4QY7A

Crystal structure of a yoba protein (bsu18810) from bacillus subtilis subsp. subtilis str. 168 at 1.55 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
b'GDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YobA
publication title Crystal structure of a hypothetical protein (yobA) from Bacillus subtilis subsp. subtilis str. 168 at 1.55 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11518 DUF3221 Protein of unknown function (DUF3221)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qy7A01
2D0OA 3D0FA 5ELNA 1E1OA 1V43A 2KHJA 4LNQA 4LF8L 4DNIA 1T9HA 2L15A 1OXSC 5FLXc 1LYLA 2K52A 4APVA 1EYGA 3F2CA 3PIOA 4B3MQ 4AYBE 1K73C 4L5QA 1ASZA 4DR2Q 2K75A 1X3GA 3BZKA 2JA6H 4JI5L 1M1KC 4DR3Q 1I50H 3H0GH 2XGTA 4YHHL 1KD1C 3GO5A 2VQEQ 2R7ZG 4DR4L 4JG2A 2BH8A 1VS0A 3K7UC 4J15A 4A3LH 3S2DH 3CCRA 1YJ9A 1PH4A 4JI1L 2CQOA 3PV0A 2JE6I 4JI0Q 5C4XH 2OTLA 3RN2A 4JI2Q 3STBD 4QQBX 5ELOA 5IYDH 3J80i 3RLFA 4DUYQ 4LUOA 1G291 3MXNB 4HJAA 2VNUD 1HZCA 2ZM6Q 2N78A 5FJ8G 5IYCG 5C4JH 4DUZQ 4LW1A 4YY3Q 1J6QA 3ULLA 1UE5A 2UUCL 4A3EH 2PQAB 4LF8Q 4JBKA 1EOVA 4BY1G 4BXXH 1NE3A 4DV4L 1YEZA 4IFDI 1SMXA 2EQSA 2MFIA 1FGUA 2B3GA 2R92H 2F52A 1K9MC 2I5HA 4JI5Q 5IT9c 2E8GA 1W3SA 2QEXA 3F2DA 2IT1A 2HHHL 3S1RH 1LTLA 4A3GH 3T1YL 3PO2H 1Z47A 2MNAA 1QUQB 5GROA 1K8GA 4L5RC 1K3RA 2ATWA 3HOUG 1MIUA 4JI1Q 4PZ7A 2A8VA 2VY3A 4LF4L 3K81C 3H3VH 1HZAA 1YZ6A 3AFQA 3I4MG 1GVPA 4B3RL 2V1CC 1VQCA 3S24A 1VQLA 4DAYB 3CCUA 4HJ9A 2OTJA 2KCTA 2HIXA 3UDGA 1KC8C 2JA9A 3HOYG 2UU9L 1EFWA 2JA8G 2JA6G 3ULPA 2VUMH 2VW9A 4PMWA 1PH3A 5DLQE 1TWFH 4DV4Q 1B8AA 3UDFA 4LF9L 4A3CH 4KHPL 4A3LG 2OQKA 5M3FG 1IL2A 2I0QA 2GVAA 2R6GA 2R93H 2MO1A 2IHFA 1W2BA 5C4XG 2NVQH 2HHHQ 1OXVA 5IY0A 5BR8L 1U0LA 1KQSA 4DPGA 1HZBA 5IYDG 4IOCA 1K0RA 4H02A 3S14H 1WCMG 2KENA 1RL2A 2CFMA 3I2ZA 4C2MH 5M5WH 3M85A 4B3SL 2UXCQ 1HNXL 4OWXB 4A93H 1EQRA 1XNQL 3FHWA 2OWOA 4HJ8A 4GNXB 1X65A 1VQ4A 4B3RQ 3DLLA 2LXJA 3EIVA 4DV5L 4KI0A 4LFCL 4NXML 4DR6L 2PQAA 1PH2A 4LF6Q 1WI5A 1VQGA 3U4ZA 2DUDA 4JI3L 4NPSA 4OXPA 4MZ9A 1NMGA 2NZOA 2UU9Q 5C0XG 1A62A 1VQHA 2E2IH 4LFBQ 1TWHH 2VZAA 5FLMG 4A3GG 3PO2G 2LXKA 4LF9Q 5LMUL 4KHPQ 2RHQB 4A3KH 1S72A 1JJGA 4OX9L 2ZTEA 3AQQA 2UXCL 4K0KL 5C0XJ 3TREA 2WB1E 5E7NA 5IE8A 1YJNA 2K4KA 1NMFA 4XTCS 1VQOA 2Q2HA 4QIWE 2Z6KA 1Q1BA 1WFQA 1Q8KA 4UP9A 2JEBI 3CCMA 1VQEA 2Z6KC 4B3SQ 1HNXQ 4DR5L 4BBSH 4BA2I 3PGZA 3VDYA 1E7ZA 3NENA 5JEAG 1XNQQ 3AEVA 2H5XA 2VUMG 3PUVA 4A3MH 4GKJL 1CSQA 4DV5Q 4LFCQ 4OO1G 1AH9A 3I4OA 4YWLA 3G71A 4A3CG 2R93G 1BKBA 1WOCA 4AIMA 1PYBA 1VQPA 1XMOL 4LUZA 3HOWH 4JI3Q 1N34L 3S15H 2VS1A 4JBJA 1TWGH 2ZTCA 4P72A 4DR6Q 4R4TA 5LMNW 4LUVA 2UXDL 3OYYA 1PFSA 4NXNQ 1A0IA 1KHIA 3S1NH 1E22A 5LMUQ 2NN6G 3I4NH 2VL6A 1HNWL 2N8NA 4AYBG 3SGIA 4OX9Q 3J81i 1EUJA 2PMZE 1BBWA 2F3IA 2R7FA 3M9BA 4K0KQ 1TWCH 3KF6B 1XPOA 4A3JG 1YIJA 1WJJA 1X6OA 3M4QA 1CKNB 4BBRH 3B6YA 3F2BA 3CCSA 2A1AA 4DV0L 1OXXK 4HIDA 4GNXA 1VQ9A 1SN8A 5GADC 1PH1A 3RLOA 4MTNA 5K36G 4GNXC 4DR5Q 2ZTDA 1BBUA 1Q1EA 1I94L 4A3DH 3S1MH 1C9OA 2XTIA 2Y0SG 3G48A 4YCWA 3UE1A 5M3MH 1A63A 3M3YH 4Y7NH 4XIGS 1UWVA 2Y0SE 1S40A 4GKJQ 3HOZG 1EWIA 3CAMA 2PI2A 2EIFA 3E9HA 4L5SA 2AWOA 2IX1A 1XMOQ 3S16H 4A3KG 4TQUS 1SLJA 1N34Q 3GDEA 3W1GA 4X62L 3CPWA 1NJIC 3J7A5 3GTJH 2UXDQ 1ASYA 4JCVE 2CCZA 2N3SA 1Y14B 2D0PA 3KDFB 3PO3G 4X65L 3J7ZC 1HNWQ 2UUAL 3EN2A 1HH2P 1IYJB 3S1QH 5JJLA 2UXBL 3GTGH 1CKOA 3RZDH 1JMCA 3PUZA 4YWMA 3CCJA 1QVCA 3STBC 4A3MG 3W5OA 4HJ7A 1OXUA 3PUXA 4UP8A 1X55A 2ZJRA 4DV0Q 1YITA 1XPRA 4IPCA 3PSIA 4L5TA 4DAMA 3CCQA 2E2JH 2B63H 1GKHA 4RG1A 4LF7L 4X64L 5GQOA 1I94Q 3S17H 4BY7H 2ID0A 3GTLH 3RLNA 4A3IH 1N33Q 1JJCB 1X56A 1YHAA 4DV6Q 3PCOB 4C3IH 3WWVA 3KFUA 2BA1A 1VQJA 4LF6L 1D7QA 1TWAH 4X62Q 4O0AA 4R4IA 3PF4A 1Z9FA 4IO9A 3HOXH 2ZJPA 3JAMc 4GLVB 3H0GG 4LFBL 4HIKA 1KAWA 3LGJA 3M4PA 4BBRG 3KF6A 4X65Q 3PIPA 2UUAQ 3HOVH 3IRBA 4IFDG 5GAGC 2UXBQ 3F8TA 2NVXH 1CKNA 2K5NA 4KLKA 4R4OA 3KJPA 4YCUA 1VQAA 3TS0A 3A0JA 1WYDA 5HGQA 4LFAL 2UUBL 1X3FA 5M3MG 1VQNA 1N32L 1FL0A 3KF8B 1JT8A 3A5ZB 3K80C 5H1SE 4DK3C 1GD7A 4UPAA 2OCEA 1KRTA 4LF7Q 4X64Q 3E9IA 1YVCA 5C0XI 1X54A 5C3EH 2E5LL 4IPDA 4A3EG 3I55A 3GTQH 1X9NA 1PH6A 4BXXG 4GKKL 1HJPA 4AH6A 2ZJQA 2GVBA 3U4VA 3KYHC 2C35B 4DK6C 1IZ6A 2CKZB 4POGA 3KDFA 2R92G 1NBWA 1D8LA 1Q46A 2A19A 3AFPA 2YTYA 3DM3A 3KOJA 2MO0A 3FKIH 4IPHA 4R4QA 2JA5H 4A3BH 3A74A 3K7AH 1PH9A 4EQ5A 4NXNL 1XMQL 1YBYA 1DGSA 1KL9A 1P16A 4GN5A 3BJUA 4X66L 4ALPA 1C7YA 2B63G 3D31A 4RMFA 5C44H 4DV3L 1YNXA 1R9TH 4QJFA 3A5UA 1HZ9A 4LF5L 4LFAQ 3J81c 5JJKA 1QZGA 2WB1G 4R1JA 2UUBQ 1N32Q 4B3TQ 1CSPA 2KHIA 4O2DA 1XJVA 3ER0A 2WAQG 3S2HH 4GN4B 4DR1Q 4OO1I 2WAQE 1Q86C 2Q2UA 1KXLA 5AJ3L 1P8LA 3KJOA 2E5LQ 2B29A 4IOAA 5GAEC 2K5VA 1M90C 4BA1I 2D62A 2K50A 3J80c 4GKKQ 3ICEA 3NBHB 1QVFA 3CW2C 1PH8A 1U5KA 1YHQA 2VQFL 5IYCH 1BVSA 4Y52H 1LM0A 3KLWA 5JJIA 2JA7H 4DV1L 2PI2E 1UEBA 4KHZA 2KCMA 5JEAJ 1XMQQ 1SRUA 1GM5A 4X66Q 3CD6A 2YU9H 3CCLA 2JK8A 2NZHA 4DV3Q 2EXDA 4A4IA 1G51A 4POFA 1IBKQ 3H15A 4JV5L 4DKAC 3CXCA 2YV5A 3ULJA 4LF5Q 2N49A 4PG3A 3EBEA 1IBML 3L2PA 4A93G 1E3PA 4HIMA 3CMEA 1N8RC 1YHBA 1B7YB 1VQ6A 1A8VA 2I5LX 3CQZH 2AMCB 4YCVA 2ES2A 1PH5A 2HIVA 4JYAL 3HOUH 5EAYA 3T1HL 1S3OA 3PUYA 1SR3A 4EX5A 1Q82C 2AKWB 4PZ6A 1VQFA 5AJ3Q 3TS2A 1PVOA 4A3BG 3FKIG 3CP0A 1VQ8A 4OONA 2E2HH 4HJ5A 2JA5G 1N33L 3I4MH 1SE8A 3NELA 3BZCA 4DV6L 2IHEA 4JI8Q 5IWAL 2VQFQ 4JI7Q 2PNHA 1VQIA 5C44G 1MKHA 5IYBH 2IY5B 3NEMA 4DV1Q 2JQOA 2ALYB 1AE3A 3GTPH 1KIXA 3HOYH 2JA8H 4WJ4A 3CCVA 1H95A 2QGQA 1PYSB 1EQQA 3HKSA 1N36L 3U58A 4GLAC 4A3FH 1I5FA 4JV5Q 5M3FH 1VQBA 1IBMQ 4GS3A 4BBSG 1RIPA 1HNZL 1Q7YC 1HR0W 4P73A 3OTOL 2WP8J 4GOPA 3OW2A 1SFOH 1N9WA 1GO3E 4GOPC 3GTOH 4C3JH 1WCMH 4JYAQ 3AYHB 3T1HQ 4FDBA 3HOWG 5LMNL 4A76A 4JI4Q 2JA7G 3L7ZC 2CWAA 4JBWA 1XPUA 1OTCA 1VCIA 3GTKH 1C0AA 1FJGL 5IWAQ 3UDXA 3CMAA 3E0EA 3U50C 3I4NG 4JC0A 3I56A 3ZJYC 4C3HH 1Q81C 2DGYA 2YTXA 4GLXA 4YHHQ 3UE0A 1N36Q 5FLMH 4PZ8A 4AQYL 4DR4Q 1VQ7A 5IP7H 2I5MX 3TEHB 1I6HH 2Q2TA 2R7DA 4TVAB 1PA6A 2F4VL 4UP7A 4WJ3M 3PF5A 2Q2IA 2KBNA 3UDIA 1L1OB 3CF5A 1HNZQ 1IBLL 4NB3A 4A3DG 1XNRL 1JB7A 3OTOQ 1Y1VH 3G4SA 4B3TL 2RF4A 1V1QA 3MEFA 3HFZB 4A75A 4IFDJ 5IYBG 3M4OH 4QY7A 2OQ0A 3TQYA 5LMNQ 1CKMA 1E1TA 2RCNA 4DR1L 3CC7A 1JE5A 2IX0A 3K8AA 5J3BA 1K8AC 4IJLA 4IPGA 4IJHA 3J81j 1Y1WH 2UUCQ 1L0WA 1UE1A 2HQLA 1KRSA 3RNUA 1FJGQ 1QZHA 1IXRA 2K5HA 3CPFA 4A3FG 1G6PA 1I3QH 1NTGA 3I7FA 4HIOA 1Q12A 1HR0L 5IP9H 1CUKA 4QGUA 1EIYB 4DV2L 3H3VI 3CCEA 2K14A 3FP9A 1YJWA 1V9PA 4AQYQ 3T1YQ 4GN3B 1PHJA 1PV4A 2JJQA 2GN5A 2WFWA 3RN5A 4JBMA 2LSSA 2F4VQ 1IBKL 1UE7A 4JI6L 4LWCA 3JC66 1FVIA 3CC2A 4BY7G 4DR7L 1L2FA 1IBLQ 1VQMA 4OWTB 4LF4Q 2BA0A 4YWKA 1XNRQ 4A3IG 2BH2A 4R4CA 1J5EL 3RR5A 4A3JH 1YI2A 4OWWB 1E24A 1AE2A 2YTVA 1PH7A 2R7ZH 3CC4A 3HKZG 1MJEA 1VQKA 3K0XA 3HKZE 3GD7A 4DV7L 3W1BA 4GOPB 5M5YH 3F1ZA 3HOXG 4JOIA 3JAMi 1VQDA 2RHSB 3HOZH 4JOIC 4P71A 2FXQA 2Z0SA 2NN6I 1XTDA 2AHOB 5IP7G 2JEAI 3Q8DA 4JI8L 3GTMH 3L0OA 3ERSX 4JI7L 2HT1A 5FJ8H 3HOVG 1HR0Q 1QUQA 2YYZA 4B3ML 4DV2Q 1VQ5A 4P74A 2NVTH 1LUZA 5BR8Q 4DR2L 1EIFA 3BU2A 1O7IA 1X3EA 3PUWA 5HY6A 4DR3L 1L1OA 1Y1VG 1OXTA 4BY1H 1MJCA 1L1OC 1JJ2A 2VQEL 3M7NA 2MQHA 3PO3H 5M5XH 4MNOA 4JI6Q 2ASBA 4P75A 4DR7Q 1UE6A 3G6EA 2CWPA 4ME3A 5GAHC 3TRZA 1QVGA 4JI0L 5C3EG 2NVYH 4QL5A 1B70B 1TXYA 2AWNA 1Y1WG 1J5EQ 4UY8C 4JI2L 1K83H 2QA4A 4NXMQ 4DUYL 1SROA 4X6AH 1NY4A 2ZM6L 4DV7Q 3RZOH 4DUZL 4YY3L 4JI4L 5IP9G
chains in the Genus database with same CATH superfamily
1B50A 4LNQA 2L1BA 5T1GA 3LWEA 1T9HA 3FPPA 4TKOB 5FLXc 1LYLA 5G3LD 1L0XB 1XWEA 4AYBE 5I6WA 1K73C 1M1KC 1I50H 4YHHL 1BDOA 2LKVA 1KD1C 3MTSA 2R7ZG 1VS0A 1YJ9A 1PH4A 5ELFA 4JI1L 2CQOA 2JE6I 2J4XA 3RD4A 1F9SA 1TWGB 1KDAA 4DUYQ 4HJAA 2VNUD 1HZCA 3TN2A 2N78A 5FLXE 5IYCG 5FJ8G 5C4JH 4LW1A 2ZM6Q 4DUZQ 2AUKA 1IW7D 3ULLA 3DXJC 3C2PA 2ICIA 5KIXA 4BXXH 4RHSA 4J8QA 4C1NK 2L55A 2MFIA 3J7AF 1FGUA 1ILPA 2XWBB 2I5HA 4FXKC 1EY7A 4C1NI 2EY1A 2MNAA 5M3MB 5ELBA 2A69D 1G8ZD 1YZ6A 1JC7A 4B3RL 3T53B 1VQCA 3S24A 3HRZC 4HJ9A 1WTOA 3UDGA 1KC8C 2JA9A 3S1QB 2UU9L 3ULPA 2VUMH 4DV4Q 3MEHA 3URYA 3HGBA 1IYVA 2R6GA 1CM9A 3TP6A 4OELB 1W2BA 2NVQH 1KDCA 5IY0A 4KY7A 2K01A 4DPGA 3D4WA 3GTLB 1TS3A 3I4LA 1GUGA 2P5ZX 3VYTA 4B3SL 1XNQL 1TWAB 1VQ4A 2LXJA 3EIVA 4KI0A 4LF6Q 1VQGA 3U4ZA 1H9SA 1ML0D 3NQTA 2EY2A 4DNRB 5FLMG 2LXKA 5LMUL 2XNAC 1ICWA 2NBFA 1VMCA 3T16A 4OX9L 2NTSA 3I73A 3SK6A 3TZDA 3T4AC 1VQOA 3OWEB 2Z6KA 3CCMA 2JEBI 2F0QA 1KAAA 3K0YA 5KNCA 4BBSH 4BA2I 1JB3A 2VUMG 4A3BB 1S5FD 4YWLA 5JAVA 2E74C 2L9HA 1TS5A 4O1NA 2VS1A 2IL8A 4DR6Q 1FYCA 2M9VA 4NW2A 3Q23A 3OYYA 1ENFA 1PFSA 1E22A 4WJWA 2N8NA 1TT2A 3DEPA 4U673 3MA2B 2UXCQ 4R8IA 2F3IA 4K0KQ 1TWCH 3S2HB 4WORA 2HUGA 1XPOA 4BBRH 3B6YA 2Z4HA 2XWJB 1SXTA 4TSSA 1SBBB 4N8X1 3MZ5A 2RDGA 1Q1EA 4A3DH 3S1MH 1STHA 3M3YH 4XIGS 2Y0SE 1S40A 4GKJQ 3BDCA 1EWIA 1EEFD 2IX1A 2AWOA 3K6OA 4BWGB 1J8IA 3GDEA 4K6DA 3IL8A 1NJIC 1SYGA 1XTCD 3GTJH 4H13C 3KUPA 4JCVE 1HFNA 1Y14B 3PO3G 3J7ZC 3V96A 2UUAL 1MGSA 1JMCA 3PUZA 2QEJC 1PZJD 3V05A 4HJ7A 2ZJRA 4UP8A 2WINB 3BS1A 4Q5VA 3CCQA 2E2JH 4LF7L 4ZUIA 5GQOA 2ID0A 1STGA 1QWYA 1T5EA 1VQJA 3PIO3 1D7QA 4RAUC 1WTQA 4A3FB 1EEID 3PF4A 1MHWC 3JAMc 4LFBL 4BBRG 4UAIA 3PIPA 4QMGA 3IRBA 3F8TA 4YIJA 4KLKA 2K5NA 1SFOB 4PMBA 3F2UA 3OHXC 4YCUA 3TS0A 4LFAL 5HGQA 3G7LA 1D5XC 2F0OA 3KF8B 3PQIA 3SR1A 1JT8A 4PV1C 3A5ZB 3K80C 4DK3C 1GD7A 3GTKB 4ZLTF 1TS4A 3I55A 1A2UA 1X9NA 4HTHA 1Y8NB 4AH6A 2ZJQA 2KECA 2K33A 3QOLA 2F3WA 2R92G 3MXPA 4DK0A 1I6HB 3DWQA 1STBA 2A68D 3KOJA 3A74A 1PTOH 1XMQL 4GZYC 1YBYA 1DGSA 1C7YA 1GHKA 2DJGC 2SOBA 3A5UA 3J81c 3J7YW 4FVMA 4ZAIA 4B3TQ 1WTWA 1Y1WB 3X3MA 4DR1Q 1FD7D 4M1UB 3CRKC 2Q2UA 1I3QB 5NUCA 1SNDA 4GKKQ 3J80c 4KV6A 3CW2C 1SE2A 2V4DA 2JA7H 3J81E 1CK1A 1U4PA 3U9OA 3NTKA 1SRUA 1I4HA 2QDLA 2YU9H 1K3BC 4JV5L 2J0TD 4IURA 3EBEA 3L2PA 4A93G 1E3PA 3BDLA 1VMPA 1O80A 2KQ3A 3VYRA 1B7YB 1VF7A 1A8VA 3KLSA 4F88A 3A8IE 3E6ZX 1SMYC 3HOUH 1S3OA 1HCZA 3BZDB 1VQFA 4O42A 3S9WA 1N33L 3I4MH 4OGQC 2NB0A 4EQPA 4DV6L 2F0WA 5IGEA 1Q8IA 1W6JA 4DV1Q 3PO3B 3GTPH 3C1FA 4WJ4A 3CCVA 2EYOA 1N36L 3SK5A 2B2UC 1VQBA 1EWHA 5FOBB 1RIPA 1EY9A 1JQYD 1HR0W 4FF2A 4P73A 4GOPA 1N9WA 1GO3E 3GTOH 4C3JH 4FDBA 1QE6A 3HOWG 4A76A 3NBHA 2JA7G 3L7ZC 3MHBA 4FYDA 1S5CD 4CDFC 1JOOA 4MIUA 5I6YA 3PMFA 5IWAQ 1JE4A 1F2ZA 5KRUA 2EZVA 3E0EA 3I4NG 1NR4A 1X32A 3VR6A 5CV9A 3TP7A 5C4XB 5IP7H 2I5MX 1U4MA 4TVAB 2CVRA 1JICA 1Q90A 2LMCB 4WJ3M 2DJFC 3KLSX 3VR2A 2F0GA 1L1OB 2TSSA 3TDQA 1ET6A 4NB3A 4ZRZA 5E1FA 4ID6A 2B39A 4A75A 3R8BA 3M4OH 3P7JA 4QY7A 1RODA 1E1TA 1JE5A 1BF4A 1TQOA 4IPGA 4LMQD 2R92B 3DMUA 1D5MC 4L6TB 3HZXA 2F0SA 1NTGA 3I7FA 4QGUA 1EIYB 2RCFA 2HCCA 4GN3B 2J7ZA 3NQIA 4RA8A 4MTKA 2O5IC 3HS0C 4JBMA 1IBKL 1V1OA 4BY7G 3L9AX 3MXNA 1IBLQ 1SNMA 1EOTA 1F2YA 4QUCA 2M2LA 4R4CA 4L8JA 4OIJA 3CC4A 3HKZG 1AFPA 1TWFB 1DOLA 1M4VA 1EY6A 1BBXC 4GOPB 1G6ZA 5M5YH 1JORA 4JOIC 4P71A 2FXQA 2Z0SA 1R4QB 5IP7G 2KCCA 3GTMH 5EKLA 3HOVG 3NWSA 3NK9A 4DV2Q 2NVTH 4P74A 1Z7TA 2PMZB 3Q0AA 4BY1H 4A93B 5M5XH 4P75A 1F9RA 4P2CB 5CYUA 4FF1A 2OXPA 1TXYA 4KN4C 3WOEA 5IGBA 1SE3A 1K83H 2L11A 2QA4A 1HA5A 4DUYL 1TWHB 1SROA 2ZM6L 1CQVA 3RZOH 4DUZL 2HD3A 4JI4L 3D0FA 5IGGA 2KHJA 3DHQA 2L15A 2QILA 1BCPC 1C48A 4MHEA 2L0CA 2K52A 5A35A 4B3MQ 4DR2Q 5ISRA 2K75A 1X3GA 1GUWA 2JA6H 1LLRD 3H0GH 2XGTA 4DR4L 2EPBA 4DN4M 4JG2A 2BH8A 1K8OA 3K5LA 4A3MB 1DJRD 4ME5A 3CCRA 3S2DH 1QNUA 1QCBD 1EFID 4J6HA 2SNSA 3HOWB 3S15B 4RHRA 2F0KA 4QQBX 3MXNB 1PMRA 3A56A 4IUPA 4YY3Q 2Z4IA 3NWTA 1J6QA 2X6LA 3I4NB 2ICEC 1UE5A 2UUCL 4LF8Q 4JBKA 1EIGA 4BY1G 1ZYRC 4DV4L 1YEZA 4IFDI 2EQSA 4LK1C 1UAPA 1PFMA 2E8GA 4A3GH 1B44D 2A5HA 1Z47A 3WDNA 4Y7NB 5I2XA 2CH4W 1IW7C 5A2QL 3OPOA 3SDZA 5L37A 2CW0C 3AFQA 3CCUA 2F0FA 3IFTA 2OTJA 1A2TA 3HOYG 5JEAH 1DYQA 1EFWA 4EGVA 2JA6G 2JA8G 3GTGB 1PH3A 4PMWA 3RZDB 4U68A 4F7XA 1B8AA 3UDFA 2R93H 2OQKA 5M3FG 1IL2A 2GVAA 2IHFA 1HUNA 2B63B 2HHHQ 1CI3M 5BR8L 4BY7B 1FGBD 1HZBA 1CZGA 1RD9D 4LAAA 3S14H 3A8KE 4XQQA 2DY7A 4OHJA 1WCMG 1DXMA 4ZYSA 1PFNA 4C2MH 4C3IB 5M5WH 3M85A 3HKZB 4ABNA 1EQRA 1BO0A 5I2YA 1BUVT 3DLLA 3EQLC 5EPJA 3E5SA 4NXML 3U9SA 1L0YB 5K36H 2Q8IB 2DUDA 3QR8A 4C3HG 4OXPA 3HOVB 1NMGA 1B9NA 3QWNA 3AMUA 1F2MA 1VQHA 2E2IH 2NVXB 3KBGA 5J22A 1PRTC 2PNRC 4X3KA 4A3GG 1GJXA 4LF9Q 4KHPQ 2RHQB 4XXEA 4A3KH 3NSWA 3OMCA 4C56C 1EQTA 1JJGA 2UXCL 3AQQA 1GUOA 4KMUC 4K0KL 1EU3A 2WB1E 1OO9B 1YJNA 4LJZC 1LO5D 2Q2HA 4QIWE 3CRLC 4UP9A 3GTQB 1HNXQ 3VDYA 3AEVA 1E7ZA 5JEAG 5COYA 3HP3A 1LACA 3PUVA 4MN3A 4GKJL 2RDHA 4HMIA 4DV5Q 5HURA 3FKIB 2JA5B 2R93G 1BKBA 4AIMA 4JBJA 4P72A 5CBAE 2QF7A 1EQVA 2B8FA 3A54A 4IALA 5AFWA 4NXNQ 5FLXL 1TVXA 3S1NH 4CDEC 2VL6A 3SGIA 4K8JA 1EUJA 2F0TA 2VB3X 2E76C 5E4WC 2B2WA 4JPBW 2K03A 3I72A 1CKNB 1VDZA 2A1AA 2KHSA 4IFDH 5GADC 1PH1A 4MTNA 5K36G 4GNXC 1EL0A 4DR5Q 3EROA 3MWYW 4YCWA 2Y0SG 1A63A 1CTMA 1VF5C 3CAMA 3K5MA 2O4XA 3S16H 4L5SA 1XMOQ 4A3KG 1SLJA 3EVQA 1N34Q 3NE5B 3W1GA 2IWHA 2HDLA 2ZT9C 4N9PA 1PDQA 5CV6A 3NTHA 2CHBD 2KVMA 1ASYA 2CCZA 2D0PA 1HNWQ 2RVLA 1A3TA 3CQZB 4CJ1B 4KKSA 1QVCA 3OIPA 3STBC 1OXUA 3PUXA 5FKAC 1FR3A 4RH6A 4DV0Q 1YITA 4H7BA 4CHTB 4IPCA 1XPRA 4L5TA 5JVH3 2E2HB 2TMPA 1GKHA 3S17H 1I94Q 3EFXD 4A3IH 1PTOC 1S5DD 4ZKCB 4DFAA 1X56A 1YHAA 2VB2X 3HOYB 5EKKA 2JA8B 3ZYYX 2BA1A 3NP8A 1J9OA 3HG9A 1DZ1A 1B3QA 2MP1A 5EQ0A 4EVOA 4IO9A 5M3FB 3HOXH 4CKCA 4HIKA 1KAWA 4KY5A 5EPLA 4X65Q 4IFDG 3NXWA 5GAGC 1CQFA 1VQAA 2HDMA 1WCMB 1RDPD 1G2TA 2F0DA 3H6MA 4XYQA 2RSNA 2A6HD 1YVCA 5C0XI 5C3EH 1BXTA 5IODA 3FRPB 4C3HB 2FINB 4HSVA 3E3XA 3SE0A 4BXXG 4GKKL 3KYHC 2CKZB 1HHVA 3AFPA 4CKBA 2MO0A 2NTTA 4RWSC 5CV4A 3SXHA 5ELDA 3K7AH 4EQ5A 1PYWD 4GN5A 4ALPA 5C44H 2NWGA 1R9TH 1HZ9A 1EU4A 5JJKA 1QZGA 1B4OA 4R1JA 2F0IA 1SYCA 2WKDA 1SAPA 3MVVA 5BN5A 4OO1I 2F0NA 2WAQE 1Q86C 4DXGA 2E5LQ 5LL6X 2B29A 5C3XA 1AEXA 2B2TC 3MC0B 5CORA 1GOZA 1PH8A 1YHQA 1X3PA 3M7GA 4DV1L 4IUTA 1BCPF 5J1ZA 1FNUA 4RFBA 2LS01 1GM5A 3CD6A 3G6JB 5DNFA 3CCLA 4DV3Q 1G51A 3KF8A 1PXUA 3CXCA 4LF5Q 2R7ZB 2N49A 1SNQA 2EYHA 1YHBA 2I5LX 1E2ZA 4PMCA 2Y0SB 2ES2A 4XT1B 1H9MA 5EAYA 3PUYA 1SJED 1SR3A 4EX5A 1Q82C 2AKWB 5AJ3Q 3KLRA 1PVOA 3CP0A 4OL7A 2F0HA 1F9QA 5IWAL 4JI7Q 2PNHA 5C44G 4QUFA 5IYBH 2IY5B 3VR5A 3IFDA 3NPPA 1AE3A 1TIID 3MAQA 3H3VC 5J39A 3GV6A 1H95A 1EQQA 1XXGA 1HQMC 2C9OA 1EYAA 3QB3A 1STYA 1K8MA 4JW0A 1IBMQ 4GS3A 4BBSG 3P75A 5JOBA 2Q8RE 3BYYB 1TR5A 4F8MA 2EY6A 1S5BD 2B2VA 2CH4A 3FEWX 4JYAQ 2XVSA 3T1HQ 1I4XA 1LT4D 2EJGC 2WKCA 1BNZA 1NSNS 4K5WA 1OTCA 1VCIA 1KNEA 1HPCA 2F0MA 5JVG3 3CMAA 1I50B 5K5PA 2DNEA 3ZJYC 2AQ3B 2DGYA 5T1IA 3JAML 1ZXTA 5C0XH 4F87A 4YHHQ 1A6XA 4B9XA 2OEOA 5JPMC 4I7AA 1KLGD 1VQ7A 4FO2A 2Q2TA 1ESFA 1PA6A 3SEBA 2Q2IA 3UDIA 4A3DG 3CF5A 1IBLL 5C4JB 4L63B 2EE1A 3OTOQ 1Y1VH 4K2KA 2B2YC 1FNVA 5IYBG 5LMNQ 3TQYA 2RCNA 3CC7A 1E2VA 1U4LA 2IX0A 5J3BA 3J81j 2NUCA 4KK7A 1UE1A 1H9JA 3RNUA 1QZHA 2K5HA 4JVZA 5LHY1 2BDOA 1IKMA 1SNCA 4XYOA 2RKSA 4KTAA 1CUKA 5IP9H 4DAPA 1BCPB 4OO1H 4DV2L 3H3VI 1IYUA 1PRTF 4FXDA 3FP9A 2F3VA 1DCZA 3RN5A 1DOKA 3J81L 4OEMB 4YWKA 1XNRQ 2F4IA 3RR5A 4A3JH 1E24A 2YTVA 2F03A 2VUMB 2MHVA 3GD7A 4K2LA 3W1BA 1YNJC 3F1ZA 3JAMi 3J80L 3PIP3 3HOZH 1LTGD 2EVBA 2K5WA 2NVQB 1XTDA 3ICEA 4JI8L 3L0OA 1EIHA 1HR0Q 1QUQA 4B3ML 1VQ5A 4DR2L 3QG1A 1L1OA 1Y1VG 2DN8A 1CA6A 3M7NA 2PCFB 4IUVA 4K14A 2EJMA 4MNOA 4JI6Q 1UE6A 2RA4A 2CWPA 5GAHC 5IGDA 1Y8PB 1QVGA 1SSOA 2NVYH 1B70B 2XRSD 2D9UA 2PQEA 2XRQD 1M8AA 5CR3A 1NY4A 5DEHA 4X6AH 4Z9CB 3DEOA 4ZKBB 4YY3L 5IP9G 4OO1G 2D0OA 5CV7A 5D65A 5ELNA 5KGUA 2FFKB 3K57A 2FMMA 4LF8L 4DNIA 1JWSD 4G7OC 4PNYA 2QDBA 3TP5A 4L5QA 1ASZA 3BZKA 4HN7A 4DR3Q 3D8GA 4BBSB 2BE5C 1GHJA 5FK9C 3K7UC 4J15A 4CDCC 4A3LH 2ZXRA 3PV0A 4JI0Q 2OTLA 1NR2A 5CGKA 5ELOA 3J80i 1G291 5C4HA 2F0VA 1PTOF 1SJHD 2H1EA 4A3EH 2PQAB 4QB4A 1EOVA 1TWCB 4NKLA 2R3ZA 2PYKA 1PRTB 2F52A 4BBRB 1WTHA 1K9MC 2F0LA 1V1PB 4JI5Q 5IT9c 3F2DA 2HHHL 2QEXA 3S1RH 3MXUA 4A3DB 3T1YL 3PO2H 3S1MB 1QUQB 1EYCA 5GROA 3M3YB 3W3AA 4L5RC 3HOUG 4G7ZC 2VY3A 1WTRA 4LF4L 4QCLA 3K81C 3H3VH 3I4MG 2V1CC 4WRDA 3BYTB 2MPMA 2Z6BA 1VQLA 3GTJB 4DAYB 3ERQA 1LTSD 5ELCA 4NDXA 1YNND 3OSOA 5IT9E 4JK1C 5DLQE 3FVQA 4LF9L 4KHPL 4A3LG 1RCVD 1Y69U 2MO1A 4HEDA 2E2JB 1RF2D 4I7ZC 1KQSA 2MGSA 4IOCA 1Z6HA 1K0RA 4C3JG 4RGTA 2KENA 2CFMA 1HNXL 4OWXB 3ITPA 4CJ0B 2OWOA 4GNXB 1X65A 4DV5L 1G2SA 1LTTD 4R8NA 3VA5A 3MFGA 1SYFA 2SNMA 3O13A 2PW7A 4NPSA 4UHVA 4XQJA 1A62A 4K5VA 4LFBQ 4HCEA 3PO2G 1LTID 1ZEQX 3KBXA 1ET9A 2BCOA 3H09A 3TREA 3NTIA 5E7NA 4XTCS 1Q1BA 1WFQA 1Q8KA 3DWAA 2Z6KC 1O7ZA 4KD4A 4DR5L 2K5QA 2K1BA 3NENA 3WOFA 2H5XA 2XSCA 1D1KA 1DOMA 4LFCQ 3I4OA 1SMYD 3G71A 3A8JE 1XMOL 1PTOB 1PYBA 1VQPA 4LUZA 4JI3Q 1N34L 5KNBA 1D6EC 1TWGH 1I4RA 2ZTCA 1UNSA 4RCOA 4LUVA 1QJOA 1KHIA 3R2TA 1GXDC 1HNWL 4R9WA 4AYBG 2KUMA 2PMZE 3M9BA 2N55A 3KF6B 3K5NA 4KKUA 1WJJA 1X6OA 3D3RA 3F2BA 4DV0L 4HIDA 5C3WA 3RLOA 3BVMA 4DF7A 2ZTDA 1LTRD 2LFNA 1I94L 2XTIA 1B1ZA 3QO2A 5M3MH 1UWVA 2JA7B 3HEJA 2EIFA 2L5TA 1PZID 2YU9B 3CPWA 4N9TA 5EGTA 2UXDQ 2Z1CA 4X3TA 3KDFB 4X65L 1D1IA 5JJLA 3EN2A 1HH2P 1TY2A 3S1QH 5FO8B 2KEEA 1HRJA 5LL6S 1E0BA 1IKLA 3T56B 5I4DA 3HOUB 3CCJA 1SDFA 5JJZA 4ZQ3A 1X55A 3R93A 3I4MB 3NUCA 1I4PA 4ZK9B 2D2CC 3GTLH 3RLNA 2F0UA 1N33Q 1JOQA 1JJCB 3GTPB 4DV6Q 1A15A 4LF6L 1TWAH 4X62Q 2L12A 4R4IA 2EXZA 2ZJPA 4GLVB 3H0GG 2WACA 1EYDA 2QKIC 2UXBQ 2A69C 3C46A 1CKNA 3CHBD 3QJYA 3GTOB 4C3JB 1WYDA 5ELEA 1X3FA 5M3MG 2WV6D 1VQNA 5CMDA 4FP5D 4B9WA 5H1SE 4QF4A 2OCEA 4X64Q 1V8QA 1X54A 2C5CA 2E5LL 3NBIA 5CC4A 1KABA 1PH6A 1WVLA 1HJPA 4CKEA 5BN4A 1SYEA 1HTPA 2C35B 4DK6C 1JCKB 4POGA 5C4ZA 3DM3A 1D8LA 4DR6L 1NNXA 4A3BH 4R4QA 1LV9A 1JOKA 5I9OA 5DAUA 5A2QE 1KL9A 3BJUA 3D31A 4RMFA 4DV3L 1HA6A 4QJFA 4LF5L 4DK1A 1RJTA 2UUBQ 1N32Q 3M4OB 1XX8A 1AN8A 1ENAA 1XJVA 1STNA 1AZQA 2WAQG 3S2HH 2ZXPA 4DU9A 1KXLA 3IKJA 5AJ3L 1P8LA 1NAPA 2K5VA 1M90C 4KY6A 2IPKD 4OIKA 4HCSA 1QILA 3LNNA 5IYCH 1BVSA 1LT5D 5DM73 4Y52H 5FO7B 3BVZA 2XN9C 4KHZA 5JEAJ 4AYBB 2Z9HA 1GUTA 4IUNA 3RUZA 2K05A 1BCPD 4X66Q 5IGFA 2RDFA 2NZHA 1IBKQ 1RKNA 1EZ6A 1O78A 4DKAC 2YV5A 3ULJA 1IBML 3L3OC 4HIMA 3CMEA 1N8RC 1SNPA 4HMJA 2AMCB 5M5YB 1PH5A 2HIVA 4JYAL 4S3SA 3T1HL 1B2TA 2H4OA 1KNAA 3GTMB 3BG3A 3TS2A 4A3BG 1WD1A 1SE8A 2PPBC 3LWUA 3NELA 2NVTB 3BZCA 2VQFQ 1VQIA 2E75C 4BY1B 3NEMA 2ALYB 4K5XA 2PZWA 5M5XB 1KIXA 1B53A 1PYSB 2QGQA 3HKSA 1ZYRD 3U58A 3OWFA 4ZCKA 2B2UA 1O7YA 4A3FH 1K83B 2HQEA 1KDBA 4ULLA 3QOJA 5JPNC 2NZ1D 4DAVA 2K6AA 2K5DA 3RZOB 1Q7YC 3OTOL 3OW2A 1SFOH 2EYMA 2FJ2A 4GOPC 3FDTA 2X6GA 2F1MA 5LMNL 4JI4Q 2E2DC 5EKIA 3VYSA 2CWAA 4JBWA 2CW0D 2EYJA 1T5XD 1UEAB 3GTKH 1C0AA 4HSPA 3UDXA 2JA6B 1UUPA 3H0GB 1H9RA 4JC0A 4KD3A 3SK4A 1AP0A 3Q22A 2YTXA 4XDXA 3VA7A 4GLXA 3S2DB 3FMCA 1JWMD 2QW7A 3UE0A 1R4PB 4PZ8A 5FLMH 1CZWA 4DR4Q 1I6HH 5EPKA 3PF5A 2KBNA 3ND8A 1HNZQ 4H44C 1XNRL 1JB7A 4B3TL 3V2TA 4IFDJ 1CKMA 4DR1L 1E2WA 1K8AC 4IJLA 1HUMA 4IJHA 5D14A 1Y1WH 2UUCQ 1KRSA 1FJGQ 1H9KA 3CPFA 4A3FG 1G6PA 1I3QH 1RTOA 4A3GB 3DWPA 1HR0L 3RMHA 1PRTD 1V9PA 4AQYQ 1PV4A 5F2DA 2F4VQ 1LT3D 1UE7A 3E0JA 4JI6L 2A6ED 1FVIA 3JC66 4RGOS 4V0BA 3CC2A 1L2FA 4OWTB 2BA0A 2WAQB 3I3CA 4A3IG 1EY5A 2PO4A 1IHZA 2HCIA 1YI2A 1PH7A 1AE2A 3K59A 1O7LA 1F2LA 2R93B 2A68C 3HOXG 4JOIA 1SYBA 3TBIB 2IX3A 2NN6I 2AHOB 2JEAI 3Q8DA 3EJIA 4H0LC 2HT1A 3D4RA 5CV8A 3S14B 2JN4A 5BR8Q 1O7IA 4X3UA 4C2MB 5IOCA 4DR3L 5M5WB 1WD0A 4FF4A 1MJCA 3PO3H 2MQHA 4DR7Q 3TRZA 3CKIB 1BR9A 3R3OA 4JI0L 5C3EG 4QL5A 1Y1WG 2AWNA 1J5EQ 1W6KA 3OOCA 1TKWB 4NXMQ 2E2IB 3MFYA 4IN3A 4KKTA 4CDDC 2PZUA 4PQXA 3TMEA 4DV7Q 4A3KB 1E1OA 1V43A 1RHPA 1JR0D 4RGNA 5G3LF 1OXSC 3MXGA 4APVA 1EYGA 3F2CA 3PIOA 1C8CA 3AU7A 1AZPA 4JI5L 1HFGA 3H94A 3GO5A 2VQEQ 3R2IA 1TY0A 3UI2A 5C4XH 3RN2A 3A7AB 4JI2Q 3STBD 3TSSA 4KJNA 5IYDH 3RLFA 2RSOA 4LUOA 2D5DA 3S1NB 3K58A 1PTOD 3LX0A 3SHLA 1NE3A 1H9SB 1SMXA 2K32A 1EWCA 2B3GA 3BDOA 2R92H 1LT6D 1IL8A 4RKLA 1W3SA 2IT1A 1LTLA 3VR3A 3FPUB 1K8GA 1K3RA 3VYUA 2ATWA 1MIUA 1EY8A 4JI1Q 4PZ7A 3S16B 1HZAA 3D4DA 3T13A 1GVPA 4G57A 4K6LA 4V190 2VXWA 1MSGA 3W2DA 4G4KA 2KCTA 2OT2A 2HIXA 2VW9A 3NHHA 1TWFH 4FXGC 2AUJD 4A3CH 2I0QA 1RTNA 1STEA 2JP1A 5C4XG 1OXVA 1U0LA 3S17B 5TSSA 3I70A 1ESRA 5IYDG 1ILQA 4H02A 4A3IB 2NN6H 5IGCA 4KHVA 1RL2A 3I2ZA 3N6RA 1F77A 5KNDA 4A93H 4N8FA 2KEDA 5HGTA 1YNNC 3FHWA 4B3RQ 4HJ8A 1PLFA 1B3AA 3BVGA 3JAME 1WTPA 1Q3LA 4LFCL 3K5OA 3A7LA 2PQAA 3P20A 1PH2A 3HOXB 1WI5A 4J1MA 4HR7B 2RQXA 4JI3L 4MZ9A 2UU9Q 2NZOA 5C0XG 1TWHH 2VZAA 2X69A 1V1PA 1KTKA 2R61A 5C5LA 2KJXA 2JSOA 1S72A 2SEBD 1S4ZA 3GV3A 5EBDA 2ZTEA 5EJWA 1F9PA 5C0XJ 3Q24A 3P1HA 5IE8A 5C3EB 2K4KA 1LABA 1NMFA 2EJFC 1VQEA 4B3SQ 4DAYA 4ZUJA 1MD2D 3M4YA 1GUNA 3PGZA 1XNQQ 4RGMA 4DXFA 1CSQA 3AB9A 4A3MH 1CT1D 1AH9A 4A3CG 1WOCA 2AQ2B 3K7AB 3HOWH 3S15H 1ZKOA 1LTAD 5C44B 1R9TB 1QNKA 4R4TA 5LMNW 2UXDL 3IAYA 1XYIA 1NCVA 1C4QA 2NYZD 1A0IA 1PZKD 4M8AA 5LMUQ 5M9OA 1NUCA 3DM1A 2NN6G 3I4NH 1KLUD 5C5MA 3VR4A 4WFN3 3J81i 4OX9Q 2R7FA 1BBWA 2F0PA 3A55A 2JXMB 1X3QA 2B2WC 4A3JG 1YIJA 3M4QA 3CCSA 1VQ9A 3J80E 1OXXK 4GNXA 1HXYD 1SN8A 2K28A 1BBUA 3OMGA 1C9OA 1I4QA 3G48A 2N88A 3UE1A 4Y7NH 3HOZG 1EY0A 2EOTA 1STAA 1U9RA 2PI2A 3E9HA 5D3IB 4TQUS 4X62L 3J7A5 3I91A 1II3A 1G91A 3H91A 2N3SA 2SDFA 4NMZA 3OIQA 3OW7A 2KCNA 1IYJB 2UXBL 3GTGH 1HQRD 2G9HD 1CKOA 4G7HC 1CHQD 3RZDH 4FNFA 5IT9L 1DM0B 1QB5D 5E4XA 4YWMA 1JWUD 2L4NA 4A3MG 3W5OA 4UDUC 2B63H 3PSIA 4DAMA 4IZ8A 2QCPX 4RG1A 4BY7H 4X64L 3I90A 2M00A 3PCOB 1TU2B 3WWVA 4C3IH 4CJ2C 3KFUA 3SK8A 2EY5A 4O0AA 1Z9FA 1WTXA 1DONA 3LGJA 3M4PA 2EYLA 3KF6A 2UUAQ 5FO9B 3HOVH 2NVXH 4R4OA 4NP5A 3KJPA 3A0JA 2UUBL 4DNTB 1N32L 1FL0A 4KJOA 4UPAA 1KRTA 4LF7Q 1GUSA 2OF1A 3QIAA 4XT3B 3C3LA 2O5JC 3E9IA 5EBCA 1CHPD 5CBEE 1SE4A 5C6AA 4IPDA 4A3EG 3GTQH 2IJ0A 2GVBA 3U4VA 1MBYA 2GA4B 1IZ6A 1TS2A 3KDFA 3TP8A 4EQNA 1YNJD 1A3VA 4Q0FA 1NBWA 1Q46A 2A19A 2A8VA 2YTYA 5I9PA 1K28A 3FKIH 4IPHA 2JA5H 1PH9A 4NXNL 3X3NA 2RBMA 3TZUA 1P16A 4X66L 2MJ8A 2B63G 1QG7A 1YNXA 1Y1VB 4E6IA 4LFAQ 1FNWA 2WB1G 1Y8OB 2DY8A 1CSPA 1ENCA 2KHIA 4O2DA 4C3IG 3ER0A 3Q6SA 4GN4B 1SYDA 3ND9A 4DA2A 2B2TA 3KJOA 1CFMA 4IOAA 2EYFA 5GAEC 2XIWA 1A3UA 4BA1I 2D62A 2K50A 3NBHB 1QVFA 1U5KA 2VQFL 1LM0A 3KLWA 5JJIA 2PI2E 4IUQA 1UEBA 4B08A 1S5ED 2KCMA 1PFBA 1XMQQ 1U4RA 3DUZA 2JK8A 2EXDA 4A4IA 2I07B 4POFA 3H15A 4A3JB 2PZTA 4PG3A 2IW3A 5D3DA 1ICFB 1B9MA 1VQ6A 1DD2A 2Q8TA 2BE5D 1ONLA 3CQZH 4ILWA 5DM63 4YCVA 1I6VC 3HOZB 1LTBD 5IIFA 4PZ6A 3GP7A 4RCNA 3FKIG 1VQ8A 2E2HH 4OONA 2JA5G 4HJ5A 2ZXOA 4DGZA 2IHEA 4JI8Q 2G5DA 1MKHA 3N52A 3KK7A 1BOSA 2EDGA 2JQOA 3HOYH 2JA8H 2MUYA 4GLAC 2NVYB 5KYLA 1I5FA 4JV5Q 4HAEA 5M3FH 2LY7A 5E3FA 3C1EA 1MSHA 3I8ZA 1HNZL 1AW7A 4CGYB 2WP8J 1D5ZC 1QOHA 2B2VC 1WCMH 3AYHB 1WTVA 1XPUA 2WIIB 2JYOA 1FJGL 3U50C 3I56A 4C3HH 1SEBD 1Q81C 4CBVA 4BS9A 2K04A 4K8IA 1N36Q 2FHTA 2BDNA 4KN7C 4AQYL 2O2LD 3TEHB 2EYPA 4IUUA 2R7DA 2F4VL 4UP7A 2G9DA 1MI2A 1D2BA 2DNCA 3G4SA 2B2YA 2BOSA 2RF4A 1V1QA 3MEFA 3HFZB 4A3EB 2CQAA 2OQ0A 2F0JA 4ODGA 3K8AA 1L0WA 2HQLA 2K7VA 1HTLD 2PW5A 1IXRA 3D6CA 2B8GA 3S1RB 4HIOA 1Q12A 3PO2B 4EQOA 1I4GA 4RKBA 3EA6A 1CA5A 3CCEA 2K14A 4TRDA 1YJWA 1PHJA 3T1YQ 2Z8LA 2WB1B 3CU7A 1BQQT 2GN5A 2AQ1B 2JJQA 2WFWA 2LSSA 4X3SA 4XQNA 5CV5A 4LWCA 2KOLA 4QIWB 2A6HC 4DR7L 2FMCA 1VQMA 4LF4Q 5BN3A 3SVMA 2BH2A 3J7AV 1J5EL 4OWWB 2R7ZH 2A73B 3T51B 1VQKA 1MJEA 3K0XA 3HKZE 4DV7L 1EZ8A 2KA7A 3D6WA 1VQDA 2RHSB 2A74C 4FF3A 3ERSX 4JI7L 5FJ8H 2A6EC 2YYZA 1LUZA 1EY4A 1EIFA 4I65A 3BU2A 1SNOA 5HY6A 1X3EA 3PUWA 1OXTA 1JJ2A 1L1OC 2F0EA 2VQEL 2ASBA 5KYIA 3G6EA 4ME3A 3ONAB 4IQZA 2ENBA 4UY8C 4JI2L 5KEEA 1K0SA 2I46A 3GQBA
chains in the Genus database with same CATH topology
2D0OA 3D0FA 5ELNA 1E1OA 1V43A 2KHJA 4LNQA 4LF8L 4DNIA 1T9HA 2L15A 1OXSC 5FLXc 1LYLA 2K52A 4APVA 1EYGA 3F2CA 3PIOA 4B3MQ 4AYBE 1K73C 4L5QA 1ASZA 4DR2Q 2K75A 1X3GA 3BZKA 2JA6H 4JI5L 1M1KC 4DR3Q 1I50H 3H0GH 2XGTA 4YHHL 1KD1C 3GO5A 2VQEQ 2R7ZG 4DR4L 4JG2A 2BH8A 1VS0A 3K7UC 4J15A 4A3LH 3S2DH 3CCRA 1YJ9A 1PH4A 4JI1L 2CQOA 3PV0A 2JE6I 4JI0Q 5C4XH 2OTLA 3RN2A 4JI2Q 3STBD 4QQBX 5ELOA 5IYDH 3J80i 3RLFA 4DUYQ 4LUOA 1G291 3MXNB 4HJAA 2VNUD 1HZCA 2ZM6Q 2N78A 5FJ8G 5IYCG 5C4JH 4DUZQ 4LW1A 4YY3Q 1J6QA 3ULLA 1UE5A 2UUCL 4A3EH 2PQAB 4LF8Q 4JBKA 1EOVA 4BY1G 4BXXH 1NE3A 4DV4L 1YEZA 4IFDI 1SMXA 2EQSA 2MFIA 1FGUA 2B3GA 2R92H 2F52A 1K9MC 2I5HA 4JI5Q 5IT9c 2E8GA 1W3SA 2QEXA 3F2DA 2IT1A 2HHHL 3S1RH 1LTLA 4A3GH 3T1YL 3PO2H 1Z47A 2MNAA 1QUQB 5GROA 1K8GA 4L5RC 1K3RA 2ATWA 3HOUG 1MIUA 4JI1Q 4PZ7A 2A8VA 2VY3A 4LF4L 3K81C 3H3VH 1HZAA 1YZ6A 3AFQA 3I4MG 1GVPA 4B3RL 2V1CC 1VQCA 3S24A 1VQLA 4DAYB 3CCUA 4HJ9A 2OTJA 2KCTA 2HIXA 3UDGA 1KC8C 2JA9A 3HOYG 2UU9L 1EFWA 2JA8G 2JA6G 3ULPA 2VUMH 2VW9A 4PMWA 1PH3A 5DLQE 1TWFH 4DV4Q 1B8AA 3UDFA 4LF9L 4A3CH 4KHPL 4A3LG 2OQKA 5M3FG 1IL2A 2I0QA 2GVAA 2R6GA 2R93H 2MO1A 2IHFA 1W2BA 5C4XG 2NVQH 2HHHQ 1OXVA 5IY0A 5BR8L 1U0LA 1KQSA 4DPGA 1HZBA 5IYDG 4IOCA 1K0RA 4H02A 3S14H 1WCMG 2KENA 1RL2A 2CFMA 3I2ZA 4C2MH 5M5WH 3M85A 4B3SL 2UXCQ 1HNXL 4OWXB 4A93H 1EQRA 1XNQL 3FHWA 2OWOA 4HJ8A 4GNXB 1X65A 1VQ4A 4B3RQ 3DLLA 2LXJA 3EIVA 4DV5L 4KI0A 4LFCL 4NXML 4DR6L 2PQAA 1PH2A 4LF6Q 1WI5A 1VQGA 3U4ZA 2DUDA 4JI3L 4NPSA 4OXPA 4MZ9A 1NMGA 2NZOA 2UU9Q 5C0XG 1A62A 1VQHA 2E2IH 4LFBQ 1TWHH 2VZAA 5FLMG 4A3GG 3PO2G 2LXKA 4LF9Q 5LMUL 4KHPQ 2RHQB 4A3KH 1S72A 1JJGA 4OX9L 2ZTEA 3AQQA 2UXCL 4K0KL 5C0XJ 3TREA 2WB1E 5E7NA 5IE8A 1YJNA 2K4KA 1NMFA 4XTCS 1VQOA 2Q2HA 4QIWE 2Z6KA 1Q1BA 1WFQA 1Q8KA 4UP9A 2JEBI 3CCMA 1VQEA 2Z6KC 4B3SQ 1HNXQ 4DR5L 4BBSH 4BA2I 3PGZA 3VDYA 1E7ZA 3NENA 5JEAG 1XNQQ 3AEVA 2H5XA 2VUMG 3PUVA 4A3MH 4GKJL 1CSQA 4DV5Q 4LFCQ 4OO1G 1AH9A 3I4OA 4YWLA 3G71A 4A3CG 2R93G 1BKBA 1WOCA 4AIMA 1PYBA 1VQPA 1XMOL 4LUZA 3HOWH 4JI3Q 1N34L 3S15H 2VS1A 4JBJA 1TWGH 2ZTCA 4P72A 4DR6Q 4R4TA 5LMNW 4LUVA 2UXDL 3OYYA 1PFSA 4NXNQ 1A0IA 1KHIA 3S1NH 1E22A 5LMUQ 2NN6G 3I4NH 2VL6A 1HNWL 2N8NA 4AYBG 3SGIA 4OX9Q 3J81i 1EUJA 2PMZE 1BBWA 2F3IA 2R7FA 3M9BA 4K0KQ 1TWCH 3KF6B 1XPOA 4A3JG 1YIJA 1WJJA 1X6OA 3M4QA 1CKNB 4BBRH 3B6YA 3F2BA 3CCSA 2A1AA 4DV0L 1OXXK 4HIDA 4GNXA 1VQ9A 1SN8A 5GADC 1PH1A 3RLOA 4MTNA 5K36G 4GNXC 4DR5Q 2ZTDA 1BBUA 1Q1EA 1I94L 4A3DH 3S1MH 1C9OA 2XTIA 2Y0SG 3G48A 4YCWA 3UE1A 5M3MH 1A63A 3M3YH 4Y7NH 4XIGS 1UWVA 2Y0SE 1S40A 4GKJQ 3HOZG 1EWIA 3CAMA 2PI2A 2EIFA 3E9HA 4L5SA 2AWOA 2IX1A 1XMOQ 3S16H 4A3KG 4TQUS 1SLJA 1N34Q 3GDEA 3W1GA 4X62L 3CPWA 1NJIC 3J7A5 3GTJH 2UXDQ 1ASYA 4JCVE 2CCZA 2N3SA 1Y14B 2D0PA 3KDFB 3PO3G 4X65L 3J7ZC 1HNWQ 2UUAL 3EN2A 1HH2P 1IYJB 3S1QH 5JJLA 2UXBL 3GTGH 1CKOA 3RZDH 1JMCA 3PUZA 4YWMA 3CCJA 1QVCA 3STBC 4A3MG 3W5OA 4HJ7A 1OXUA 3PUXA 4UP8A 1X55A 2ZJRA 4DV0Q 1YITA 1XPRA 4IPCA 3PSIA 4L5TA 4DAMA 3CCQA 2E2JH 2B63H 1GKHA 4RG1A 4LF7L 4X64L 5GQOA 1I94Q 3S17H 4BY7H 2ID0A 3GTLH 3RLNA 4A3IH 1N33Q 1JJCB 1X56A 1YHAA 4DV6Q 3PCOB 4C3IH 3WWVA 3KFUA 2BA1A 1VQJA 4LF6L 1D7QA 1TWAH 4X62Q 4O0AA 4R4IA 3PF4A 1Z9FA 4IO9A 3HOXH 2ZJPA 3JAMc 4GLVB 3H0GG 4LFBL 4HIKA 1KAWA 3LGJA 3M4PA 4BBRG 3KF6A 4X65Q 3PIPA 2UUAQ 3HOVH 3IRBA 4IFDG 5GAGC 2UXBQ 3F8TA 2NVXH 1CKNA 2K5NA 4KLKA 4R4OA 3KJPA 4YCUA 1VQAA 3TS0A 3A0JA 1WYDA 5HGQA 4LFAL 2UUBL 1X3FA 5M3MG 1VQNA 1N32L 1FL0A 3KF8B 1JT8A 3A5ZB 3K80C 5H1SE 4DK3C 1GD7A 4UPAA 2OCEA 1KRTA 4LF7Q 4X64Q 3E9IA 1YVCA 5C0XI 1X54A 5C3EH 2E5LL 4IPDA 4A3EG 3I55A 3GTQH 1X9NA 1PH6A 4BXXG 4GKKL 1HJPA 4AH6A 2ZJQA 2GVBA 3U4VA 3KYHC 2C35B 4DK6C 1IZ6A 2CKZB 4POGA 3KDFA 2R92G 1NBWA 1D8LA 1Q46A 2A19A 3AFPA 2YTYA 3DM3A 3KOJA 2MO0A 3FKIH 4IPHA 4R4QA 2JA5H 4A3BH 3A74A 3K7AH 1PH9A 4EQ5A 4NXNL 1XMQL 1YBYA 1DGSA 1KL9A 1P16A 4GN5A 3BJUA 4X66L 4ALPA 1C7YA 2B63G 3D31A 4RMFA 5C44H 4DV3L 1YNXA 1R9TH 4QJFA 3A5UA 1HZ9A 4LF5L 4LFAQ 3J81c 5JJKA 1QZGA 2WB1G 4R1JA 2UUBQ 1N32Q 4B3TQ 1CSPA 2KHIA 4O2DA 1XJVA 3ER0A 2WAQG 3S2HH 4GN4B 4DR1Q 4OO1I 2WAQE 1Q86C 2Q2UA 1KXLA 5AJ3L 1P8LA 3KJOA 2E5LQ 2B29A 4IOAA 5GAEC 2K5VA 1M90C 4BA1I 2D62A 2K50A 3J80c 4GKKQ 3ICEA 3NBHB 1QVFA 3CW2C 1PH8A 1U5KA 1YHQA 2VQFL 5IYCH 1BVSA 4Y52H 1LM0A 3KLWA 5JJIA 2JA7H 4DV1L 2PI2E 1UEBA 4KHZA 2KCMA 5JEAJ 1XMQQ 1SRUA 1GM5A 4X66Q 3CD6A 2YU9H 3CCLA 2JK8A 2NZHA 4DV3Q 2EXDA 4A4IA 1G51A 4POFA 1IBKQ 3H15A 4JV5L 4DKAC 3CXCA 2YV5A 3ULJA 4LF5Q 2N49A 4PG3A 3EBEA 1IBML 3L2PA 4A93G 1E3PA 4HIMA 3CMEA 1N8RC 1YHBA 1B7YB 1VQ6A 1A8VA 2I5LX 3CQZH 2AMCB 4YCVA 2ES2A 1PH5A 2HIVA 4JYAL 3HOUH 5EAYA 3T1HL 1S3OA 3PUYA 1SR3A 4EX5A 1Q82C 2AKWB 4PZ6A 1VQFA 5AJ3Q 3TS2A 1PVOA 4A3BG 3FKIG 3CP0A 1VQ8A 4OONA 2E2HH 4HJ5A 2JA5G 1N33L 3I4MH 1SE8A 3NELA 3BZCA 4DV6L 2IHEA 4JI8Q 5IWAL 2VQFQ 4JI7Q 2PNHA 1VQIA 5C44G 1MKHA 5IYBH 2IY5B 3NEMA 4DV1Q 2JQOA 2ALYB 1AE3A 3GTPH 1KIXA 3HOYH 2JA8H 4WJ4A 3CCVA 1H95A 2QGQA 1PYSB 1EQQA 3HKSA 1N36L 3U58A 4GLAC 4A3FH 1I5FA 4JV5Q 5M3FH 1VQBA 1IBMQ 4GS3A 4BBSG 1RIPA 1HNZL 1Q7YC 1HR0W 4P73A 3OTOL 2WP8J 4GOPA 3OW2A 1SFOH 1N9WA 1GO3E 4GOPC 3GTOH 4C3JH 1WCMH 4JYAQ 3AYHB 3T1HQ 4FDBA 3HOWG 5LMNL 4A76A 4JI4Q 2JA7G 3L7ZC 2CWAA 4JBWA 1XPUA 1OTCA 1VCIA 3GTKH 1C0AA 1FJGL 5IWAQ 3UDXA 3CMAA 3E0EA 3U50C 3I4NG 4JC0A 3I56A 3ZJYC 4C3HH 1Q81C 2DGYA 2YTXA 4GLXA 4YHHQ 3UE0A 1N36Q 5FLMH 4PZ8A 4AQYL 4DR4Q 1VQ7A 5IP7H 2I5MX 3TEHB 1I6HH 2Q2TA 2R7DA 4TVAB 1PA6A 2F4VL 4UP7A 4WJ3M 3PF5A 2Q2IA 2KBNA 3UDIA 1L1OB 3CF5A 1HNZQ 1IBLL 4NB3A 4A3DG 1XNRL 1JB7A 3OTOQ 1Y1VH 3G4SA 4B3TL 2RF4A 1V1QA 3MEFA 3HFZB 4A75A 4IFDJ 5IYBG 3M4OH 4QY7A 2OQ0A 3TQYA 5LMNQ 1CKMA 1E1TA 2RCNA 4DR1L 3CC7A 1JE5A 2IX0A 3K8AA 5J3BA 1K8AC 4IJLA 4IPGA 4IJHA 3J81j 1Y1WH 2UUCQ 1L0WA 1UE1A 2HQLA 1KRSA 3RNUA 1FJGQ 1QZHA 1IXRA 2K5HA 3CPFA 4A3FG 1G6PA 1I3QH 1NTGA 3I7FA 4HIOA 1Q12A 1HR0L 5IP9H 1CUKA 4QGUA 1EIYB 4DV2L 3H3VI 3CCEA 2K14A 3FP9A 1YJWA 1V9PA 4AQYQ 3T1YQ 4GN3B 1PHJA 1PV4A 2JJQA 2GN5A 2WFWA 3RN5A 4JBMA 2LSSA 2F4VQ 1IBKL 1UE7A 4JI6L 4LWCA 3JC66 1FVIA 3CC2A 4BY7G 4DR7L 1L2FA 1IBLQ 1VQMA 4OWTB 4LF4Q 2BA0A 4YWKA 1XNRQ 4A3IG 2BH2A 4R4CA 1J5EL 3RR5A 4A3JH 1YI2A 4OWWB 1E24A 1AE2A 2YTVA 1PH7A 2R7ZH 3CC4A 3HKZG 1MJEA 1VQKA 3K0XA 3HKZE 3GD7A 4DV7L 3W1BA 4GOPB 5M5YH 3F1ZA 3HOXG 4JOIA 3JAMi 1VQDA 2RHSB 3HOZH 4JOIC 4P71A 2FXQA 2Z0SA 2NN6I 1XTDA 2AHOB 5IP7G 2JEAI 3Q8DA 4JI8L 3GTMH 3L0OA 3ERSX 4JI7L 2HT1A 5FJ8H 3HOVG 1HR0Q 1QUQA 2YYZA 4B3ML 4DV2Q 1VQ5A 4P74A 2NVTH 1LUZA 5BR8Q 4DR2L 1EIFA 3BU2A 1O7IA 1X3EA 3PUWA 5HY6A 4DR3L 1L1OA 1Y1VG 1OXTA 4BY1H 1MJCA 1L1OC 1JJ2A 2VQEL 3M7NA 2MQHA 3PO3H 5M5XH 4MNOA 4JI6Q 2ASBA 4P75A 4DR7Q 1UE6A 3G6EA 2CWPA 4ME3A 5GAHC 3TRZA 1QVGA 4JI0L 5C3EG 2NVYH 4QL5A 1B70B 1TXYA 2AWNA 1Y1WG 1J5EQ 4UY8C 4JI2L 1K83H 2QA4A 4NXMQ 4DUYL 1SROA 4X6AH 1NY4A 2ZM6L 4DV7Q 3RZOH 4DUZL 4YY3L 4JI4L 5IP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0O A;  3D0F A;  5ELN A;  1E1O A;  1V43 A;  2KHJ A;  4LNQ A;  4LF8 L;  4DNI A;  1T9H A;  2L15 A;  1OXS C;  5FLX c;  1LYL A;  2K52 A;  4APV A;  1EYG A;  3F2C A;  3PIO A;  4B3M Q;  4AYB E;  1K73 C;  4L5Q A;  1ASZ A;  4DR2 Q;  2K75 A;  1X3G A;  3BZK A;  2JA6 H;  4JI5 L;  1M1K C;  4DR3 Q;  1I50 H;  3H0G H;  2XGT A;  4YHH L;  1KD1 C;  3GO5 A;  2VQE Q;  2R7Z G;  4DR4 L;  4JG2 A;  2BH8 A;  1VS0 A;  3K7U C;  4J15 A;  4A3L H;  3S2D H;  3CCR A;  1YJ9 A;  1PH4 A;  4JI1 L;  2CQO A;  3PV0 A;  2JE6 I;  4JI0 Q;  5C4X H;  2OTL A;  3RN2 A;  4JI2 Q;  3STB D;  4QQB X;  5ELO A;  5IYD H;  3J80 i;  3RLF A;  4DUY Q;  4LUO A;  1G29 1;  3MXN B;  4HJA A;  2VNU D;  1HZC A;  2ZM6 Q;  2N78 A;  5FJ8 G;  5IYC G;  5C4J H;  4DUZ Q;  4LW1 A;  4YY3 Q;  1J6Q A;  3ULL A;  1UE5 A;  2UUC L;  4A3E H;  2PQA B;  4LF8 Q;  4JBK A;  1EOV A;  4BY1 G;  4BXX H;  1NE3 A;  4DV4 L;  1YEZ A;  4IFD I;  1SMX A;  2EQS A;  2MFI A;  1FGU A;  2B3G A;  2R92 H;  2F52 A;  1K9M C;  2I5H A;  4JI5 Q;  5IT9 c;  2E8G A;  1W3S A;  2QEX A;  3F2D A;  2IT1 A;  2HHH L;  3S1R H;  1LTL A;  4A3G H;  3T1Y L;  3PO2 H;  1Z47 A;  2MNA A;  1QUQ B;  5GRO A;  1K8G A;  4L5R C;  1K3R A;  2ATW A;  3HOU G;  1MIU A;  4JI1 Q;  4PZ7 A;  2A8V A;  2VY3 A;  4LF4 L;  3K81 C;  3H3V H;  1HZA A;  1YZ6 A;  3AFQ A;  3I4M G;  1GVP A;  4B3R L;  2V1C C;  1VQC A;  3S24 A;  1VQL A;  4DAY B;  3CCU A;  4HJ9 A;  2OTJ A;  2KCT A;  2HIX A;  3UDG A;  1KC8 C;  2JA9 A;  3HOY G;  2UU9 L;  1EFW A;  2JA8 G;  2JA6 G;  3ULP A;  2VUM H;  2VW9 A;  4PMW A;  1PH3 A;  5DLQ E;  1TWF H;  4DV4 Q;  1B8A A;  3UDF A;  4LF9 L;  4A3C H;  4KHP L;  4A3L G;  2OQK A;  5M3F G;  1IL2 A;  2I0Q A;  2GVA A;  2R6G A;  2R93 H;  2MO1 A;  2IHF A;  1W2B A;  5C4X G;  2NVQ H;  2HHH Q;  1OXV A;  5IY0 A;  5BR8 L;  1U0L A;  1KQS A;  4DPG A;  1HZB A;  5IYD G;  4IOC A;  1K0R A;  4H02 A;  3S14 H;  1WCM G;  2KEN A;  1RL2 A;  2CFM A;  3I2Z A;  4C2M H;  5M5W H;  3M85 A;  4B3S L;  2UXC Q;  1HNX L;  4OWX B;  4A93 H;  1EQR A;  1XNQ L;  3FHW A;  2OWO A;  4HJ8 A;  4GNX B;  1X65 A;  1VQ4 A;  4B3R Q;  3DLL A;  2LXJ A;  3EIV A;  4DV5 L;  4KI0 A;  4LFC L;  4NXM L;  4DR6 L;  2PQA A;  1PH2 A;  4LF6 Q;  1WI5 A;  1VQG A;  3U4Z A;  2DUD A;  4JI3 L;  4NPS A;  4OXP A;  4MZ9 A;  1NMG A;  2NZO A;  2UU9 Q;  5C0X G;  1A62 A;  1VQH A;  2E2I H;  4LFB Q;  1TWH H;  2VZA A;  5FLM G;  4A3G G;  3PO2 G;  2LXK A;  4LF9 Q;  5LMU L;  4KHP Q;  2RHQ B;  4A3K H;  1S72 A;  1JJG A;  4OX9 L;  2ZTE A;  3AQQ A;  2UXC L;  4K0K L;  5C0X J;  3TRE A;  2WB1 E;  5E7N A;  5IE8 A;  1YJN A;  2K4K A;  1NMF A;  4XTC S;  1VQO A;  2Q2H A;  4QIW E;  2Z6K A;  1Q1B A;  1WFQ A;  1Q8K A;  4UP9 A;  2JEB I;  3CCM A;  1VQE A;  2Z6K C;  4B3S Q;  1HNX Q;  4DR5 L;  4BBS H;  4BA2 I;  3PGZ A;  3VDY A;  1E7Z A;  3NEN A;  5JEA G;  1XNQ Q;  3AEV A;  2H5X A;  2VUM G;  3PUV A;  4A3M H;  4GKJ L;  1CSQ A;  4DV5 Q;  4LFC Q;  4OO1 G;  1AH9 A;  3I4O A;  4YWL A;  3G71 A;  4A3C G;  2R93 G;  1BKB A;  1WOC A;  4AIM A;  1PYB A;  1VQP A;  1XMO L;  4LUZ A;  3HOW H;  4JI3 Q;  1N34 L;  3S15 H;  2VS1 A;  4JBJ A;  1TWG H;  2ZTC A;  4P72 A;  4DR6 Q;  4R4T A;  5LMN W;  4LUV A;  2UXD L;  3OYY A;  1PFS A;  4NXN Q;  1A0I A;  1KHI A;  3S1N H;  1E22 A;  5LMU Q;  2NN6 G;  3I4N H;  2VL6 A;  1HNW L;  2N8N A;  4AYB G;  3SGI A;  4OX9 Q;  3J81 i;  1EUJ A;  2PMZ E;  1BBW A;  2F3I A;  2R7F A;  3M9B A;  4K0K Q;  1TWC H;  3KF6 B;  1XPO A;  4A3J G;  1YIJ A;  1WJJ A;  1X6O A;  3M4Q A;  1CKN B;  4BBR H;  3B6Y A;  3F2B A;  3CCS A;  2A1A A;  4DV0 L;  1OXX K;  4HID A;  4GNX A;  1VQ9 A;  1SN8 A;  5GAD C;  1PH1 A;  3RLO A;  4MTN A;  5K36 G;  4GNX C;  4DR5 Q;  2ZTD A;  1BBU A;  1Q1E A;  1I94 L;  4A3D H;  3S1M H;  1C9O A;  2XTI A;  2Y0S G;  3G48 A;  4YCW A;  3UE1 A;  5M3M H;  1A63 A;  3M3Y H;  4Y7N H;  4XIG S;  1UWV A;  2Y0S E;  1S40 A;  4GKJ Q;  3HOZ G;  1EWI A;  3CAM A;  2PI2 A;  2EIF A;  3E9H A;  4L5S A;  2AWO A;  2IX1 A;  1XMO Q;  3S16 H;  4A3K G;  4TQU S;  1SLJ A;  1N34 Q;  3GDE A;  3W1G A;  4X62 L;  3CPW A;  1NJI C;  3J7A 5;  3GTJ H;  2UXD Q;  1ASY A;  4JCV E;  2CCZ A;  2N3S A;  1Y14 B;  2D0P A;  3KDF B;  3PO3 G;  4X65 L;  3J7Z C;  1HNW Q;  2UUA L;  3EN2 A;  1HH2 P;  1IYJ B;  3S1Q H;  5JJL A;  2UXB L;  3GTG H;  1CKO A;  3RZD H;  1JMC A;  3PUZ A;  4YWM A;  3CCJ A;  1QVC A;  3STB C;  4A3M G;  3W5O A;  4HJ7 A;  1OXU A;  3PUX A;  4UP8 A;  1X55 A;  2ZJR A;  4DV0 Q;  1YIT A;  1XPR A;  4IPC A;  3PSI A;  4L5T A;  4DAM A;  3CCQ A;  2E2J H;  2B63 H;  1GKH A;  4RG1 A;  4LF7 L;  4X64 L;  5GQO A;  1I94 Q;  3S17 H;  4BY7 H;  2ID0 A;  3GTL H;  3RLN A;  4A3I H;  1N33 Q;  1JJC B;  1X56 A;  1YHA A;  4DV6 Q;  3PCO B;  4C3I H;  3WWV A;  3KFU A;  2BA1 A;  1VQJ A;  4LF6 L;  1D7Q A;  1TWA H;  4X62 Q;  4O0A A;  4R4I A;  3PF4 A;  1Z9F A;  4IO9 A;  3HOX H;  2ZJP A;  3JAM c;  4GLV B;  3H0G G;  4LFB L;  4HIK A;  1KAW A;  3LGJ A;  3M4P A;  4BBR G;  3KF6 A;  4X65 Q;  3PIP A;  2UUA Q;  3HOV H;  3IRB A;  4IFD G;  5GAG C;  2UXB Q;  3F8T A;  2NVX H;  1CKN A;  2K5N A;  4KLK A;  4R4O A;  3KJP A;  4YCU A;  1VQA A;  3TS0 A;  3A0J A;  1WYD A;  5HGQ A;  4LFA L;  2UUB L;  1X3F A;  5M3M G;  1VQN A;  1N32 L;  1FL0 A;  3KF8 B;  1JT8 A;  3A5Z B;  3K80 C;  5H1S E;  4DK3 C;  1GD7 A;  4UPA A;  2OCE A;  1KRT A;  4LF7 Q;  4X64 Q;  3E9I A;  1YVC A;  5C0X I;  1X54 A;  5C3E H;  2E5L L;  4IPD A;  4A3E G;  3I55 A;  3GTQ H;  1X9N A;  1PH6 A;  4BXX G;  4GKK L;  1HJP A;  4AH6 A;  2ZJQ A;  2GVB A;  3U4V A;  3KYH C;  2C35 B;  4DK6 C;  1IZ6 A;  2CKZ B;  4POG A;  3KDF A;  2R92 G;  1NBW A;  1D8L A;  1Q46 A;  2A19 A;  3AFP A;  2YTY A;  3DM3 A;  3KOJ A;  2MO0 A;  3FKI H;  4IPH A;  4R4Q A;  2JA5 H;  4A3B H;  3A74 A;  3K7A H;  1PH9 A;  4EQ5 A;  4NXN L;  1XMQ L;  1YBY A;  1DGS A;  1KL9 A;  1P16 A;  4GN5 A;  3BJU A;  4X66 L;  4ALP A;  1C7Y A;  2B63 G;  3D31 A;  4RMF A;  5C44 H;  4DV3 L;  1YNX A;  1R9T H;  4QJF A;  3A5U A;  1HZ9 A;  4LF5 L;  4LFA Q;  3J81 c;  5JJK A;  1QZG A;  2WB1 G;  4R1J A;  2UUB Q;  1N32 Q;  4B3T Q;  1CSP A;  2KHI A;  4O2D A;  1XJV A;  3ER0 A;  2WAQ G;  3S2H H;  4GN4 B;  4DR1 Q;  4OO1 I;  2WAQ E;  1Q86 C;  2Q2U A;  1KXL A;  5AJ3 L;  1P8L A;  3KJO A;  2E5L Q;  2B29 A;  4IOA A;  5GAE C;  2K5V A;  1M90 C;  4BA1 I;  2D62 A;  2K50 A;  3J80 c;  4GKK Q;  3ICE A;  3NBH B;  1QVF A;  3CW2 C;  1PH8 A;  1U5K A;  1YHQ A;  2VQF L;  5IYC H;  1BVS A;  4Y52 H;  1LM0 A;  3KLW A;  5JJI A;  2JA7 H;  4DV1 L;  2PI2 E;  1UEB A;  4KHZ A;  2KCM A;  5JEA J;  1XMQ Q;  1SRU A;  1GM5 A;  4X66 Q;  3CD6 A;  2YU9 H;  3CCL A;  2JK8 A;  2NZH A;  4DV3 Q;  2EXD A;  4A4I A;  1G51 A;  4POF A;  1IBK Q;  3H15 A;  4JV5 L;  4DKA C;  3CXC A;  2YV5 A;  3ULJ A;  4LF5 Q;  2N49 A;  4PG3 A;  3EBE A;  1IBM L;  3L2P A;  4A93 G;  1E3P A;  4HIM A;  3CME A;  1N8R C;  1YHB A;  1B7Y B;  1VQ6 A;  1A8V A;  2I5L X;  3CQZ H;  2AMC B;  4YCV A;  2ES2 A;  1PH5 A;  2HIV A;  4JYA L;  3HOU H;  5EAY A;  3T1H L;  1S3O A;  3PUY A;  1SR3 A;  4EX5 A;  1Q82 C;  2AKW B;  4PZ6 A;  1VQF A;  5AJ3 Q;  3TS2 A;  1PVO A;  4A3B G;  3FKI G;  3CP0 A;  1VQ8 A;  4OON A;  2E2H H;  4HJ5 A;  2JA5 G;  1N33 L;  3I4M H;  1SE8 A;  3NEL A;  3BZC A;  4DV6 L;  2IHE A;  4JI8 Q;  5IWA L;  2VQF Q;  4JI7 Q;  2PNH A;  1VQI A;  5C44 G;  1MKH A;  5IYB H;  2IY5 B;  3NEM A;  4DV1 Q;  2JQO A;  2ALY B;  1AE3 A;  3GTP H;  1KIX A;  3HOY H;  2JA8 H;  4WJ4 A;  3CCV A;  1H95 A;  2QGQ A;  1PYS B;  1EQQ A;  3HKS A;  1N36 L;  3U58 A;  4GLA C;  4A3F H;  1I5F A;  4JV5 Q;  5M3F H;  1VQB A;  1IBM Q;  4GS3 A;  4BBS G;  1RIP A;  1HNZ L;  1Q7Y C;  1HR0 W;  4P73 A;  3OTO L;  2WP8 J;  4GOP A;  3OW2 A;  1SFO H;  1N9W A;  1GO3 E;  4GOP C;  3GTO H;  4C3J H;  1WCM H;  4JYA Q;  3AYH B;  3T1H Q;  4FDB A;  3HOW G;  5LMN L;  4A76 A;  4JI4 Q;  2JA7 G;  3L7Z C;  2CWA A;  4JBW A;  1XPU A;  1OTC A;  1VCI A;  3GTK H;  1C0A A;  1FJG L;  5IWA Q;  3UDX A;  3CMA A;  3E0E A;  3U50 C;  3I4N G;  4JC0 A;  3I56 A;  3ZJY C;  4C3H H;  1Q81 C;  2DGY A;  2YTX A;  4GLX A;  4YHH Q;  3UE0 A;  1N36 Q;  5FLM H;  4PZ8 A;  4AQY L;  4DR4 Q;  1VQ7 A;  5IP7 H;  2I5M X;  3TEH B;  1I6H H;  2Q2T A;  2R7D A;  4TVA B;  1PA6 A;  2F4V L;  4UP7 A;  4WJ3 M;  3PF5 A;  2Q2I A;  2KBN A;  3UDI A;  1L1O B;  3CF5 A;  1HNZ Q;  1IBL L;  4NB3 A;  4A3D G;  1XNR L;  1JB7 A;  3OTO Q;  1Y1V H;  3G4S A;  4B3T L;  2RF4 A;  1V1Q A;  3MEF A;  3HFZ B;  4A75 A;  4IFD J;  5IYB G;  3M4O H;  4QY7 A;  2OQ0 A;  3TQY A;  5LMN Q;  1CKM A;  1E1T A;  2RCN A;  4DR1 L;  3CC7 A;  1JE5 A;  2IX0 A;  3K8A A;  5J3B A;  1K8A C;  4IJL A;  4IPG A;  4IJH A;  3J81 j;  1Y1W H;  2UUC Q;  1L0W A;  1UE1 A;  2HQL A;  1KRS A;  3RNU A;  1FJG Q;  1QZH A;  1IXR A;  2K5H A;  3CPF A;  4A3F G;  1G6P A;  1I3Q H;  1NTG A;  3I7F A;  4HIO A;  1Q12 A;  1HR0 L;  5IP9 H;  1CUK A;  4QGU A;  1EIY B;  4DV2 L;  3H3V I;  3CCE A;  2K14 A;  3FP9 A;  1YJW A;  1V9P A;  4AQY Q;  3T1Y Q;  4GN3 B;  1PHJ A;  1PV4 A;  2JJQ A;  2GN5 A;  2WFW A;  3RN5 A;  4JBM A;  2LSS A;  2F4V Q;  1IBK L;  1UE7 A;  4JI6 L;  4LWC A;  3JC6 6;  1FVI A;  3CC2 A;  4BY7 G;  4DR7 L;  1L2F A;  1IBL Q;  1VQM A;  4OWT B;  4LF4 Q;  2BA0 A;  4YWK A;  1XNR Q;  4A3I G;  2BH2 A;  4R4C A;  1J5E L;  3RR5 A;  4A3J H;  1YI2 A;  4OWW B;  1E24 A;  1AE2 A;  2YTV A;  1PH7 A;  2R7Z H;  3CC4 A;  3HKZ G;  1MJE A;  1VQK A;  3K0X A;  3HKZ E;  3GD7 A;  4DV7 L;  3W1B A;  4GOP B;  5M5Y H;  3F1Z A;  3HOX G;  4JOI A;  3JAM i;  1VQD A;  2RHS B;  3HOZ H;  4JOI C;  4P71 A;  2FXQ A;  2Z0S A;  2NN6 I;  1XTD A;  2AHO B;  5IP7 G;  2JEA I;  3Q8D A;  4JI8 L;  3GTM H;  3L0O A;  3ERS X;  4JI7 L;  2HT1 A;  5FJ8 H;  3HOV G;  1HR0 Q;  1QUQ A;  2YYZ A;  4B3M L;  4DV2 Q;  1VQ5 A;  4P74 A;  2NVT H;  1LUZ A;  5BR8 Q;  4DR2 L;  1EIF A;  3BU2 A;  1O7I A;  1X3E A;  3PUW A;  5HY6 A;  4DR3 L;  1L1O A;  1Y1V G;  1OXT A;  4BY1 H;  1MJC A;  1L1O C;  1JJ2 A;  2VQE L;  3M7N A;  2MQH A;  3PO3 H;  5M5X H;  4MNO A;  4JI6 Q;  2ASB A;  4P75 A;  4DR7 Q;  1UE6 A;  3G6E A;  2CWP A;  4ME3 A;  5GAH C;  3TRZ A;  1QVG A;  4JI0 L;  5C3E G;  2NVY H;  4QL5 A;  1B70 B;  1TXY A;  2AWN A;  1Y1W G;  1J5E Q;  4UY8 C;  4JI2 L;  1K83 H;  2QA4 A;  4NXM Q;  4DUY L;  1SRO A;  4X6A H;  1NY4 A;  2ZM6 L;  4DV7 Q;  3RZO H;  4DUZ L;  4YY3 L;  4JI4 L;  5IP9 G; 
#chains in the Genus database with same CATH topology
 1B50 A;  4LNQ A;  2L1B A;  5T1G A;  3LWE A;  1T9H A;  3FPP A;  4TKO B;  5FLX c;  1LYL A;  5G3L D;  1L0X B;  1XWE A;  4AYB E;  5I6W A;  1K73 C;  1M1K C;  1I50 H;  4YHH L;  1BDO A;  2LKV A;  1KD1 C;  3MTS A;  2R7Z G;  1VS0 A;  1YJ9 A;  1PH4 A;  5ELF A;  4JI1 L;  2CQO A;  2JE6 I;  2J4X A;  3RD4 A;  1F9S A;  1TWG B;  1KDA A;  4DUY Q;  4HJA A;  2VNU D;  1HZC A;  3TN2 A;  2N78 A;  5FLX E;  5IYC G;  5FJ8 G;  5C4J H;  4LW1 A;  2ZM6 Q;  4DUZ Q;  2AUK A;  1IW7 D;  3ULL A;  3DXJ C;  3C2P A;  2ICI A;  5KIX A;  4BXX H;  4RHS A;  4J8Q A;  4C1N K;  2L55 A;  2MFI A;  3J7A F;  1FGU A;  1ILP A;  2XWB B;  2I5H A;  4FXK C;  1EY7 A;  4C1N I;  2EY1 A;  2MNA A;  5M3M B;  5ELB A;  2A69 D;  1G8Z D;  1YZ6 A;  1JC7 A;  4B3R L;  3T53 B;  1VQC A;  3S24 A;  3HRZ C;  4HJ9 A;  1WTO A;  3UDG A;  1KC8 C;  2JA9 A;  3S1Q B;  2UU9 L;  3ULP A;  2VUM H;  4DV4 Q;  3MEH A;  3URY A;  3HGB A;  1IYV A;  2R6G A;  1CM9 A;  3TP6 A;  4OEL B;  1W2B A;  2NVQ H;  1KDC A;  5IY0 A;  4KY7 A;  2K01 A;  4DPG A;  3D4W A;  3GTL B;  1TS3 A;  3I4L A;  1GUG A;  2P5Z X;  3VYT A;  4B3S L;  1XNQ L;  1TWA B;  1VQ4 A;  2LXJ A;  3EIV A;  4KI0 A;  4LF6 Q;  1VQG A;  3U4Z A;  1H9S A;  1ML0 D;  3NQT A;  2EY2 A;  4DNR B;  5FLM G;  2LXK A;  5LMU L;  2XNA C;  1ICW A;  2NBF A;  1VMC A;  3T16 A;  4OX9 L;  2NTS A;  3I73 A;  3SK6 A;  3TZD A;  3T4A C;  1VQO A;  3OWE B;  2Z6K A;  3CCM A;  2JEB I;  2F0Q A;  1KAA A;  3K0Y A;  5KNC A;  4BBS H;  4BA2 I;  1JB3 A;  2VUM G;  4A3B B;  1S5F D;  4YWL A;  5JAV A;  2E74 C;  2L9H A;  1TS5 A;  4O1N A;  2VS1 A;  2IL8 A;  4DR6 Q;  1FYC A;  2M9V A;  4NW2 A;  3Q23 A;  3OYY A;  1ENF A;  1PFS A;  1E22 A;  4WJW A;  2N8N A;  1TT2 A;  3DEP A;  4U67 3;  3MA2 B;  2UXC Q;  4R8I A;  2F3I A;  4K0K Q;  1TWC H;  3S2H B;  4WOR A;  2HUG A;  1XPO A;  4BBR H;  3B6Y A;  2Z4H A;  2XWJ B;  1SXT A;  4TSS A;  1SBB B;  4N8X 1;  3MZ5 A;  2RDG A;  1Q1E A;  4A3D H;  3S1M H;  1STH A;  3M3Y H;  4XIG S;  2Y0S E;  1S40 A;  4GKJ Q;  3BDC A;  1EWI A;  1EEF D;  2IX1 A;  2AWO A;  3K6O A;  4BWG B;  1J8I A;  3GDE A;  4K6D A;  3IL8 A;  1NJI C;  1SYG A;  1XTC D;  3GTJ H;  4H13 C;  3KUP A;  4JCV E;  1HFN A;  1Y14 B;  3PO3 G;  3J7Z C;  3V96 A;  2UUA L;  1MGS A;  1JMC A;  3PUZ A;  2QEJ C;  1PZJ D;  3V05 A;  4HJ7 A;  2ZJR A;  4UP8 A;  2WIN B;  3BS1 A;  4Q5V A;  3CCQ A;  2E2J H;  4LF7 L;  4ZUI A;  5GQO A;  2ID0 A;  1STG A;  1QWY A;  1T5E A;  1VQJ A;  3PIO 3;  1D7Q A;  4RAU C;  1WTQ A;  4A3F B;  1EEI D;  3PF4 A;  1MHW C;  3JAM c;  4LFB L;  4BBR G;  4UAI A;  3PIP A;  4QMG A;  3IRB A;  3F8T A;  4YIJ A;  4KLK A;  2K5N A;  1SFO B;  4PMB A;  3F2U A;  3OHX C;  4YCU A;  3TS0 A;  4LFA L;  5HGQ A;  3G7L A;  1D5X C;  2F0O A;  3KF8 B;  3PQI A;  3SR1 A;  1JT8 A;  4PV1 C;  3A5Z B;  3K80 C;  4DK3 C;  1GD7 A;  3GTK B;  4ZLT F;  1TS4 A;  3I55 A;  1A2U A;  1X9N A;  4HTH A;  1Y8N B;  4AH6 A;  2ZJQ A;  2KEC A;  2K33 A;  3QOL A;  2F3W A;  2R92 G;  3MXP A;  4DK0 A;  1I6H B;  3DWQ A;  1STB A;  2A68 D;  3KOJ A;  3A74 A;  1PTO H;  1XMQ L;  4GZY C;  1YBY A;  1DGS A;  1C7Y A;  1GHK A;  2DJG C;  2SOB A;  3A5U A;  3J81 c;  3J7Y W;  4FVM A;  4ZAI A;  4B3T Q;  1WTW A;  1Y1W B;  3X3M A;  4DR1 Q;  1FD7 D;  4M1U B;  3CRK C;  2Q2U A;  1I3Q B;  5NUC A;  1SND A;  4GKK Q;  3J80 c;  4KV6 A;  3CW2 C;  1SE2 A;  2V4D A;  2JA7 H;  3J81 E;  1CK1 A;  1U4P A;  3U9O A;  3NTK A;  1SRU A;  1I4H A;  2QDL A;  2YU9 H;  1K3B C;  4JV5 L;  2J0T D;  4IUR A;  3EBE A;  3L2P A;  4A93 G;  1E3P A;  3BDL A;  1VMP A;  1O80 A;  2KQ3 A;  3VYR A;  1B7Y B;  1VF7 A;  1A8V A;  3KLS A;  4F88 A;  3A8I E;  3E6Z X;  1SMY C;  3HOU H;  1S3O A;  1HCZ A;  3BZD B;  1VQF A;  4O42 A;  3S9W A;  1N33 L;  3I4M H;  4OGQ C;  2NB0 A;  4EQP A;  4DV6 L;  2F0W A;  5IGE A;  1Q8I A;  1W6J A;  4DV1 Q;  3PO3 B;  3GTP H;  3C1F A;  4WJ4 A;  3CCV A;  2EYO A;  1N36 L;  3SK5 A;  2B2U C;  1VQB A;  1EWH A;  5FOB B;  1RIP A;  1EY9 A;  1JQY D;  1HR0 W;  4FF2 A;  4P73 A;  4GOP A;  1N9W A;  1GO3 E;  3GTO H;  4C3J H;  4FDB A;  1QE6 A;  3HOW G;  4A76 A;  3NBH A;  2JA7 G;  3L7Z C;  3MHB A;  4FYD A;  1S5C D;  4CDF C;  1JOO A;  4MIU A;  5I6Y A;  3PMF A;  5IWA Q;  1JE4 A;  1F2Z A;  5KRU A;  2EZV A;  3E0E A;  3I4N G;  1NR4 A;  1X32 A;  3VR6 A;  5CV9 A;  3TP7 A;  5C4X B;  5IP7 H;  2I5M X;  1U4M A;  4TVA B;  2CVR A;  1JIC A;  1Q90 A;  2LMC B;  4WJ3 M;  2DJF C;  3KLS X;  3VR2 A;  2F0G A;  1L1O B;  2TSS A;  3TDQ A;  1ET6 A;  4NB3 A;  4ZRZ A;  5E1F A;  4ID6 A;  2B39 A;  4A75 A;  3R8B A;  3M4O H;  3P7J A;  4QY7 A;  1ROD A;  1E1T A;  1JE5 A;  1BF4 A;  1TQO A;  4IPG A;  4LMQ D;  2R92 B;  3DMU A;  1D5M C;  4L6T B;  3HZX A;  2F0S A;  1NTG A;  3I7F A;  4QGU A;  1EIY B;  2RCF A;  2HCC A;  4GN3 B;  2J7Z A;  3NQI A;  4RA8 A;  4MTK A;  2O5I C;  3HS0 C;  4JBM A;  1IBK L;  1V1O A;  4BY7 G;  3L9A X;  3MXN A;  1IBL Q;  1SNM A;  1EOT A;  1F2Y A;  4QUC A;  2M2L A;  4R4C A;  4L8J A;  4OIJ A;  3CC4 A;  3HKZ G;  1AFP A;  1TWF B;  1DOL A;  1M4V A;  1EY6 A;  1BBX C;  4GOP B;  1G6Z A;  5M5Y H;  1JOR A;  4JOI C;  4P71 A;  2FXQ A;  2Z0S A;  1R4Q B;  5IP7 G;  2KCC A;  3GTM H;  5EKL A;  3HOV G;  3NWS A;  3NK9 A;  4DV2 Q;  2NVT H;  4P74 A;  1Z7T A;  2PMZ B;  3Q0A A;  4BY1 H;  4A93 B;  5M5X H;  4P75 A;  1F9R A;  4P2C B;  5CYU A;  4FF1 A;  2OXP A;  1TXY A;  4KN4 C;  3WOE A;  5IGB A;  1SE3 A;  1K83 H;  2L11 A;  2QA4 A;  1HA5 A;  4DUY L;  1TWH B;  1SRO A;  2ZM6 L;  1CQV A;  3RZO H;  4DUZ L;  2HD3 A;  4JI4 L;  3D0F A;  5IGG A;  2KHJ A;  3DHQ A;  2L15 A;  2QIL A;  1BCP C;  1C48 A;  4MHE A;  2L0C A;  2K52 A;  5A35 A;  4B3M Q;  4DR2 Q;  5ISR A;  2K75 A;  1X3G A;  1GUW A;  2JA6 H;  1LLR D;  3H0G H;  2XGT A;  4DR4 L;  2EPB A;  4DN4 M;  4JG2 A;  2BH8 A;  1K8O A;  3K5L A;  4A3M B;  1DJR D;  4ME5 A;  3CCR A;  3S2D H;  1QNU A;  1QCB D;  1EFI D;  4J6H A;  2SNS A;  3HOW B;  3S15 B;  4RHR A;  2F0K A;  4QQB X;  3MXN B;  1PMR A;  3A56 A;  4IUP A;  4YY3 Q;  2Z4I A;  3NWT A;  1J6Q A;  2X6L A;  3I4N B;  2ICE C;  1UE5 A;  2UUC L;  4LF8 Q;  4JBK A;  1EIG A;  4BY1 G;  1ZYR C;  4DV4 L;  1YEZ A;  4IFD I;  2EQS A;  4LK1 C;  1UAP A;  1PFM A;  2E8G A;  4A3G H;  1B44 D;  2A5H A;  1Z47 A;  3WDN A;  4Y7N B;  5I2X A;  2CH4 W;  1IW7 C;  5A2Q L;  3OPO A;  3SDZ A;  5L37 A;  2CW0 C;  3AFQ A;  3CCU A;  2F0F A;  3IFT A;  2OTJ A;  1A2T A;  3HOY G;  5JEA H;  1DYQ A;  1EFW A;  4EGV A;  2JA6 G;  2JA8 G;  3GTG B;  1PH3 A;  4PMW A;  3RZD B;  4U68 A;  4F7X A;  1B8A A;  3UDF A;  2R93 H;  2OQK A;  5M3F G;  1IL2 A;  2GVA A;  2IHF A;  1HUN A;  2B63 B;  2HHH Q;  1CI3 M;  5BR8 L;  4BY7 B;  1FGB D;  1HZB A;  1CZG A;  1RD9 D;  4LAA A;  3S14 H;  3A8K E;  4XQQ A;  2DY7 A;  4OHJ A;  1WCM G;  1DXM A;  4ZYS A;  1PFN A;  4C2M H;  4C3I B;  5M5W H;  3M85 A;  3HKZ B;  4ABN A;  1EQR A;  1BO0 A;  5I2Y A;  1BUV T;  3DLL A;  3EQL C;  5EPJ A;  3E5S A;  4NXM L;  3U9S A;  1L0Y B;  5K36 H;  2Q8I B;  2DUD A;  3QR8 A;  4C3H G;  4OXP A;  3HOV B;  1NMG A;  1B9N A;  3QWN A;  3AMU A;  1F2M A;  1VQH A;  2E2I H;  2NVX B;  3KBG A;  5J22 A;  1PRT C;  2PNR C;  4X3K A;  4A3G G;  1GJX A;  4LF9 Q;  4KHP Q;  2RHQ B;  4XXE A;  4A3K H;  3NSW A;  3OMC A;  4C56 C;  1EQT A;  1JJG A;  2UXC L;  3AQQ A;  1GUO A;  4KMU C;  4K0K L;  1EU3 A;  2WB1 E;  1OO9 B;  1YJN A;  4LJZ C;  1LO5 D;  2Q2H A;  4QIW E;  3CRL C;  4UP9 A;  3GTQ B;  1HNX Q;  3VDY A;  3AEV A;  1E7Z A;  5JEA G;  5COY A;  3HP3 A;  1LAC A;  3PUV A;  4MN3 A;  4GKJ L;  2RDH A;  4HMI A;  4DV5 Q;  5HUR A;  3FKI B;  2JA5 B;  2R93 G;  1BKB A;  4AIM A;  4JBJ A;  4P72 A;  5CBA E;  2QF7 A;  1EQV A;  2B8F A;  3A54 A;  4IAL A;  5AFW A;  4NXN Q;  5FLX L;  1TVX A;  3S1N H;  4CDE C;  2VL6 A;  3SGI A;  4K8J A;  1EUJ A;  2F0T A;  2VB3 X;  2E76 C;  5E4W C;  2B2W A;  4JPB W;  2K03 A;  3I72 A;  1CKN B;  1VDZ A;  2A1A A;  2KHS A;  4IFD H;  5GAD C;  1PH1 A;  4MTN A;  5K36 G;  4GNX C;  1EL0 A;  4DR5 Q;  3ERO A;  3MWY W;  4YCW A;  2Y0S G;  1A63 A;  1CTM A;  1VF5 C;  3CAM A;  3K5M A;  2O4X A;  3S16 H;  4L5S A;  1XMO Q;  4A3K G;  1SLJ A;  3EVQ A;  1N34 Q;  3NE5 B;  3W1G A;  2IWH A;  2HDL A;  2ZT9 C;  4N9P A;  1PDQ A;  5CV6 A;  3NTH A;  2CHB D;  2KVM A;  1ASY A;  2CCZ A;  2D0P A;  1HNW Q;  2RVL A;  1A3T A;  3CQZ B;  4CJ1 B;  4KKS A;  1QVC A;  3OIP A;  3STB C;  1OXU A;  3PUX A;  5FKA C;  1FR3 A;  4RH6 A;  4DV0 Q;  1YIT A;  4H7B A;  4CHT B;  4IPC A;  1XPR A;  4L5T A;  5JVH 3;  2E2H B;  2TMP A;  1GKH A;  3S17 H;  1I94 Q;  3EFX D;  4A3I H;  1PTO C;  1S5D D;  4ZKC B;  4DFA A;  1X56 A;  1YHA A;  2VB2 X;  3HOY B;  5EKK A;  2JA8 B;  3ZYY X;  2BA1 A;  3NP8 A;  1J9O A;  3HG9 A;  1DZ1 A;  1B3Q A;  2MP1 A;  5EQ0 A;  4EVO A;  4IO9 A;  5M3F B;  3HOX H;  4CKC A;  4HIK A;  1KAW A;  4KY5 A;  5EPL A;  4X65 Q;  4IFD G;  3NXW A;  5GAG C;  1CQF A;  1VQA A;  2HDM A;  1WCM B;  1RDP D;  1G2T A;  2F0D A;  3H6M A;  4XYQ A;  2RSN A;  2A6H D;  1YVC A;  5C0X I;  5C3E H;  1BXT A;  5IOD A;  3FRP B;  4C3H B;  2FIN B;  4HSV A;  3E3X A;  3SE0 A;  4BXX G;  4GKK L;  3KYH C;  2CKZ B;  1HHV A;  3AFP A;  4CKB A;  2MO0 A;  2NTT A;  4RWS C;  5CV4 A;  3SXH A;  5ELD A;  3K7A H;  4EQ5 A;  1PYW D;  4GN5 A;  4ALP A;  5C44 H;  2NWG A;  1R9T H;  1HZ9 A;  1EU4 A;  5JJK A;  1QZG A;  1B4O A;  4R1J A;  2F0I A;  1SYC A;  2WKD A;  1SAP A;  3MVV A;  5BN5 A;  4OO1 I;  2F0N A;  2WAQ E;  1Q86 C;  4DXG A;  2E5L Q;  5LL6 X;  2B29 A;  5C3X A;  1AEX A;  2B2T C;  3MC0 B;  5COR A;  1GOZ A;  1PH8 A;  1YHQ A;  1X3P A;  3M7G A;  4DV1 L;  4IUT A;  1BCP F;  5J1Z A;  1FNU A;  4RFB A;  2LS0 1;  1GM5 A;  3CD6 A;  3G6J B;  5DNF A;  3CCL A;  4DV3 Q;  1G51 A;  3KF8 A;  1PXU A;  3CXC A;  4LF5 Q;  2R7Z B;  2N49 A;  1SNQ A;  2EYH A;  1YHB A;  2I5L X;  1E2Z A;  4PMC A;  2Y0S B;  2ES2 A;  4XT1 B;  1H9M A;  5EAY A;  3PUY A;  1SJE D;  1SR3 A;  4EX5 A;  1Q82 C;  2AKW B;  5AJ3 Q;  3KLR A;  1PVO A;  3CP0 A;  4OL7 A;  2F0H A;  1F9Q A;  5IWA L;  4JI7 Q;  2PNH A;  5C44 G;  4QUF A;  5IYB H;  2IY5 B;  3VR5 A;  3IFD A;  3NPP A;  1AE3 A;  1TII D;  3MAQ A;  3H3V C;  5J39 A;  3GV6 A;  1H95 A;  1EQQ A;  1XXG A;  1HQM C;  2C9O A;  1EYA A;  3QB3 A;  1STY A;  1K8M A;  4JW0 A;  1IBM Q;  4GS3 A;  4BBS G;  3P75 A;  5JOB A;  2Q8R E;  3BYY B;  1TR5 A;  4F8M A;  2EY6 A;  1S5B D;  2B2V A;  2CH4 A;  3FEW X;  4JYA Q;  2XVS A;  3T1H Q;  1I4X A;  1LT4 D;  2EJG C;  2WKC A;  1BNZ A;  1NSN S;  4K5W A;  1OTC A;  1VCI A;  1KNE A;  1HPC A;  2F0M A;  5JVG 3;  3CMA A;  1I50 B;  5K5P A;  2DNE A;  3ZJY C;  2AQ3 B;  2DGY A;  5T1I A;  3JAM L;  1ZXT A;  5C0X H;  4F87 A;  4YHH Q;  1A6X A;  4B9X A;  2OEO A;  5JPM C;  4I7A A;  1KLG D;  1VQ7 A;  4FO2 A;  2Q2T A;  1ESF A;  1PA6 A;  3SEB A;  2Q2I A;  3UDI A;  4A3D G;  3CF5 A;  1IBL L;  5C4J B;  4L63 B;  2EE1 A;  3OTO Q;  1Y1V H;  4K2K A;  2B2Y C;  1FNV A;  5IYB G;  5LMN Q;  3TQY A;  2RCN A;  3CC7 A;  1E2V A;  1U4L A;  2IX0 A;  5J3B A;  3J81 j;  2NUC A;  4KK7 A;  1UE1 A;  1H9J A;  3RNU A;  1QZH A;  2K5H A;  4JVZ A;  5LHY 1;  2BDO A;  1IKM A;  1SNC A;  4XYO A;  2RKS A;  4KTA A;  1CUK A;  5IP9 H;  4DAP A;  1BCP B;  4OO1 H;  4DV2 L;  3H3V I;  1IYU A;  1PRT F;  4FXD A;  3FP9 A;  2F3V A;  1DCZ A;  3RN5 A;  1DOK A;  3J81 L;  4OEM B;  4YWK A;  1XNR Q;  2F4I A;  3RR5 A;  4A3J H;  1E24 A;  2YTV A;  2F03 A;  2VUM B;  2MHV A;  3GD7 A;  4K2L A;  3W1B A;  1YNJ C;  3F1Z A;  3JAM i;  3J80 L;  3PIP 3;  3HOZ H;  1LTG D;  2EVB A;  2K5W A;  2NVQ B;  1XTD A;  3ICE A;  4JI8 L;  3L0O A;  1EIH A;  1HR0 Q;  1QUQ A;  4B3M L;  1VQ5 A;  4DR2 L;  3QG1 A;  1L1O A;  1Y1V G;  2DN8 A;  1CA6 A;  3M7N A;  2PCF B;  4IUV A;  4K14 A;  2EJM A;  4MNO A;  4JI6 Q;  1UE6 A;  2RA4 A;  2CWP A;  5GAH C;  5IGD A;  1Y8P B;  1QVG A;  1SSO A;  2NVY H;  1B70 B;  2XRS D;  2D9U A;  2PQE A;  2XRQ D;  1M8A A;  5CR3 A;  1NY4 A;  5DEH A;  4X6A H;  4Z9C B;  3DEO A;  4ZKB B;  4YY3 L;  5IP9 G;  4OO1 G;  2D0O A;  5CV7 A;  5D65 A;  5ELN A;  5KGU A;  2FFK B;  3K57 A;  2FMM A;  4LF8 L;  4DNI A;  1JWS D;  4G7O C;  4PNY A;  2QDB A;  3TP5 A;  4L5Q A;  1ASZ A;  3BZK A;  4HN7 A;  4DR3 Q;  3D8G A;  4BBS B;  2BE5 C;  1GHJ A;  5FK9 C;  3K7U C;  4J15 A;  4CDC C;  4A3L H;  2ZXR A;  3PV0 A;  4JI0 Q;  2OTL A;  1NR2 A;  5CGK A;  5ELO A;  3J80 i;  1G29 1;  5C4H A;  2F0V A;  1PTO F;  1SJH D;  2H1E A;  4A3E H;  2PQA B;  4QB4 A;  1EOV A;  1TWC B;  4NKL A;  2R3Z A;  2PYK A;  1PRT B;  2F52 A;  4BBR B;  1WTH A;  1K9M C;  2F0L A;  1V1P B;  4JI5 Q;  5IT9 c;  3F2D A;  2HHH L;  2QEX A;  3S1R H;  3MXU A;  4A3D B;  3T1Y L;  3PO2 H;  3S1M B;  1QUQ B;  1EYC A;  5GRO A;  3M3Y B;  3W3A A;  4L5R C;  3HOU G;  4G7Z C;  2VY3 A;  1WTR A;  4LF4 L;  4QCL A;  3K81 C;  3H3V H;  3I4M G;  2V1C C;  4WRD A;  3BYT B;  2MPM A;  2Z6B A;  1VQL A;  3GTJ B;  4DAY B;  3ERQ A;  1LTS D;  5ELC A;  4NDX A;  1YNN D;  3OSO A;  5IT9 E;  4JK1 C;  5DLQ E;  3FVQ A;  4LF9 L;  4KHP L;  4A3L G;  1RCV D;  1Y69 U;  2MO1 A;  4HED A;  2E2J B;  1RF2 D;  4I7Z C;  1KQS A;  2MGS A;  4IOC A;  1Z6H A;  1K0R A;  4C3J G;  4RGT A;  2KEN A;  2CFM A;  1HNX L;  4OWX B;  3ITP A;  4CJ0 B;  2OWO A;  4GNX B;  1X65 A;  4DV5 L;  1G2S A;  1LTT D;  4R8N A;  3VA5 A;  3MFG A;  1SYF A;  2SNM A;  3O13 A;  2PW7 A;  4NPS A;  4UHV A;  4XQJ A;  1A62 A;  4K5V A;  4LFB Q;  4HCE A;  3PO2 G;  1LTI D;  1ZEQ X;  3KBX A;  1ET9 A;  2BCO A;  3H09 A;  3TRE A;  3NTI A;  5E7N A;  4XTC S;  1Q1B A;  1WFQ A;  1Q8K A;  3DWA A;  2Z6K C;  1O7Z A;  4KD4 A;  4DR5 L;  2K5Q A;  2K1B A;  3NEN A;  3WOF A;  2H5X A;  2XSC A;  1D1K A;  1DOM A;  4LFC Q;  3I4O A;  1SMY D;  3G71 A;  3A8J E;  1XMO L;  1PTO B;  1PYB A;  1VQP A;  4LUZ A;  4JI3 Q;  1N34 L;  5KNB A;  1D6E C;  1TWG H;  1I4R A;  2ZTC A;  1UNS A;  4RCO A;  4LUV A;  1QJO A;  1KHI A;  3R2T A;  1GXD C;  1HNW L;  4R9W A;  4AYB G;  2KUM A;  2PMZ E;  3M9B A;  2N55 A;  3KF6 B;  3K5N A;  4KKU A;  1WJJ A;  1X6O A;  3D3R A;  3F2B A;  4DV0 L;  4HID A;  5C3W A;  3RLO A;  3BVM A;  4DF7 A;  2ZTD A;  1LTR D;  2LFN A;  1I94 L;  2XTI A;  1B1Z A;  3QO2 A;  5M3M H;  1UWV A;  2JA7 B;  3HEJ A;  2EIF A;  2L5T A;  1PZI D;  2YU9 B;  3CPW A;  4N9T A;  5EGT A;  2UXD Q;  2Z1C A;  4X3T A;  3KDF B;  4X65 L;  1D1I A;  5JJL A;  3EN2 A;  1HH2 P;  1TY2 A;  3S1Q H;  5FO8 B;  2KEE A;  1HRJ A;  5LL6 S;  1E0B A;  1IKL A;  3T56 B;  5I4D A;  3HOU B;  3CCJ A;  1SDF A;  5JJZ A;  4ZQ3 A;  1X55 A;  3R93 A;  3I4M B;  3NUC A;  1I4P A;  4ZK9 B;  2D2C C;  3GTL H;  3RLN A;  2F0U A;  1N33 Q;  1JOQ A;  1JJC B;  3GTP B;  4DV6 Q;  1A15 A;  4LF6 L;  1TWA H;  4X62 Q;  2L12 A;  4R4I A;  2EXZ A;  2ZJP A;  4GLV B;  3H0G G;  2WAC A;  1EYD A;  2QKI C;  2UXB Q;  2A69 C;  3C46 A;  1CKN A;  3CHB D;  3QJY A;  3GTO B;  4C3J B;  1WYD A;  5ELE A;  1X3F A;  5M3M G;  2WV6 D;  1VQN A;  5CMD A;  4FP5 D;  4B9W A;  5H1S E;  4QF4 A;  2OCE A;  4X64 Q;  1V8Q A;  1X54 A;  2C5C A;  2E5L L;  3NBI A;  5CC4 A;  1KAB A;  1PH6 A;  1WVL A;  1HJP A;  4CKE A;  5BN4 A;  1SYE A;  1HTP A;  2C35 B;  4DK6 C;  1JCK B;  4POG A;  5C4Z A;  3DM3 A;  1D8L A;  4DR6 L;  1NNX A;  4A3B H;  4R4Q A;  1LV9 A;  1JOK A;  5I9O A;  5DAU A;  5A2Q E;  1KL9 A;  3BJU A;  3D31 A;  4RMF A;  4DV3 L;  1HA6 A;  4QJF A;  4LF5 L;  4DK1 A;  1RJT A;  2UUB Q;  1N32 Q;  3M4O B;  1XX8 A;  1AN8 A;  1ENA A;  1XJV A;  1STN A;  1AZQ A;  2WAQ G;  3S2H H;  2ZXP A;  4DU9 A;  1KXL A;  3IKJ A;  5AJ3 L;  1P8L A;  1NAP A;  2K5V A;  1M90 C;  4KY6 A;  2IPK D;  4OIK A;  4HCS A;  1QIL A;  3LNN A;  5IYC H;  1BVS A;  1LT5 D;  5DM7 3;  4Y52 H;  5FO7 B;  3BVZ A;  2XN9 C;  4KHZ A;  5JEA J;  4AYB B;  2Z9H A;  1GUT A;  4IUN A;  3RUZ A;  2K05 A;  1BCP D;  4X66 Q;  5IGF A;  2RDF A;  2NZH A;  1IBK Q;  1RKN A;  1EZ6 A;  1O78 A;  4DKA C;  2YV5 A;  3ULJ A;  1IBM L;  3L3O C;  4HIM A;  3CME A;  1N8R C;  1SNP A;  4HMJ A;  2AMC B;  5M5Y B;  1PH5 A;  2HIV A;  4JYA L;  4S3S A;  3T1H L;  1B2T A;  2H4O A;  1KNA A;  3GTM B;  3BG3 A;  3TS2 A;  4A3B G;  1WD1 A;  1SE8 A;  2PPB C;  3LWU A;  3NEL A;  2NVT B;  3BZC A;  2VQF Q;  1VQI A;  2E75 C;  4BY1 B;  3NEM A;  2ALY B;  4K5X A;  2PZW A;  5M5X B;  1KIX A;  1B53 A;  1PYS B;  2QGQ A;  3HKS A;  1ZYR D;  3U58 A;  3OWF A;  4ZCK A;  2B2U A;  1O7Y A;  4A3F H;  1K83 B;  2HQE A;  1KDB A;  4ULL A;  3QOJ A;  5JPN C;  2NZ1 D;  4DAV A;  2K6A A;  2K5D A;  3RZO B;  1Q7Y C;  3OTO L;  3OW2 A;  1SFO H;  2EYM A;  2FJ2 A;  4GOP C;  3FDT A;  2X6G A;  2F1M A;  5LMN L;  4JI4 Q;  2E2D C;  5EKI A;  3VYS A;  2CWA A;  4JBW A;  2CW0 D;  2EYJ A;  1T5X D;  1UEA B;  3GTK H;  1C0A A;  4HSP A;  3UDX A;  2JA6 B;  1UUP A;  3H0G B;  1H9R A;  4JC0 A;  4KD3 A;  3SK4 A;  1AP0 A;  3Q22 A;  2YTX A;  4XDX A;  3VA7 A;  4GLX A;  3S2D B;  3FMC A;  1JWM D;  2QW7 A;  3UE0 A;  1R4P B;  4PZ8 A;  5FLM H;  1CZW A;  4DR4 Q;  1I6H H;  5EPK A;  3PF5 A;  2KBN A;  3ND8 A;  1HNZ Q;  4H44 C;  1XNR L;  1JB7 A;  4B3T L;  3V2T A;  4IFD J;  1CKM A;  4DR1 L;  1E2W A;  1K8A C;  4IJL A;  1HUM A;  4IJH A;  5D14 A;  1Y1W H;  2UUC Q;  1KRS A;  1FJG Q;  1H9K A;  3CPF A;  4A3F G;  1G6P A;  1I3Q H;  1RTO A;  4A3G B;  3DWP A;  1HR0 L;  3RMH A;  1PRT D;  1V9P A;  4AQY Q;  1PV4 A;  5F2D A;  2F4V Q;  1LT3 D;  1UE7 A;  3E0J A;  4JI6 L;  2A6E D;  1FVI A;  3JC6 6;  4RGO S;  4V0B A;  3CC2 A;  1L2F A;  4OWT B;  2BA0 A;  2WAQ B;  3I3C A;  4A3I G;  1EY5 A;  2PO4 A;  1IHZ A;  2HCI A;  1YI2 A;  1PH7 A;  1AE2 A;  3K59 A;  1O7L A;  1F2L A;  2R93 B;  2A68 C;  3HOX G;  4JOI A;  1SYB A;  3TBI B;  2IX3 A;  2NN6 I;  2AHO B;  2JEA I;  3Q8D A;  3EJI A;  4H0L C;  2HT1 A;  3D4R A;  5CV8 A;  3S14 B;  2JN4 A;  5BR8 Q;  1O7I A;  4X3U A;  4C2M B;  5IOC A;  4DR3 L;  5M5W B;  1WD0 A;  4FF4 A;  1MJC A;  3PO3 H;  2MQH A;  4DR7 Q;  3TRZ A;  3CKI B;  1BR9 A;  3R3O A;  4JI0 L;  5C3E G;  4QL5 A;  1Y1W G;  2AWN A;  1J5E Q;  1W6K A;  3OOC A;  1TKW B;  4NXM Q;  2E2I B;  3MFY A;  4IN3 A;  4KKT A;  4CDD C;  2PZU A;  4PQX A;  3TME A;  4DV7 Q;  4A3K B;  1E1O A;  1V43 A;  1RHP A;  1JR0 D;  4RGN A;  5G3L F;  1OXS C;  3MXG A;  4APV A;  1EYG A;  3F2C A;  3PIO A;  1C8C A;  3AU7 A;  1AZP A;  4JI5 L;  1HFG A;  3H94 A;  3GO5 A;  2VQE Q;  3R2I A;  1TY0 A;  3UI2 A;  5C4X H;  3RN2 A;  3A7A B;  4JI2 Q;  3STB D;  3TSS A;  4KJN A;  5IYD H;  3RLF A;  2RSO A;  4LUO A;  2D5D A;  3S1N B;  3K58 A;  1PTO D;  3LX0 A;  3SHL A;  1NE3 A;  1H9S B;  1SMX A;  2K32 A;  1EWC A;  2B3G A;  3BDO A;  2R92 H;  1LT6 D;  1IL8 A;  4RKL A;  1W3S A;  2IT1 A;  1LTL A;  3VR3 A;  3FPU B;  1K8G A;  1K3R A;  3VYU A;  2ATW A;  1MIU A;  1EY8 A;  4JI1 Q;  4PZ7 A;  3S16 B;  1HZA A;  3D4D A;  3T13 A;  1GVP A;  4G57 A;  4K6L A;  4V19 0;  2VXW A;  1MSG A;  3W2D A;  4G4K A;  2KCT A;  2OT2 A;  2HIX A;  2VW9 A;  3NHH A;  1TWF H;  4FXG C;  2AUJ D;  4A3C H;  2I0Q A;  1RTN A;  1STE A;  2JP1 A;  5C4X G;  1OXV A;  1U0L A;  3S17 B;  5TSS A;  3I70 A;  1ESR A;  5IYD G;  1ILQ A;  4H02 A;  4A3I B;  2NN6 H;  5IGC A;  4KHV A;  1RL2 A;  3I2Z A;  3N6R A;  1F77 A;  5KND A;  4A93 H;  4N8F A;  2KED A;  5HGT A;  1YNN C;  3FHW A;  4B3R Q;  4HJ8 A;  1PLF A;  1B3A A;  3BVG A;  3JAM E;  1WTP A;  1Q3L A;  4LFC L;  3K5O A;  3A7L A;  2PQA A;  3P20 A;  1PH2 A;  3HOX B;  1WI5 A;  4J1M A;  4HR7 B;  2RQX A;  4JI3 L;  4MZ9 A;  2UU9 Q;  2NZO A;  5C0X G;  1TWH H;  2VZA A;  2X69 A;  1V1P A;  1KTK A;  2R61 A;  5C5L A;  2KJX A;  2JSO A;  1S72 A;  2SEB D;  1S4Z A;  3GV3 A;  5EBD A;  2ZTE A;  5EJW A;  1F9P A;  5C0X J;  3Q24 A;  3P1H A;  5IE8 A;  5C3E B;  2K4K A;  1LAB A;  1NMF A;  2EJF C;  1VQE A;  4B3S Q;  4DAY A;  4ZUJ A;  1MD2 D;  3M4Y A;  1GUN A;  3PGZ A;  1XNQ Q;  4RGM A;  4DXF A;  1CSQ A;  3AB9 A;  4A3M H;  1CT1 D;  1AH9 A;  4A3C G;  1WOC A;  2AQ2 B;  3K7A B;  3HOW H;  3S15 H;  1ZKO A;  1LTA D;  5C44 B;  1R9T B;  1QNK A;  4R4T A;  5LMN W;  2UXD L;  3IAY A;  1XYI A;  1NCV A;  1C4Q A;  2NYZ D;  1A0I A;  1PZK D;  4M8A A;  5LMU Q;  5M9O A;  1NUC A;  3DM1 A;  2NN6 G;  3I4N H;  1KLU D;  5C5M A;  3VR4 A;  4WFN 3;  3J81 i;  4OX9 Q;  2R7F A;  1BBW A;  2F0P A;  3A55 A;  2JXM B;  1X3Q A;  2B2W C;  4A3J G;  1YIJ A;  3M4Q A;  3CCS A;  1VQ9 A;  3J80 E;  1OXX K;  4GNX A;  1HXY D;  1SN8 A;  2K28 A;  1BBU A;  3OMG A;  1C9O A;  1I4Q A;  3G48 A;  2N88 A;  3UE1 A;  4Y7N H;  3HOZ G;  1EY0 A;  2EOT A;  1STA A;  1U9R A;  2PI2 A;  3E9H A;  5D3I B;  4TQU S;  4X62 L;  3J7A 5;  3I91 A;  1II3 A;  1G91 A;  3H91 A;  2N3S A;  2SDF A;  4NMZ A;  3OIQ A;  3OW7 A;  2KCN A;  1IYJ B;  2UXB L;  3GTG H;  1HQR D;  2G9H D;  1CKO A;  4G7H C;  1CHQ D;  3RZD H;  4FNF A;  5IT9 L;  1DM0 B;  1QB5 D;  5E4X A;  4YWM A;  1JWU D;  2L4N A;  4A3M G;  3W5O A;  4UDU C;  2B63 H;  3PSI A;  4DAM A;  4IZ8 A;  2QCP X;  4RG1 A;  4BY7 H;  4X64 L;  3I90 A;  2M00 A;  3PCO B;  1TU2 B;  3WWV A;  4C3I H;  4CJ2 C;  3KFU A;  3SK8 A;  2EY5 A;  4O0A A;  1Z9F A;  1WTX A;  1DON A;  3LGJ A;  3M4P A;  2EYL A;  3KF6 A;  2UUA Q;  5FO9 B;  3HOV H;  2NVX H;  4R4O A;  4NP5 A;  3KJP A;  3A0J A;  2UUB L;  4DNT B;  1N32 L;  1FL0 A;  4KJO A;  4UPA A;  1KRT A;  4LF7 Q;  1GUS A;  2OF1 A;  3QIA A;  4XT3 B;  3C3L A;  2O5J C;  3E9I A;  5EBC A;  1CHP D;  5CBE E;  1SE4 A;  5C6A A;  4IPD A;  4A3E G;  3GTQ H;  2IJ0 A;  2GVB A;  3U4V A;  1MBY A;  2GA4 B;  1IZ6 A;  1TS2 A;  3KDF A;  3TP8 A;  4EQN A;  1YNJ D;  1A3V A;  4Q0F A;  1NBW A;  1Q46 A;  2A19 A;  2A8V A;  2YTY A;  5I9P A;  1K28 A;  3FKI H;  4IPH A;  2JA5 H;  1PH9 A;  4NXN L;  3X3N A;  2RBM A;  3TZU A;  1P16 A;  4X66 L;  2MJ8 A;  2B63 G;  1QG7 A;  1YNX A;  1Y1V B;  4E6I A;  4LFA Q;  1FNW A;  2WB1 G;  1Y8O B;  2DY8 A;  1CSP A;  1ENC A;  2KHI A;  4O2D A;  4C3I G;  3ER0 A;  3Q6S A;  4GN4 B;  1SYD A;  3ND9 A;  4DA2 A;  2B2T A;  3KJO A;  1CFM A;  4IOA A;  2EYF A;  5GAE C;  2XIW A;  1A3U A;  4BA1 I;  2D62 A;  2K50 A;  3NBH B;  1QVF A;  1U5K A;  2VQF L;  1LM0 A;  3KLW A;  5JJI A;  2PI2 E;  4IUQ A;  1UEB A;  4B08 A;  1S5E D;  2KCM A;  1PFB A;  1XMQ Q;  1U4R A;  3DUZ A;  2JK8 A;  2EXD A;  4A4I A;  2I07 B;  4POF A;  3H15 A;  4A3J B;  2PZT A;  4PG3 A;  2IW3 A;  5D3D A;  1ICF B;  1B9M A;  1VQ6 A;  1DD2 A;  2Q8T A;  2BE5 D;  1ONL A;  3CQZ H;  4ILW A;  5DM6 3;  4YCV A;  1I6V C;  3HOZ B;  1LTB D;  5IIF A;  4PZ6 A;  3GP7 A;  4RCN A;  3FKI G;  1VQ8 A;  2E2H H;  4OON A;  2JA5 G;  4HJ5 A;  2ZXO A;  4DGZ A;  2IHE A;  4JI8 Q;  2G5D A;  1MKH A;  3N52 A;  3KK7 A;  1BOS A;  2EDG A;  2JQO A;  3HOY H;  2JA8 H;  2MUY A;  4GLA C;  2NVY B;  5KYL A;  1I5F A;  4JV5 Q;  4HAE A;  5M3F H;  2LY7 A;  5E3F A;  3C1E A;  1MSH A;  3I8Z A;  1HNZ L;  1AW7 A;  4CGY B;  2WP8 J;  1D5Z C;  1QOH A;  2B2V C;  1WCM H;  3AYH B;  1WTV A;  1XPU A;  2WII B;  2JYO A;  1FJG L;  3U50 C;  3I56 A;  4C3H H;  1SEB D;  1Q81 C;  4CBV A;  4BS9 A;  2K04 A;  4K8I A;  1N36 Q;  2FHT A;  2BDN A;  4KN7 C;  4AQY L;  2O2L D;  3TEH B;  2EYP A;  4IUU A;  2R7D A;  2F4V L;  4UP7 A;  2G9D A;  1MI2 A;  1D2B A;  2DNC A;  3G4S A;  2B2Y A;  2BOS A;  2RF4 A;  1V1Q A;  3MEF A;  3HFZ B;  4A3E B;  2CQA A;  2OQ0 A;  2F0J A;  4ODG A;  3K8A A;  1L0W A;  2HQL A;  2K7V A;  1HTL D;  2PW5 A;  1IXR A;  3D6C A;  2B8G A;  3S1R B;  4HIO A;  1Q12 A;  3PO2 B;  4EQO A;  1I4G A;  4RKB A;  3EA6 A;  1CA5 A;  3CCE A;  2K14 A;  4TRD A;  1YJW A;  1PHJ A;  3T1Y Q;  2Z8L A;  2WB1 B;  3CU7 A;  1BQQ T;  2GN5 A;  2AQ1 B;  2JJQ A;  2WFW A;  2LSS A;  4X3S A;  4XQN A;  5CV5 A;  4LWC A;  2KOL A;  4QIW B;  2A6H C;  4DR7 L;  2FMC A;  1VQM A;  4LF4 Q;  5BN3 A;  3SVM A;  2BH2 A;  3J7A V;  1J5E L;  4OWW B;  2R7Z H;  2A73 B;  3T51 B;  1VQK A;  1MJE A;  3K0X A;  3HKZ E;  4DV7 L;  1EZ8 A;  2KA7 A;  3D6W A;  1VQD A;  2RHS B;  2A74 C;  4FF3 A;  3ERS X;  4JI7 L;  5FJ8 H;  2A6E C;  2YYZ A;  1LUZ A;  1EY4 A;  1EIF A;  4I65 A;  3BU2 A;  1SNO A;  5HY6 A;  1X3E A;  3PUW A;  1OXT A;  1JJ2 A;  1L1O C;  2F0E A;  2VQE L;  2ASB A;  5KYI A;  3G6E A;  4ME3 A;  3ONA B;  4IQZ A;  2ENB A;  4UY8 C;  4JI2 L;  5KEE A;  1K0S A;  2I46 A;  3GQB A; 
#chains in the Genus database with same CATH homology
 2D0O A;  3D0F A;  5ELN A;  1E1O A;  1V43 A;  2KHJ A;  4LNQ A;  4LF8 L;  4DNI A;  1T9H A;  2L15 A;  1OXS C;  5FLX c;  1LYL A;  2K52 A;  4APV A;  1EYG A;  3F2C A;  3PIO A;  4B3M Q;  4AYB E;  1K73 C;  4L5Q A;  1ASZ A;  4DR2 Q;  2K75 A;  1X3G A;  3BZK A;  2JA6 H;  4JI5 L;  1M1K C;  4DR3 Q;  1I50 H;  3H0G H;  2XGT A;  4YHH L;  1KD1 C;  3GO5 A;  2VQE Q;  2R7Z G;  4DR4 L;  4JG2 A;  2BH8 A;  1VS0 A;  3K7U C;  4J15 A;  4A3L H;  3S2D H;  3CCR A;  1YJ9 A;  1PH4 A;  4JI1 L;  2CQO A;  3PV0 A;  2JE6 I;  4JI0 Q;  5C4X H;  2OTL A;  3RN2 A;  4JI2 Q;  3STB D;  4QQB X;  5ELO A;  5IYD H;  3J80 i;  3RLF A;  4DUY Q;  4LUO A;  1G29 1;  3MXN B;  4HJA A;  2VNU D;  1HZC A;  2ZM6 Q;  2N78 A;  5FJ8 G;  5IYC G;  5C4J H;  4DUZ Q;  4LW1 A;  4YY3 Q;  1J6Q A;  3ULL A;  1UE5 A;  2UUC L;  4A3E H;  2PQA B;  4LF8 Q;  4JBK A;  1EOV A;  4BY1 G;  4BXX H;  1NE3 A;  4DV4 L;  1YEZ A;  4IFD I;  1SMX A;  2EQS A;  2MFI A;  1FGU A;  2B3G A;  2R92 H;  2F52 A;  1K9M C;  2I5H A;  4JI5 Q;  5IT9 c;  2E8G A;  1W3S A;  2QEX A;  3F2D A;  2IT1 A;  2HHH L;  3S1R H;  1LTL A;  4A3G H;  3T1Y L;  3PO2 H;  1Z47 A;  2MNA A;  1QUQ B;  5GRO A;  1K8G A;  4L5R C;  1K3R A;  2ATW A;  3HOU G;  1MIU A;  4JI1 Q;  4PZ7 A;  2A8V A;  2VY3 A;  4LF4 L;  3K81 C;  3H3V H;  1HZA A;  1YZ6 A;  3AFQ A;  3I4M G;  1GVP A;  4B3R L;  2V1C C;  1VQC A;  3S24 A;  1VQL A;  4DAY B;  3CCU A;  4HJ9 A;  2OTJ A;  2KCT A;  2HIX A;  3UDG A;  1KC8 C;  2JA9 A;  3HOY G;  2UU9 L;  1EFW A;  2JA8 G;  2JA6 G;  3ULP A;  2VUM H;  2VW9 A;  4PMW A;  1PH3 A;  5DLQ E;  1TWF H;  4DV4 Q;  1B8A A;  3UDF A;  4LF9 L;  4A3C H;  4KHP L;  4A3L G;  2OQK A;  5M3F G;  1IL2 A;  2I0Q A;  2GVA A;  2R6G A;  2R93 H;  2MO1 A;  2IHF A;  1W2B A;  5C4X G;  2NVQ H;  2HHH Q;  1OXV A;  5IY0 A;  5BR8 L;  1U0L A;  1KQS A;  4DPG A;  1HZB A;  5IYD G;  4IOC A;  1K0R A;  4H02 A;  3S14 H;  1WCM G;  2KEN A;  1RL2 A;  2CFM A;  3I2Z A;  4C2M H;  5M5W H;  3M85 A;  4B3S L;  2UXC Q;  1HNX L;  4OWX B;  4A93 H;  1EQR A;  1XNQ L;  3FHW A;  2OWO A;  4HJ8 A;  4GNX B;  1X65 A;  1VQ4 A;  4B3R Q;  3DLL A;  2LXJ A;  3EIV A;  4DV5 L;  4KI0 A;  4LFC L;  4NXM L;  4DR6 L;  2PQA A;  1PH2 A;  4LF6 Q;  1WI5 A;  1VQG A;  3U4Z A;  2DUD A;  4JI3 L;  4NPS A;  4OXP A;  4MZ9 A;  1NMG A;  2NZO A;  2UU9 Q;  5C0X G;  1A62 A;  1VQH A;  2E2I H;  4LFB Q;  1TWH H;  2VZA A;  5FLM G;  4A3G G;  3PO2 G;  2LXK A;  4LF9 Q;  5LMU L;  4KHP Q;  2RHQ B;  4A3K H;  1S72 A;  1JJG A;  4OX9 L;  2ZTE A;  3AQQ A;  2UXC L;  4K0K L;  5C0X J;  3TRE A;  2WB1 E;  5E7N A;  5IE8 A;  1YJN A;  2K4K A;  1NMF A;  4XTC S;  1VQO A;  2Q2H A;  4QIW E;  2Z6K A;  1Q1B A;  1WFQ A;  1Q8K A;  4UP9 A;  2JEB I;  3CCM A;  1VQE A;  2Z6K C;  4B3S Q;  1HNX Q;  4DR5 L;  4BBS H;  4BA2 I;  3PGZ A;  3VDY A;  1E7Z A;  3NEN A;  5JEA G;  1XNQ Q;  3AEV A;  2H5X A;  2VUM G;  3PUV A;  4A3M H;  4GKJ L;  1CSQ A;  4DV5 Q;  4LFC Q;  4OO1 G;  1AH9 A;  3I4O A;  4YWL A;  3G71 A;  4A3C G;  2R93 G;  1BKB A;  1WOC A;  4AIM A;  1PYB A;  1VQP A;  1XMO L;  4LUZ A;  3HOW H;  4JI3 Q;  1N34 L;  3S15 H;  2VS1 A;  4JBJ A;  1TWG H;  2ZTC A;  4P72 A;  4DR6 Q;  4R4T A;  5LMN W;  4LUV A;  2UXD L;  3OYY A;  1PFS A;  4NXN Q;  1A0I A;  1KHI A;  3S1N H;  1E22 A;  5LMU Q;  2NN6 G;  3I4N H;  2VL6 A;  1HNW L;  2N8N A;  4AYB G;  3SGI A;  4OX9 Q;  3J81 i;  1EUJ A;  2PMZ E;  1BBW A;  2F3I A;  2R7F A;  3M9B A;  4K0K Q;  1TWC H;  3KF6 B;  1XPO A;  4A3J G;  1YIJ A;  1WJJ A;  1X6O A;  3M4Q A;  1CKN B;  4BBR H;  3B6Y A;  3F2B A;  3CCS A;  2A1A A;  4DV0 L;  1OXX K;  4HID A;  4GNX A;  1VQ9 A;  1SN8 A;  5GAD C;  1PH1 A;  3RLO A;  4MTN A;  5K36 G;  4GNX C;  4DR5 Q;  2ZTD A;  1BBU A;  1Q1E A;  1I94 L;  4A3D H;  3S1M H;  1C9O A;  2XTI A;  2Y0S G;  3G48 A;  4YCW A;  3UE1 A;  5M3M H;  1A63 A;  3M3Y H;  4Y7N H;  4XIG S;  1UWV A;  2Y0S E;  1S40 A;  4GKJ Q;  3HOZ G;  1EWI A;  3CAM A;  2PI2 A;  2EIF A;  3E9H A;  4L5S A;  2AWO A;  2IX1 A;  1XMO Q;  3S16 H;  4A3K G;  4TQU S;  1SLJ A;  1N34 Q;  3GDE A;  3W1G A;  4X62 L;  3CPW A;  1NJI C;  3J7A 5;  3GTJ H;  2UXD Q;  1ASY A;  4JCV E;  2CCZ A;  2N3S A;  1Y14 B;  2D0P A;  3KDF B;  3PO3 G;  4X65 L;  3J7Z C;  1HNW Q;  2UUA L;  3EN2 A;  1HH2 P;  1IYJ B;  3S1Q H;  5JJL A;  2UXB L;  3GTG H;  1CKO A;  3RZD H;  1JMC A;  3PUZ A;  4YWM A;  3CCJ A;  1QVC A;  3STB C;  4A3M G;  3W5O A;  4HJ7 A;  1OXU A;  3PUX A;  4UP8 A;  1X55 A;  2ZJR A;  4DV0 Q;  1YIT A;  1XPR A;  4IPC A;  3PSI A;  4L5T A;  4DAM A;  3CCQ A;  2E2J H;  2B63 H;  1GKH A;  4RG1 A;  4LF7 L;  4X64 L;  5GQO A;  1I94 Q;  3S17 H;  4BY7 H;  2ID0 A;  3GTL H;  3RLN A;  4A3I H;  1N33 Q;  1JJC B;  1X56 A;  1YHA A;  4DV6 Q;  3PCO B;  4C3I H;  3WWV A;  3KFU A;  2BA1 A;  1VQJ A;  4LF6 L;  1D7Q A;  1TWA H;  4X62 Q;  4O0A A;  4R4I A;  3PF4 A;  1Z9F A;  4IO9 A;  3HOX H;  2ZJP A;  3JAM c;  4GLV B;  3H0G G;  4LFB L;  4HIK A;  1KAW A;  3LGJ A;  3M4P A;  4BBR G;  3KF6 A;  4X65 Q;  3PIP A;  2UUA Q;  3HOV H;  3IRB A;  4IFD G;  5GAG C;  2UXB Q;  3F8T A;  2NVX H;  1CKN A;  2K5N A;  4KLK A;  4R4O A;  3KJP A;  4YCU A;  1VQA A;  3TS0 A;  3A0J A;  1WYD A;  5HGQ A;  4LFA L;  2UUB L;  1X3F A;  5M3M G;  1VQN A;  1N32 L;  1FL0 A;  3KF8 B;  1JT8 A;  3A5Z B;  3K80 C;  5H1S E;  4DK3 C;  1GD7 A;  4UPA A;  2OCE A;  1KRT A;  4LF7 Q;  4X64 Q;  3E9I A;  1YVC A;  5C0X I;  1X54 A;  5C3E H;  2E5L L;  4IPD A;  4A3E G;  3I55 A;  3GTQ H;  1X9N A;  1PH6 A;  4BXX G;  4GKK L;  1HJP A;  4AH6 A;  2ZJQ A;  2GVB A;  3U4V A;  3KYH C;  2C35 B;  4DK6 C;  1IZ6 A;  2CKZ B;  4POG A;  3KDF A;  2R92 G;  1NBW A;  1D8L A;  1Q46 A;  2A19 A;  3AFP A;  2YTY A;  3DM3 A;  3KOJ A;  2MO0 A;  3FKI H;  4IPH A;  4R4Q A;  2JA5 H;  4A3B H;  3A74 A;  3K7A H;  1PH9 A;  4EQ5 A;  4NXN L;  1XMQ L;  1YBY A;  1DGS A;  1KL9 A;  1P16 A;  4GN5 A;  3BJU A;  4X66 L;  4ALP A;  1C7Y A;  2B63 G;  3D31 A;  4RMF A;  5C44 H;  4DV3 L;  1YNX A;  1R9T H;  4QJF A;  3A5U A;  1HZ9 A;  4LF5 L;  4LFA Q;  3J81 c;  5JJK A;  1QZG A;  2WB1 G;  4R1J A;  2UUB Q;  1N32 Q;  4B3T Q;  1CSP A;  2KHI A;  4O2D A;  1XJV A;  3ER0 A;  2WAQ G;  3S2H H;  4GN4 B;  4DR1 Q;  4OO1 I;  2WAQ E;  1Q86 C;  2Q2U A;  1KXL A;  5AJ3 L;  1P8L A;  3KJO A;  2E5L Q;  2B29 A;  4IOA A;  5GAE C;  2K5V A;  1M90 C;  4BA1 I;  2D62 A;  2K50 A;  3J80 c;  4GKK Q;  3ICE A;  3NBH B;  1QVF A;  3CW2 C;  1PH8 A;  1U5K A;  1YHQ A;  2VQF L;  5IYC H;  1BVS A;  4Y52 H;  1LM0 A;  3KLW A;  5JJI A;  2JA7 H;  4DV1 L;  2PI2 E;  1UEB A;  4KHZ A;  2KCM A;  5JEA J;  1XMQ Q;  1SRU A;  1GM5 A;  4X66 Q;  3CD6 A;  2YU9 H;  3CCL A;  2JK8 A;  2NZH A;  4DV3 Q;  2EXD A;  4A4I A;  1G51 A;  4POF A;  1IBK Q;  3H15 A;  4JV5 L;  4DKA C;  3CXC A;  2YV5 A;  3ULJ A;  4LF5 Q;  2N49 A;  4PG3 A;  3EBE A;  1IBM L;  3L2P A;  4A93 G;  1E3P A;  4HIM A;  3CME A;  1N8R C;  1YHB A;  1B7Y B;  1VQ6 A;  1A8V A;  2I5L X;  3CQZ H;  2AMC B;  4YCV A;  2ES2 A;  1PH5 A;  2HIV A;  4JYA L;  3HOU H;  5EAY A;  3T1H L;  1S3O A;  3PUY A;  1SR3 A;  4EX5 A;  1Q82 C;  2AKW B;  4PZ6 A;  1VQF A;  5AJ3 Q;  3TS2 A;  1PVO A;  4A3B G;  3FKI G;  3CP0 A;  1VQ8 A;  4OON A;  2E2H H;  4HJ5 A;  2JA5 G;  1N33 L;  3I4M H;  1SE8 A;  3NEL A;  3BZC A;  4DV6 L;  2IHE A;  4JI8 Q;  5IWA L;  2VQF Q;  4JI7 Q;  2PNH A;  1VQI A;  5C44 G;  1MKH A;  5IYB H;  2IY5 B;  3NEM A;  4DV1 Q;  2JQO A;  2ALY B;  1AE3 A;  3GTP H;  1KIX A;  3HOY H;  2JA8 H;  4WJ4 A;  3CCV A;  1H95 A;  2QGQ A;  1PYS B;  1EQQ A;  3HKS A;  1N36 L;  3U58 A;  4GLA C;  4A3F H;  1I5F A;  4JV5 Q;  5M3F H;  1VQB A;  1IBM Q;  4GS3 A;  4BBS G;  1RIP A;  1HNZ L;  1Q7Y C;  1HR0 W;  4P73 A;  3OTO L;  2WP8 J;  4GOP A;  3OW2 A;  1SFO H;  1N9W A;  1GO3 E;  4GOP C;  3GTO H;  4C3J H;  1WCM H;  4JYA Q;  3AYH B;  3T1H Q;  4FDB A;  3HOW G;  5LMN L;  4A76 A;  4JI4 Q;  2JA7 G;  3L7Z C;  2CWA A;  4JBW A;  1XPU A;  1OTC A;  1VCI A;  3GTK H;  1C0A A;  1FJG L;  5IWA Q;  3UDX A;  3CMA A;  3E0E A;  3U50 C;  3I4N G;  4JC0 A;  3I56 A;  3ZJY C;  4C3H H;  1Q81 C;  2DGY A;  2YTX A;  4GLX A;  4YHH Q;  3UE0 A;  1N36 Q;  5FLM H;  4PZ8 A;  4AQY L;  4DR4 Q;  1VQ7 A;  5IP7 H;  2I5M X;  3TEH B;  1I6H H;  2Q2T A;  2R7D A;  4TVA B;  1PA6 A;  2F4V L;  4UP7 A;  4WJ3 M;  3PF5 A;  2Q2I A;  2KBN A;  3UDI A;  1L1O B;  3CF5 A;  1HNZ Q;  1IBL L;  4NB3 A;  4A3D G;  1XNR L;  1JB7 A;  3OTO Q;  1Y1V H;  3G4S A;  4B3T L;  2RF4 A;  1V1Q A;  3MEF A;  3HFZ B;  4A75 A;  4IFD J;  5IYB G;  3M4O H;  4QY7 A;  2OQ0 A;  3TQY A;  5LMN Q;  1CKM A;  1E1T A;  2RCN A;  4DR1 L;  3CC7 A;  1JE5 A;  2IX0 A;  3K8A A;  5J3B A;  1K8A C;  4IJL A;  4IPG A;  4IJH A;  3J81 j;  1Y1W H;  2UUC Q;  1L0W A;  1UE1 A;  2HQL A;  1KRS A;  3RNU A;  1FJG Q;  1QZH A;  1IXR A;  2K5H A;  3CPF A;  4A3F G;  1G6P A;  1I3Q H;  1NTG A;  3I7F A;  4HIO A;  1Q12 A;  1HR0 L;  5IP9 H;  1CUK A;  4QGU A;  1EIY B;  4DV2 L;  3H3V I;  3CCE A;  2K14 A;  3FP9 A;  1YJW A;  1V9P A;  4AQY Q;  3T1Y Q;  4GN3 B;  1PHJ A;  1PV4 A;  2JJQ A;  2GN5 A;  2WFW A;  3RN5 A;  4JBM A;  2LSS A;  2F4V Q;  1IBK L;  1UE7 A;  4JI6 L;  4LWC A;  3JC6 6;  1FVI A;  3CC2 A;  4BY7 G;  4DR7 L;  1L2F A;  1IBL Q;  1VQM A;  4OWT B;  4LF4 Q;  2BA0 A;  4YWK A;  1XNR Q;  4A3I G;  2BH2 A;  4R4C A;  1J5E L;  3RR5 A;  4A3J H;  1YI2 A;  4OWW B;  1E24 A;  1AE2 A;  2YTV A;  1PH7 A;  2R7Z H;  3CC4 A;  3HKZ G;  1MJE A;  1VQK A;  3K0X A;  3HKZ E;  3GD7 A;  4DV7 L;  3W1B A;  4GOP B;  5M5Y H;  3F1Z A;  3HOX G;  4JOI A;  3JAM i;  1VQD A;  2RHS B;  3HOZ H;  4JOI C;  4P71 A;  2FXQ A;  2Z0S A;  2NN6 I;  1XTD A;  2AHO B;  5IP7 G;  2JEA I;  3Q8D A;  4JI8 L;  3GTM H;  3L0O A;  3ERS X;  4JI7 L;  2HT1 A;  5FJ8 H;  3HOV G;  1HR0 Q;  1QUQ A;  2YYZ A;  4B3M L;  4DV2 Q;  1VQ5 A;  4P74 A;  2NVT H;  1LUZ A;  5BR8 Q;  4DR2 L;  1EIF A;  3BU2 A;  1O7I A;  1X3E A;  3PUW A;  5HY6 A;  4DR3 L;  1L1O A;  1Y1V G;  1OXT A;  4BY1 H;  1MJC A;  1L1O C;  1JJ2 A;  2VQE L;  3M7N A;  2MQH A;  3PO3 H;  5M5X H;  4MNO A;  4JI6 Q;  2ASB A;  4P75 A;  4DR7 Q;  1UE6 A;  3G6E A;  2CWP A;  4ME3 A;  5GAH C;  3TRZ A;  1QVG A;  4JI0 L;  5C3E G;  2NVY H;  4QL5 A;  1B70 B;  1TXY A;  2AWN A;  1Y1W G;  1J5E Q;  4UY8 C;  4JI2 L;  1K83 H;  2QA4 A;  4NXM Q;  4DUY L;  1SRO A;  4X6A H;  1NY4 A;  2ZM6 L;  4DV7 Q;  3RZO H;  4DUZ L;  4YY3 L;  4JI4 L;  5IP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...