4QY7A

Crystal structure of a yoba protein (bsu18810) from bacillus subtilis subsp. subtilis str. 168 at 1.55 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
GDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YobA
publication title Crystal structure of a hypothetical protein (yobA) from Bacillus subtilis subsp. subtilis str. 168 at 1.55 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11518 DUF3221 Protein of unknown function (DUF3221)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qy7A01
3M3YH 1EWIA 2NN6G 1GM5A 4J15A 4A3BG 1A62A 1Y1VH 3UDGA 1I3QH 2ATWA 1BVSA 1H95A 3CP0A 3F2BA 5JJIA 2E8GA 1J6QA 3HOYH 2ID0A 1PH4A 1D7QA 2N78A 1QVCA 1AH9A 5C3EG 2ZM6L 4JI4L 5JJLA 3Q8DA 4DUYQ 2Z0SA 4A76A 3W1BA 4LW1A 2IX0A 4YWLA 2R7ZH 5FJ8H 1S40A 1QVGA 1A8VA 1RIPA 4A93H 1X65A 4LF7L 1LTLA 3I7FA 2NN6I 5LMNW 4X62Q 5LMNL 3HOZH 5IP9G 2R7FA 5IE8A 3MEFA 5J3BA 3NELA 3CCUA 1YHQA 2GN5A 4OX9Q 5ELNA 1DGSA 4A3EH 5IYDG 2L15A 4R1JA 1HNZQ 1YZ6A 2K75A 4DV5Q 1MIUA 1GD7A 4LUZA 5HGQA 3JC66 1Q82C 3CC2A 4KHPQ 1K3RA 3A0JA 1WCMG 3S17H 2PMZE 2Q2IA 1A63A 4TVAB 2BH2A 4DR1L 1LYLA 2CWPA 4AQYL 4JI0Q 4JYAL 4X66Q 4POGA 1PYSB 1G6PA 1HJPA 3CCMA 1M90C 1HH2P 2VY3A 1L2FA 4AYBE 4Y7NH 2PQAB 4IJLA 1N8RC 1L1OB 2NVYH 1CKMA 2ALYB 3T1HL 1EIYB 4BBRG 4YCWA 4DV2L 2IX1A 3K8AA 3U4ZA 4GNXA 1LUZA 3J81j 2C35B 2XTIA 1JE5A 1AE2A 1V1QA 3HOXH 4JBMA 1IZ6A 5M3FH 4HIOA 4B3TL 3KDFA 1EIFA 3PO3G 3F2DA 1MJCA 1VS0A 4A3MG 2VUMG 3KJPA 4RMFA 4HJAA 3ER0A 1Z47A 1AE3A 1VQFA 4P71A 1WJJA 3NBHB 1KHIA 1TXYA 4ALPA 3G4SA 2CKZB 3TEHB 4PZ8A 3PF5A 5LMUQ 4P75A 1K8AC 3L7ZC 4JI8L 3CPWA 1Q81C 4HIDA 4LF9L 1PH1A 2EQSA 1V9PA 4DR2Q 1PH9A 2NVXH 2A8VA 1VCIA 3GTJH 4JBJA 4AYBG 4RG1A 4A3KH 3PUVA 1U5KA 3E0EA 2I0QA 3LGJA 4IPCA 4KLKA 2VNUD 2ZJRA 4DV6Q 4QJFA 3T1YL 1EQQA 4LF6L 4B3SL 2B63H 4X6AH 3BZKA 4GKJQ 2AWNA 3NEMA 1VQHA 1PYBA 1EOVA 2Q2UA 2IHFA 1SMXA 1Y1WG 4A3DH 3M4QA 5ELOA 2UXDQ 1M1KC 2PNHA 4DV0Q 3HKSA 4JI7L 4UY8C 4C3IH 3D0FA 4DR3Q 2E2HH 4QQBX 2IT1A 1X9NA 1Q1EA 2R93G 4NPSA 4B3RQ 1N34L 3FHWA 3HFZB 3K80C 1HR0L 3PSIA 5IWAQ 3FKIG 3M7NA 3STBC 1VQBA 3L2PA 4A3GH 2RHQB 3JAMi 3GO5A 4L5RC 4AH6A 3K81C 4C3HH 3F1ZA 4DV3Q 3WWVA 5IYBG 2YV5A 4R4QA 2AWOA 4JV5L 4DAMA 1NMFA 1VQ8A 2BA1A 1YIJA 2JEAI 2JA7G 2BA0A 2UU9Q 2MO1A 4LFBQ 1GKHA 4UP8A 4LUOA 3H0GH 2FXQA 3RZDH 2R92H 4Y52H 4IFDJ 1N32Q 1E24A 5BR8Q 1JJ2A 5GAGC 1WOCA 1W3SA 2RHSB 2B3GA 4MTNA 4JI3Q 2HHHL 1I5FA 3S15H 4DR5L 5M3MG 2K50A 4X64L 2Z6KA 1YJ9A 3CD6A 1X3GA 4ME3A 4AIMA 2JA6H 2YTVA 1X54A 3S24A 1K73C 1PH5A 3RLOA 1JJCB 1QUQA 4LFAL 2KHJA 2E5LL 1K9MC 3PO2H 3PCOB 3F2CA 2ZJQA 2JEBI 4GNXB 1IBKQ 3UDFA 4P73A 4JC0A 5HY6A 4DUZQ 3PUXA 3PIOA 4A3IG 2CFMA 4DV6L 2RCNA 1YVCA 2B29A 2IHEA 4BY1G 5C44G 2DUDA 4IO9A 4DR4L 3RLNA 1FVIA 2JA8H 5FLMH 2DGYA 1YJNA 2QGQA 1NTGA 3RN2A 4YWMA 2I5LX 3CMEA 1XMOL 1SE8A 3AYHB 1A0IA 1YNXA 2AMCB 3OTOQ 4A3BH 1CKNA 1PH2A 1NJIC 4JI2Q 4IJHA 4B3RL 3K7AH 4FDBA 1P16A 5IWAL 3GTQH 4IFDI 5C3EH 4JBKA 3ICEA 4JOIA 4YCVA 3U4VA 5IP7H 2A19A 4OXPA 2AHOB 3RN5A 4DV3L 3PGZA 4HJ7A 1IBMQ 4BBSG 1OXSC 2WB1E 3HKZE 1QZGA 4WJ4A 1I50H 2VZAA 3ULPA 2UUBL 1VQDA 2CQOA 3KF6B 1KC8C 1IBLL 1NMGA 2YTYA 4LFBL 1XNQQ 4H02A 3HOVG 2R7ZG 1Q86C 2KCTA 3ULLA 5IP9H 5M5WH 5BR8L 4GNXC 4B3ML 4DPGA 4JI5L 2WAQE 4BXXG 4LF5Q 4DV1L 4O2DA 4A93G 4JI1L 4OO1G 4HIMA 5IYDH 4DK6C 3I4OA 3RZOH 3J7ZC 1EFWA 2VQFL 1CSQA 1C9OA 4YHHQ 1UE7A 3ULJA 2UUAL 1N9WA 1IXRA 1WCMH 3ERSX 1G51A 1D8LA 3M4OH 1NY4A 3PIPA 3J7A5 1UE1A 1UEBA 2YU9H 4LFCL 1YI2A 3KF8B 1YBYA 2K5NA 1Z9FA 5AJ3L 1Y14B 1PFSA 2XGTA 1VQ9A 4OO1I 4A3JG 3CCRA 5IYCG 2BH8A 3DM3A 3CQZH 3J81i 2UUCQ 3OYYA 1EQRA 5GAEC 2F52A 1XNRQ 4A3CH 3BJUA 1R9TH 2WB1G 3HKZG 3G48A 4DUYL 2F3IA 1XJVA 4DV4Q 4BY7G 4IPDA 3TREA 1N33Q 4GKKQ 2JK8A 3PO3H 3TQYA 1L0WA 3W5OA 1SN8A 1E1TA 1X3FA 4A3MH 3U58A 2WAQG 4GOPA 3L0OA 2I5HA 1VQ4A 2VUMH 2HIVA 2R6GA 3CPFA 1QUQB 4X62L 1NBWA 1IBML 3HOWG 4DNIA 2HQLA 4OX9L 2ZJPA 2CCZA 2NVTH 5E7NA 3GTKH 4L5QA 1UWVA 1VQAA 1HNZL 1XNQL 3CXCA 4DR7Q 4DV5L 1L1OC 1YHAA 4KHPL 4P72A 4JI6Q 4TQUS 2H5XA 1J5EQ 1S3OA 3UDIA 2JE6I 1HNWQ 4A3FG 4X65Q 1TWFH 2E2IH 3PUWA 4HIKA 1VQ7A 4JI0L 3B6YA 1EUJA 4X66L 1KIXA 4A3LG 2GVAA 5H1SE 2JA5H 4JBWA 3S1QH 4DKAC 3TS2A 2Q2HA 2NZOA 4EQ5A 2NZHA 4NXNQ 4LF8Q 2CWAA 2N8NA 4HJ8A 2N3SA 2VW9A 1P8LA 3I4NG 4GN4B 1KL9A 1Y1WH 1HNXQ 3A74A 4DR6Q 1SR3A 2MFIA 2Z6KC 1VQ5A 1IL2A 2F4VQ 4BA2I 2IY5B 1B7YB 1SFOH 2WP8J 2VS1A 1CSPA 3H3VH 4YWKA 2UUCL 4OONA 1VQLA 2MO0A 3FKIH 4HJ5A 1E1OA 3GTOH 1Q7YC 1TWAH 1E3PA 3PF4A 3S16H 4APVA 3NENA 2V1CC 4GLVB 1YITA 1N33L 5IYBH 4GKKL 2EIFA 1PHJA 2K5HA 4A3GG 2JA7H 1SROA 2ZM6Q 3GTMH 5LMUL 1Q8KA 1SRUA 3S2DH 2PQAA 3HOUG 1GVPA 3GDEA 1FGUA 3JAMc 4DR2L 3E9IA 4LF7Q 2LXJA 5M3MH 3H0GG 1K8GA 5LMNQ 3CC4A 3KYHC 1YEZA 3H15A 5C4XG 1J5EL 3J80c 1OXTA 1XTDA 4A75A 1B70B 1OXUA 4X65L 2PI2A 3KDFB 4GKJL 2ZTCA 2JA6G 2OCEA 2JQOA 2Y0SE 4KI0A 4MZ9A 1CKOA 1HZBA 5C44H 2OTLA 4BY1H 2UXDL 1T9HA 4DV0L 1QZHA 3F8TA 4DR1Q 4DR3L 4NB3A 4AQYQ 4JYAQ 1GO3E 1X55A 4QY7A 3I4MG 1X6OA 4QL5A 4GOPB 1HNXL 4PG3A 1WFQA 1PVOA 4MNOA 1O7IA 2A1AA 1JB7A 2F4VL 2JA8G 2PI2E 5GQOA 5M5XH 4QGUA 3CCEA 3CMAA 1Y1VG 1ASZA 2R7DA 1VQKA 2MNAA 1ASYA 5M5YH 4PMWA 4DV2Q 3TRZA 3HOYG 1NE3A 1U0LA 1I6HH 2ZTDA 3STBD 3U50C 5FLXc 2UU9L 2N49A 4L5TA 3CF5A 2K4KA 4BBSH 5FJ8G 4B3TQ 1N32L 3PV0A 1WYDA 4L5SA 1FJGQ 3EIVA 2MQHA 4JI3L 3CW2C 3CCVA 5IP7G 3E9HA 3G71A 3HOVH 2KCMA 4DAYB 3HOZG 4NXMQ 5GROA 4BXXH 5K36G 3S1RH 1VQMA 1QVFA 1B8AA 4OWWB 4IFDG 1HZCA 1K0RA 3M85A 3RNUA 4A3EG 2Y0SG 3KJOA 2I5MX 4GN5A 4JG2A 4JI8Q 4R4OA 4KHZA 5EAYA 4OWTB 1XMQQ 2K5VA 1IBKL 4LF9Q 3PUYA 4R4IA 1BBUA 4IPGA 4DUZL 1I94Q 1BBWA 1X3EA 4GOPC 1FL0A 3CCJA 1VQOA 4LF4Q 4LWCA 1TWHH 3UDXA 3S1NH 2UXBQ 4GLXA 5JJKA 2UXCQ 2KBNA 3T1YQ 4BBRH 4LF6Q 4B3SQ 2Q2TA 1UE6A 3RLFA 1X56A 1JMCA 2OTJA 3RR5A 4A3JH 2GVBA 3OTOL 1N36Q 4A4IA 5IYCH 1EYGA 3CCQA 3DLLA 5DLQE 2LSSA 2VQEQ 1VQIA 3A5ZB 4JI2L 2LXKA 2JA9A 1Q1BA 2EXDA 1PV4A 1TWCH 4JI7Q 4LUVA 2NVQH 4GLAC 1MKHA 2D0PA 3BU2A 3HOXG 1YJWA 4DK3C 1N34Q 5M3FG 1HR0Q 4BY7H 4A3CG 1Q12A 3PUZA 4K0KQ 1IYJB 1SLJA 3I56A 1XPRA 4IOCA 1OXVA 3J81c 3HOWH 4PZ7A 2OQKA 1YHBA 4EX5A 4JV5Q 2OQ0A 4O0AA 1FJGL 4LF5L 5C0XJ 3G6EA 3CAMA 4UPAA 2WFWA 3FP9A 4DV7Q 1VQPA 1JJGA 4NXML 4IPHA 1PH6A 1BKBA 4YHHL 3OW2A 2HHHQ 4YY3Q 4DR5Q 2JJQA 1CKNB 2HIXA 4A3FH 2ES2A 4X64Q 1XMQL 1XNRL 3S1MH 3A5UA 4A3KG 1TWGH 3ZJYC 5C4JH 1PH7A 1I94L 3S14H 4A3LH 4UP9A 1K83H 3SGIA 4LFAQ 2B63G 3IRBA 2E5LQ 2KENA 2OWOA 4LF4L 5C0XG 1Q46A 1KRSA 2RF4A 1XPUA 5JEAJ 3W1GA 4GS3A 4POFA 3I4NH 2UXBL 3KF6A 1E7ZA 1G291 3UE1A 3GTPH 2UXCL 4A3DG 2R93H 2D0OA 2JA5G 3KOJA 4DR4Q 1HZAA 1PH3A 4P74A 2AKWB 3D31A 4BA1I 1N36L 4YCUA 2K14A 5GADC 4C3JH 1S72A 2VQEL 4C2MH 4DV4L 3I55A 1XMOQ 1PH8A 3CCSA 1RL2A 3KLWA 3EN2A 4JI4Q 3AQQA 1KXLA 5C0XI 1KAWA 1MJEA 1HR0W 5IY0A 5JEAG 1OXXK 1L1OA 3GD7A 4K0KL 4XIGS 1KD1C 1C0AA 4OWXB 2K52A 3K7UC 1KQSA 2R92G 3CCLA 4DR7L 1KRTA 3AFQA 4WJ3M 2ZTEA 4HJ9A 1LM0A 1XPOA 4IOAA 3HOUH 4JI6L 3MXNB 2UUBQ 1UE5A 3J80i 1WI5A 4JOIC 4QIWE 3GTGH 1JT8A 1IBLQ 1HNWL 4R4CA 3AEVA 4DV7L 4GN3B 3CC7A 5IT9c 1E22A 1VQNA 4R4TA 3GTLH 3H3VI 2QA4A 4B3MQ 2E2JH 4PZ6A 4JI5Q 5C4XH 4DV1Q 4A3IH 4JI1Q 4YY3L 4XTCS 2QEXA 2ASBA 3UE0A 2YTXA 4JCVE 3K0XA 3PO2G 4NXNL 2VQFQ 4LF8L 3M4PA 3VDYA 1PA6A 1OTCA 2YYZA 1VQGA 3M9BA 4LNQA 2UUAQ 1W2BA 3KFUA 2D62A 1C7YA 3TS0A 2KHIA 1CUKA 4UP7A 4DR6L 1VQCA 1VQJA 3S2HH 2HT1A 5FLMG 1HZ9A 1VQEA 3T1HQ 1V43A 2VL6A 4LFCQ 3I4MH 3I2ZA 3EBEA 3BZCA 5GAHC 5AJ3Q 1VQ6A 3AFPA
chains in the Genus database with same CATH superfamily
2ATWA 1BVSA 5JJIA 2E8GA 4ZRZA 2ID0A 1D7QA 5ELBA 2N78A 1LT5D 1AH9A 4JI4L 1B1ZA 2IX0A 5FJ8H 1TS3A 1SDFA 4JVZA 1S40A 3MEHA 4LF7L 2FMCA 1J9OA 2NN6I 2NTSA 4X62Q 5IP9G 4FF1A 3MEFA 3MC0B 5K36H 2GN5A 1DGSA 5CV8A 4A3EH 2L15A 1YZ6A 4KHPQ 5CORA 3IL8A 2IWHA 2PMZE 4RGTA 2PQEA 4TVAB 2I07B 1B44D 2E76C 1SNPA 1GUOA 1PYWD 5T1IA 1HJPA 3CRKC 5E3FA 1I50B 4N9TA 3KUPA 3QOLA 4IJLA 4ZYSA 1CKMA 1TU2B 3D4RA 2CW0C 3RD4A 3TP8A 2IX1A 3MTSA 4GNXA 3IKJA 3T53B 1EIHA 2G5DA 3K59A 1HHVA 1WTWA 4JBMA 4HIOA 1EIFA 1KDAA 3PO3G 3F2DA 1WCMB 4FNFA 1Z47A 1AE3A 1WJJA 3ZYYX 1KHIA 2CKZB 4RH6A 1PRTC 4P75A 2IX3A 1Q81C 1PH1A 2K05A 2E75C 1HTLD 1U5KA 2HDLA 2BDNA 3X3MA 4KLKA 4LF6L 4X6AH 4CKEA 1CZGA 1VQHA 5CV9A 5JPMC 1JWUD 1SNDA 1SMXA 1F77A 2Z9HA 4G7HC 4A3DH 1Y8OB 3VR4A 4ZUJA 4JI7L 2E2HH 1YNND 2LFNA 3FHWA 4PNYA 5IWAQ 3STBC 3L2PA 1LACA 2RHQB 3JAMi 1AW7A 3GO5A 4L5RC 3KF8A 4AH6A 4C3HH 1LABA 2RVLA 5JEAH 4U68A 2BA1A 2BA0A 2A74C 1GKHA 4UAIA 5BN5A 2R92H 2OEOA 1E24A 1W3SA 2QKIC 4P2CB 4XYOA 4DR5L 1EU4A 1JR0D 1SYEA 2Z6KA 3LX0A 1CQFA 5COYA 1DONA 4UDUC 2Q8IB 4F87A 1JJCB 4X3SA 1B9NA 1K9MC 5EQ0A 3F2CA 2R92B 3UDFA 3PUXA 1K8AC 2CFMA 2RCNA 1YVCA 2IHEA 3RLNA 1FVIA 2Z6BA 5FLMH 2X69A 4IUNA 1NTGA 3PQIA 1JB3A 2BE5C 3AYHB 1V1PB 1HQRD 2AMCB 1X32A 3SK6A 4B3RL 3GTQH 4QCLA 2F0QA 4JBKA 4JOIA 4DU9A 5BN4A 3DWQA 3H3VC 4WJ4A 1TS5A 4BY1B 1VQDA 3KF6B 3O13A 3VR2A 1Q86C 2NUCA 2B2WA 2WAQE 2O2LD 3TSSA 4KKSA 1C4QA 4JI1L 2A6EC 3RZOH 5C5LA 1KLGD 1FYCA 2L11A 3BS1A 3W3AA 2CQAA 5I2YA 3GQBA 1QCBD 4LFCL 4BBSB 4LJZC 3P20A 5AJ3L 2F0LA 1ONLA 4OO1I 3MXNA 3CCRA 1S5DD 2EY1A 1Y8PB 4OHJA 1ILQA 3CQZH 3J81i 4ME5A 3GV6A 3OYYA 2F52A 1R9TH 2K32A 1HPCA 2LY7A 3KK7A 4DUYL 1XJVA 1QJOA 4TRDA 1LTAD 1SYCA 5DEHA 2KA7A 1PTOF 2OXPA 1SN8A 1X3FA 4A3MH 2VUMH 1E2ZA 1STBA 2HIVA 1IBML 1QUQB 3HOWG 1NBWA 1A2UA 5E7NA 3V05A 4L5QA 3W2DA 4A3JB 4DV5L 2XRQD 1YHAA 1TWCB 1RD9D 2NVQB 1TWFH 5J39A 4BY7B 4A3LG 3I91A 2GVAA 4L6TB 4DKAC 1LTID 2Q2HA 4G7OC 4KN7C 4LF8Q 4HJ8A 2N3SA 1Y1WH 2E74C 1HNXQ 2SDFA 1VQ5A 4BA2I 1KLUD 1IL2A 3DWAA 2VS1A 1CSPA 2CW0D 4DF7A 4YWKA 4OGQC 4HJ5A 1GUTA 1E1OA 1TWAH 3S16H 4APVA 5E4XA 4GLVB 1SAPA 2V4DA 3TN2A 1N33L 4GKKL 2EIFA 1Y1WB 2K5HA 1SROA 4ID6A 2ICIA 1SRUA 1H9SA 3S2DH 3I4NB 4IN3A 3GTPB 4NW2A 1PFMA 1AZQA 3MFYA 4WORA 4DR2L 4LF7Q 5M3MH 1HXYD 1PRTD 1K3BC 1STYA 4F88A 2F0IA 3KYHC 4IQZA 3H15A 3K5MA 3Q23A 5C4XG 4MN3A 1J5EL 2N88A 1B70B 3KDFB 3A7LA 4R8NA 2IPKD 3J7AV 2OCEA 3ERQA 4IFDH 4KI0A 1I4GA 5C44H 2UXDL 1MBYA 4DV0L 1QZHA 2L12A 4NB3A 4LMQD 2K5DA 4QY7A 3I4MG 4QL5A 4GOPB 1QG7A 4CBVA 4KKTA 5GQOA 4DFAA 1SJHD 4DXGA 2Z1CA 3JAME 1ASYA 2E2JB 5M5YH 3HOYG 4A3IB 1PFBA 2B39A 3STBD 3TMEA 5C44B 1E2WA 4KK7A 1N32L 1WYDA 1OO9B 2PCFB 3S2HB 3CCVA 3R2TA 3HOVH 4ZKBB 2EJMA 2HD3A 1QOHA 4OWWB 2XSCA 2Y0SG 5NUCA 2I5MX 1XMQQ 3TDQA 2N55A 4ODGA 1IBKL 1Y1VB 5CV5A 1I3QB 3T56B 1I94Q 1BBUA 4DUZL 4E6IA 1GJXA 1VQOA 3CCJA 4HMIA 4WJWA 1SNQA 5JJKA 1WVLA 2KBNA 1D5MC 3OIQA 4KD4A 4LF6Q 1UE6A 3DWPA 1X56A 4A93B 2WIIB 2OTJA 3RR5A 1N36Q 2GVBA 4A4IA 3A8IE 4QUCA 2LSSA 2VQEQ 4JI2L 2H1EA 1Q1BA 2BE5D 2LMCB 4JI7Q 2R3ZA 1VF5C 4GLAC 1MKHA 1YJWA 3KLRA 2F1MA 1SEBD 5CR3A 1EZ6A 3S17B 2FJ2A 1SLJA 3MXUA 3I56A 1XPRA 1OXVA 2WKCA 1EWCA 1TVXA 4PZ7A 1ET6A 1FJGL 4LF5L 4Y7NB 3G6EA 2WFWA 4IPHA 2MP1A 2PPBC 2JSOA 1WTOA 3OWEB 1STHA 2F4IA 4DR5Q 2JJQA 1CKNB 2A6ED 2HIXA 3S1MH 2KCCA 1FNWA 3SEBA 4A3KG 5C4JH 3HOXB 5M3FB 2SOBA 3NTIA 2F03A 2B63G 2EJGC 4LF4L 1XPUA 5JEAJ 3VYRA 1BUVT 3KOJA 3V2TA 4BA1I 3J81E 1G6ZA 4YCUA 1EYDA 4RAUC 2TMPA 1S72A 4C2MH 4DV4L 1IW7C 1PH8A 1IYUA 1STAA 3CCSA 2NVXB 1B3AA 2A68C 3GTJB 2EYLA 1NUCA 3OMGA 1HR0W 1L1OA 2F0OA 4K0KL 1KD1C 2K52A 4HSVA 1AFPA 3CCLA 1GUNA 2ZTEA 4IOAA 3LWEA 3HOUH 4RKBA 3VR6A 3GTGH 3FDTA 4JOIC 3VA5A 4DV7L 4EGVA 4C3IB 2ZXOA 5IT9c 1VQNA 3GTLH 2QA4A 3EVQA 2M2LA 2RCFA 4Q5VA 4JI1Q 2QEXA 1DOMA 2MHVA 1QE6A 2B2WC 2JXMB 4NXNL 1PA6A 1JOQA 2YYZA 1PDQA 3VR3A 2AQ3B 4LNQA 1W2BA 3VA7A 3A8JE 1CUKA 3GTGB 2HT1A 4G7ZC 3DEOA 1E0BA 1JC7A 1I6VC 1VQEA 4LFCQ 2VL6A 1XXGA 3EBEA 3K6OA 4M8AA 5AJ3Q 1RL2A 3M3YH 2NN6G 4A3BG 4J15A 1EY7A 3N6RA 1SE4A 3R3OA 2C9OA 2JA6B 4QB4A 2K28A 5C3XA 3OW7A 1DOLA 1PH4A 5C3EG 2ZM6L 3PO2B 2NZ1D 4DUYQ 2HCIA 3W1BA 4JK1C 2R7ZH 1ESRA 1STNA 1A8VA 1RIPA 3Q24A 1LTLA 3I7FA 5LMNW 5LMNL 3HOZH 5IE8A 3MVVA 3CCUA 1YHQA 1DZ1A 3AU7A 1EEFD 2BOSA 3D6WA 5C4ZA 2PZUA 2EVBA 4R1JA 1T5EA 5IYDG 4DV5Q 1RKNA 1B53A 3D3RA 3PIO3 2XRSD 1NR2A 1F2YA 1IHZA 2Q2IA 2AUJD 1A63A 2BH2A 3L9AX 3NBIA 3L3OC 5DNFA 3NQIA 1PYSB 5IT9L 4POGA 3CCMA 4JYAL 1SXTA 4AYBE 3OIPA 1B50A 2NVYH 1MSHA 3T1HL 2HUGA 3SK4A 3SXHA 2KECA 3U4ZA 1BCPC 3ITPA 2B8GA 1JE5A 1IKMA 5JAVA 4B3TL 5EBCA 1JOKA 1TR5A 3U9SA 3H94A 2MUYA 1MJCA 3KJPA 2EYMA 3C1EA 4P71A 2RKSA 4KD3A 3DM1A 5LL6X 5C5MA 3QR8A 1A6XA 4LF9L 2EQSA 1PTOH 1V9PA 4DR2Q 2A8VA 3QO2A 3PUVA 3ND8A 1RJTA 4DV6Q 3T1YL 3PO3B 4V190 4B3SL 2IJ0A 2AWNA 2Q2UA 4ZK9B 2WV6D 3M4QA 2UXDQ 1M1KC 3I73A 2K5WA 2NVTB 2PNHA 5ELFA 3HKSA 4B08A 4DV0Q 5KNBA 4UY8C 3GTKB 3D0FA 4DAPA 1LLRD 4QQBX 2IT1A 1NNXA 4DN4M 1N34L 3HFZB 3A55A 3PSIA 3FKIG 2Z8LA 3EROA 2E2IB 3K81C 1DCZA 4DV3Q 3BYYB 1IL8A 2AWOA 4JV5L 1VQ8A 2JEAI 1YIJA 2JA7G 3P75A 5D14A 3RZDH 4UP8A 2MJ8A 4Y52H 2FXQA 3NPPA 4FO2A 4IFDJ 1N32Q 1QNUA 5BR8Q 1WOCA 3K5NA 2HHHL 4RHRA 3S15H 2F0HA 1CT1D 2ICEC 4ME3A 4XYQA 1TY0A 1EYAA 2JEBI 4GNXB 1IBKQ 1CA6A 2X6LA 4P73A 4DUZQ 3BDLA 5HY6A 3PIOA 5IGBA 1EY6A 1EZ8A 1GHJA 2JN4A 3GTMB 1YJNA 1HQMC 1LTBD 3RN2A 2I5LX 3WDNA 1R4QB 1YNXA 4JI2Q 1IW7D 4IJHA 2KJXA 1F2MA 4IFDI 3E3XA 4YCVA 2A68D 4LAAA 2WB1E 5EPJA 3UI2A 3A54A 1I50H 2LS01 1KC8C 4LFBL 1D6EC 2KVMA 1XNQQ 2R7ZG 1TS4A 3ULLA 3NTKA 1EY5A 1Y8NB 4LF5Q 4DV1L 2B2VA 4OO1G 4HIMA 1F9RA 4DK6C 3I4OA 3I72A 5M5XB 1EFWA 1E2VA 1C9OA 2VB3X 4FXGC 1D1KA 3ULJA 1N9WA 1WCMH 2CH4A 3ERSX 1I6HB 1G51A 1NY4A 1LT6D 3PIPA 3J7A5 1UE1A 1GHKA 1YI2A 2NBFA 3KF8B 1C8CA 2A73B 1K8OA 1Y14B 1PFSA 2XGTA 3DXJC 3DM3A 3J80L 5GAEC 4CDDC 4A3CH 4PQXA 1U9RA 2K33A 1WD0A 1JCKB 4V0BA 4DV4Q 1T5XD 4IPDA 2SEBD 1S5BD 5FOBB 2WAQG 5F2DA 2I5HA 3S9WA 2R6GA 2EY6A 1TWHB 4DNIA 1HFNA 4BBRB 1WTRA 1HA5A 2CCZA 4RFBA 2F0PA 1UWVA 3CRLC 3CXCA 1L1OC 2K5QA 2RDHA 4TQUS 4CKCA 5JVH3 1S3OA 2HCCA 1ICWA 4A3FG 3FPUB 4H7BA 4HIKA 1VQ7A 3B6YA 3OMCA 2NZOA 3ND9A 4EQ5A 4NXNQ 2FHTA 3H09A 2CWAA 2N8NA 3HOWB 1P8LA 1JQYD 4GN4B 1HFGA 2RA4A 2MFIA 4EQPA 2F4VQ 4OIKA 4C3JG 5I9PA 3TZDA 2UUCL 1ESFA 4ABNA 1BCPD 2KQ3A 1Q7YC 1M8AA 1E3PA 3NENA 2O5JC 1XWEA 3S14B 5IYBH 4IUPA 1K83B 5EGTA 2ZM6Q 5LMUL 1KNEA 2J7ZA 4KY7A 3T4AC 1L0YB 2R93B 2EPBA 1FGUA 2PW7A 2K01A 2LXJA 2E2DC 1F9SA 5LMNQ 3P7JA 1LT4D 1YEZA 2D5DA 3BVMA 5A2QL 1TT2A 5JVG3 1XTDA 4X65L 1OXUA 4K6LA 3HS0C 4NMZA 4GKJL 2QF7A 3F2UA 5C3WA 4MIUA 5KYIA 1CKOA 3K58A 4BY1H 1ENFA 1O7ZA 1T9HA 1ENCA 3F8TA 4DR3L 4JYAQ 1GO3E 1X55A 1SYBA 5DM63 4PG3A 1WFQA 1JB7A 2PI2E 4QGUA 5KNCA 1L0XB 1ASZA 5IIFA 1TQOA 5C4XB 2CHBD 3BVGA 2ZTDA 3U50C 1A3VA 4L5TA 4BBSH 5FJ8G 4B3TQ 3ONAB 3PV0A 1IYVA 1CM9A 1JE4A 4I7ZC 1JWMD 3E9HA 3G71A 2F0MA 2KCMA 2SNMA 3FMCA 4ULLA 5GROA 3I4MB 4BXXH 5K36G 3M4YA 1VQMA 1B8AA 1HZCA 4XQQA 3M85A 3RNUA 4A3EG 3BDCA 3DHQA 4GN5A 1XNRQ 4R4OA 5IGCA 5EAYA 4OWTB 2VB2X 4LF9Q 4R4IA 4XDXA 1BBWA 1FL0A 1FNVA 2F0WA 1G2SA 3HZXA 4GLXA 3I90A 5EJWA 3T1YQ 1WTHA 1WTXA 4B3SQ 1D1IA 2PW5A 4A3JH 3QG1A 5IYCH 5DLQE 3G6JB 2MPMA 2KEDA 1EIGA 2ZXPA 4ZKCB 2JA9A 2EXDA 1TWCH 1JWSD 4LUVA 5I2XA 2NVQH 5FO7B 1WD1A 2PNRC 1N34Q 4BY7H 4A3CG 1Q12A 5HURA 4HEDA 2OQKA 1ICFB 1U4LA 4JV5Q 3E6ZX 2F0FA 1RDPD 5C0XJ 4XQNA 3CAMA 4UPAA 1CK1A 4DK0A 3FP9A 1SYDA 3HKZB 4RGNA 1VQPA 4NXML 1V1PA 4YHHL 2HHHQ 2ES2A 1PH7A 2RSNA 1XTCD 1S5ED 3SGIA 5FKAC 2KENA 1YNJC 1KRSA 2RF4A 3I4NH 3Q0AA 2UXBL 3KF6A 3GTPH 1G291 2UXCL 4A3DG 1H9MA 3R8BA 2D0OA 4M1UB 3NUCA 4L63B 1HZAA 1PH3A 4P74A 1FR3A 1BOSA 1LTTD 3I55A 3KLWA 4JI4Q 3FRPB 5C0XI 4C3HG 4A3KB 1RCVD 1K0SA 2JYOA 5JEAG 1OXXK 1EWHA 4XIGS 2B63B 5CBEE 4OWXB 1BR9A 2M9VA 3E0JA 5KRUA 2R92G 1JOOA 3VYTA 1KRTA 3AFQA 4DR7L 1J8IA 1LM0A 4PMCA 2LKVA 3J80i 1JT8A 1HNWL 2AQ1B 2L4NA 1HUNA 4R4TA 5FO8B 4RGOS 4PZ6A 5ELCA 2E2JH 4DV1Q 4A3IH 4YY3L 1FD7D 4A3GB 3NBHA 5JOBA 3VDYA 1X3PA 3E5SA 1VQGA 2K04A 2F0EA 2B2VC 2NTTA 1SYFA 3TS0A 4DR6L 3S2HH 1PTOC 1Q90A 1CHQD 1VQJA 5FLMG 1MGSA 3H0GB 1HZ9A 1RTOA 5T1GA 1DYQA 1V43A 1WTQA 3BZCA 1VQ6A 4FP5D 2EDGA 3EJIA 1Z6HA 2EY5A 1A62A 3OHXC 1Y1VH 3LWUA 1I3QH 3UDGA 2QEJC 3CP0A 1LO5D 3F2BA 1PZJD 5FK9C 5IT9E 1GOZA 4YWLA 4B9XA 1H9RA 3MHBA 4ZLTF 1UUPA 4A93H 3BDOA 2JA8B 3NTHA 1EY0A 1V1OA 3NELA 4RGMA 4CGYB 2K75A 1GD7A 4LUZA 5HGQA 3CC2A 2F3WA 1BDOA 3K7AB 1ML0D 2B2UA 3S17H 1PRTB 1I4QA 4N8FA 5C3EB 3IAYA 2EJFC 5HGTA 1NSNS 3SE0A 4AQYL 1G6PA 1HH2P 3D6CA 2VY3A 4Y7NH 2PQAB 1L1OB 1IKLA 2ALYB 3NE5B 5M5WB 3J81j 4FXKC 4K5XA 2XTIA 1LV9A 4RCOA 3HOXH 1IZ6A 5M3FH 3KDFA 4C1NK 5LHY1 1EOTA 3V96A 2AUKA 4A3MG 3M4OB 2VUMG 4RMFA 3LNNA 4HJAA 3ER0A 2YU9B 1I4HA 1VQFA 4IZ8A 1TXYA 1B9MA 1B3QA 4MTKA 4PZ8A 5LMUQ 1BF4A 3C2PA 5K5PA 3L7ZC 4HIDA 2WACA 4L8JA 2RQXA 1XYIA 2NVXH 1WTPA 3U9OA 1ET9A 1EU3A 3GTJH 4JBJA 4AYBG 4RG1A 4YIJA 5E1FA 2I0QA 3LGJA 3OOCA 2VNUD 2ZJRA 1EQQA 1ENAA 3SK5A 4S3SA 2CH4W 3BZKA 4GKJQ 5I6WA 3NEMA 1Y1WG 3T16A 5ELOA 4RKLA 4C3IH 4DR3Q 4R9WA 3R2IA 4NPSA 4B3RQ 3K80C 1HR0L 3M7NA 1VQBA 1U4MA 4G57A 3F1ZA 3AMUA 4DAMA 1NMFA 2JA5B 3S1QB 2MO1A 4LUOA 5G3LD 1GUWA 2RHSB 2B3GA 3URYA 1I5FA 2KUMA 5M3MG 1BNZA 1SFOB 4X64L 4HAEA 5DM73 1YJ9A 3CD6A 2EYHA 4KHVA 2JA6H 2YTVA 3I4LA 1X54A 2J4XA 3S24A 1PH5A 4ILWA 3RLOA 3GTOB 1TKWB 2KHJA 3KBGA 4RCNA 3PO2H 1UNSA 3PCOB 2ZJQA 5IGDA 3KLSX 4IFDG 4A3IG 2JP1A 1Z7TA 1G8ZD 5C44G 5CBAE 2DUDA 2F0SA 4DR4L 2JA7B 4N8X1 3P1HA 1YNJD 3CHBD 3NSWA 2QGQA 2RDFA 2F0DA 3T51B 4YWMA 3CMEA 1SE8A 4O42A 1CKNA 1TS2A 1PH2A 1RTNA 5IWAL 3VR5A 2F0JA 1EYCA 2A19A 5E4WC 5IGGA 3RN5A 4HJ7A 1IBMQ 1EY8A 1OXSC 3TP6A 3HKZE 2KOLA 1KNAA 2VZAA 3ULPA 3H91A 3GP7A 2CQOA 2YTYA 4H02A 3HOVG 5D3IB 3NXWA 4BS9A 3J80E 4FF2A 5IP9H 1H9KA 3HG9A 4B3ML 1KDBA 4O2DA 4A93G 1X3QA 5EPKA 1CSQA 4KN4C 4OL7A 3DMUA 4YHHQ 2UUAL 1O78A 2WINB 1NR4A 1D8LA 4I65A 1UEBA 4XT3B 4KKUA 1YBYA 2K5NA 1PTOD 1MI2A 1VQ9A 4CJ1B 5IOCA 1SE2A 2BH8A 1SBBB 5ELDA 1EQRA 3S1RB 1DJRD 4BWGB 2RBMA 2WB1G 1GXDC 3D4WA 3G48A 2F3IA 4NKLA 3TREA 1N33Q 1RHPA 4GKKQ 2JK8A 3Q22A 3PO3H 3TQYA 1L0WA 1KTKA 1VF7A 3W5OA 1E1TA 2XWJB 1Q3LA 4N9PA 1VQ4A 2XIWA 3L0OA 1LT3D 3CPFA 1O7LA 3S1NB 2HQLA 4OX9L 1NCVA 2ZJPA 2NVTH 3GTKH 1HNZL 4DR7Q 5CGKA 4P72A 2TSSA 2H5XA 1J5EQ 2XWBB 3UDIA 2JE6I 1HNWQ 1FNUA 2OF1A 5C0XH 2E2IH 3NQTA 3PUWA 2Z4HA 3EA6A 5EKLA 4JI0L 1EUJA 4X66L 1KIXA 1HRJA 4DAYA 4JBWA 1Y69U 3TS2A 2NZHA 2WAQB 3RUZA 4KY5A 1A3TA 3BG3A 4CKBA 1I4XA 4DR6Q 1SR3A 4IALA 4K5VA 1A15A 1STGA 2WP8J 3DEPA 5A2QE 4OONA 1VQLA 4C3IG 4A3FB 4EQNA 1TWGB 1EQVA 1YITA 1PZID 4O1NA 1PHJA 4C56C 3GTMH 2B2TA 2G9DA 1Q8KA 4B9WA 3HOUG 3GDEA 1ZKOA 1DXMA 4ZQ3A 3KLSA 3QIAA 4C3JB 3CC4A 3J80c 1OXTA 4A75A 3WOFA 2IL8A 4H44C 2K7VA 2PI2A 2ZTCA 2DJFC 2JA6G 3QWNA 3BYTB 4MZ9A 2K1BA 1HZBA 1AP0A 2OTLA 1PRTF 4IUTA 4X3KA 4AQYQ 1EY9A 1X6OA 4K2KA 2B2UC 1HNXL 4J8QA 4MNOA 1O7IA 4K5WA 5M5XH 3CCEA 2R7DA 2MNAA 4HCEA 4PMWA 3TRZA 1U0LA 1I6HH 2MGSA 2UU9L 4XXEA 2N49A 3CF5A 2K4KA 4L5SA 1FJGQ 2MQHA 4JI3L 5I6YA 1AEXA 2DNEA 3HOZG 2L5TA 1FGBD 3I70A 1QVFA 1D5XC 1W6JA 1KDCA 5CV7A 2C5CA 4JG2A 4KHZA 2A69C 3PUYA 3MWYW 4GOPC 4CDFC 4LF4Q 3HGBA 4RA8A 3C3LA 4HR7B 1TWHH 2ZXRA 4MHEA 3UDXA 1LTRD 4FVMA 4BBRH 2Q2TA 4JW0A 3OTOL 1VQIA 3EFXD 2LXKA 1PV4A 4A3EB 1PLFA 2D0PA 1I4RA 5JPNC 4DK3C 1HR0Q 4F7XA 4K0KQ 4K14A 1K28A 4IOCA 3HOWH 4J1MA 1YHBA 3OPOA 4EX5A 1TIID 2OQ0A 4O0AA 3VYSA 3J7YW 4DV7Q 1SSOA 1SNMA 3VYUA 5EKIA 1W6KA 4X64Q 1XMQL 3A5UA 2EYPA 3ZJYC 1I94L 3S14H 4A3LH 2X6GA 4EQOA 1O7YA 3N52A 1VMPA 1K83H 5C0XG 1Q46A 1F2LA 4GS3A 4POFA 1E7ZA 5I9OA 3UE1A 2R93H 4OELB 1DOKA 4DR4Q 2AKWB 2O4XA 3D8GA 1N36L 2VQEL 4ZCKA 4H13C 4R8IA 3EN2A 2L9HA 4CHTB 1SNCA 5IY0A 5TSSA 3GD7A 3J7AF 2EE1A 1C0AA 2F0KA 2RSOA 5CMDA 5KYLA 4WJ3M 1XPOA 4HJ9A 2L0CA 3I3CA 4JI6L 3MXNB 4A3DB 4K8JA 1WI5A 3KBXA 4R4CA 2AQ2B 4GN3B 3MXGA 2E2HB 3H3VI 4B3MQ 1O80A 5C4XH 4XTCS 2ASBA 2YTXA 4JCVE 3M4PA 4C3HB 1OTCA 1S4ZA 2UUAQ 3KFUA 4QUFA 2D62A 1C7YA 2KHIA 4UP7A 5G3LF 2EZVA 3R93A 4IURA 3IFTA 5CV4A 3T1HQ 2M00A 3I4MH 4K6DA 4FXDA 5KGUA 2QILA 1KAAA 3AFPA 1EWIA 1GM5A 4HTHA 1H95A 5A35A 3M7GA 1J6QA 3HOYH 4GZYC 1QVCA 5JJLA 3Q8DA 2Z0SA 4A76A 4LW1A 1BCPB 1EFID 1QB5D 1QVGA 1X65A 2D9UA 3SVMA 2L55A 1B2TA 2R7FA 4IUQA 5J3BA 1RF2D 3NHHA 5KNDA 4J6HA 4OX9Q 1ZYRC 5ELNA 2B2YA 3HOYB 1HNZQ 2EYOA 5IGFA 1MIUA 5CV6A 1Q82C 3JC66 4EVOA 4DK1A 1K3RA 3A0JA 3GTQB 1WCMG 1H9JA 4DR1L 1LYLA 2CWPA 4JI0Q 4CDEC 4X66Q 2QCPX 1DM0B 1CZWA 1M90C 1L2FA 1H9SB 1N8RC 2Y0SB 1SMYC 1U4RA 4OIJA 5D65A 1EIYB 4BBRG 4YCWA 4DV2L 3K8AA 2J0TD 1LUZA 2C35B 3RZOB 1AE2A 4KMUC 1V1QA 2F0NA 4KY6A 3SHLA 1VS0A 2KEEA 4QF4A 3AB9A 1AZPA 3NBHB 2HQEA 4TSSA 2Z4IA 4ALPA 3G4SA 3TEHB 3PF5A 4U673 4JI8L 3CPWA 3TP5A 2QDBA 2IW3A 3CQZB 4WRDA 4ZAIA 1PH9A 2B2TC 1R9TB 4XQJA 1VCIA 3EQLC 4A3KH 2A69D 3E0EA 4IUVA 4IPCA 2VXWA 4QJFA 1GUGA 2B63H 1V8QA 1PMRA 4A3MB 2VUMB 1CA5A 1PYBA 1EOVA 1XX8A 2IHFA 3PMFA 2O5IC 3SDZA 1CFMA 4HSPA 2A6HC 2FMMA 2P5ZX 4WFN3 1X9NA 1Q1EA 2R93G 2QW7A 3G7LA 4A3GH 2F0VA 1I4PA 1TWFB 4K8IA 4AYBB 1CHPD 2CVRA 2NB0A 3WWVA 5IYBG 2YV5A 4R4QA 2XN9C 2UU9Q 4LFBQ 2PO4A 3H0GH 3QB3A 2SNSA 1JJ2A 5GAGC 5KIXA 4MTNA 5IODA 4JI3Q 2K50A 2PZWA 4C1NI 1F9QA 1F9PA 1X3GA 2EYJA 4AIMA 2A5HA 3HRZC 1K73C 2DN8A 4DXFA 4LFAL 1QUQA 2E5LL 1TWAB 5D3DA 1B4OA 3S16B 4JC0A 5JJZA 4DV6L 2B29A 4BY1G 1R4PB 4IO9A 3HEJA 2JA8H 2DGYA 3TZUA 3S2DB 4NDXA 2DY8A 3SK8A 1ILPA 1PXUA 1F2ZA 1S5FD 2OT2A 1XMOL 1D5ZC 1A0IA 3NWSA 2NN6H 3NK9A 4DA2A 5M3MB 3OTOQ 2WKDA 4A3BH 5BN3A 2DNCA 1NJIC 1G2TA 2FFKB 3K7AH 4FDBA 1P16A 1HUMA 5L37A 1AN8A 5C3EH 3ICEA 3U4VA 5IP7H 4OXPA 2AHOB 4DV3L 3K5OA 3PGZA 4BBSG 3K0YA 1QZGA 2UUBL 1A2TA 2H4OA 3I8ZA 2F0UA 1IBLL 1NMGA 4A3BB 1D2BA 4CJ2C 1VDZA 1MHWC 2KCTA 3FVQA 5M5WH 5BR8L 4GNXC 4BXXG 4DPGA 4JI5L 5I4DA 5IYDH 1HA6A 3J7ZC 2VQFL 4QIWB 4I7AA 1UE7A 5M5YB 3TP7A 1IXRA 1STEA 2B8FA 3M4OH 1S5CD 4CJ0B 2YU9H 1HTPA 4KV6A 3HP3A 1Z9FA 3NWTA 2XVSA 4A3JG 5IYCG 3HOVB 2EY2A 2L1BA 2UUCQ 5FLXE 4JPBW 3BJUA 5J22A 3HKZG 4CDCC 4BY7G 5IGEA 3IFDA 2PZTA 3C46A 1PFNA 3U58A 4GOPA 4X62L 5J1ZA 1VQAA 4KTAA 1XNQL 2F0GA 3X3NA 4KHPL 1CQVA 1LTSD 1UAPA 4JI6Q 1EL0A 1ZYRD 1SE3A 3H6MA 2WB1B 4RWSC 4X65Q 3BZDB 1G91A 4X3UA 5H1SE 2JA5H 3S1QH 4OEMB 3MAQA 1Q8IA 2EYFA 1PZKD 3I4NG 2VW9A 1KL9A 1QILA 2PMZB 3A74A 4HMJA 3C1FA 2Z6KC 1GUSA 5ISRA 2IY5B 1B7YB 1SFOH 1SMYD 1JORA 3CKIB 4FF3A 1C48A 3H3VH 5ELEA 2MO0A 3FKIH 1KABA 3GTOH 3S1MB 3A7AB 3PF4A 2BCOA 3SR1A 5DAUA 1UEAB 1SJED 2G9HD 2V1CC 3K57A 2KHSA 5C4JB 4A3GG 3QJYA 2JA7H 2RDGA 2ENBA 2PQAA 1GVPA 4RHSA 1BCPF 1BQQT 4K2LA 3JAMc 3E9IA 3FKIB 3OSOA 3FEWX 3H0GG 1K8GA 1DD2A 1QWYA 1LTGD 4C2MB 3WOEA 4Z9CB 1A3UA 1SNOA 1RODA 2JQOA 2Y0SE 1BBXC 4HN7A 2B2YC 4IUUA 4QMGA 4LK1C 4DR1Q 4Q0FA 1TY2A 1PVOA 3HOUB 1EY4A 5KEEA 2A1AA 2F4VL 2JA8G 2A6HD 3CMAA 2I46A 1Y1VG 2HDMA 1JICA 3GTLB 1VQKA 4DV2Q 1CI3M 1NE3A 2R61A 3NP8A 3D4DA 5FLXc 4ZUIA 3T13A 1SYGA 1ZEQX 3EIVA 5M9OA 3CW2C 2K03A 5IP7G 4XT1B 4DAYB 4NXMQ 4UHVA 3S1RH 1K0RA 4OO1H 4DGZA 2F0TA 2ZT9C 3KJOA 3M3YB 3A56A 4JI8Q 2D2CC 2K5VA 5C4HA 4IPGA 2DY7A 1X3EA 3JAML 4PV1C 5EBDA 3Q6SA 4LWCA 2R7ZB 3S1NH 1WTVA 1VMCA 2UXBQ 2UXCQ 3MA2B 3RLFA 4FF4A 3K5LA 1JMCA 2KCNA 1CTMA 1EYGA 3CCQA 3GV3A 3DLLA 3HOZB 1YNNC 3CU7A 3A5ZB 1II3A 2BDOA 2PYKA 3DUZA 3A8KE 2FINB 3MZ5A 4X3TA 3BU2A 3HOXG 2Q8RE 3QOJA 5M3FG 4F8MA 3PUZA 2DJGC 1IYJB 2GA4B 2F3VA 3MXPA 3J81c 5FLXL 4H0LC 2NVYB 4FYDA 1JJGA 1PH6A 5C6AA 4PMBA 1BKBA 3OW2A 4YY3Q 5AFWA 4A3FH 1XNRL 2QDLA 1TWGH 2NWGA 4UP9A 4LFAQ 1ZXTA 3IRBA 2E5LQ 2OWOA 3BVZA 3W1GA 3PIP3 2K6AA 3RMHA 2JA5G 4KJOA 3D31A 5CC4A 2Q8TA 1MD2D 2K14A 4TKOB 5GADC 4C3JH 5FO9B 5EPLA 4DNRB 2NYZD 1MSGA 1PTOB 1XMOQ 1KXLA 1U4PA 3AQQA 3MFGA 1NAPA 1KAWA 1M4VA 1MJEA 1BO0A 2XNAC 4HCSA 3FPPA 1K8MA 1BXTA 3K7UC 3OWFA 1KQSA 5EKKA 2UUBQ 1UE5A 4QIWE 1IBLQ 3AEVA 4KJNA 3CC7A 1E22A 3J81L 4DNTB 4JI5Q 3TBIB 5LL6S 4G4KA 3UE0A 2EOTA 5CYUA 2EXZA 3K0XA 3PO2G 1HCZA 2VQFQ 4LF8L 3M9BA 4NP5A 1VQCA 4DAVA 3RZDB 3I2ZA 1EEID 1QNKA 5GAHC 3S15B 1EQTA
chains in the Genus database with same CATH topology
3M3YH 1EWIA 2NN6G 1GM5A 4J15A 4A3BG 1A62A 1Y1VH 3UDGA 1I3QH 2ATWA 1BVSA 1H95A 3CP0A 3F2BA 5JJIA 2E8GA 1J6QA 3HOYH 2ID0A 1PH4A 1D7QA 2N78A 1QVCA 1AH9A 5C3EG 2ZM6L 4JI4L 5JJLA 3Q8DA 4DUYQ 2Z0SA 4A76A 3W1BA 4LW1A 2IX0A 4YWLA 2R7ZH 5FJ8H 1S40A 1QVGA 1A8VA 1RIPA 4A93H 1X65A 4LF7L 1LTLA 3I7FA 2NN6I 5LMNW 4X62Q 5LMNL 3HOZH 5IP9G 2R7FA 5IE8A 3MEFA 5J3BA 3NELA 3CCUA 1YHQA 2GN5A 4OX9Q 5ELNA 1DGSA 4A3EH 5IYDG 2L15A 4R1JA 1HNZQ 1YZ6A 2K75A 4DV5Q 1MIUA 1GD7A 4LUZA 5HGQA 3JC66 1Q82C 3CC2A 4KHPQ 1K3RA 3A0JA 1WCMG 3S17H 2PMZE 2Q2IA 1A63A 4TVAB 2BH2A 4DR1L 1LYLA 2CWPA 4AQYL 4JI0Q 4JYAL 4X66Q 4POGA 1PYSB 1G6PA 1HJPA 3CCMA 1M90C 1HH2P 2VY3A 1L2FA 4AYBE 4Y7NH 2PQAB 4IJLA 1N8RC 1L1OB 2NVYH 1CKMA 2ALYB 3T1HL 1EIYB 4BBRG 4YCWA 4DV2L 2IX1A 3K8AA 3U4ZA 4GNXA 1LUZA 3J81j 2C35B 2XTIA 1JE5A 1AE2A 1V1QA 3HOXH 4JBMA 1IZ6A 5M3FH 4HIOA 4B3TL 3KDFA 1EIFA 3PO3G 3F2DA 1MJCA 1VS0A 4A3MG 2VUMG 3KJPA 4RMFA 4HJAA 3ER0A 1Z47A 1AE3A 1VQFA 4P71A 1WJJA 3NBHB 1KHIA 1TXYA 4ALPA 3G4SA 2CKZB 3TEHB 4PZ8A 3PF5A 5LMUQ 4P75A 1K8AC 3L7ZC 4JI8L 3CPWA 1Q81C 4HIDA 4LF9L 1PH1A 2EQSA 1V9PA 4DR2Q 1PH9A 2NVXH 2A8VA 1VCIA 3GTJH 4JBJA 4AYBG 4RG1A 4A3KH 3PUVA 1U5KA 3E0EA 2I0QA 3LGJA 4IPCA 4KLKA 2VNUD 2ZJRA 4DV6Q 4QJFA 3T1YL 1EQQA 4LF6L 4B3SL 2B63H 4X6AH 3BZKA 4GKJQ 2AWNA 3NEMA 1VQHA 1PYBA 1EOVA 2Q2UA 2IHFA 1SMXA 1Y1WG 4A3DH 3M4QA 5ELOA 2UXDQ 1M1KC 2PNHA 4DV0Q 3HKSA 4JI7L 4UY8C 4C3IH 3D0FA 4DR3Q 2E2HH 4QQBX 2IT1A 1X9NA 1Q1EA 2R93G 4NPSA 4B3RQ 1N34L 3FHWA 3HFZB 3K80C 1HR0L 3PSIA 5IWAQ 3FKIG 3M7NA 3STBC 1VQBA 3L2PA 4A3GH 2RHQB 3JAMi 3GO5A 4L5RC 4AH6A 3K81C 4C3HH 3F1ZA 4DV3Q 3WWVA 5IYBG 2YV5A 4R4QA 2AWOA 4JV5L 4DAMA 1NMFA 1VQ8A 2BA1A 1YIJA 2JEAI 2JA7G 2BA0A 2UU9Q 2MO1A 4LFBQ 1GKHA 4UP8A 4LUOA 3H0GH 2FXQA 3RZDH 2R92H 4Y52H 4IFDJ 1N32Q 1E24A 5BR8Q 1JJ2A 5GAGC 1WOCA 1W3SA 2RHSB 2B3GA 4MTNA 4JI3Q 2HHHL 1I5FA 3S15H 4DR5L 5M3MG 2K50A 4X64L 2Z6KA 1YJ9A 3CD6A 1X3GA 4ME3A 4AIMA 2JA6H 2YTVA 1X54A 3S24A 1K73C 1PH5A 3RLOA 1JJCB 1QUQA 4LFAL 2KHJA 2E5LL 1K9MC 3PO2H 3PCOB 3F2CA 2ZJQA 2JEBI 4GNXB 1IBKQ 3UDFA 4P73A 4JC0A 5HY6A 4DUZQ 3PUXA 3PIOA 4A3IG 2CFMA 4DV6L 2RCNA 1YVCA 2B29A 2IHEA 4BY1G 5C44G 2DUDA 4IO9A 4DR4L 3RLNA 1FVIA 2JA8H 5FLMH 2DGYA 1YJNA 2QGQA 1NTGA 3RN2A 4YWMA 2I5LX 3CMEA 1XMOL 1SE8A 3AYHB 1A0IA 1YNXA 2AMCB 3OTOQ 4A3BH 1CKNA 1PH2A 1NJIC 4JI2Q 4IJHA 4B3RL 3K7AH 4FDBA 1P16A 5IWAL 3GTQH 4IFDI 5C3EH 4JBKA 3ICEA 4JOIA 4YCVA 3U4VA 5IP7H 2A19A 4OXPA 2AHOB 3RN5A 4DV3L 3PGZA 4HJ7A 1IBMQ 4BBSG 1OXSC 2WB1E 3HKZE 1QZGA 4WJ4A 1I50H 2VZAA 3ULPA 2UUBL 1VQDA 2CQOA 3KF6B 1KC8C 1IBLL 1NMGA 2YTYA 4LFBL 1XNQQ 4H02A 3HOVG 2R7ZG 1Q86C 2KCTA 3ULLA 5IP9H 5M5WH 5BR8L 4GNXC 4B3ML 4DPGA 4JI5L 2WAQE 4BXXG 4LF5Q 4DV1L 4O2DA 4A93G 4JI1L 4OO1G 4HIMA 5IYDH 4DK6C 3I4OA 3RZOH 3J7ZC 1EFWA 2VQFL 1CSQA 1C9OA 4YHHQ 1UE7A 3ULJA 2UUAL 1N9WA 1IXRA 1WCMH 3ERSX 1G51A 1D8LA 3M4OH 1NY4A 3PIPA 3J7A5 1UE1A 1UEBA 2YU9H 4LFCL 1YI2A 3KF8B 1YBYA 2K5NA 1Z9FA 5AJ3L 1Y14B 1PFSA 2XGTA 1VQ9A 4OO1I 4A3JG 3CCRA 5IYCG 2BH8A 3DM3A 3CQZH 3J81i 2UUCQ 3OYYA 1EQRA 5GAEC 2F52A 1XNRQ 4A3CH 3BJUA 1R9TH 2WB1G 3HKZG 3G48A 4DUYL 2F3IA 1XJVA 4DV4Q 4BY7G 4IPDA 3TREA 1N33Q 4GKKQ 2JK8A 3PO3H 3TQYA 1L0WA 3W5OA 1SN8A 1E1TA 1X3FA 4A3MH 3U58A 2WAQG 4GOPA 3L0OA 2I5HA 1VQ4A 2VUMH 2HIVA 2R6GA 3CPFA 1QUQB 4X62L 1NBWA 1IBML 3HOWG 4DNIA 2HQLA 4OX9L 2ZJPA 2CCZA 2NVTH 5E7NA 3GTKH 4L5QA 1UWVA 1VQAA 1HNZL 1XNQL 3CXCA 4DR7Q 4DV5L 1L1OC 1YHAA 4KHPL 4P72A 4JI6Q 4TQUS 2H5XA 1J5EQ 1S3OA 3UDIA 2JE6I 1HNWQ 4A3FG 4X65Q 1TWFH 2E2IH 3PUWA 4HIKA 1VQ7A 4JI0L 3B6YA 1EUJA 4X66L 1KIXA 4A3LG 2GVAA 5H1SE 2JA5H 4JBWA 3S1QH 4DKAC 3TS2A 2Q2HA 2NZOA 4EQ5A 2NZHA 4NXNQ 4LF8Q 2CWAA 2N8NA 4HJ8A 2N3SA 2VW9A 1P8LA 3I4NG 4GN4B 1KL9A 1Y1WH 1HNXQ 3A74A 4DR6Q 1SR3A 2MFIA 2Z6KC 1VQ5A 1IL2A 2F4VQ 4BA2I 2IY5B 1B7YB 1SFOH 2WP8J 2VS1A 1CSPA 3H3VH 4YWKA 2UUCL 4OONA 1VQLA 2MO0A 3FKIH 4HJ5A 1E1OA 3GTOH 1Q7YC 1TWAH 1E3PA 3PF4A 3S16H 4APVA 3NENA 2V1CC 4GLVB 1YITA 1N33L 5IYBH 4GKKL 2EIFA 1PHJA 2K5HA 4A3GG 2JA7H 1SROA 2ZM6Q 3GTMH 5LMUL 1Q8KA 1SRUA 3S2DH 2PQAA 3HOUG 1GVPA 3GDEA 1FGUA 3JAMc 4DR2L 3E9IA 4LF7Q 2LXJA 5M3MH 3H0GG 1K8GA 5LMNQ 3CC4A 3KYHC 1YEZA 3H15A 5C4XG 1J5EL 3J80c 1OXTA 1XTDA 4A75A 1B70B 1OXUA 4X65L 2PI2A 3KDFB 4GKJL 2ZTCA 2JA6G 2OCEA 2JQOA 2Y0SE 4KI0A 4MZ9A 1CKOA 1HZBA 5C44H 2OTLA 4BY1H 2UXDL 1T9HA 4DV0L 1QZHA 3F8TA 4DR1Q 4DR3L 4NB3A 4AQYQ 4JYAQ 1GO3E 1X55A 4QY7A 3I4MG 1X6OA 4QL5A 4GOPB 1HNXL 4PG3A 1WFQA 1PVOA 4MNOA 1O7IA 2A1AA 1JB7A 2F4VL 2JA8G 2PI2E 5GQOA 5M5XH 4QGUA 3CCEA 3CMAA 1Y1VG 1ASZA 2R7DA 1VQKA 2MNAA 1ASYA 5M5YH 4PMWA 4DV2Q 3TRZA 3HOYG 1NE3A 1U0LA 1I6HH 2ZTDA 3STBD 3U50C 5FLXc 2UU9L 2N49A 4L5TA 3CF5A 2K4KA 4BBSH 5FJ8G 4B3TQ 1N32L 3PV0A 1WYDA 4L5SA 1FJGQ 3EIVA 2MQHA 4JI3L 3CW2C 3CCVA 5IP7G 3E9HA 3G71A 3HOVH 2KCMA 4DAYB 3HOZG 4NXMQ 5GROA 4BXXH 5K36G 3S1RH 1VQMA 1QVFA 1B8AA 4OWWB 4IFDG 1HZCA 1K0RA 3M85A 3RNUA 4A3EG 2Y0SG 3KJOA 2I5MX 4GN5A 4JG2A 4JI8Q 4R4OA 4KHZA 5EAYA 4OWTB 1XMQQ 2K5VA 1IBKL 4LF9Q 3PUYA 4R4IA 1BBUA 4IPGA 4DUZL 1I94Q 1BBWA 1X3EA 4GOPC 1FL0A 3CCJA 1VQOA 4LF4Q 4LWCA 1TWHH 3UDXA 3S1NH 2UXBQ 4GLXA 5JJKA 2UXCQ 2KBNA 3T1YQ 4BBRH 4LF6Q 4B3SQ 2Q2TA 1UE6A 3RLFA 1X56A 1JMCA 2OTJA 3RR5A 4A3JH 2GVBA 3OTOL 1N36Q 4A4IA 5IYCH 1EYGA 3CCQA 3DLLA 5DLQE 2LSSA 2VQEQ 1VQIA 3A5ZB 4JI2L 2LXKA 2JA9A 1Q1BA 2EXDA 1PV4A 1TWCH 4JI7Q 4LUVA 2NVQH 4GLAC 1MKHA 2D0PA 3BU2A 3HOXG 1YJWA 4DK3C 1N34Q 5M3FG 1HR0Q 4BY7H 4A3CG 1Q12A 3PUZA 4K0KQ 1IYJB 1SLJA 3I56A 1XPRA 4IOCA 1OXVA 3J81c 3HOWH 4PZ7A 2OQKA 1YHBA 4EX5A 4JV5Q 2OQ0A 4O0AA 1FJGL 4LF5L 5C0XJ 3G6EA 3CAMA 4UPAA 2WFWA 3FP9A 4DV7Q 1VQPA 1JJGA 4NXML 4IPHA 1PH6A 1BKBA 4YHHL 3OW2A 2HHHQ 4YY3Q 4DR5Q 2JJQA 1CKNB 2HIXA 4A3FH 2ES2A 4X64Q 1XMQL 1XNRL 3S1MH 3A5UA 4A3KG 1TWGH 3ZJYC 5C4JH 1PH7A 1I94L 3S14H 4A3LH 4UP9A 1K83H 3SGIA 4LFAQ 2B63G 3IRBA 2E5LQ 2KENA 2OWOA 4LF4L 5C0XG 1Q46A 1KRSA 2RF4A 1XPUA 5JEAJ 3W1GA 4GS3A 4POFA 3I4NH 2UXBL 3KF6A 1E7ZA 1G291 3UE1A 3GTPH 2UXCL 4A3DG 2R93H 2D0OA 2JA5G 3KOJA 4DR4Q 1HZAA 1PH3A 4P74A 2AKWB 3D31A 4BA1I 1N36L 4YCUA 2K14A 5GADC 4C3JH 1S72A 2VQEL 4C2MH 4DV4L 3I55A 1XMOQ 1PH8A 3CCSA 1RL2A 3KLWA 3EN2A 4JI4Q 3AQQA 1KXLA 5C0XI 1KAWA 1MJEA 1HR0W 5IY0A 5JEAG 1OXXK 1L1OA 3GD7A 4K0KL 4XIGS 1KD1C 1C0AA 4OWXB 2K52A 3K7UC 1KQSA 2R92G 3CCLA 4DR7L 1KRTA 3AFQA 4WJ3M 2ZTEA 4HJ9A 1LM0A 1XPOA 4IOAA 3HOUH 4JI6L 3MXNB 2UUBQ 1UE5A 3J80i 1WI5A 4JOIC 4QIWE 3GTGH 1JT8A 1IBLQ 1HNWL 4R4CA 3AEVA 4DV7L 4GN3B 3CC7A 5IT9c 1E22A 1VQNA 4R4TA 3GTLH 3H3VI 2QA4A 4B3MQ 2E2JH 4PZ6A 4JI5Q 5C4XH 4DV1Q 4A3IH 4JI1Q 4YY3L 4XTCS 2QEXA 2ASBA 3UE0A 2YTXA 4JCVE 3K0XA 3PO2G 4NXNL 2VQFQ 4LF8L 3M4PA 3VDYA 1PA6A 1OTCA 2YYZA 1VQGA 3M9BA 4LNQA 2UUAQ 1W2BA 3KFUA 2D62A 1C7YA 3TS0A 2KHIA 1CUKA 4UP7A 4DR6L 1VQCA 1VQJA 3S2HH 2HT1A 5FLMG 1HZ9A 1VQEA 3T1HQ 1V43A 2VL6A 4LFCQ 3I4MH 3I2ZA 3EBEA 3BZCA 5GAHC 5AJ3Q 1VQ6A 3AFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y H;  1EWI A;  2NN6 G;  1GM5 A;  4J15 A;  4A3B G;  1A62 A;  1Y1V H;  3UDG A;  1I3Q H;  2ATW A;  1BVS A;  1H95 A;  3CP0 A;  3F2B A;  5JJI A;  2E8G A;  1J6Q A;  3HOY H;  2ID0 A;  1PH4 A;  1D7Q A;  2N78 A;  1QVC A;  1AH9 A;  5C3E G;  2ZM6 L;  4JI4 L;  5JJL A;  3Q8D A;  4DUY Q;  2Z0S A;  4A76 A;  3W1B A;  4LW1 A;  2IX0 A;  4YWL A;  2R7Z H;  5FJ8 H;  1S40 A;  1QVG A;  1A8V A;  1RIP A;  4A93 H;  1X65 A;  4LF7 L;  1LTL A;  3I7F A;  2NN6 I;  5LMN W;  4X62 Q;  5LMN L;  3HOZ H;  5IP9 G;  2R7F A;  5IE8 A;  3MEF A;  5J3B A;  3NEL A;  3CCU A;  1YHQ A;  2GN5 A;  4OX9 Q;  5ELN A;  1DGS A;  4A3E H;  5IYD G;  2L15 A;  4R1J A;  1HNZ Q;  1YZ6 A;  2K75 A;  4DV5 Q;  1MIU A;  1GD7 A;  4LUZ A;  5HGQ A;  3JC6 6;  1Q82 C;  3CC2 A;  4KHP Q;  1K3R A;  3A0J A;  1WCM G;  3S17 H;  2PMZ E;  2Q2I A;  1A63 A;  4TVA B;  2BH2 A;  4DR1 L;  1LYL A;  2CWP A;  4AQY L;  4JI0 Q;  4JYA L;  4X66 Q;  4POG A;  1PYS B;  1G6P A;  1HJP A;  3CCM A;  1M90 C;  1HH2 P;  2VY3 A;  1L2F A;  4AYB E;  4Y7N H;  2PQA B;  4IJL A;  1N8R C;  1L1O B;  2NVY H;  1CKM A;  2ALY B;  3T1H L;  1EIY B;  4BBR G;  4YCW A;  4DV2 L;  2IX1 A;  3K8A A;  3U4Z A;  4GNX A;  1LUZ A;  3J81 j;  2C35 B;  2XTI A;  1JE5 A;  1AE2 A;  1V1Q A;  3HOX H;  4JBM A;  1IZ6 A;  5M3F H;  4HIO A;  4B3T L;  3KDF A;  1EIF A;  3PO3 G;  3F2D A;  1MJC A;  1VS0 A;  4A3M G;  2VUM G;  3KJP A;  4RMF A;  4HJA A;  3ER0 A;  1Z47 A;  1AE3 A;  1VQF A;  4P71 A;  1WJJ A;  3NBH B;  1KHI A;  1TXY A;  4ALP A;  3G4S A;  2CKZ B;  3TEH B;  4PZ8 A;  3PF5 A;  5LMU Q;  4P75 A;  1K8A C;  3L7Z C;  4JI8 L;  3CPW A;  1Q81 C;  4HID A;  4LF9 L;  1PH1 A;  2EQS A;  1V9P A;  4DR2 Q;  1PH9 A;  2NVX H;  2A8V A;  1VCI A;  3GTJ H;  4JBJ A;  4AYB G;  4RG1 A;  4A3K H;  3PUV A;  1U5K A;  3E0E A;  2I0Q A;  3LGJ A;  4IPC A;  4KLK A;  2VNU D;  2ZJR A;  4DV6 Q;  4QJF A;  3T1Y L;  1EQQ A;  4LF6 L;  4B3S L;  2B63 H;  4X6A H;  3BZK A;  4GKJ Q;  2AWN A;  3NEM A;  1VQH A;  1PYB A;  1EOV A;  2Q2U A;  2IHF A;  1SMX A;  1Y1W G;  4A3D H;  3M4Q A;  5ELO A;  2UXD Q;  1M1K C;  2PNH A;  4DV0 Q;  3HKS A;  4JI7 L;  4UY8 C;  4C3I H;  3D0F A;  4DR3 Q;  2E2H H;  4QQB X;  2IT1 A;  1X9N A;  1Q1E A;  2R93 G;  4NPS A;  4B3R Q;  1N34 L;  3FHW A;  3HFZ B;  3K80 C;  1HR0 L;  3PSI A;  5IWA Q;  3FKI G;  3M7N A;  3STB C;  1VQB A;  3L2P A;  4A3G H;  2RHQ B;  3JAM i;  3GO5 A;  4L5R C;  4AH6 A;  3K81 C;  4C3H H;  3F1Z A;  4DV3 Q;  3WWV A;  5IYB G;  2YV5 A;  4R4Q A;  2AWO A;  4JV5 L;  4DAM A;  1NMF A;  1VQ8 A;  2BA1 A;  1YIJ A;  2JEA I;  2JA7 G;  2BA0 A;  2UU9 Q;  2MO1 A;  4LFB Q;  1GKH A;  4UP8 A;  4LUO A;  3H0G H;  2FXQ A;  3RZD H;  2R92 H;  4Y52 H;  4IFD J;  1N32 Q;  1E24 A;  5BR8 Q;  1JJ2 A;  5GAG C;  1WOC A;  1W3S A;  2RHS B;  2B3G A;  4MTN A;  4JI3 Q;  2HHH L;  1I5F A;  3S15 H;  4DR5 L;  5M3M G;  2K50 A;  4X64 L;  2Z6K A;  1YJ9 A;  3CD6 A;  1X3G A;  4ME3 A;  4AIM A;  2JA6 H;  2YTV A;  1X54 A;  3S24 A;  1K73 C;  1PH5 A;  3RLO A;  1JJC B;  1QUQ A;  4LFA L;  2KHJ A;  2E5L L;  1K9M C;  3PO2 H;  3PCO B;  3F2C A;  2ZJQ A;  2JEB I;  4GNX B;  1IBK Q;  3UDF A;  4P73 A;  4JC0 A;  5HY6 A;  4DUZ Q;  3PUX A;  3PIO A;  4A3I G;  2CFM A;  4DV6 L;  2RCN A;  1YVC A;  2B29 A;  2IHE A;  4BY1 G;  5C44 G;  2DUD A;  4IO9 A;  4DR4 L;  3RLN A;  1FVI A;  2JA8 H;  5FLM H;  2DGY A;  1YJN A;  2QGQ A;  1NTG A;  3RN2 A;  4YWM A;  2I5L X;  3CME A;  1XMO L;  1SE8 A;  3AYH B;  1A0I A;  1YNX A;  2AMC B;  3OTO Q;  4A3B H;  1CKN A;  1PH2 A;  1NJI C;  4JI2 Q;  4IJH A;  4B3R L;  3K7A H;  4FDB A;  1P16 A;  5IWA L;  3GTQ H;  4IFD I;  5C3E H;  4JBK A;  3ICE A;  4JOI A;  4YCV A;  3U4V A;  5IP7 H;  2A19 A;  4OXP A;  2AHO B;  3RN5 A;  4DV3 L;  3PGZ A;  4HJ7 A;  1IBM Q;  4BBS G;  1OXS C;  2WB1 E;  3HKZ E;  1QZG A;  4WJ4 A;  1I50 H;  2VZA A;  3ULP A;  2UUB L;  1VQD A;  2CQO A;  3KF6 B;  1KC8 C;  1IBL L;  1NMG A;  2YTY A;  4LFB L;  1XNQ Q;  4H02 A;  3HOV G;  2R7Z G;  1Q86 C;  2KCT A;  3ULL A;  5IP9 H;  5M5W H;  5BR8 L;  4GNX C;  4B3M L;  4DPG A;  4JI5 L;  2WAQ E;  4BXX G;  4LF5 Q;  4DV1 L;  4O2D A;  4A93 G;  4JI1 L;  4OO1 G;  4HIM A;  5IYD H;  4DK6 C;  3I4O A;  3RZO H;  3J7Z C;  1EFW A;  2VQF L;  1CSQ A;  1C9O A;  4YHH Q;  1UE7 A;  3ULJ A;  2UUA L;  1N9W A;  1IXR A;  1WCM H;  3ERS X;  1G51 A;  1D8L A;  3M4O H;  1NY4 A;  3PIP A;  3J7A 5;  1UE1 A;  1UEB A;  2YU9 H;  4LFC L;  1YI2 A;  3KF8 B;  1YBY A;  2K5N A;  1Z9F A;  5AJ3 L;  1Y14 B;  1PFS A;  2XGT A;  1VQ9 A;  4OO1 I;  4A3J G;  3CCR A;  5IYC G;  2BH8 A;  3DM3 A;  3CQZ H;  3J81 i;  2UUC Q;  3OYY A;  1EQR A;  5GAE C;  2F52 A;  1XNR Q;  4A3C H;  3BJU A;  1R9T H;  2WB1 G;  3HKZ G;  3G48 A;  4DUY L;  2F3I A;  1XJV A;  4DV4 Q;  4BY7 G;  4IPD A;  3TRE A;  1N33 Q;  4GKK Q;  2JK8 A;  3PO3 H;  3TQY A;  1L0W A;  3W5O A;  1SN8 A;  1E1T A;  1X3F A;  4A3M H;  3U58 A;  2WAQ G;  4GOP A;  3L0O A;  2I5H A;  1VQ4 A;  2VUM H;  2HIV A;  2R6G A;  3CPF A;  1QUQ B;  4X62 L;  1NBW A;  1IBM L;  3HOW G;  4DNI A;  2HQL A;  4OX9 L;  2ZJP A;  2CCZ A;  2NVT H;  5E7N A;  3GTK H;  4L5Q A;  1UWV A;  1VQA A;  1HNZ L;  1XNQ L;  3CXC A;  4DR7 Q;  4DV5 L;  1L1O C;  1YHA A;  4KHP L;  4P72 A;  4JI6 Q;  4TQU S;  2H5X A;  1J5E Q;  1S3O A;  3UDI A;  2JE6 I;  1HNW Q;  4A3F G;  4X65 Q;  1TWF H;  2E2I H;  3PUW A;  4HIK A;  1VQ7 A;  4JI0 L;  3B6Y A;  1EUJ A;  4X66 L;  1KIX A;  4A3L G;  2GVA A;  5H1S E;  2JA5 H;  4JBW A;  3S1Q H;  4DKA C;  3TS2 A;  2Q2H A;  2NZO A;  4EQ5 A;  2NZH A;  4NXN Q;  4LF8 Q;  2CWA A;  2N8N A;  4HJ8 A;  2N3S A;  2VW9 A;  1P8L A;  3I4N G;  4GN4 B;  1KL9 A;  1Y1W H;  1HNX Q;  3A74 A;  4DR6 Q;  1SR3 A;  2MFI A;  2Z6K C;  1VQ5 A;  1IL2 A;  2F4V Q;  4BA2 I;  2IY5 B;  1B7Y B;  1SFO H;  2WP8 J;  2VS1 A;  1CSP A;  3H3V H;  4YWK A;  2UUC L;  4OON A;  1VQL A;  2MO0 A;  3FKI H;  4HJ5 A;  1E1O A;  3GTO H;  1Q7Y C;  1TWA H;  1E3P A;  3PF4 A;  3S16 H;  4APV A;  3NEN A;  2V1C C;  4GLV B;  1YIT A;  1N33 L;  5IYB H;  4GKK L;  2EIF A;  1PHJ A;  2K5H A;  4A3G G;  2JA7 H;  1SRO A;  2ZM6 Q;  3GTM H;  5LMU L;  1Q8K A;  1SRU A;  3S2D H;  2PQA A;  3HOU G;  1GVP A;  3GDE A;  1FGU A;  3JAM c;  4DR2 L;  3E9I A;  4LF7 Q;  2LXJ A;  5M3M H;  3H0G G;  1K8G A;  5LMN Q;  3CC4 A;  3KYH C;  1YEZ A;  3H15 A;  5C4X G;  1J5E L;  3J80 c;  1OXT A;  1XTD A;  4A75 A;  1B70 B;  1OXU A;  4X65 L;  2PI2 A;  3KDF B;  4GKJ L;  2ZTC A;  2JA6 G;  2OCE A;  2JQO A;  2Y0S E;  4KI0 A;  4MZ9 A;  1CKO A;  1HZB A;  5C44 H;  2OTL A;  4BY1 H;  2UXD L;  1T9H A;  4DV0 L;  1QZH A;  3F8T A;  4DR1 Q;  4DR3 L;  4NB3 A;  4AQY Q;  4JYA Q;  1GO3 E;  1X55 A;  4QY7 A;  3I4M G;  1X6O A;  4QL5 A;  4GOP B;  1HNX L;  4PG3 A;  1WFQ A;  1PVO A;  4MNO A;  1O7I A;  2A1A A;  1JB7 A;  2F4V L;  2JA8 G;  2PI2 E;  5GQO A;  5M5X H;  4QGU A;  3CCE A;  3CMA A;  1Y1V G;  1ASZ A;  2R7D A;  1VQK A;  2MNA A;  1ASY A;  5M5Y H;  4PMW A;  4DV2 Q;  3TRZ A;  3HOY G;  1NE3 A;  1U0L A;  1I6H H;  2ZTD A;  3STB D;  3U50 C;  5FLX c;  2UU9 L;  2N49 A;  4L5T A;  3CF5 A;  2K4K A;  4BBS H;  5FJ8 G;  4B3T Q;  1N32 L;  3PV0 A;  1WYD A;  4L5S A;  1FJG Q;  3EIV A;  2MQH A;  4JI3 L;  3CW2 C;  3CCV A;  5IP7 G;  3E9H A;  3G71 A;  3HOV H;  2KCM A;  4DAY B;  3HOZ G;  4NXM Q;  5GRO A;  4BXX H;  5K36 G;  3S1R H;  1VQM A;  1QVF A;  1B8A A;  4OWW B;  4IFD G;  1HZC A;  1K0R A;  3M85 A;  3RNU A;  4A3E G;  2Y0S G;  3KJO A;  2I5M X;  4GN5 A;  4JG2 A;  4JI8 Q;  4R4O A;  4KHZ A;  5EAY A;  4OWT B;  1XMQ Q;  2K5V A;  1IBK L;  4LF9 Q;  3PUY A;  4R4I A;  1BBU A;  4IPG A;  4DUZ L;  1I94 Q;  1BBW A;  1X3E A;  4GOP C;  1FL0 A;  3CCJ A;  1VQO A;  4LF4 Q;  4LWC A;  1TWH H;  3UDX A;  3S1N H;  2UXB Q;  4GLX A;  5JJK A;  2UXC Q;  2KBN A;  3T1Y Q;  4BBR H;  4LF6 Q;  4B3S Q;  2Q2T A;  1UE6 A;  3RLF A;  1X56 A;  1JMC A;  2OTJ A;  3RR5 A;  4A3J H;  2GVB A;  3OTO L;  1N36 Q;  4A4I A;  5IYC H;  1EYG A;  3CCQ A;  3DLL A;  5DLQ E;  2LSS A;  2VQE Q;  1VQI A;  3A5Z B;  4JI2 L;  2LXK A;  2JA9 A;  1Q1B A;  2EXD A;  1PV4 A;  1TWC H;  4JI7 Q;  4LUV A;  2NVQ H;  4GLA C;  1MKH A;  2D0P A;  3BU2 A;  3HOX G;  1YJW A;  4DK3 C;  1N34 Q;  5M3F G;  1HR0 Q;  4BY7 H;  4A3C G;  1Q12 A;  3PUZ A;  4K0K Q;  1IYJ B;  1SLJ A;  3I56 A;  1XPR A;  4IOC A;  1OXV A;  3J81 c;  3HOW H;  4PZ7 A;  2OQK A;  1YHB A;  4EX5 A;  4JV5 Q;  2OQ0 A;  4O0A A;  1FJG L;  4LF5 L;  5C0X J;  3G6E A;  3CAM A;  4UPA A;  2WFW A;  3FP9 A;  4DV7 Q;  1VQP A;  1JJG A;  4NXM L;  4IPH A;  1PH6 A;  1BKB A;  4YHH L;  3OW2 A;  2HHH Q;  4YY3 Q;  4DR5 Q;  2JJQ A;  1CKN B;  2HIX A;  4A3F H;  2ES2 A;  4X64 Q;  1XMQ L;  1XNR L;  3S1M H;  3A5U A;  4A3K G;  1TWG H;  3ZJY C;  5C4J H;  1PH7 A;  1I94 L;  3S14 H;  4A3L H;  4UP9 A;  1K83 H;  3SGI A;  4LFA Q;  2B63 G;  3IRB A;  2E5L Q;  2KEN A;  2OWO A;  4LF4 L;  5C0X G;  1Q46 A;  1KRS A;  2RF4 A;  1XPU A;  5JEA J;  3W1G A;  4GS3 A;  4POF A;  3I4N H;  2UXB L;  3KF6 A;  1E7Z A;  1G29 1;  3UE1 A;  3GTP H;  2UXC L;  4A3D G;  2R93 H;  2D0O A;  2JA5 G;  3KOJ A;  4DR4 Q;  1HZA A;  1PH3 A;  4P74 A;  2AKW B;  3D31 A;  4BA1 I;  1N36 L;  4YCU A;  2K14 A;  5GAD C;  4C3J H;  1S72 A;  2VQE L;  4C2M H;  4DV4 L;  3I55 A;  1XMO Q;  1PH8 A;  3CCS A;  1RL2 A;  3KLW A;  3EN2 A;  4JI4 Q;  3AQQ A;  1KXL A;  5C0X I;  1KAW A;  1MJE A;  1HR0 W;  5IY0 A;  5JEA G;  1OXX K;  1L1O A;  3GD7 A;  4K0K L;  4XIG S;  1KD1 C;  1C0A A;  4OWX B;  2K52 A;  3K7U C;  1KQS A;  2R92 G;  3CCL A;  4DR7 L;  1KRT A;  3AFQ A;  4WJ3 M;  2ZTE A;  4HJ9 A;  1LM0 A;  1XPO A;  4IOA A;  3HOU H;  4JI6 L;  3MXN B;  2UUB Q;  1UE5 A;  3J80 i;  1WI5 A;  4JOI C;  4QIW E;  3GTG H;  1JT8 A;  1IBL Q;  1HNW L;  4R4C A;  3AEV A;  4DV7 L;  4GN3 B;  3CC7 A;  5IT9 c;  1E22 A;  1VQN A;  4R4T A;  3GTL H;  3H3V I;  2QA4 A;  4B3M Q;  2E2J H;  4PZ6 A;  4JI5 Q;  5C4X H;  4DV1 Q;  4A3I H;  4JI1 Q;  4YY3 L;  4XTC S;  2QEX A;  2ASB A;  3UE0 A;  2YTX A;  4JCV E;  3K0X A;  3PO2 G;  4NXN L;  2VQF Q;  4LF8 L;  3M4P A;  3VDY A;  1PA6 A;  1OTC A;  2YYZ A;  1VQG A;  3M9B A;  4LNQ A;  2UUA Q;  1W2B A;  3KFU A;  2D62 A;  1C7Y A;  3TS0 A;  2KHI A;  1CUK A;  4UP7 A;  4DR6 L;  1VQC A;  1VQJ A;  3S2H H;  2HT1 A;  5FLM G;  1HZ9 A;  1VQE A;  3T1H Q;  1V43 A;  2VL6 A;  4LFC Q;  3I4M H;  3I2Z A;  3EBE A;  3BZC A;  5GAH C;  5AJ3 Q;  1VQ6 A;  3AFP A; 
#chains in the Genus database with same CATH topology
 2ATW A;  1BVS A;  5JJI A;  2E8G A;  4ZRZ A;  2ID0 A;  1D7Q A;  5ELB A;  2N78 A;  1LT5 D;  1AH9 A;  4JI4 L;  1B1Z A;  2IX0 A;  5FJ8 H;  1TS3 A;  1SDF A;  4JVZ A;  1S40 A;  3MEH A;  4LF7 L;  2FMC A;  1J9O A;  2NN6 I;  2NTS A;  4X62 Q;  5IP9 G;  4FF1 A;  3MEF A;  3MC0 B;  5K36 H;  2GN5 A;  1DGS A;  5CV8 A;  4A3E H;  2L15 A;  1YZ6 A;  4KHP Q;  5COR A;  3IL8 A;  2IWH A;  2PMZ E;  4RGT A;  2PQE A;  4TVA B;  2I07 B;  1B44 D;  2E76 C;  1SNP A;  1GUO A;  1PYW D;  5T1I A;  1HJP A;  3CRK C;  5E3F A;  1I50 B;  4N9T A;  3KUP A;  3QOL A;  4IJL A;  4ZYS A;  1CKM A;  1TU2 B;  3D4R A;  2CW0 C;  3RD4 A;  3TP8 A;  2IX1 A;  3MTS A;  4GNX A;  3IKJ A;  3T53 B;  1EIH A;  2G5D A;  3K59 A;  1HHV A;  1WTW A;  4JBM A;  4HIO A;  1EIF A;  1KDA A;  3PO3 G;  3F2D A;  1WCM B;  4FNF A;  1Z47 A;  1AE3 A;  1WJJ A;  3ZYY X;  1KHI A;  2CKZ B;  4RH6 A;  1PRT C;  4P75 A;  2IX3 A;  1Q81 C;  1PH1 A;  2K05 A;  2E75 C;  1HTL D;  1U5K A;  2HDL A;  2BDN A;  3X3M A;  4KLK A;  4LF6 L;  4X6A H;  4CKE A;  1CZG A;  1VQH A;  5CV9 A;  5JPM C;  1JWU D;  1SND A;  1SMX A;  1F77 A;  2Z9H A;  4G7H C;  4A3D H;  1Y8O B;  3VR4 A;  4ZUJ A;  4JI7 L;  2E2H H;  1YNN D;  2LFN A;  3FHW A;  4PNY A;  5IWA Q;  3STB C;  3L2P A;  1LAC A;  2RHQ B;  3JAM i;  1AW7 A;  3GO5 A;  4L5R C;  3KF8 A;  4AH6 A;  4C3H H;  1LAB A;  2RVL A;  5JEA H;  4U68 A;  2BA1 A;  2BA0 A;  2A74 C;  1GKH A;  4UAI A;  5BN5 A;  2R92 H;  2OEO A;  1E24 A;  1W3S A;  2QKI C;  4P2C B;  4XYO A;  4DR5 L;  1EU4 A;  1JR0 D;  1SYE A;  2Z6K A;  3LX0 A;  1CQF A;  5COY A;  1DON A;  4UDU C;  2Q8I B;  4F87 A;  1JJC B;  4X3S A;  1B9N A;  1K9M C;  5EQ0 A;  3F2C A;  2R92 B;  3UDF A;  3PUX A;  1K8A C;  2CFM A;  2RCN A;  1YVC A;  2IHE A;  3RLN A;  1FVI A;  2Z6B A;  5FLM H;  2X69 A;  4IUN A;  1NTG A;  3PQI A;  1JB3 A;  2BE5 C;  3AYH B;  1V1P B;  1HQR D;  2AMC B;  1X32 A;  3SK6 A;  4B3R L;  3GTQ H;  4QCL A;  2F0Q A;  4JBK A;  4JOI A;  4DU9 A;  5BN4 A;  3DWQ A;  3H3V C;  4WJ4 A;  1TS5 A;  4BY1 B;  1VQD A;  3KF6 B;  3O13 A;  3VR2 A;  1Q86 C;  2NUC A;  2B2W A;  2WAQ E;  2O2L D;  3TSS A;  4KKS A;  1C4Q A;  4JI1 L;  2A6E C;  3RZO H;  5C5L A;  1KLG D;  1FYC A;  2L11 A;  3BS1 A;  3W3A A;  2CQA A;  5I2Y A;  3GQB A;  1QCB D;  4LFC L;  4BBS B;  4LJZ C;  3P20 A;  5AJ3 L;  2F0L A;  1ONL A;  4OO1 I;  3MXN A;  3CCR A;  1S5D D;  2EY1 A;  1Y8P B;  4OHJ A;  1ILQ A;  3CQZ H;  3J81 i;  4ME5 A;  3GV6 A;  3OYY A;  2F52 A;  1R9T H;  2K32 A;  1HPC A;  2LY7 A;  3KK7 A;  4DUY L;  1XJV A;  1QJO A;  4TRD A;  1LTA D;  1SYC A;  5DEH A;  2KA7 A;  1PTO F;  2OXP A;  1SN8 A;  1X3F A;  4A3M H;  2VUM H;  1E2Z A;  1STB A;  2HIV A;  1IBM L;  1QUQ B;  3HOW G;  1NBW A;  1A2U A;  5E7N A;  3V05 A;  4L5Q A;  3W2D A;  4A3J B;  4DV5 L;  2XRQ D;  1YHA A;  1TWC B;  1RD9 D;  2NVQ B;  1TWF H;  5J39 A;  4BY7 B;  4A3L G;  3I91 A;  2GVA A;  4L6T B;  4DKA C;  1LTI D;  2Q2H A;  4G7O C;  4KN7 C;  4LF8 Q;  4HJ8 A;  2N3S A;  1Y1W H;  2E74 C;  1HNX Q;  2SDF A;  1VQ5 A;  4BA2 I;  1KLU D;  1IL2 A;  3DWA A;  2VS1 A;  1CSP A;  2CW0 D;  4DF7 A;  4YWK A;  4OGQ C;  4HJ5 A;  1GUT A;  1E1O A;  1TWA H;  3S16 H;  4APV A;  5E4X A;  4GLV B;  1SAP A;  2V4D A;  3TN2 A;  1N33 L;  4GKK L;  2EIF A;  1Y1W B;  2K5H A;  1SRO A;  4ID6 A;  2ICI A;  1SRU A;  1H9S A;  3S2D H;  3I4N B;  4IN3 A;  3GTP B;  4NW2 A;  1PFM A;  1AZQ A;  3MFY A;  4WOR A;  4DR2 L;  4LF7 Q;  5M3M H;  1HXY D;  1PRT D;  1K3B C;  1STY A;  4F88 A;  2F0I A;  3KYH C;  4IQZ A;  3H15 A;  3K5M A;  3Q23 A;  5C4X G;  4MN3 A;  1J5E L;  2N88 A;  1B70 B;  3KDF B;  3A7L A;  4R8N A;  2IPK D;  3J7A V;  2OCE A;  3ERQ A;  4IFD H;  4KI0 A;  1I4G A;  5C44 H;  2UXD L;  1MBY A;  4DV0 L;  1QZH A;  2L12 A;  4NB3 A;  4LMQ D;  2K5D A;  4QY7 A;  3I4M G;  4QL5 A;  4GOP B;  1QG7 A;  4CBV A;  4KKT A;  5GQO A;  4DFA A;  1SJH D;  4DXG A;  2Z1C A;  3JAM E;  1ASY A;  2E2J B;  5M5Y H;  3HOY G;  4A3I B;  1PFB A;  2B39 A;  3STB D;  3TME A;  5C44 B;  1E2W A;  4KK7 A;  1N32 L;  1WYD A;  1OO9 B;  2PCF B;  3S2H B;  3CCV A;  3R2T A;  3HOV H;  4ZKB B;  2EJM A;  2HD3 A;  1QOH A;  4OWW B;  2XSC A;  2Y0S G;  5NUC A;  2I5M X;  1XMQ Q;  3TDQ A;  2N55 A;  4ODG A;  1IBK L;  1Y1V B;  5CV5 A;  1I3Q B;  3T56 B;  1I94 Q;  1BBU A;  4DUZ L;  4E6I A;  1GJX A;  1VQO A;  3CCJ A;  4HMI A;  4WJW A;  1SNQ A;  5JJK A;  1WVL A;  2KBN A;  1D5M C;  3OIQ A;  4KD4 A;  4LF6 Q;  1UE6 A;  3DWP A;  1X56 A;  4A93 B;  2WII B;  2OTJ A;  3RR5 A;  1N36 Q;  2GVB A;  4A4I A;  3A8I E;  4QUC A;  2LSS A;  2VQE Q;  4JI2 L;  2H1E A;  1Q1B A;  2BE5 D;  2LMC B;  4JI7 Q;  2R3Z A;  1VF5 C;  4GLA C;  1MKH A;  1YJW A;  3KLR A;  2F1M A;  1SEB D;  5CR3 A;  1EZ6 A;  3S17 B;  2FJ2 A;  1SLJ A;  3MXU A;  3I56 A;  1XPR A;  1OXV A;  2WKC A;  1EWC A;  1TVX A;  4PZ7 A;  1ET6 A;  1FJG L;  4LF5 L;  4Y7N B;  3G6E A;  2WFW A;  4IPH A;  2MP1 A;  2PPB C;  2JSO A;  1WTO A;  3OWE B;  1STH A;  2F4I A;  4DR5 Q;  2JJQ A;  1CKN B;  2A6E D;  2HIX A;  3S1M H;  2KCC A;  1FNW A;  3SEB A;  4A3K G;  5C4J H;  3HOX B;  5M3F B;  2SOB A;  3NTI A;  2F03 A;  2B63 G;  2EJG C;  4LF4 L;  1XPU A;  5JEA J;  3VYR A;  1BUV T;  3KOJ A;  3V2T A;  4BA1 I;  3J81 E;  1G6Z A;  4YCU A;  1EYD A;  4RAU C;  2TMP A;  1S72 A;  4C2M H;  4DV4 L;  1IW7 C;  1PH8 A;  1IYU A;  1STA A;  3CCS A;  2NVX B;  1B3A A;  2A68 C;  3GTJ B;  2EYL A;  1NUC A;  3OMG A;  1HR0 W;  1L1O A;  2F0O A;  4K0K L;  1KD1 C;  2K52 A;  4HSV A;  1AFP A;  3CCL A;  1GUN A;  2ZTE A;  4IOA A;  3LWE A;  3HOU H;  4RKB A;  3VR6 A;  3GTG H;  3FDT A;  4JOI C;  3VA5 A;  4DV7 L;  4EGV A;  4C3I B;  2ZXO A;  5IT9 c;  1VQN A;  3GTL H;  2QA4 A;  3EVQ A;  2M2L A;  2RCF A;  4Q5V A;  4JI1 Q;  2QEX A;  1DOM A;  2MHV A;  1QE6 A;  2B2W C;  2JXM B;  4NXN L;  1PA6 A;  1JOQ A;  2YYZ A;  1PDQ A;  3VR3 A;  2AQ3 B;  4LNQ A;  1W2B A;  3VA7 A;  3A8J E;  1CUK A;  3GTG B;  2HT1 A;  4G7Z C;  3DEO A;  1E0B A;  1JC7 A;  1I6V C;  1VQE A;  4LFC Q;  2VL6 A;  1XXG A;  3EBE A;  3K6O A;  4M8A A;  5AJ3 Q;  1RL2 A;  3M3Y H;  2NN6 G;  4A3B G;  4J15 A;  1EY7 A;  3N6R A;  1SE4 A;  3R3O A;  2C9O A;  2JA6 B;  4QB4 A;  2K28 A;  5C3X A;  3OW7 A;  1DOL A;  1PH4 A;  5C3E G;  2ZM6 L;  3PO2 B;  2NZ1 D;  4DUY Q;  2HCI A;  3W1B A;  4JK1 C;  2R7Z H;  1ESR A;  1STN A;  1A8V A;  1RIP A;  3Q24 A;  1LTL A;  3I7F A;  5LMN W;  5LMN L;  3HOZ H;  5IE8 A;  3MVV A;  3CCU A;  1YHQ A;  1DZ1 A;  3AU7 A;  1EEF D;  2BOS A;  3D6W A;  5C4Z A;  2PZU A;  2EVB A;  4R1J A;  1T5E A;  5IYD G;  4DV5 Q;  1RKN A;  1B53 A;  3D3R A;  3PIO 3;  2XRS D;  1NR2 A;  1F2Y A;  1IHZ A;  2Q2I A;  2AUJ D;  1A63 A;  2BH2 A;  3L9A X;  3NBI A;  3L3O C;  5DNF A;  3NQI A;  1PYS B;  5IT9 L;  4POG A;  3CCM A;  4JYA L;  1SXT A;  4AYB E;  3OIP A;  1B50 A;  2NVY H;  1MSH A;  3T1H L;  2HUG A;  3SK4 A;  3SXH A;  2KEC A;  3U4Z A;  1BCP C;  3ITP A;  2B8G A;  1JE5 A;  1IKM A;  5JAV A;  4B3T L;  5EBC A;  1JOK A;  1TR5 A;  3U9S A;  3H94 A;  2MUY A;  1MJC A;  3KJP A;  2EYM A;  3C1E A;  4P71 A;  2RKS A;  4KD3 A;  3DM1 A;  5LL6 X;  5C5M A;  3QR8 A;  1A6X A;  4LF9 L;  2EQS A;  1PTO H;  1V9P A;  4DR2 Q;  2A8V A;  3QO2 A;  3PUV A;  3ND8 A;  1RJT A;  4DV6 Q;  3T1Y L;  3PO3 B;  4V19 0;  4B3S L;  2IJ0 A;  2AWN A;  2Q2U A;  4ZK9 B;  2WV6 D;  3M4Q A;  2UXD Q;  1M1K C;  3I73 A;  2K5W A;  2NVT B;  2PNH A;  5ELF A;  3HKS A;  4B08 A;  4DV0 Q;  5KNB A;  4UY8 C;  3GTK B;  3D0F A;  4DAP A;  1LLR D;  4QQB X;  2IT1 A;  1NNX A;  4DN4 M;  1N34 L;  3HFZ B;  3A55 A;  3PSI A;  3FKI G;  2Z8L A;  3ERO A;  2E2I B;  3K81 C;  1DCZ A;  4DV3 Q;  3BYY B;  1IL8 A;  2AWO A;  4JV5 L;  1VQ8 A;  2JEA I;  1YIJ A;  2JA7 G;  3P75 A;  5D14 A;  3RZD H;  4UP8 A;  2MJ8 A;  4Y52 H;  2FXQ A;  3NPP A;  4FO2 A;  4IFD J;  1N32 Q;  1QNU A;  5BR8 Q;  1WOC A;  3K5N A;  2HHH L;  4RHR A;  3S15 H;  2F0H A;  1CT1 D;  2ICE C;  4ME3 A;  4XYQ A;  1TY0 A;  1EYA A;  2JEB I;  4GNX B;  1IBK Q;  1CA6 A;  2X6L A;  4P73 A;  4DUZ Q;  3BDL A;  5HY6 A;  3PIO A;  5IGB A;  1EY6 A;  1EZ8 A;  1GHJ A;  2JN4 A;  3GTM B;  1YJN A;  1HQM C;  1LTB D;  3RN2 A;  2I5L X;  3WDN A;  1R4Q B;  1YNX A;  4JI2 Q;  1IW7 D;  4IJH A;  2KJX A;  1F2M A;  4IFD I;  3E3X A;  4YCV A;  2A68 D;  4LAA A;  2WB1 E;  5EPJ A;  3UI2 A;  3A54 A;  1I50 H;  2LS0 1;  1KC8 C;  4LFB L;  1D6E C;  2KVM A;  1XNQ Q;  2R7Z G;  1TS4 A;  3ULL A;  3NTK A;  1EY5 A;  1Y8N B;  4LF5 Q;  4DV1 L;  2B2V A;  4OO1 G;  4HIM A;  1F9R A;  4DK6 C;  3I4O A;  3I72 A;  5M5X B;  1EFW A;  1E2V A;  1C9O A;  2VB3 X;  4FXG C;  1D1K A;  3ULJ A;  1N9W A;  1WCM H;  2CH4 A;  3ERS X;  1I6H B;  1G51 A;  1NY4 A;  1LT6 D;  3PIP A;  3J7A 5;  1UE1 A;  1GHK A;  1YI2 A;  2NBF A;  3KF8 B;  1C8C A;  2A73 B;  1K8O A;  1Y14 B;  1PFS A;  2XGT A;  3DXJ C;  3DM3 A;  3J80 L;  5GAE C;  4CDD C;  4A3C H;  4PQX A;  1U9R A;  2K33 A;  1WD0 A;  1JCK B;  4V0B A;  4DV4 Q;  1T5X D;  4IPD A;  2SEB D;  1S5B D;  5FOB B;  2WAQ G;  5F2D A;  2I5H A;  3S9W A;  2R6G A;  2EY6 A;  1TWH B;  4DNI A;  1HFN A;  4BBR B;  1WTR A;  1HA5 A;  2CCZ A;  4RFB A;  2F0P A;  1UWV A;  3CRL C;  3CXC A;  1L1O C;  2K5Q A;  2RDH A;  4TQU S;  4CKC A;  5JVH 3;  1S3O A;  2HCC A;  1ICW A;  4A3F G;  3FPU B;  4H7B A;  4HIK A;  1VQ7 A;  3B6Y A;  3OMC A;  2NZO A;  3ND9 A;  4EQ5 A;  4NXN Q;  2FHT A;  3H09 A;  2CWA A;  2N8N A;  3HOW B;  1P8L A;  1JQY D;  4GN4 B;  1HFG A;  2RA4 A;  2MFI A;  4EQP A;  2F4V Q;  4OIK A;  4C3J G;  5I9P A;  3TZD A;  2UUC L;  1ESF A;  4ABN A;  1BCP D;  2KQ3 A;  1Q7Y C;  1M8A A;  1E3P A;  3NEN A;  2O5J C;  1XWE A;  3S14 B;  5IYB H;  4IUP A;  1K83 B;  5EGT A;  2ZM6 Q;  5LMU L;  1KNE A;  2J7Z A;  4KY7 A;  3T4A C;  1L0Y B;  2R93 B;  2EPB A;  1FGU A;  2PW7 A;  2K01 A;  2LXJ A;  2E2D C;  1F9S A;  5LMN Q;  3P7J A;  1LT4 D;  1YEZ A;  2D5D A;  3BVM A;  5A2Q L;  1TT2 A;  5JVG 3;  1XTD A;  4X65 L;  1OXU A;  4K6L A;  3HS0 C;  4NMZ A;  4GKJ L;  2QF7 A;  3F2U A;  5C3W A;  4MIU A;  5KYI A;  1CKO A;  3K58 A;  4BY1 H;  1ENF A;  1O7Z A;  1T9H A;  1ENC A;  3F8T A;  4DR3 L;  4JYA Q;  1GO3 E;  1X55 A;  1SYB A;  5DM6 3;  4PG3 A;  1WFQ A;  1JB7 A;  2PI2 E;  4QGU A;  5KNC A;  1L0X B;  1ASZ A;  5IIF A;  1TQO A;  5C4X B;  2CHB D;  3BVG A;  2ZTD A;  3U50 C;  1A3V A;  4L5T A;  4BBS H;  5FJ8 G;  4B3T Q;  3ONA B;  3PV0 A;  1IYV A;  1CM9 A;  1JE4 A;  4I7Z C;  1JWM D;  3E9H A;  3G71 A;  2F0M A;  2KCM A;  2SNM A;  3FMC A;  4ULL A;  5GRO A;  3I4M B;  4BXX H;  5K36 G;  3M4Y A;  1VQM A;  1B8A A;  1HZC A;  4XQQ A;  3M85 A;  3RNU A;  4A3E G;  3BDC A;  3DHQ A;  4GN5 A;  1XNR Q;  4R4O A;  5IGC A;  5EAY A;  4OWT B;  2VB2 X;  4LF9 Q;  4R4I A;  4XDX A;  1BBW A;  1FL0 A;  1FNV A;  2F0W A;  1G2S A;  3HZX A;  4GLX A;  3I90 A;  5EJW A;  3T1Y Q;  1WTH A;  1WTX A;  4B3S Q;  1D1I A;  2PW5 A;  4A3J H;  3QG1 A;  5IYC H;  5DLQ E;  3G6J B;  2MPM A;  2KED A;  1EIG A;  2ZXP A;  4ZKC B;  2JA9 A;  2EXD A;  1TWC H;  1JWS D;  4LUV A;  5I2X A;  2NVQ H;  5FO7 B;  1WD1 A;  2PNR C;  1N34 Q;  4BY7 H;  4A3C G;  1Q12 A;  5HUR A;  4HED A;  2OQK A;  1ICF B;  1U4L A;  4JV5 Q;  3E6Z X;  2F0F A;  1RDP D;  5C0X J;  4XQN A;  3CAM A;  4UPA A;  1CK1 A;  4DK0 A;  3FP9 A;  1SYD A;  3HKZ B;  4RGN A;  1VQP A;  4NXM L;  1V1P A;  4YHH L;  2HHH Q;  2ES2 A;  1PH7 A;  2RSN A;  1XTC D;  1S5E D;  3SGI A;  5FKA C;  2KEN A;  1YNJ C;  1KRS A;  2RF4 A;  3I4N H;  3Q0A A;  2UXB L;  3KF6 A;  3GTP H;  1G29 1;  2UXC L;  4A3D G;  1H9M A;  3R8B A;  2D0O A;  4M1U B;  3NUC A;  4L63 B;  1HZA A;  1PH3 A;  4P74 A;  1FR3 A;  1BOS A;  1LTT D;  3I55 A;  3KLW A;  4JI4 Q;  3FRP B;  5C0X I;  4C3H G;  4A3K B;  1RCV D;  1K0S A;  2JYO A;  5JEA G;  1OXX K;  1EWH A;  4XIG S;  2B63 B;  5CBE E;  4OWX B;  1BR9 A;  2M9V A;  3E0J A;  5KRU A;  2R92 G;  1JOO A;  3VYT A;  1KRT A;  3AFQ A;  4DR7 L;  1J8I A;  1LM0 A;  4PMC A;  2LKV A;  3J80 i;  1JT8 A;  1HNW L;  2AQ1 B;  2L4N A;  1HUN A;  4R4T A;  5FO8 B;  4RGO S;  4PZ6 A;  5ELC A;  2E2J H;  4DV1 Q;  4A3I H;  4YY3 L;  1FD7 D;  4A3G B;  3NBH A;  5JOB A;  3VDY A;  1X3P A;  3E5S A;  1VQG A;  2K04 A;  2F0E A;  2B2V C;  2NTT A;  1SYF A;  3TS0 A;  4DR6 L;  3S2H H;  1PTO C;  1Q90 A;  1CHQ D;  1VQJ A;  5FLM G;  1MGS A;  3H0G B;  1HZ9 A;  1RTO A;  5T1G A;  1DYQ A;  1V43 A;  1WTQ A;  3BZC A;  1VQ6 A;  4FP5 D;  2EDG A;  3EJI A;  1Z6H A;  2EY5 A;  1A62 A;  3OHX C;  1Y1V H;  3LWU A;  1I3Q H;  3UDG A;  2QEJ C;  3CP0 A;  1LO5 D;  3F2B A;  1PZJ D;  5FK9 C;  5IT9 E;  1GOZ A;  4YWL A;  4B9X A;  1H9R A;  3MHB A;  4ZLT F;  1UUP A;  4A93 H;  3BDO A;  2JA8 B;  3NTH A;  1EY0 A;  1V1O A;  3NEL A;  4RGM A;  4CGY B;  2K75 A;  1GD7 A;  4LUZ A;  5HGQ A;  3CC2 A;  2F3W A;  1BDO A;  3K7A B;  1ML0 D;  2B2U A;  3S17 H;  1PRT B;  1I4Q A;  4N8F A;  5C3E B;  3IAY A;  2EJF C;  5HGT A;  1NSN S;  3SE0 A;  4AQY L;  1G6P A;  1HH2 P;  3D6C A;  2VY3 A;  4Y7N H;  2PQA B;  1L1O B;  1IKL A;  2ALY B;  3NE5 B;  5M5W B;  3J81 j;  4FXK C;  4K5X A;  2XTI A;  1LV9 A;  4RCO A;  3HOX H;  1IZ6 A;  5M3F H;  3KDF A;  4C1N K;  5LHY 1;  1EOT A;  3V96 A;  2AUK A;  4A3M G;  3M4O B;  2VUM G;  4RMF A;  3LNN A;  4HJA A;  3ER0 A;  2YU9 B;  1I4H A;  1VQF A;  4IZ8 A;  1TXY A;  1B9M A;  1B3Q A;  4MTK A;  4PZ8 A;  5LMU Q;  1BF4 A;  3C2P A;  5K5P A;  3L7Z C;  4HID A;  2WAC A;  4L8J A;  2RQX A;  1XYI A;  2NVX H;  1WTP A;  3U9O A;  1ET9 A;  1EU3 A;  3GTJ H;  4JBJ A;  4AYB G;  4RG1 A;  4YIJ A;  5E1F A;  2I0Q A;  3LGJ A;  3OOC A;  2VNU D;  2ZJR A;  1EQQ A;  1ENA A;  3SK5 A;  4S3S A;  2CH4 W;  3BZK A;  4GKJ Q;  5I6W A;  3NEM A;  1Y1W G;  3T16 A;  5ELO A;  4RKL A;  4C3I H;  4DR3 Q;  4R9W A;  3R2I A;  4NPS A;  4B3R Q;  3K80 C;  1HR0 L;  3M7N A;  1VQB A;  1U4M A;  4G57 A;  3F1Z A;  3AMU A;  4DAM A;  1NMF A;  2JA5 B;  3S1Q B;  2MO1 A;  4LUO A;  5G3L D;  1GUW A;  2RHS B;  2B3G A;  3URY A;  1I5F A;  2KUM A;  5M3M G;  1BNZ A;  1SFO B;  4X64 L;  4HAE A;  5DM7 3;  1YJ9 A;  3CD6 A;  2EYH A;  4KHV A;  2JA6 H;  2YTV A;  3I4L A;  1X54 A;  2J4X A;  3S24 A;  1PH5 A;  4ILW A;  3RLO A;  3GTO B;  1TKW B;  2KHJ A;  3KBG A;  4RCN A;  3PO2 H;  1UNS A;  3PCO B;  2ZJQ A;  5IGD A;  3KLS X;  4IFD G;  4A3I G;  2JP1 A;  1Z7T A;  1G8Z D;  5C44 G;  5CBA E;  2DUD A;  2F0S A;  4DR4 L;  2JA7 B;  4N8X 1;  3P1H A;  1YNJ D;  3CHB D;  3NSW A;  2QGQ A;  2RDF A;  2F0D A;  3T51 B;  4YWM A;  3CME A;  1SE8 A;  4O42 A;  1CKN A;  1TS2 A;  1PH2 A;  1RTN A;  5IWA L;  3VR5 A;  2F0J A;  1EYC A;  2A19 A;  5E4W C;  5IGG A;  3RN5 A;  4HJ7 A;  1IBM Q;  1EY8 A;  1OXS C;  3TP6 A;  3HKZ E;  2KOL A;  1KNA A;  2VZA A;  3ULP A;  3H91 A;  3GP7 A;  2CQO A;  2YTY A;  4H02 A;  3HOV G;  5D3I B;  3NXW A;  4BS9 A;  3J80 E;  4FF2 A;  5IP9 H;  1H9K A;  3HG9 A;  4B3M L;  1KDB A;  4O2D A;  4A93 G;  1X3Q A;  5EPK A;  1CSQ A;  4KN4 C;  4OL7 A;  3DMU A;  4YHH Q;  2UUA L;  1O78 A;  2WIN B;  1NR4 A;  1D8L A;  4I65 A;  1UEB A;  4XT3 B;  4KKU A;  1YBY A;  2K5N A;  1PTO D;  1MI2 A;  1VQ9 A;  4CJ1 B;  5IOC A;  1SE2 A;  2BH8 A;  1SBB B;  5ELD A;  1EQR A;  3S1R B;  1DJR D;  4BWG B;  2RBM A;  2WB1 G;  1GXD C;  3D4W A;  3G48 A;  2F3I A;  4NKL A;  3TRE A;  1N33 Q;  1RHP A;  4GKK Q;  2JK8 A;  3Q22 A;  3PO3 H;  3TQY A;  1L0W A;  1KTK A;  1VF7 A;  3W5O A;  1E1T A;  2XWJ B;  1Q3L A;  4N9P A;  1VQ4 A;  2XIW A;  3L0O A;  1LT3 D;  3CPF A;  1O7L A;  3S1N B;  2HQL A;  4OX9 L;  1NCV A;  2ZJP A;  2NVT H;  3GTK H;  1HNZ L;  4DR7 Q;  5CGK A;  4P72 A;  2TSS A;  2H5X A;  1J5E Q;  2XWB B;  3UDI A;  2JE6 I;  1HNW Q;  1FNU A;  2OF1 A;  5C0X H;  2E2I H;  3NQT A;  3PUW A;  2Z4H A;  3EA6 A;  5EKL A;  4JI0 L;  1EUJ A;  4X66 L;  1KIX A;  1HRJ A;  4DAY A;  4JBW A;  1Y69 U;  3TS2 A;  2NZH A;  2WAQ B;  3RUZ A;  4KY5 A;  1A3T A;  3BG3 A;  4CKB A;  1I4X A;  4DR6 Q;  1SR3 A;  4IAL A;  4K5V A;  1A15 A;  1STG A;  2WP8 J;  3DEP A;  5A2Q E;  4OON A;  1VQL A;  4C3I G;  4A3F B;  4EQN A;  1TWG B;  1EQV A;  1YIT A;  1PZI D;  4O1N A;  1PHJ A;  4C56 C;  3GTM H;  2B2T A;  2G9D A;  1Q8K A;  4B9W A;  3HOU G;  3GDE A;  1ZKO A;  1DXM A;  4ZQ3 A;  3KLS A;  3QIA A;  4C3J B;  3CC4 A;  3J80 c;  1OXT A;  4A75 A;  3WOF A;  2IL8 A;  4H44 C;  2K7V A;  2PI2 A;  2ZTC A;  2DJF C;  2JA6 G;  3QWN A;  3BYT B;  4MZ9 A;  2K1B A;  1HZB A;  1AP0 A;  2OTL A;  1PRT F;  4IUT A;  4X3K A;  4AQY Q;  1EY9 A;  1X6O A;  4K2K A;  2B2U C;  1HNX L;  4J8Q A;  4MNO A;  1O7I A;  4K5W A;  5M5X H;  3CCE A;  2R7D A;  2MNA A;  4HCE A;  4PMW A;  3TRZ A;  1U0L A;  1I6H H;  2MGS A;  2UU9 L;  4XXE A;  2N49 A;  3CF5 A;  2K4K A;  4L5S A;  1FJG Q;  2MQH A;  4JI3 L;  5I6Y A;  1AEX A;  2DNE A;  3HOZ G;  2L5T A;  1FGB D;  3I70 A;  1QVF A;  1D5X C;  1W6J A;  1KDC A;  5CV7 A;  2C5C A;  4JG2 A;  4KHZ A;  2A69 C;  3PUY A;  3MWY W;  4GOP C;  4CDF C;  4LF4 Q;  3HGB A;  4RA8 A;  3C3L A;  4HR7 B;  1TWH H;  2ZXR A;  4MHE A;  3UDX A;  1LTR D;  4FVM A;  4BBR H;  2Q2T A;  4JW0 A;  3OTO L;  1VQI A;  3EFX D;  2LXK A;  1PV4 A;  4A3E B;  1PLF A;  2D0P A;  1I4R A;  5JPN C;  4DK3 C;  1HR0 Q;  4F7X A;  4K0K Q;  4K14 A;  1K28 A;  4IOC A;  3HOW H;  4J1M A;  1YHB A;  3OPO A;  4EX5 A;  1TII D;  2OQ0 A;  4O0A A;  3VYS A;  3J7Y W;  4DV7 Q;  1SSO A;  1SNM A;  3VYU A;  5EKI A;  1W6K A;  4X64 Q;  1XMQ L;  3A5U A;  2EYP A;  3ZJY C;  1I94 L;  3S14 H;  4A3L H;  2X6G A;  4EQO A;  1O7Y A;  3N52 A;  1VMP A;  1K83 H;  5C0X G;  1Q46 A;  1F2L A;  4GS3 A;  4POF A;  1E7Z A;  5I9O A;  3UE1 A;  2R93 H;  4OEL B;  1DOK A;  4DR4 Q;  2AKW B;  2O4X A;  3D8G A;  1N36 L;  2VQE L;  4ZCK A;  4H13 C;  4R8I A;  3EN2 A;  2L9H A;  4CHT B;  1SNC A;  5IY0 A;  5TSS A;  3GD7 A;  3J7A F;  2EE1 A;  1C0A A;  2F0K A;  2RSO A;  5CMD A;  5KYL A;  4WJ3 M;  1XPO A;  4HJ9 A;  2L0C A;  3I3C A;  4JI6 L;  3MXN B;  4A3D B;  4K8J A;  1WI5 A;  3KBX A;  4R4C A;  2AQ2 B;  4GN3 B;  3MXG A;  2E2H B;  3H3V I;  4B3M Q;  1O80 A;  5C4X H;  4XTC S;  2ASB A;  2YTX A;  4JCV E;  3M4P A;  4C3H B;  1OTC A;  1S4Z A;  2UUA Q;  3KFU A;  4QUF A;  2D62 A;  1C7Y A;  2KHI A;  4UP7 A;  5G3L F;  2EZV A;  3R93 A;  4IUR A;  3IFT A;  5CV4 A;  3T1H Q;  2M00 A;  3I4M H;  4K6D A;  4FXD A;  5KGU A;  2QIL A;  1KAA A;  3AFP A;  1EWI A;  1GM5 A;  4HTH A;  1H95 A;  5A35 A;  3M7G A;  1J6Q A;  3HOY H;  4GZY C;  1QVC A;  5JJL A;  3Q8D A;  2Z0S A;  4A76 A;  4LW1 A;  1BCP B;  1EFI D;  1QB5 D;  1QVG A;  1X65 A;  2D9U A;  3SVM A;  2L55 A;  1B2T A;  2R7F A;  4IUQ A;  5J3B A;  1RF2 D;  3NHH A;  5KND A;  4J6H A;  4OX9 Q;  1ZYR C;  5ELN A;  2B2Y A;  3HOY B;  1HNZ Q;  2EYO A;  5IGF A;  1MIU A;  5CV6 A;  1Q82 C;  3JC6 6;  4EVO A;  4DK1 A;  1K3R A;  3A0J A;  3GTQ B;  1WCM G;  1H9J A;  4DR1 L;  1LYL A;  2CWP A;  4JI0 Q;  4CDE C;  4X66 Q;  2QCP X;  1DM0 B;  1CZW A;  1M90 C;  1L2F A;  1H9S B;  1N8R C;  2Y0S B;  1SMY C;  1U4R A;  4OIJ A;  5D65 A;  1EIY B;  4BBR G;  4YCW A;  4DV2 L;  3K8A A;  2J0T D;  1LUZ A;  2C35 B;  3RZO B;  1AE2 A;  4KMU C;  1V1Q A;  2F0N A;  4KY6 A;  3SHL A;  1VS0 A;  2KEE A;  4QF4 A;  3AB9 A;  1AZP A;  3NBH B;  2HQE A;  4TSS A;  2Z4I A;  4ALP A;  3G4S A;  3TEH B;  3PF5 A;  4U67 3;  4JI8 L;  3CPW A;  3TP5 A;  2QDB A;  2IW3 A;  3CQZ B;  4WRD A;  4ZAI A;  1PH9 A;  2B2T C;  1R9T B;  4XQJ A;  1VCI A;  3EQL C;  4A3K H;  2A69 D;  3E0E A;  4IUV A;  4IPC A;  2VXW A;  4QJF A;  1GUG A;  2B63 H;  1V8Q A;  1PMR A;  4A3M B;  2VUM B;  1CA5 A;  1PYB A;  1EOV A;  1XX8 A;  2IHF A;  3PMF A;  2O5I C;  3SDZ A;  1CFM A;  4HSP A;  2A6H C;  2FMM A;  2P5Z X;  4WFN 3;  1X9N A;  1Q1E A;  2R93 G;  2QW7 A;  3G7L A;  4A3G H;  2F0V A;  1I4P A;  1TWF B;  4K8I A;  4AYB B;  1CHP D;  2CVR A;  2NB0 A;  3WWV A;  5IYB G;  2YV5 A;  4R4Q A;  2XN9 C;  2UU9 Q;  4LFB Q;  2PO4 A;  3H0G H;  3QB3 A;  2SNS A;  1JJ2 A;  5GAG C;  5KIX A;  4MTN A;  5IOD A;  4JI3 Q;  2K50 A;  2PZW A;  4C1N I;  1F9Q A;  1F9P A;  1X3G A;  2EYJ A;  4AIM A;  2A5H A;  3HRZ C;  1K73 C;  2DN8 A;  4DXF A;  4LFA L;  1QUQ A;  2E5L L;  1TWA B;  5D3D A;  1B4O A;  3S16 B;  4JC0 A;  5JJZ A;  4DV6 L;  2B29 A;  4BY1 G;  1R4P B;  4IO9 A;  3HEJ A;  2JA8 H;  2DGY A;  3TZU A;  3S2D B;  4NDX A;  2DY8 A;  3SK8 A;  1ILP A;  1PXU A;  1F2Z A;  1S5F D;  2OT2 A;  1XMO L;  1D5Z C;  1A0I A;  3NWS A;  2NN6 H;  3NK9 A;  4DA2 A;  5M3M B;  3OTO Q;  2WKD A;  4A3B H;  5BN3 A;  2DNC A;  1NJI C;  1G2T A;  2FFK B;  3K7A H;  4FDB A;  1P16 A;  1HUM A;  5L37 A;  1AN8 A;  5C3E H;  3ICE A;  3U4V A;  5IP7 H;  4OXP A;  2AHO B;  4DV3 L;  3K5O A;  3PGZ A;  4BBS G;  3K0Y A;  1QZG A;  2UUB L;  1A2T A;  2H4O A;  3I8Z A;  2F0U A;  1IBL L;  1NMG A;  4A3B B;  1D2B A;  4CJ2 C;  1VDZ A;  1MHW C;  2KCT A;  3FVQ A;  5M5W H;  5BR8 L;  4GNX C;  4BXX G;  4DPG A;  4JI5 L;  5I4D A;  5IYD H;  1HA6 A;  3J7Z C;  2VQF L;  4QIW B;  4I7A A;  1UE7 A;  5M5Y B;  3TP7 A;  1IXR A;  1STE A;  2B8F A;  3M4O H;  1S5C D;  4CJ0 B;  2YU9 H;  1HTP A;  4KV6 A;  3HP3 A;  1Z9F A;  3NWT A;  2XVS A;  4A3J G;  5IYC G;  3HOV B;  2EY2 A;  2L1B A;  2UUC Q;  5FLX E;  4JPB W;  3BJU A;  5J22 A;  3HKZ G;  4CDC C;  4BY7 G;  5IGE A;  3IFD A;  2PZT A;  3C46 A;  1PFN A;  3U58 A;  4GOP A;  4X62 L;  5J1Z A;  1VQA A;  4KTA A;  1XNQ L;  2F0G A;  3X3N A;  4KHP L;  1CQV A;  1LTS D;  1UAP A;  4JI6 Q;  1EL0 A;  1ZYR D;  1SE3 A;  3H6M A;  2WB1 B;  4RWS C;  4X65 Q;  3BZD B;  1G91 A;  4X3U A;  5H1S E;  2JA5 H;  3S1Q H;  4OEM B;  3MAQ A;  1Q8I A;  2EYF A;  1PZK D;  3I4N G;  2VW9 A;  1KL9 A;  1QIL A;  2PMZ B;  3A74 A;  4HMJ A;  3C1F A;  2Z6K C;  1GUS A;  5ISR A;  2IY5 B;  1B7Y B;  1SFO H;  1SMY D;  1JOR A;  3CKI B;  4FF3 A;  1C48 A;  3H3V H;  5ELE A;  2MO0 A;  3FKI H;  1KAB A;  3GTO H;  3S1M B;  3A7A B;  3PF4 A;  2BCO A;  3SR1 A;  5DAU A;  1UEA B;  1SJE D;  2G9H D;  2V1C C;  3K57 A;  2KHS A;  5C4J B;  4A3G G;  3QJY A;  2JA7 H;  2RDG A;  2ENB A;  2PQA A;  1GVP A;  4RHS A;  1BCP F;  1BQQ T;  4K2L A;  3JAM c;  3E9I A;  3FKI B;  3OSO A;  3FEW X;  3H0G G;  1K8G A;  1DD2 A;  1QWY A;  1LTG D;  4C2M B;  3WOE A;  4Z9C B;  1A3U A;  1SNO A;  1ROD A;  2JQO A;  2Y0S E;  1BBX C;  4HN7 A;  2B2Y C;  4IUU A;  4QMG A;  4LK1 C;  4DR1 Q;  4Q0F A;  1TY2 A;  1PVO A;  3HOU B;  1EY4 A;  5KEE A;  2A1A A;  2F4V L;  2JA8 G;  2A6H D;  3CMA A;  2I46 A;  1Y1V G;  2HDM A;  1JIC A;  3GTL B;  1VQK A;  4DV2 Q;  1CI3 M;  1NE3 A;  2R61 A;  3NP8 A;  3D4D A;  5FLX c;  4ZUI A;  3T13 A;  1SYG A;  1ZEQ X;  3EIV A;  5M9O A;  3CW2 C;  2K03 A;  5IP7 G;  4XT1 B;  4DAY B;  4NXM Q;  4UHV A;  3S1R H;  1K0R A;  4OO1 H;  4DGZ A;  2F0T A;  2ZT9 C;  3KJO A;  3M3Y B;  3A56 A;  4JI8 Q;  2D2C C;  2K5V A;  5C4H A;  4IPG A;  2DY7 A;  1X3E A;  3JAM L;  4PV1 C;  5EBD A;  3Q6S A;  4LWC A;  2R7Z B;  3S1N H;  1WTV A;  1VMC A;  2UXB Q;  2UXC Q;  3MA2 B;  3RLF A;  4FF4 A;  3K5L A;  1JMC A;  2KCN A;  1CTM A;  1EYG A;  3CCQ A;  3GV3 A;  3DLL A;  3HOZ B;  1YNN C;  3CU7 A;  3A5Z B;  1II3 A;  2BDO A;  2PYK A;  3DUZ A;  3A8K E;  2FIN B;  3MZ5 A;  4X3T A;  3BU2 A;  3HOX G;  2Q8R E;  3QOJ A;  5M3F G;  4F8M A;  3PUZ A;  2DJG C;  1IYJ B;  2GA4 B;  2F3V A;  3MXP A;  3J81 c;  5FLX L;  4H0L C;  2NVY B;  4FYD A;  1JJG A;  1PH6 A;  5C6A A;  4PMB A;  1BKB A;  3OW2 A;  4YY3 Q;  5AFW A;  4A3F H;  1XNR L;  2QDL A;  1TWG H;  2NWG A;  4UP9 A;  4LFA Q;  1ZXT A;  3IRB A;  2E5L Q;  2OWO A;  3BVZ A;  3W1G A;  3PIP 3;  2K6A A;  3RMH A;  2JA5 G;  4KJO A;  3D31 A;  5CC4 A;  2Q8T A;  1MD2 D;  2K14 A;  4TKO B;  5GAD C;  4C3J H;  5FO9 B;  5EPL A;  4DNR B;  2NYZ D;  1MSG A;  1PTO B;  1XMO Q;  1KXL A;  1U4P A;  3AQQ A;  3MFG A;  1NAP A;  1KAW A;  1M4V A;  1MJE A;  1BO0 A;  2XNA C;  4HCS A;  3FPP A;  1K8M A;  1BXT A;  3K7U C;  3OWF A;  1KQS A;  5EKK A;  2UUB Q;  1UE5 A;  4QIW E;  1IBL Q;  3AEV A;  4KJN A;  3CC7 A;  1E22 A;  3J81 L;  4DNT B;  4JI5 Q;  3TBI B;  5LL6 S;  4G4K A;  3UE0 A;  2EOT A;  5CYU A;  2EXZ A;  3K0X A;  3PO2 G;  1HCZ A;  2VQF Q;  4LF8 L;  3M9B A;  4NP5 A;  1VQC A;  4DAV A;  3RZD B;  3I2Z A;  1EEI D;  1QNK A;  5GAH C;  3S15 B;  1EQT A; 
#chains in the Genus database with same CATH homology
 3M3Y H;  1EWI A;  2NN6 G;  1GM5 A;  4J15 A;  4A3B G;  1A62 A;  1Y1V H;  3UDG A;  1I3Q H;  2ATW A;  1BVS A;  1H95 A;  3CP0 A;  3F2B A;  5JJI A;  2E8G A;  1J6Q A;  3HOY H;  2ID0 A;  1PH4 A;  1D7Q A;  2N78 A;  1QVC A;  1AH9 A;  5C3E G;  2ZM6 L;  4JI4 L;  5JJL A;  3Q8D A;  4DUY Q;  2Z0S A;  4A76 A;  3W1B A;  4LW1 A;  2IX0 A;  4YWL A;  2R7Z H;  5FJ8 H;  1S40 A;  1QVG A;  1A8V A;  1RIP A;  4A93 H;  1X65 A;  4LF7 L;  1LTL A;  3I7F A;  2NN6 I;  5LMN W;  4X62 Q;  5LMN L;  3HOZ H;  5IP9 G;  2R7F A;  5IE8 A;  3MEF A;  5J3B A;  3NEL A;  3CCU A;  1YHQ A;  2GN5 A;  4OX9 Q;  5ELN A;  1DGS A;  4A3E H;  5IYD G;  2L15 A;  4R1J A;  1HNZ Q;  1YZ6 A;  2K75 A;  4DV5 Q;  1MIU A;  1GD7 A;  4LUZ A;  5HGQ A;  3JC6 6;  1Q82 C;  3CC2 A;  4KHP Q;  1K3R A;  3A0J A;  1WCM G;  3S17 H;  2PMZ E;  2Q2I A;  1A63 A;  4TVA B;  2BH2 A;  4DR1 L;  1LYL A;  2CWP A;  4AQY L;  4JI0 Q;  4JYA L;  4X66 Q;  4POG A;  1PYS B;  1G6P A;  1HJP A;  3CCM A;  1M90 C;  1HH2 P;  2VY3 A;  1L2F A;  4AYB E;  4Y7N H;  2PQA B;  4IJL A;  1N8R C;  1L1O B;  2NVY H;  1CKM A;  2ALY B;  3T1H L;  1EIY B;  4BBR G;  4YCW A;  4DV2 L;  2IX1 A;  3K8A A;  3U4Z A;  4GNX A;  1LUZ A;  3J81 j;  2C35 B;  2XTI A;  1JE5 A;  1AE2 A;  1V1Q A;  3HOX H;  4JBM A;  1IZ6 A;  5M3F H;  4HIO A;  4B3T L;  3KDF A;  1EIF A;  3PO3 G;  3F2D A;  1MJC A;  1VS0 A;  4A3M G;  2VUM G;  3KJP A;  4RMF A;  4HJA A;  3ER0 A;  1Z47 A;  1AE3 A;  1VQF A;  4P71 A;  1WJJ A;  3NBH B;  1KHI A;  1TXY A;  4ALP A;  3G4S A;  2CKZ B;  3TEH B;  4PZ8 A;  3PF5 A;  5LMU Q;  4P75 A;  1K8A C;  3L7Z C;  4JI8 L;  3CPW A;  1Q81 C;  4HID A;  4LF9 L;  1PH1 A;  2EQS A;  1V9P A;  4DR2 Q;  1PH9 A;  2NVX H;  2A8V A;  1VCI A;  3GTJ H;  4JBJ A;  4AYB G;  4RG1 A;  4A3K H;  3PUV A;  1U5K A;  3E0E A;  2I0Q A;  3LGJ A;  4IPC A;  4KLK A;  2VNU D;  2ZJR A;  4DV6 Q;  4QJF A;  3T1Y L;  1EQQ A;  4LF6 L;  4B3S L;  2B63 H;  4X6A H;  3BZK A;  4GKJ Q;  2AWN A;  3NEM A;  1VQH A;  1PYB A;  1EOV A;  2Q2U A;  2IHF A;  1SMX A;  1Y1W G;  4A3D H;  3M4Q A;  5ELO A;  2UXD Q;  1M1K C;  2PNH A;  4DV0 Q;  3HKS A;  4JI7 L;  4UY8 C;  4C3I H;  3D0F A;  4DR3 Q;  2E2H H;  4QQB X;  2IT1 A;  1X9N A;  1Q1E A;  2R93 G;  4NPS A;  4B3R Q;  1N34 L;  3FHW A;  3HFZ B;  3K80 C;  1HR0 L;  3PSI A;  5IWA Q;  3FKI G;  3M7N A;  3STB C;  1VQB A;  3L2P A;  4A3G H;  2RHQ B;  3JAM i;  3GO5 A;  4L5R C;  4AH6 A;  3K81 C;  4C3H H;  3F1Z A;  4DV3 Q;  3WWV A;  5IYB G;  2YV5 A;  4R4Q A;  2AWO A;  4JV5 L;  4DAM A;  1NMF A;  1VQ8 A;  2BA1 A;  1YIJ A;  2JEA I;  2JA7 G;  2BA0 A;  2UU9 Q;  2MO1 A;  4LFB Q;  1GKH A;  4UP8 A;  4LUO A;  3H0G H;  2FXQ A;  3RZD H;  2R92 H;  4Y52 H;  4IFD J;  1N32 Q;  1E24 A;  5BR8 Q;  1JJ2 A;  5GAG C;  1WOC A;  1W3S A;  2RHS B;  2B3G A;  4MTN A;  4JI3 Q;  2HHH L;  1I5F A;  3S15 H;  4DR5 L;  5M3M G;  2K50 A;  4X64 L;  2Z6K A;  1YJ9 A;  3CD6 A;  1X3G A;  4ME3 A;  4AIM A;  2JA6 H;  2YTV A;  1X54 A;  3S24 A;  1K73 C;  1PH5 A;  3RLO A;  1JJC B;  1QUQ A;  4LFA L;  2KHJ A;  2E5L L;  1K9M C;  3PO2 H;  3PCO B;  3F2C A;  2ZJQ A;  2JEB I;  4GNX B;  1IBK Q;  3UDF A;  4P73 A;  4JC0 A;  5HY6 A;  4DUZ Q;  3PUX A;  3PIO A;  4A3I G;  2CFM A;  4DV6 L;  2RCN A;  1YVC A;  2B29 A;  2IHE A;  4BY1 G;  5C44 G;  2DUD A;  4IO9 A;  4DR4 L;  3RLN A;  1FVI A;  2JA8 H;  5FLM H;  2DGY A;  1YJN A;  2QGQ A;  1NTG A;  3RN2 A;  4YWM A;  2I5L X;  3CME A;  1XMO L;  1SE8 A;  3AYH B;  1A0I A;  1YNX A;  2AMC B;  3OTO Q;  4A3B H;  1CKN A;  1PH2 A;  1NJI C;  4JI2 Q;  4IJH A;  4B3R L;  3K7A H;  4FDB A;  1P16 A;  5IWA L;  3GTQ H;  4IFD I;  5C3E H;  4JBK A;  3ICE A;  4JOI A;  4YCV A;  3U4V A;  5IP7 H;  2A19 A;  4OXP A;  2AHO B;  3RN5 A;  4DV3 L;  3PGZ A;  4HJ7 A;  1IBM Q;  4BBS G;  1OXS C;  2WB1 E;  3HKZ E;  1QZG A;  4WJ4 A;  1I50 H;  2VZA A;  3ULP A;  2UUB L;  1VQD A;  2CQO A;  3KF6 B;  1KC8 C;  1IBL L;  1NMG A;  2YTY A;  4LFB L;  1XNQ Q;  4H02 A;  3HOV G;  2R7Z G;  1Q86 C;  2KCT A;  3ULL A;  5IP9 H;  5M5W H;  5BR8 L;  4GNX C;  4B3M L;  4DPG A;  4JI5 L;  2WAQ E;  4BXX G;  4LF5 Q;  4DV1 L;  4O2D A;  4A93 G;  4JI1 L;  4OO1 G;  4HIM A;  5IYD H;  4DK6 C;  3I4O A;  3RZO H;  3J7Z C;  1EFW A;  2VQF L;  1CSQ A;  1C9O A;  4YHH Q;  1UE7 A;  3ULJ A;  2UUA L;  1N9W A;  1IXR A;  1WCM H;  3ERS X;  1G51 A;  1D8L A;  3M4O H;  1NY4 A;  3PIP A;  3J7A 5;  1UE1 A;  1UEB A;  2YU9 H;  4LFC L;  1YI2 A;  3KF8 B;  1YBY A;  2K5N A;  1Z9F A;  5AJ3 L;  1Y14 B;  1PFS A;  2XGT A;  1VQ9 A;  4OO1 I;  4A3J G;  3CCR A;  5IYC G;  2BH8 A;  3DM3 A;  3CQZ H;  3J81 i;  2UUC Q;  3OYY A;  1EQR A;  5GAE C;  2F52 A;  1XNR Q;  4A3C H;  3BJU A;  1R9T H;  2WB1 G;  3HKZ G;  3G48 A;  4DUY L;  2F3I A;  1XJV A;  4DV4 Q;  4BY7 G;  4IPD A;  3TRE A;  1N33 Q;  4GKK Q;  2JK8 A;  3PO3 H;  3TQY A;  1L0W A;  3W5O A;  1SN8 A;  1E1T A;  1X3F A;  4A3M H;  3U58 A;  2WAQ G;  4GOP A;  3L0O A;  2I5H A;  1VQ4 A;  2VUM H;  2HIV A;  2R6G A;  3CPF A;  1QUQ B;  4X62 L;  1NBW A;  1IBM L;  3HOW G;  4DNI A;  2HQL A;  4OX9 L;  2ZJP A;  2CCZ A;  2NVT H;  5E7N A;  3GTK H;  4L5Q A;  1UWV A;  1VQA A;  1HNZ L;  1XNQ L;  3CXC A;  4DR7 Q;  4DV5 L;  1L1O C;  1YHA A;  4KHP L;  4P72 A;  4JI6 Q;  4TQU S;  2H5X A;  1J5E Q;  1S3O A;  3UDI A;  2JE6 I;  1HNW Q;  4A3F G;  4X65 Q;  1TWF H;  2E2I H;  3PUW A;  4HIK A;  1VQ7 A;  4JI0 L;  3B6Y A;  1EUJ A;  4X66 L;  1KIX A;  4A3L G;  2GVA A;  5H1S E;  2JA5 H;  4JBW A;  3S1Q H;  4DKA C;  3TS2 A;  2Q2H A;  2NZO A;  4EQ5 A;  2NZH A;  4NXN Q;  4LF8 Q;  2CWA A;  2N8N A;  4HJ8 A;  2N3S A;  2VW9 A;  1P8L A;  3I4N G;  4GN4 B;  1KL9 A;  1Y1W H;  1HNX Q;  3A74 A;  4DR6 Q;  1SR3 A;  2MFI A;  2Z6K C;  1VQ5 A;  1IL2 A;  2F4V Q;  4BA2 I;  2IY5 B;  1B7Y B;  1SFO H;  2WP8 J;  2VS1 A;  1CSP A;  3H3V H;  4YWK A;  2UUC L;  4OON A;  1VQL A;  2MO0 A;  3FKI H;  4HJ5 A;  1E1O A;  3GTO H;  1Q7Y C;  1TWA H;  1E3P A;  3PF4 A;  3S16 H;  4APV A;  3NEN A;  2V1C C;  4GLV B;  1YIT A;  1N33 L;  5IYB H;  4GKK L;  2EIF A;  1PHJ A;  2K5H A;  4A3G G;  2JA7 H;  1SRO A;  2ZM6 Q;  3GTM H;  5LMU L;  1Q8K A;  1SRU A;  3S2D H;  2PQA A;  3HOU G;  1GVP A;  3GDE A;  1FGU A;  3JAM c;  4DR2 L;  3E9I A;  4LF7 Q;  2LXJ A;  5M3M H;  3H0G G;  1K8G A;  5LMN Q;  3CC4 A;  3KYH C;  1YEZ A;  3H15 A;  5C4X G;  1J5E L;  3J80 c;  1OXT A;  1XTD A;  4A75 A;  1B70 B;  1OXU A;  4X65 L;  2PI2 A;  3KDF B;  4GKJ L;  2ZTC A;  2JA6 G;  2OCE A;  2JQO A;  2Y0S E;  4KI0 A;  4MZ9 A;  1CKO A;  1HZB A;  5C44 H;  2OTL A;  4BY1 H;  2UXD L;  1T9H A;  4DV0 L;  1QZH A;  3F8T A;  4DR1 Q;  4DR3 L;  4NB3 A;  4AQY Q;  4JYA Q;  1GO3 E;  1X55 A;  4QY7 A;  3I4M G;  1X6O A;  4QL5 A;  4GOP B;  1HNX L;  4PG3 A;  1WFQ A;  1PVO A;  4MNO A;  1O7I A;  2A1A A;  1JB7 A;  2F4V L;  2JA8 G;  2PI2 E;  5GQO A;  5M5X H;  4QGU A;  3CCE A;  3CMA A;  1Y1V G;  1ASZ A;  2R7D A;  1VQK A;  2MNA A;  1ASY A;  5M5Y H;  4PMW A;  4DV2 Q;  3TRZ A;  3HOY G;  1NE3 A;  1U0L A;  1I6H H;  2ZTD A;  3STB D;  3U50 C;  5FLX c;  2UU9 L;  2N49 A;  4L5T A;  3CF5 A;  2K4K A;  4BBS H;  5FJ8 G;  4B3T Q;  1N32 L;  3PV0 A;  1WYD A;  4L5S A;  1FJG Q;  3EIV A;  2MQH A;  4JI3 L;  3CW2 C;  3CCV A;  5IP7 G;  3E9H A;  3G71 A;  3HOV H;  2KCM A;  4DAY B;  3HOZ G;  4NXM Q;  5GRO A;  4BXX H;  5K36 G;  3S1R H;  1VQM A;  1QVF A;  1B8A A;  4OWW B;  4IFD G;  1HZC A;  1K0R A;  3M85 A;  3RNU A;  4A3E G;  2Y0S G;  3KJO A;  2I5M X;  4GN5 A;  4JG2 A;  4JI8 Q;  4R4O A;  4KHZ A;  5EAY A;  4OWT B;  1XMQ Q;  2K5V A;  1IBK L;  4LF9 Q;  3PUY A;  4R4I A;  1BBU A;  4IPG A;  4DUZ L;  1I94 Q;  1BBW A;  1X3E A;  4GOP C;  1FL0 A;  3CCJ A;  1VQO A;  4LF4 Q;  4LWC A;  1TWH H;  3UDX A;  3S1N H;  2UXB Q;  4GLX A;  5JJK A;  2UXC Q;  2KBN A;  3T1Y Q;  4BBR H;  4LF6 Q;  4B3S Q;  2Q2T A;  1UE6 A;  3RLF A;  1X56 A;  1JMC A;  2OTJ A;  3RR5 A;  4A3J H;  2GVB A;  3OTO L;  1N36 Q;  4A4I A;  5IYC H;  1EYG A;  3CCQ A;  3DLL A;  5DLQ E;  2LSS A;  2VQE Q;  1VQI A;  3A5Z B;  4JI2 L;  2LXK A;  2JA9 A;  1Q1B A;  2EXD A;  1PV4 A;  1TWC H;  4JI7 Q;  4LUV A;  2NVQ H;  4GLA C;  1MKH A;  2D0P A;  3BU2 A;  3HOX G;  1YJW A;  4DK3 C;  1N34 Q;  5M3F G;  1HR0 Q;  4BY7 H;  4A3C G;  1Q12 A;  3PUZ A;  4K0K Q;  1IYJ B;  1SLJ A;  3I56 A;  1XPR A;  4IOC A;  1OXV A;  3J81 c;  3HOW H;  4PZ7 A;  2OQK A;  1YHB A;  4EX5 A;  4JV5 Q;  2OQ0 A;  4O0A A;  1FJG L;  4LF5 L;  5C0X J;  3G6E A;  3CAM A;  4UPA A;  2WFW A;  3FP9 A;  4DV7 Q;  1VQP A;  1JJG A;  4NXM L;  4IPH A;  1PH6 A;  1BKB A;  4YHH L;  3OW2 A;  2HHH Q;  4YY3 Q;  4DR5 Q;  2JJQ A;  1CKN B;  2HIX A;  4A3F H;  2ES2 A;  4X64 Q;  1XMQ L;  1XNR L;  3S1M H;  3A5U A;  4A3K G;  1TWG H;  3ZJY C;  5C4J H;  1PH7 A;  1I94 L;  3S14 H;  4A3L H;  4UP9 A;  1K83 H;  3SGI A;  4LFA Q;  2B63 G;  3IRB A;  2E5L Q;  2KEN A;  2OWO A;  4LF4 L;  5C0X G;  1Q46 A;  1KRS A;  2RF4 A;  1XPU A;  5JEA J;  3W1G A;  4GS3 A;  4POF A;  3I4N H;  2UXB L;  3KF6 A;  1E7Z A;  1G29 1;  3UE1 A;  3GTP H;  2UXC L;  4A3D G;  2R93 H;  2D0O A;  2JA5 G;  3KOJ A;  4DR4 Q;  1HZA A;  1PH3 A;  4P74 A;  2AKW B;  3D31 A;  4BA1 I;  1N36 L;  4YCU A;  2K14 A;  5GAD C;  4C3J H;  1S72 A;  2VQE L;  4C2M H;  4DV4 L;  3I55 A;  1XMO Q;  1PH8 A;  3CCS A;  1RL2 A;  3KLW A;  3EN2 A;  4JI4 Q;  3AQQ A;  1KXL A;  5C0X I;  1KAW A;  1MJE A;  1HR0 W;  5IY0 A;  5JEA G;  1OXX K;  1L1O A;  3GD7 A;  4K0K L;  4XIG S;  1KD1 C;  1C0A A;  4OWX B;  2K52 A;  3K7U C;  1KQS A;  2R92 G;  3CCL A;  4DR7 L;  1KRT A;  3AFQ A;  4WJ3 M;  2ZTE A;  4HJ9 A;  1LM0 A;  1XPO A;  4IOA A;  3HOU H;  4JI6 L;  3MXN B;  2UUB Q;  1UE5 A;  3J80 i;  1WI5 A;  4JOI C;  4QIW E;  3GTG H;  1JT8 A;  1IBL Q;  1HNW L;  4R4C A;  3AEV A;  4DV7 L;  4GN3 B;  3CC7 A;  5IT9 c;  1E22 A;  1VQN A;  4R4T A;  3GTL H;  3H3V I;  2QA4 A;  4B3M Q;  2E2J H;  4PZ6 A;  4JI5 Q;  5C4X H;  4DV1 Q;  4A3I H;  4JI1 Q;  4YY3 L;  4XTC S;  2QEX A;  2ASB A;  3UE0 A;  2YTX A;  4JCV E;  3K0X A;  3PO2 G;  4NXN L;  2VQF Q;  4LF8 L;  3M4P A;  3VDY A;  1PA6 A;  1OTC A;  2YYZ A;  1VQG A;  3M9B A;  4LNQ A;  2UUA Q;  1W2B A;  3KFU A;  2D62 A;  1C7Y A;  3TS0 A;  2KHI A;  1CUK A;  4UP7 A;  4DR6 L;  1VQC A;  1VQJ A;  3S2H H;  2HT1 A;  5FLM G;  1HZ9 A;  1VQE A;  3T1H Q;  1V43 A;  2VL6 A;  4LFC Q;  3I4M H;  3I2Z A;  3EBE A;  3BZC A;  5GAH C;  5AJ3 Q;  1VQ6 A;  3AFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...