1JTD A;  3CJM A;  3VSL A;  2FFY A;  3NDG A;  3RXX A;  5L2F A;  4IBR A;  4MEZ A;  1HD8 A;  4WEK A;  1LHY A;  3A3E A;  1G68 A;  4X6T A;  3ZDJ A;  3UE3 A;  5GLB A;  4KZ7 A;  5E2F A;  1ERM A;  4S2O A;  1LI0 A;  3GQZ A;  1PI5 A;  5DVA A;  2EFU A;  2ZM2 A;  3NCK A;  5CGW A;  3SH9 A;  5HW3 A;  4FD8 A;  2OLV A;  1QMF A;  5GHZ A;  1I5Q A;  1C3B A;  4N92 A;  1G6A A;  1BLC A;  4QY6 A;  2ZC6 B;  4Y0T A;  1XGI A;  2EX2 A;  5KSC A;  3VP4 A;  3ZCZ A;  3A3I A;  2XFS A;  4R4R A;  3NDE A;  1DJA A;  3CZD A;  3PBN A;  5FAQ A;  1BSG A;  1JWZ A;  5EOO A;  3V3R A;  5HL1 A;  3UDF A;  1XPB A;  1PI4 A;  2Y2P A;  2HDR A;  5KSH A;  4OPR A;  5EVI D;  3QNC A;  4B4Z A;  2ZD8 A;  4C75 A;  1E3U D;  3HUO A;  4KQO A;  2EX9 A;  4DE0 A;  5AQB A;  3TOI A;  3IWI A;  2Q9N A;  2XQZ A;  3PBR A;  2IWC A;  2Y91 A;  4XUX A;  2ZC3 B;  3WS1 A;  3VP3 A;  2P9V A;  2Y2G A;  3M6H A;  3BRM A;  1ERO A;  2G2W A;  4OPZ A;  3GV9 A;  4OOM A;  5CGX A;  5IHV A;  2ZQC A;  2VGK A;  4KZ3 A;  2RCX A;  5CHM A;  2RL3 A;  4QY5 A;  3FKW A;  1WYB A;  4ZJ3 A;  5GLC A;  5KZH A;  5U47 A;  3MXR A;  1M6K A;  3OPP A;  4OOY A;  2J9O A;  3I7J A;  4F94 A;  3WS4 A;  3OPH A;  3W8K A;  3FKV A;  4KZ9 A;  3TG9 A;  1K38 A;  4FSF A;  3G35 A;  5FSR A;  1J9M A;  1SDE A;  1FR6 A;  4BL3 A;  1FCN A;  4R0Q A;  3WRZ A;  3OPR A;  5EEC A;  1YT4 A;  1CEG A;  3O3V A;  5AQ9 A;  5EUA A;  5FAS A;  3VFH A;  5G18 A;  2HP5 A;  2V20 A;  3SS3 A;  5A92 A;  4IED A;  1ONH A;  3GR2 A;  1OME A;  1ZKJ A;  2DCF A;  2Y2K A;  3P09 A;  5F82 A;  1NZU A;  1I2W A;  3LEZ A;  5CER A;  4RA7 A;  3DW0 A;  1SKF A;  1BLP A;  5BOH A;  1L2S A;  2OLU A;  2PU2 A;  2XFT A;  3CMZ A;  4GD6 A;  2WAF A;  1CI9 A;  3A3F A;  1K56 D;  3N6I A;  1ESU A;  1E25 A;  4GOG A;  1BTL A;  4GDB A;  5F1F A;  5EPH A;  1CI8 A;  4JF6 A;  4ZAM A;  2WGV A;  4WEJ A;  1CK3 A;  1YLZ A;  2ZLY A;  1K4E A;  1PZO A;  4OPQ A;  3MKE A;  1XP4 A;  1GHM A;  5GHY A;  2I72 A;  4HBU A;  3VP2 A;  4E3K A;  5M19 A;  1FOF A;  4KZA A;  1U60 A;  3HLC A;  5JYP A;  1PW8 A;  4K0W A;  3V5M A;  3ZG5 A;  4C3Q A;  1FSY A;  2XDM A;  5FQ9 A;  2WYX A;  3IH8 A;  3SH7 A;  3ZNT A;  3ITA A;  4E6W A;  1YLP A;  3BFF A;  1NXY A;  2ZC5 B;  4Y0U A;  3FV7 A;  3LY4 A;  5FI7 A;  1IEM A;  5D3O A;  2H5S A;  2Y2J A;  3MFD A;  4L0L A;  3RXW A;  1Z6F A;  2A3U A;  2XD1 A;  2QZ6 A;  3WWX A;  1TVF A;  4ZJ2 A;  2XK1 A;  1KGE A;  5FQQ A;  4N9L A;  5FAO A;  4DRT A;  1XXM A;  4DKI A;  4ZDX A;  1HZO A;  3HBR A;  3IF6 B;  5GHX A;  3Q7Z A;  5GLD A;  4BD1 A;  2WGW B;  1JWP A;  1KE3 A;  5M18 A;  3VP0 A;  1QME A;  4DE2 A;  1AXB A;  3EQU A;  3VFF A;  4JKT A;  5A93 A;  3IXD A;  2OV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...