4QY7A

Crystal structure of a yoba protein (bsu18810) from bacillus subtilis subsp. subtilis str. 168 at 1.55 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
GDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YobA
publication title Crystal structure of a hypothetical protein (yobA) from Bacillus subtilis subsp. subtilis str. 168 at 1.55 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11518 DUF3221 Protein of unknown function (DUF3221)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qy7A01
1FGUA 2PMZE 1FJGL 1SE8A 3TQYA 3F1ZA 1X3GA 1PH3A 4NXML 1X9NA 3TEHB 4P72A 4B3TQ 5M3FG 3CCMA 1M90C 1HR0W 4A3GG 1PYBA 2HIVA 4LF5L 4JI0L 3L0OA 1VQ8A 3CD6A 1I94Q 3G6EA 1WCMH 1V43A 2DUDA 3WWVA 1PH9A 4OX9Q 1Y1WH 2GVAA 1NJIC 4JV5Q 4L5TA 1PV4A 4JI6Q 3CMEA 1HNZL 3I4NG 4YCWA 1EQRA 3HOYG 4B3RL 2N78A 1VQNA 1X3EA 2LSSA 4P73A 2UXDL 4OONA 2KHIA 1FVIA 1CUKA 2YTXA 4X66L 5BR8Q 4HJ5A 1QUQA 4A3KG 1YJNA 5FJ8G 2HT1A 4DR7L 4A3DH 4DV5L 5C44G 2UUCQ 3HOZH 5IP7H 3JC66 2B29A 2NVTH 1WJJA 1SN8A 2YTYA 3M4OH 1NBWA 3H0GG 4JYAL 3GTKH 2IY5B 3BU2A 1EOVA 4L5QA 1PHJA 2I5MX 1Q86C 4LF4Q 4DUYQ 1TWGH 2MNAA 5DLQE 2IX0A 3CPWA 1OXSC 4LFAQ 1W3SA 4DR3Q 3CP0A 1JE5A 1V1QA 2JE6I 4APVA 3AYHB 3E9HA 4DR4Q 1XJVA 2EQSA 1VQPA 3LGJA 4GN4B 4DV6L 1CKMA 1BVSA 2PI2E 2LXJA 2ZM6L 4DV3L 4EX5A 3OW2A 4GKJQ 3KFUA 2HIXA 2R7FA 4YWLA 5FLMG 3S2HH 3UDFA 4RMFA 2A19A 4JG2A 1IBKQ 4RG1A 1HNXL 4IJHA 2F4VQ 1JJGA 1X55A 2JK8A 4DV4L 1Q82C 2BH2A 4X65Q 4A3EH 2JEBI 2WAQG 1S72A 1WYDA 1HR0Q 3I4MG 2HQLA 4GLXA 3KDFA 4C3JH 4JI5L 4DV3Q 2K4KA 2MFIA 3TRZA 4HJ8A 1G51A 4NPSA 4JI3L 1HZ9A 1Q81C 1J6QA 3RZDH 4A93G 1L2FA 4DV7Q 3UDXA 4KHPQ 4DR1Q 1EIYB 3AEVA 2UUAQ 3PO3G 5IYDH 3A0JA 5C0XG 5IE8A 4GN5A 2JA5G 1WOCA 1L1OA 4GLVB 3HKZG 2NVXH 1TWFH 2EXDA 2WFWA 4DR2Q 1PH7A 1K0RA 2V1CC 4KHZA 4GLAC 4JI2L 2ALYB 1SLJA 5IYCG 1PVOA 4BY1G 2R93H 3S24A 1PA6A 1MJEA 5EAYA 4PZ8A 4JI8Q 3PUYA 3HOXH 4DR5L 3H3VH 1IZ6A 1C0AA 2Q2HA 1C7YA 4ALPA 1VCIA 2VS1A 5GQOA 2VQFL 3T1HL 1N33L 3G48A 3U4ZA 4R4TA 4XIGS 4BA1I 3HOWG 1XTDA 2R7ZG 1UE1A 1YHBA 3SGIA 4JI7Q 4JI4L 3S1QH 2XTIA 2ZTEA 3K80C 2Q2UA 1QUQB 5M5WH 2ZTCA 2ZJPA 2KBNA 3PSIA 3MEFA 2YTVA 2Q2TA 3HKSA 1XMQL 4DV0Q 2UUBQ 1IL2A 1FL0A 5LMNQ 1LUZA 1K8GA 1KIXA 4BBRH 3FP9A 4DAMA 1L1OC 1X54A 3U4VA 2NVQH 5E7NA 3J7ZC 3CCEA 1EQQA 2H5XA 5ELOA 4GN3B 2UXBL 3FKIH 3RLNA 5IYBG 3EBEA 3KJOA 1XPUA 1KL9A 4DR6L 3PGZA 3OYYA 4K0KL 2JA8G 4X64L 5GAHC 2Q2IA 3M4PA 4DUZQ 1XPRA 1RL2A 4MZ9A 4UP7A 3CCVA 5AJ3Q 1K3RA 1N32L 3K7UC 3S2DH 2E2HH 3KOJA 4HIMA 3L2PA 1HZCA 5FLXc 1S3OA 4WJ4A 2IHEA 5M5YH 1U0LA 2UXCL 3W5OA 4HJ7A 3U58A 4POGA 4A3LG 1VQBA 4P71A 1X65A 2C35B 2EIFA 5IP9G 1CKNA 3AFQA 2Y0SE 2ASBA 3A5UA 1KD1C 1M1KC 1YITA 3IRBA 4DV2L 3KDFB 1X6OA 4LF9L 1KHIA 4KLKA 5JEAG 5LMUL 3F2DA 1Q1EA 4KI0A 1Z47A 2N49A 3K7AH 3S16H 3S1NH 4A3FH 2KHJA 1SMXA 3D31A 2B63H 1N36Q 1K73C 5C3EH 4DV1L 4GNXA 1L1OB 2K75A 4NB3A 1PH6A 3AFPA 4JCVE 1A8VA 3T1YL 4X62L 1J5EL 1VQGA 4B3SQ 2A8VA 4A3MH 3GTPH 4BY7H 1FJGQ 4YCUA 3ZJYC 1MKHA 3K8AA 4NXMQ 5C0XJ 2VQEL 4A3KH 5C4JH 4LF5Q 3FHWA 4JBMA 4IPCA 4YWKA 4JI0Q 4JI1L 4YWMA 3VDYA 3HOVG 4IFDG 1QZGA 4GOPA 5M3MH 3I2ZA 3MXNB 3H0GH 3UE0A 4DK3C 4UPAA 2Z6KA 5HY6A 1KRTA 5IWAL 3PUZA 2UU9L 2KENA 1AE2A 1NE3A 1VQCA 4FDBA 1NMFA 2K5HA 3ULPA 1Y1WG 1HNZQ 3GTLH 4B3RQ 1PH2A 4P74A 3KYHC 3NEMA 4PZ6A 2F52A 2UXDQ 1KC8C 4X66Q 4GKKQ 4O0AA 4B3ML 4DR7Q 3CW2C 4DV5Q 1N34L 1YJ9A 2YU9H 3AQQA 2OCEA 4A3DG 1CSPA 4L5RC 3B6YA 5IP7G 1R9TH 3GD7A 4GNXC 4JYAQ 3H15A 2E2JH 1C9OA 3OTOL 5ELNA 1I50H 2ZJRA 4XTCS 1T9HA 5GAEC 1RIPA 3EN2A 4IFDI 5C4XH 4DK6C 1VQEA 4AQYL 4Y52H 2XGTA 4HJ9A 3RNUA 1OXTA 3TREA 3G71A 4IPHA 3J81j 1HNWL 4BBSH 4A3BH 2CKZB 1P16A 3M85A 3KJPA 4DV6Q 2I0QA 1JB7A 4GOPC 2K5VA 1N34Q 2PNHA 3KF6A 4C2MH 2R92H 3I4MH 4LF7L 2ZM6Q 4LWCA 2Z6KC 1JMCA 3I7FA 4POFA 3CCJA 5GROA 5GADC 1H95A 2R7DA 3PUXA 3STBD 1XMOL 4OWWB 4OO1G 4QQBX 1DGSA 3M7NA 1VQ6A 2GN5A 1YHQA 3CQZH 4LF8L 4YY3L 4A3JH 1Q1BA 1XPOA 1HNXQ 1OTCA 1MIUA 3UDIA 4DV4Q 2JA5H 1EUJA 2ZJQA 4MNOA 4AYBE 1I3QH 4LFCL 4NXNL 2MO1A 3PUVA 1EWIA 1P8LA 2D0OA 4A3EG 1XNRL 2WB1E 1KRSA 4IO9A 1YZ6A 1WFQA 4JI5Q 1XNQL 2R6GA 4PZ7A 4BY1H 4JI3Q 3RLOA 1UE7A 3CC7A 3RN5A 3GTQH 3RLFA 2QA4A 5JEAJ 4LUVA 3HOUH 4X6AH 4GNXB 1VQ5A 1IBLL 2D62A 1HZAA 3S1RH 4A76A 1G6PA 2F3IA 4R4OA 3ULLA 2VW9A 1D7QA 5IYDG 2NN6G 4Y7NH 4L5SA 4A3CH 4OO1I 3ULJA 3RR5A 4OWXB 3UE1A 1TWAH 1E22A 2CQOA 4JI2Q 5C0XI 2AMCB 3DLLA 3GTOH 3PO2H 2Y0SG 2OTJA 1LTLA 2HHHL 2R93G 4DR5Q 4GOPB 3TS2A 1GKHA 3HOXG 1BBUA 2Z0SA 3KLWA 4LF6L 1K83H 2ID0A 2VUMG 2VQFQ 3T1HQ 3U50C 3CCLA 1PH8A 1N33Q 2JA7H 3PF5A 4JBKA 2AWOA 2QGQA 2E5LL 5J3BA 4IFDJ 1VQIA 1YBYA 2BH8A 1VQMA 2L15A 1E1TA 3GTJH 1YEZA 4JI4Q 1GM5A 2OWOA 2AWNA 2RF4A 4GS3A 4PMWA 3ER0A 1PYSB 4GKKL 1BBWA 2NN6I 3DM3A 1B70B 4HJAA 4DPGA 4QGUA 1XMQQ 1QVFA 3GTGH 1LM0A 4HIOA 4BXXH 1N9WA 3CC2A 3RZOH 2BA0A 2PI2A 2JA6G 4A75A 2OTLA 4LFBL 4BBRG 3A74A 1IXRA 3CF5A 1HZBA 1SR3A 3GTMH 2UXBQ 3HKZE 4OXPA 3H3VI 2PQAA 4MTNA 3FKIG 4DR6Q 1KXLA 2KCMA 1NTGA 1CSQA 3L7ZC 4K0KQ 4QJFA 4X64Q 3KF6B 2AKWB 4LUOA 1GVPA 1S40A 1EYGA 2A1AA 4A3GH 1HJPA 1E24A 2RCNA 5M3FH 1YJWA 4B3TL 2MQHA 3CCSA 2JA9A 1N32Q 4O2DA 1PFSA 4JBWA 4H02A 1I94L 4AH6A 2ES2A 2UXCQ 1QVGA 1Y1VG 4P75A 2ZTDA 3TS0A 1AH9A 4OX9L 3I4NH 1I5FA 4A3IG 4JV5L 2K50A 3HOYH 4JI6L 5GAGC 1A63A 3NBHB 4DV2Q 4LF9Q 3CCQA 5LMUQ 5FJ8H 4JC0A 5BR8L 3S15H 5C44H 1VQAA 2WP8J 2UUCL 3HOVH 4LW1A 1OXXK 4DAYB 3J80c 1YIJA 1WCMG 4IOCA 4A3FG 2B63G 1B8AA 1UE6A 2BA1A 4DV1Q 3D0FA 1IYJB 1Y14B 5C3EG 1CKOA 3T1YQ 4LF4L 4X62Q 3K81C 4DUYL 2RHQB 4C3IH 1J5EQ 4LFAL 1PH1A 4A3MG 3KF8B 4BY7G 2MO0A 3GDEA 4DR3L 2IHFA 2VQEQ 2VNUD 4QY7A 1VS0A 4AYBG 2RHSB 4DR4L 1SRUA 3M4QA 4JI1Q 2QEXA 1EFWA 4J15A 3HOZG 4UP9A 1E7ZA 2WB1G 1PH5A 2ATWA 1PH4A 2VY3A 3G4SA 5JJIA 1VQLA 5M3MG 4QIWE 4GKJL 4UP8A 2GVBA 3Q8DA 5FLMH 5IWAQ 1I6HH 2UU9Q 2CWPA 2YYZA 2YV5A 2CFMA 1KQSA 3W1BA 1IBKL 3EIVA 2F4VL 4B3MQ 3BJUA 4X65L 1AE3A 1HR0L 1ASYA 1X56A 3I4OA 2JEAI 3NELA 2E8GA 1IBML 3RN2A 3OTOQ 4A93H 2CWAA 1UE5A 5LMNW 2PQAB 1VQKA 3CC4A 4DV7L 4AQYQ 1CKNB 3PO3H 4DR1L 4KHPL 5C4XG 1VQJA 3J81i 2UUAL 1HNWQ 1V9PA 4QL5A 3PV0A 1VQ4A 5JJLA 4IPGA 4HIKA 4A3BG 4BBSG 4R4IA 2NVYH 2E2IH 1X3FA 4DR2L 1VQ9A 5IYCH 3CCRA 4LF7Q 2VZAA 2R92G 1NMGA 2DGYA 3UDGA 4ME3A 3NENA 2N8NA 5JJKA 3K0XA 1IBMQ 1XMOQ 3S14H 4JI8L 2NZHA 1B7YB 1YHAA 1UWVA 5K36G 1D8LA 4LF8Q 4YY3Q 2LXKA 3HOWH 1TWCH 5IY0A 1K8AC 1Q12A 4A3JG 3J81c 4LNQA 2R7ZH 3JAMi 4YCVA 2K5NA 1UEBA 1VQFA 2AHOB 2FXQA 4R1JA 4LFCQ 1U5KA 1VQHA 4OWTB 4JI7L 4NXNQ 2D0PA 3PCOB 1XNRQ 3BZKA 1G291 3CCUA 4JOIA 3PUWA 2CCZA 4UY8C 4YHHL 3PIOA 1XNQQ 4DNIA 5HGQA 2JQOA 1LYLA 1W2BA 1TXYA 1VQOA 2I5HA 4DV0L 2UUBL 4AIMA 2OQ0A 4JBJA 5M5XH 2K14A 5LMNL 1IBLQ 3HOUG 2IT1A 2VUMH 2OQKA 1KAWA 1OXUA 3F8TA 4EQ5A 1JJ2A 4DKAC 3F2CA 1N8RC 1BKBA 5IYBH 3W1GA 3JAMc 1HH2P 4A3CG 2WAQE 2JA8H 1QVCA 4HIDA 3J7A5 1SROA 4PG3A 4TVAB 3A5ZB 4A4IA 4YHHQ 3F2BA 3PO2G 1JT8A 2HHHQ 3E9IA 2K52A 3ICEA 4DUZL 4IOAA 4LUZA 1VQ7A 3I56A 1GD7A 5AJ3L 4LF6Q 1WI5A 2JA6H 3CAMA 3CMAA 2IX1A 2I5LX 3ERSX 4R4CA 2E5LQ 2JA7G 2KCTA 1VQDA 2N3SA 3CXCA 4A3LH 3STBC 1SFOH 1Q8KA 4JOIC 2NZOA 1L0WA 5IP9H 1MJCA 3PIPA 4IPDA 1Q7YC 1ASZA 1GO3E 4WJ3M 1Z9FA 2B3GA 3S1MH 1JJCB 1TWHH 3E0EA 3M3YH 5H1SE 1EIFA 4TQUS 4C3HH 4BXXG 4BA2I 4LFBQ 3GO5A 3M9BA 1QZHA 1E1OA 3J80i 5IT9c 1K9MC 3S17H 1O7IA 1YVCA 3PF4A 3HFZB 1Y1VH 3CPFA 1A62A 1Q46A 3I55A 1YI2A 1N36L 1A0IA 4R4QA 4A3IH 1NY4A 1OXVA 3BZCA 1YNXA 4IJLA 2JJQA 1E3PA 4B3SL 2VL6A
chains in the Genus database with same CATH superfamily
1LTTD 3HOXB 1SE8A 2L4NA 1X3GA 5G3LD 1X9NA 2N88A 4P72A 3TEHB 3QOLA 3K5MA 3CCMA 5M3FG 1HR0W 1PYBA 4B3TQ 3L0OA 1WTOA 1Y8OB 1PMRA 3NWTA 2A6EC 1WCMH 1V43A 1HFGA 2DUDA 3WWVA 1PH9A 3C2PA 1XX8A 4YCWA 2N78A 2IPKD 1STAA 2UXDL 1CUKA 2HT1A 2ZT9C 4A3KG 4DR7L 4BBRB 5FJ8G 5C44G 1EEFD 4O1NA 2MPMA 3HOZH 4K5VA 2EY5A 2YTYA 2NVTH 4JYAL 2HD3A 3FKIB 3GTKH 1EOVA 2F0LA 2L55A 4L5QA 1Z7TA 4DUYQ 1TWGH 1BCPC 4IUVA 3S1MB 1TWHB 3M3YB 2IX0A 4KHVA 3CPWA 3V05A 4C3HB 5I6YA 1V1QA 2JE6I 1NR2A 1VQPA 2E2HB 4GN4B 1EEID 3GV6A 1CKMA 5KIXA 1BVSA 2PI2E 3BG3A 3BVMA 5M5YB 3OW2A 3ND8A 1S5BD 4GKJQ 1PTOH 3VR2A 3MA2B 3JAME 1C48A 3S2HH 3FPUB 1PZJD 4CGYB 1IBKQ 4CJ1B 1RJTA 2F0TA 2NWGA 4F88A 2WAQG 1S72A 3SK8A 4QMGA 3NTKA 5KYIA 4GLXA 1SE3A 5D3DA 4C3JH 4DV3Q 4BS9A 1LT3D 3D4WA 3TRZA 1G51A 4NPSA 2G5DA 1WTQA 1SNPA 4DV7Q 1O7LA 3UDXA 5IGDA 4A3MB 3GTPB 2JN4A 3PO3G 2PW5A 5EBCA 2NN6H 3A0JA 1ICWA 4AYBB 1PRTD 4GLVB 3HKZG 4R8IA 4OGQC 1TWFH 2WB1B 4DR2Q 4FXKC 4KHZA 4HSPA 5IYCG 3C1EA 2R93H 3TZDA 3V2TA 1MJEA 1H9RA 3HOXH 4DR5L 1RTOA 1STEA 1C0AA 3K57A 1C7YA 4V190 1KDCA 2VS1A 1N33L 4O42A 3OWEB 2VXWA 4U673 4R4TA 4ZLTF 2R7ZG 1HTLD 1YHBA 5LHY1 3T56B 2YU9B 4JI4L 2ZTEA 5M5WH 3BS1A 4XYOA 5IGEA 2ZJPA 4HN7A 2ENBA 1PYWD 2PQEA 2UUBQ 4QUFA 1K8GA 3HEJA 4BBRH 3FP9A 1L1OC 1X54A 5E7NA 4GN3B 2UXBL 5LL6X 3FKIH 3BVZA 1KL9A 2B2VA 4DR6L 3OYYA 4MN3A 1CA5A 1SE4A 4I7ZC 2Q2IA 1WTVA 3DM1A 1LTSD 1XPRA 3CCVA 2WACA 3CQZB 1K3RA 1N32L 5EJWA 3S2DH 2E2HH 4HIMA 3L2PA 1HZCA 1S3OA 4FNFA 2PNRC 4RKLA 5M5YH 2R3ZA 4ZRZA 2BDOA 2LKVA 3R2IA 3MWYW 1X65A 2NZ1D 4HSVA 2N55A 2Z4HA 5IP9G 1MHWC 3A5UA 1KD1C 3EJIA 4RGTA 1UAPA 4LF9L 2EJGC 4OELB 2BE5C 1ILPA 3F2DA 1EQVA 1Z47A 1NNXA 2KHJA 1SMXA 2EYPA 4LAAA 4GNXA 1PTOD 2EY2A 4WJWA 3PO2B 4X62L 1BXTA 3GTPH 4A3MH 4BY7H 5JJZA 4NXMQ 2F4IA 3NQIA 4A3KH 4LF5Q 4JBMA 4IPCA 3HOVG 3VDYA 3WOEA 4IFDG 5KNCA 5M3MH 3GTJB 4UPAA 2Z6KA 3PUZA 2UU9L 1Y1WG 1WD0A 3ULPA 4ZK9B 2K5HA 1HNZQ 2K7VA 2B2WC 2F52A 1LACA 1SE2A 2DJFC 5ISRA 3CW2C 5FLXL 2YU9H 4K8IA 2OCEA 3Q6SA 3B6YA 4QIWB 3EFXD 2E2JH 1W6KA 1C9OA 1T9HA 1AEXA 4F87A 3EN2A 2CH4A 4AQYL 1EY6A 3TBIB 4DNRB 4FF4A 2F0IA 3RNUA 1GUGA 3G71A 3OMCA 1D5ZC 2I0QA 3QR8A 2IY5B 1JMCA 3VA5A 5C3EB 3CCJA 2WKCA 3PUXA 4OWWB 4QQBX 1DGSA 3CQZH 4P2CB 1ZYRD 2CQAA 4LF8L 4YY3L 3UDIA 2JP1A 4DV4Q 4AYBE 3DXJC 2MO1A 3PUVA 1TY0A 5C5MA 2WB1E 2K28A 3H0GB 1J8IA 1YZ6A 4JI5Q 1XNQL 2FINB 4JI3Q 3RN5A 3RLFA 1VF5C 3LWEA 4GNXB 2K04A 3ULLA 1D7QA 3R93A 5IYDG 4DNTB 3DMUA 3K5OA 4OO1I 5AFWA 3DLLA 1GXDC 3PO2H 2AMCB 3KF8A 4UDUC 1G91A 1LTLA 3MFYA 1EL0A 3TP6A 3OSOA 4XYQA 3TS2A 1BBUA 4BWGB 3A7AB 2VQFQ 3CCLA 1ENCA 2AQ1B 3PMFA 4CJ2C 3PF5A 4A3BB 2QGQA 5J3BA 3I4MB 1TS2A 3GTJH 3I91A 3V96A 1K0SA 2RF4A 2Z9HA 4Q5VA 2EY1A 3ER0A 2QEJC 4QGUA 5I2XA 5JPMC 4A93B 3CC2A 1FR3A 4WFN3 3A74A 3E5SA 3CF5A 5FOBB 3OHXC 3HKZE 1BBXC 1WD1A 1KXLA 1NTGA 5E1FA 4CDDC 1YNND 4X64Q 5EGTA 1B3AA 3VA7A 2AKWB 4LUOA 3ITPA 1GVPA 4A3GH 3NHHA 1TS5A 1YJWA 3S1RB 4B3TL 2KEDA 3CCSA 2EZVA 2JA9A 1A3UA 1TWCB 1BF4A 3CKIB 1TWAB 1SJHD 3GTOB 1EZ8A 2K1BA 2A6HC 5C4ZA 2QKIC 2FJ2A 4ZUIA 5LMUQ 3HP3A 3HOVH 2B2YC 3MC0B 4DAYB 4DV1Q 1Y14B 1CKOA 4DUYL 3BYYB 1CZWA 1ML0D 1PH1A 1ET9A 3KF8B 2L1BA 3GDEA 3IFDA 1G6ZA 3MFGA 5EPKA 5BN4A 2RHSB 3M4QA 1TY2A 1E7ZA 1IKLA 2ATWA 1VQLA 4QIWE 4GKJL 4OIJA 4TSSA 3QO2A 3NK9A 2YV5A 3SVMA 1TS3A 4NMZA 1IBKL 1A6XA 4B3MQ 3BJUA 1U4MA 1HCZA 5ELCA 1EWCA 3BDOA 3IL8A 3QJYA 4G7HC 1KDBA 1HTPA 2E8GA 3C1FA 3PQIA 3RN2A 1E2WA 2O4XA 1Q8IA 4A93H 4DV7L 5CMDA 3KLRA 5C0XH 1I4GA 1ICFB 1V9PA 4QL5A 3DWPA 2F0KA 5JJLA 1Q3LA 1PTOC 4G57A 4IPGA 4YIJA 4DR2L 1VQ9A 1T5XD 2PCFB 2R92G 3UDGA 2QCPX 4C3IB 1HUNA 3SHLA 1YHAA 1UWVA 4EQOA 3Q24A 1TWCH 4LNQA 4A3JG 1EY4A 1SNMA 4NXNQ 4A3DB 1U5KA 3FRPB 4OWTB 2D0PA 1XNRQ 2NYZD 3VYUA 4JOIA 4UY8C 1E0BA 2X6LA 4DNIA 1I6HB 2F0MA 2UUBL 4AIMA 1NR4A 2OQKA 1OXUA 5CV6A 3F8TA 4EQ5A 5FO8B 2L11A 1J9OA 1BKBA 4WORA 3W1GA 1HH2P 2ICEC 1PZKD 3PIO3 1DOLA 3WDNA 1GHKA 1SROA 1DOMA 4YHHQ 1GJXA 1WTPA 2LS01 3NSWA 1FD7D 1DOKA 1GD7A 2KUMA 3CAMA 1QG7A 3CMAA 2I5LX 3ERSX 3KBGA 4KJNA 1CQFA 2N3SA 2NVYB 4A3EB 1CHQD 2NZOA 1S5ED 1ZYRC 1QWYA 1B44D 5KNBA 3O13A 3E0EA 3SE0A 5JEAH 5BN5A 3RZDB 3J81L 1QZHA 1E1OA 5IT9c 2AUKA 3N6RA 2IWHA 2ZXPA 1YVCA 1I4HA 3PF4A 3HFZB 3CPFA 1A62A 1WTWA 1YNXA 4IQZA 2JJQA 1E3PA 2A69C 3MAQA 3F1ZA 3DEOA 4NXML 1QB5D 2EJMA 3SXHA 3I3CA 5CBEE 2K32A 4LF5L 3T4AC 2MP1A 5C5LA 1I94Q 4I7AA 3S1QB 1X3QA 1ET6A 4JV5Q 4L5TA 2DNCA 1HNZL 1EQRA 1D1KA 2OEOA 1O80A 2KHIA 4A3DH 2IJ0A 1PRTB 4IALA 5IP7H 2K33A 2B29A 1SN8A 1NBWA 3KBXA 1Q86C 3MEHA 5DLQE 1SXTA 1AZQA 5KRUA 1W3SA 1C8CA 1XYIA 5EKLA 3AYHB 2EQSA 1KNAA 1CI3M 2LXJA 1K8OA 2RSNA 3QIAA 3SK4A 3P1HA 1CZGA 4ZCKA 1JORA 2SEBD 4FO2A 4IJHA 1X55A 2JK8A 4DV4L 1V8QA 4NW2A 4X65Q 4A3EH 2JEBI 1HR0Q 2DY7A 1WYDA 1KTKA 3S16B 1WCMB 3S1NB 4JI5L 5CR3A 2MFIA 4JI3L 5ELEA 1Q81C 4LK1C 3RZDH 1L2FA 2OXPA 4KKSA 4DFAA 2EDGA 4KHPQ 1STYA 5IE8A 2JA5G 5KNDA 5C4JB 3HOZB 1PH7A 2WFWA 2F0JA 1SLJA 5C6AA 3QWNA 2B8GA 3S24A 5EAYA 1TWGB 4RCNA 5FLXE 1IZ6A 5K5PA 1A3TA 2SOBA 4DU9A 1HHVA 5GQOA 2VQFL 4CDFC 3U4ZA 3VYTA 4XIGS 3HOWG 5FO9B 1UE1A 3UI2A 3SGIA 4JI7Q 3ZYYX 2EYHA 3S1QH 2XTIA 3K80C 2Q2UA 1HPCA 1STGA 2ZTCA 1PTOB 4E6IA 3MEFA 1H9SB 1S5FD 3S2HB 2X69A 5C3WA 4DV0Q 1IL2A 1S4ZA 2K6AA 1FL0A 5LMNQ 5C4XB 1KIXA 1IW7D 2I07B 2TMPA 4PV1C 2NVQH 3J7ZC 3CCEA 1EQQA 4J8QA 4NP5A 5ELOA 4H13C 2FMCA 1WTXA 1D5XC 4X64L 1AW7A 2KHSA 3BDLA 3M4PA 1EZ6A 4G7ZC 1RL2A 4WRDA 4HEDA 3NUCA 4K8JA 2KOLA 3R3OA 1LTRD 2KCNA 5FLXc 4WJ4A 3HRZC 2IHEA 1TWFB 3W5OA 2NTSA 3U58A 1VQBA 4P71A 1F2ZA 1CKNA 2RDHA 1Y8NB 2F0EA 1TT2A 1YITA 4PNYA 1X6OA 1KHIA 2F0DA 5LMUL 2Z6BA 4IN3A 2F0SA 4KI0A 2N49A 3S16H 1LT6D 3S1NH 2B2VC 5M5WB 3HG9A 4DV1L 4JCVE 4X3UA 1GUOA 5KGUA 2A8VA 2FHTA 1FJGQ 3K8AA 5C0XJ 1GUTA 5C4JH 5IGCA 4B9WA 4KN4C 1QZGA 4GOPA 1KRTA 1NE3A 3A54A 1PH2A 5CBAE 3GTGB 3KYHC 4IUUA 1NCVA 2F0VA 5IT9L 1KC8C 4B3ML 3S2DB 4DV5Q 4FP5D 1SNCA 4L5RC 3GD7A 4GNXC 5ELNA 2ZJRA 4XTCS 1HRJA 2XRSD 1RIPA 3A8IE 5C4XH 1VQEA 2XGTA 2RDGA 4HJ9A 4IPHA 2M2LA 2CKZB 1P16A 3D4DA 4U68A 3KJPA 4DV6Q 1N34Q 1SBBB 3D8GA 2Z6KC 1H9MA 3I7FA 1B9NA 5GROA 5GADC 1EIGA 4OO1G 1ESRA 5EKIA 4BY7B 1YHQA 1E2ZA 1HNXQ 4CBVA 4A3KB 2JA5H 5C44B 5EPLA 1IYUA 4NXNL 2D0OA 3NBHA 1XNRL 2RA4A 5M3MB 1EFID 4XQNA 3RUZA 3NBIA 4QCLA 1MSHA 1WFQA 4PZ7A 4IUPA 3RLOA 1UE7A 1H9JA 5JEAJ 4X6AH 4ULLA 1HZAA 4A76A 2F3IA 4R4OA 5DAUA 2VW9A 4Y7NH 4A3CH 1BOSA 4CJ0B 1E2VA 4X3SA 1SNOA 1E22A 1LTAD 2E2JB 2ZXRA 2Y0SG 2OTJA 4GOPB 1IKMA 5D14A 1GKHA 4CKBA 2VUMG 3T1HQ 1PH8A 5ELBA 4ZKBB 3EQLC 2JA7H 4JBKA 2KCCA 2GA4B 5FO7B 2WAQB 1E1TA 2E74C 1GM5A 2B2TA 2OWOA 4GS3A 1CA6A 3MXUA 1YNJD 2NN6I 1B70B 2HCCA 4HJAA 4DPGA 1XMQQ 3GTGH 4HIOA 2F0WA 2JA6G 1Y69U 3PO3B 3NXWA 1IHZA 1HZBA 1SR3A 3HKZB 3GTMH 1F2YA 4C56C 5E4XA 3E3XA 2CVRA 1QNKA 2KCMA 4K0KQ 3L7ZC 1DONA 3J7YW 4DAPA 4FF2A 2E2DC 2HDLA 3K6OA 2A1AA 5M3FH 2MQHA 4O2DA 1PFSA 4DK1A 2R7ZB 2A68D 4H02A 1I94L 4AH6A 2UXCQ 1F2LA 1Y1VG 4P75A 2I46A 3DUZA 3J7AF 1EYCA 3MXPA 4A3IG 4JV5L 2K50A 4HCEA 3R8BA 3NBHB 2PMZB 4RHSA 2WKDA 5CV7A 1HFNA 5FJ8H 5C4HA 3S15H 5C44H 1LV9A 1OXXK 1V1OA 3J80c 4J1MA 4A3FG 2B63G 1B8AA 1ZXTA 3D0FA 4FXDA 5C3EG 5J22A 1PFNA 3K81C 4ILWA 2AQ3B 4HMIA 2VQEQ 1H9KA 3X3MA 2QEXA 4JI1Q 2VB2X 4N8FA 1EFWA 5ELFA 4IZ8A 1PH5A 3WOFA 1PH4A 2VY3A 4KD3A 2HUGA 3Q8DA 5IWAQ 3J81E 1JQYD 5EKKA 3EIVA 4A3GB 1DCZA 2L12A 1A2TA 4X65L 1HR0L 1DJRD 3I4OA 2K5WA 2Q8TA 2B2UA 3OTOQ 3Q22A 4MIUA 1VQKA 3CC4A 3PO3H 4KHPL 3J81i 1LT5D 1HNWQ 3PV0A 1VQ4A 1WVLA 1HXYD 2PZTA 1KLGD 2XN9C 2AUJD 3HOVB 1U4LA 4A3BG 4K6LA 1X3FA 4UHVA 4BBSG 5IYCH 4LF7Q 3Q0AA 2WINB 2DGYA 2N8NA 5JJKA 3K0XA 1PFBA 1IBMQ 1B7YB 2M00A 5K36G 1SSOA 1D8LA 2K05A 4RWSC 3BZDB 5IY0A 2R7ZH 3EA6A 1K8AC 3J81c 2G9DA 4OIKA 4YCVA 2K5NA 4JI7L 3T51B 1G291 2CCZA 3I90A 1STHA 1ONLA 1MSGA 3DWQA 2KEEA 5I9OA 2EY6A 2JQOA 1RTNA 1TXYA 4DV0L 4K5WA 2OQ0A 5M5XH 5LMNL 2K14A 1IBLQ 3HOUG 2VUMH 3RMHA 2XIWA 3H94A 2DJGC 2SDFA 2QDBA 2WAQE 4HIDA 5IIFA 4PG3A 3F2BA 1JT8A 4X3KA 2F0HA 2XWBB 2P5ZX 4LJZC 3TP8A 3MHBA 4QB4A 4IOAA 4LUZA 1VQ7A 3I56A 2JA6H 5E4WC 1M4VA 1BCPF 4I65A 1DYQA 2O5JC 1Q8KA 4JOIC 1L0WA 2X6GA 1JOOA 5IP9H 4KY6A 1GUNA 1Q7YC 2KQ3A 4WJ3M 1GO3E 1Z9FA 2B3GA 4ODGA 1PRTC 1EIFA 3I70A 4BXXG 3AB9A 3Q23A 2G9HD 4FVMA 3M9BA 4LFBQ 2BCOA 3S17H 2K5DA 1S5CD 3URYA 1Y1VH 4JVZA 4JW0A 3PIP3 1Q46A 4PQXA 1MBYA 4H7BA 1OXVA 1NY4A 4A3IH 3RR5A 2VL6A 1FGUA 2PMZE 1FJGL 3H6MA 2D2CC 1BUVT 1JWMD 3TQYA 2VNUD 4UAIA 1M90C 2RQXA 2HIVA 3VR4A 4LMQD 1I4XA 4IFDH 2XNAC 2CW0D 1VQ8A 3CD6A 5F2DA 3G6EA 5I2YA 4PMBA 1T5EA 4OX9Q 1Y1WH 1AFPA 2GVAA 1WTRA 1PV4A 4JI6Q 3I4NG 1CK1A 3HOYG 1X3EA 1CTMA 1FVIA 2YTXA 4HJ5A 1FGBD 1QUQA 1TVXA 4DV5L 2UUCQ 3JC66 5ELDA 4N9PA 3VYSA 1PHJA 3SK5A 2I5MX 4LF4Q 3OOCA 4C3IG 4N9TA 4DR3Q 1GUSA 3QOJA 1XJVA 3LGJA 4DV6L 2XVSA 4DV3L 3KFUA 1B3QA 1BQQT 2HIXA 3M4YA 2HCIA 2R7FA 5FLMG 3MTSA 3IKJA 2A19A 1A2UA 4JG2A 3LX0A 1PFMA 4XXEA 2CHBD 1HNXL 2F4VQ 3G7LA 1JJGA 3TZUA 1Q82C 4RFBA 3J80L 5JOBA 3K7AB 2HQLA 5LL6S 1EY7A 1R4QB 1HZ9A 1J6QA 1I4RA 1UNSA 1LTID 3AEVA 2UUAQ 5IYDH 3ND9A 5I6WA 4GN5A 3W2DA 1FYCA 2KVMA 1Q90A 2EXDA 4CDEC 3W3AA 5IT9E 1PVOA 4BY1G 1LABA 2EOTA 1PA6A 4PZ8A 4DAVA 3H3VH 3CRLC 4ALPA 3T1HL 3MXNA 2MHVA 3G48A 4BA1I 4EVOA 1LTGD 5L37A 3A56A 3H91A 3MVVA 1QUQB 1R9TB 2KBNA 3PSIA 5IOCA 1NSNS 1VDZA 2YTVA 2Q2TA 3HKSA 1XMQL 2A6ED 4KV6A 1QE6A 1W6JA 1TU2B 3U4VA 3SR1A 2H5XA 3KK7A 4GZYC 5IYBG 2DY8A 3EBEA 1O7YA 3KJOA 4C2MB 3PGZA 4K0KL 2JA8G 4KD4A 1TQOA 4F8MA 5JVH3 1KLUD 1B9MA 4DUZQ 1GUWA 4OL7A 4C1NK 5AJ3Q 4PMCA 4L63B 3K7UC 2RDFA 1EYAA 1K8MA 1BCPD 2TSSA 3T13A 4KJOA 1I3QB 1U0LA 4HJ7A 4POGA 4A3LG 2UXCL 3C46A 1UUPA 2C35B 3AFQA 4Q0FA 2ASBA 2EYLA 1M1KC 3IRBA 3H09A 3I73A 4CHTB 1F77A 1F9QA 2NTTA 3K7AH 4N8X1 3DHQA 1K73C 5EPJA 4NB3A 4B08A 3P75A 4B3SQ 4YCUA 3ZJYC 1EY0A 2VQEL 1B53A 4IURA 3FHWA 4YWKA 1STBA 4JI0Q 2NVQB 1KABA 4JI1L 3MXNB 2CH4W 5I4DA 3UE0A 5HY6A 5IWAL 1AE2A 4FDBA 1NMFA 4B3RQ 3R2TA 2IW3A 4PZ6A 3NEMA 1B50A 3OMGA 3RZOB 4X66Q 4GKKQ 2Z1CA 2JSOA 1YNNC 3AQQA 5T1IA 1UEAB 1R9TH 2E76C 1D1IA 3H15A 3OTOL 2KECA 4DGZA 5M9OA 3BDCA 1BO0A 4Y52H 3OWFA 2F0PA 4HR7B 1HNWL 2A73B 3TDQA 3M85A 1QJOA 4GOPC 2R92H 2PNHA 3KF6A 4C2MH 2PYKA 4LF7L 2ZM6Q 3HS0C 1B2TA 4LWCA 5I9PA 4ZYSA 1H95A 1U4RA 3STBD 3M7NA 3MXGA 1EQTA 4A3JH 1OTCA 1EU4A 2ZJQA 1EUJA 4K5XA 4MNOA 1I3QH 1EWIA 1O78A 2L9HA 4IO9A 4EGVA 2R6GA 4C3JG 4BY1H 4DA2A 2PZUA 5D65A 3CC7A 1V1PA 1XXGA 4JK1C 1IBLL 2D62A 1G6PA 1IYVA 2NN6G 5EBDA 4L5SA 1EYDA 2BE5D 4JI2Q 1L0YB 3AU7A 4CKCA 1SNQA 2R93G 3HOXG 4DXGA 2Z0SA 3KLWA 1K83H 2ID0A 3K5NA 3D3RA 2AWOA 4IFDJ 4HMJA 5KEEA 1YBYA 1VQMA 2L15A 1YEZA 1JICA 4FF1A 2AWNA 4KMUC 4PMWA 1BNZA 1EIHA 3DM3A 3TP5A 1QVFA 5EQ0A 5IGFA 1N9WA 1CM9A 1CFMA 3RZOH 2BA0A 4K2LA 5DNFA 1SYGA 2MUYA 4R9WA 4IUNA 1RDPD 4BBRG 2OTLA 4LFBL 2JA5B 5FK9C 5JAVA 4IUTA 4MTNA 3FKIG 1ENAA 2SNMA 1ZKOA 1TKWB 3T53B 4EQPA 2MGSA 3KF6B 3S14B 1S40A 4DK0A 4C3HG 1HJPA 2RCNA 5COYA 2F0OA 4J6HA 4Y7NB 3MZ5A 1SEBD 5HGTA 2B2TC 2ZTDA 1AH9A 4OX9L 1SDFA 2QW7A 1I5FA 4JI6L 5GAGC 2EYFA 2JXMB 4DV2Q 2O5IC 2MJ8A 3CHBD 3EVQA 2JA7B 1V1PB 1B1ZA 2UUCL 1X32A 4LW1A 1ENFA 1YIJA 4IOCA 4LF4L 3T1YQ 1J5EQ 2RHQB 5CV5A 4A3MG 4BY7G 4DR3L 5CORA 4QY7A 4AYBG 1SRUA 3GTMB 4UP9A 2WB1G 3G4SA 1SFOB 2FMMA 5M3MG 2D9UA 3D6CA 2C9OA 5IGBA 2CWPA 2YYZA 2CFMA 1KQSA 2F3VA 3I4LA 5M3FB 2F4VL 4RA8A 2H1EA 5IGGA 4RGMA 1AE3A 1ASYA 1X56A 1G8ZD 1B4OA 1MD2D 1EWHA 1GHJA 3VR3A 3GV3A 5LMNW 4NDXA 1CKNB 4S3SA 3VR6A 3P20A 2KA7A 2UUAL 3S15B 2M9VA 3TMEA 4ME5A 4HIKA 2E2IH 2F0QA 1EU3A 2RSOA 3G6JB 1NMGA 4ME3A 3NENA 4R8NA 3F2UA 1NUCA 1XMOQ 3S14H 2NZHA 1XWEA 5DEHA 2XWJB 4RCOA 5J39A 3HOWH 4L8JA 1Q12A 1SYBA 3JAMi 3TSSA 1VQFA 2AHOB 3A55A 1PDQA 3OPOA 4LFCQ 2O2LD 3CCUA 1M8AA 2B2UC 4YHHL 3M4OB 3PIOA 2L0CA 5HGQA 2A5HA 1W2BA 5A2QL 2I5HA 2RBMA 1VQOA 2IT1A 2A6HD 3NWSA 3ONAB 2E75C 1JJ2A 2ZXOA 3F2CA 3BVGA 3JAMc 1D2BA 3H3VC 5DM63 1F9SA 4A4IA 3A5ZB 3PO2G 2J0TD 2HHHQ 3E9IA 2EJFC 3ICEA 4DUZL 3J80E 4LF6Q 5AJ3L 1JC7A 2C5CA 1WI5A 2LFNA 2IX3A 2PZWA 3FEWX 4R4CA 2E5LQ 4FYDA 1VQDA 2NBFA 3STBC 1SFOH 2EPBA 1MJCA 2F03A 3S1MH 3NPPA 3KLSX 1TWHH 3M3YH 4TQUS 2XRQD 4C3HH 3AMUA 3SDZA 3GO5A 3J80i 1RODA 3CRKC 5FKAC 1K9MC 1IL8A 2NVXB 4M1UB 3I55A 1LLRD 2Y0SB 3BZCA 4B3SL 2OF1A 3T16A 4FF3A 5M5XB 1PH3A 3OIQA 4A3GG 2VUMB 3A8JE 3FMCA 2B8FA 1FNVA 4JI0L 4ZQ3A 1EOTA 5HURA 3DWAA 1NJIC 4DF7A 1IW7C 2DNEA 1EY5A 4TRDA 3CMEA 4B3RL 2DN8A 1VQNA 1A15A 2LSSA 3IFTA 2PW7A 4P73A 4OONA 2JA6B 4X66L 5BR8Q 1YJNA 4GKKL 1HA6A 3K59A 1HQMC 1PLFA 3GQBA 1WJJA 3M4OH 3H0GG 1U4PA 3BU2A 3TP7A 1SYCA 3N52A 2MNAA 2QILA 1OXSC 4LFAQ 1L0XB 3CP0A 1JE5A 4APVA 3E9HA 4QF4A 4KTAA 4QUCA 2F3WA 4DR4Q 3S17B 4XT1B 3NTHA 1R4PB 1Y1VB 2ZM6L 4EX5A 4OO1H 4A3IB 2F0UA 4YWLA 2PPBC 3UDFA 4RMFA 2D5DA 4RG1A 4KK7A 2LMCB 4RKBA 1SYEA 2BH2A 3I4MG 1DM0B 4A3FB 3KDFA 2B63B 2K4KA 1Y1WB 5CV9A 4HJ8A 1BDOA 4A93G 1QNUA 1AN8A 4ZAIA 4DR1Q 1EIYB 1ESFA 5C0XG 1WOCA 1L1OA 1BCPB 2NVXH 1K0RA 2V1CC 4GLAC 4JI2L 1JR0D 2ALYB 1OO9B 4JI8Q 4OHJA 3PUYA 3OIPA 1RKNA 2Q2HA 3GTLB 3QB3A 1VCIA 4DAYA 1TIID 1XTDA 5CC4A 2A69D 1RD9D 1LTBD 1S5DD 5JPNC 2R61A 2IL8A 1I50B 3CU7A 1LUZA 2Z4IA 3KLSA 1EY8A 4DAMA 3QG1A 4BBSB 2AQ2B 3RLNA 1XPUA 3NQTA 4DN4M 2RCFA 2A74C 1I4QA 3DEPA 1II3A 1HA5A 3A8KE 5GAHC 5D3IB 4MZ9A 4UP7A 2F0GA 1QILA 3A7LA 4RH6A 2BOSA 3KOJA 1I6VC 3K0YA 5J1ZA 3L3OC 5TSSA 1GOZA 2EIFA 1PXUA 2Y0SE 4ZUJA 1CHPD 4DV2L 3KDFB 3GTQB 3FDTA 1AP0A 4KLKA 5JEAG 3HOUB 2B2WA 2V4DA 3JAML 1Q1EA 4CDCC 4XDXA 4A3FH 2B63H 3D31A 1N36Q 5C3EH 1L1OB 2K75A 1PH6A 1JB3A 1XTCD 3AFPA 1A8VA 3D4RA 3T1YL 4RAUC 1J5EL 1VQGA 3I72A 3U9SA 1MKHA 3EROA 1VMCA 3FPPA 1YNJC 4YWMA 2HQEA 1D6EC 3I2ZA 3H0GH 3KUPA 4DK3C 5JVG3 4ID6A 4B9XA 1F9PA 2F0FA 2KENA 1VQCA 1KDAA 1LT4D 3GTLH 1C4QA 2NUCA 4P74A 4OEMB 2Z8LA 2UXDQ 3M7GA 3K58A 4O0AA 4DR7Q 4K14A 1JWSD 1N34L 1YJ9A 1SYFA 3NE5B 4A3DG 1CSPA 1D5MC 1ZEQX 3TN2A 2OT2A 5IP7G 4JYAQ 1F9RA 2NB0A 1I50H 5GAEC 1JWUD 2B39A 2A68C 4IFDI 4DK6C 4EQNA 1O7ZA 1OXTA 3TREA 3J81j 4BBSH 4A3BH 1SMYD 1CQVA 1JB7A 5KYLA 3I4MH 2K5VA 2Q8RE 1DXMA 4POFA 4RGOS 2R7DA 1XMOL 3GP7A 3I4NB 3HOYB 5K36H 1VQ6A 1K28A 1LO5D 2GN5A 1XPOA 1Q1BA 1MIUA 1JCKB 5CGKA 3VR5A 1DD2A 4LFCL 1P8LA 4A3EG 1KRSA 1JOKA 4H44C 5A35A 4M8AA 2EYJA 3GTQH 2QA4A 4LUVA 3HOUH 1VQ5A 3S1RH 1JOQA 4XT3B 1A3VA 3ULJA 2K03A 4OWXB 3UE1A 1TWAH 1MI2A 2CQOA 5C0XI 3GTOH 4KN7C 2HHHL 4DR5Q 4LF6L 4KY5A 1K3BC 1N33Q 3U50C 1SJED 2QDLA 4KKTA 1CT1D 3X3NA 2E5LL 1VQIA 1VMPA 2R92B 2BH8A 4JI4Q 4RHRA 2BDNA 3E0JA 1PYSB 1BBWA 5CYUA 1LM0A 4BXXH 2PI2A 4A75A 4A3JB 1IXRA 1JE4A 2UXBQ 2B2YA 1SAPA 2J7ZA 2K01A 4OXPA 3H3VI 2PQAA 2PO4A 1STNA 3J7AV 4DR6Q 4FXGC 1CSQA 1U9RA 4QJFA 4BY1B 1QOHA 4KY7A 1EYGA 5G3LF 1E24A 1G2TA 1N32Q 4ABNA 3SK6A 4JBWA 1Y8PB 5A2QE 2ES2A 1QVGA 3TS0A 3VYRA 4KKUA 3I4NH 3K5LA 3HOYH 1A63A 4K6DA 2EYMA 1KAAA 4JPBW 4NKLA 3C3LA 4LF9Q 3NP8A 3CCQA 2KJXA 1K83B 5BR8L 4JC0A 1HQRD 2JYOA 1VQAA 2SNSA 3SEBA 2WP8J 3LWUA 4HTHA 3P7JA 1WCMG 3LNNA 1BR9A 1PZID 1UE6A 2BA1A 1ILQA 2JA8B 1IYJB 1TR5A 4X62Q 4C3IH 4IUQA 4MHEA 4LFAL 1RF2D 2MO0A 2EYOA 2IHFA 5CV8A 1VS0A 4DR4L 3NTIA 3HOZG 4J15A 3E6ZX 2EXZA 1H9SA 5DM73 5C3XA 5IODA 5JJIA 4UP8A 2GVBA 5FLMH 1I6HH 2UU9Q 4G7OC 2L5TA 1NAPA 1RCVD 1MGSA 3W1BA 2QF7A 2WIIB 1WTHA 4Z9CB 4K2KA 3S9WA 2JEAI 4G4KA 3NELA 1IBML 4MTKA 2CWAA 1UE5A 1SYDA 3D6WA 2PQAB 2CW0C 3HZXA 4AQYQ 3I8ZA 3IAYA 4DR1L 5C4XG 1QCBD 1VQJA 1TS4A 1G2SA 1PRTF 4R4IA 2NVYH 1FNUA 1SNDA 3CCRA 4C1NI 2EVBA 2VZAA 4JI8L 3L9AX 2EE1A 4CKEA 4L6TB 2F0NA 5T1GA 4LF8Q 4YY3Q 2J4XA 2LXKA 2HDMA 1EY9A 1UEBA 2FXQA 4R1JA 1VQHA 1Z6HA 3PCOB 3BZKA 3PUWA 4V0BA 1HUMA 2NVTB 1XNQQ 3GTKB 2F1MA 1LYLA 1X3PA 4F7XA 1VF7A 4RGNA 4JBJA 3U9OA 2VB3X 1KAWA 2K5QA 3RD4A 4DKAC 3BYTB 4H0LC 1N8RC 5IYBH 4A3CG 4DXFA 5CV4A 2JA8H 1QVCA 3J7A5 1DZ1A 4TVAB 2Q8IB 1RHPA 3FVQA 5BN3A 2K52A 4HAEA 5NUCA 2H4OA 1SMYC 4ZKCB 1I4PA 2IX1A 2RKSA 2FFKB 2JA7G 4HCSA 2KCTA 4A3LH 2RVLA 3CXCA 2E2IB 1F2MA 2WV6D 2ICIA 3PIPA 4IPDA 4TKOB 4C3JB 1KNEA 1ASZA 3OW7A 5E3FA 1JJCB 5H1SE 2LY7A 1FNWA 2XSCA 4BA2I 3HOWB 3HGBA 3ERQA 1O7IA 1PTOF 4X3TA 1YI2A 4XQJA 1N36L 1A0IA 4R4QA 4IJLA 4XQQA 1AZPA 2R93B
chains in the Genus database with same CATH topology
1FGUA 2PMZE 1FJGL 1SE8A 3TQYA 3F1ZA 1X3GA 1PH3A 4NXML 1X9NA 3TEHB 4P72A 4B3TQ 5M3FG 3CCMA 1M90C 1HR0W 4A3GG 1PYBA 2HIVA 4LF5L 4JI0L 3L0OA 1VQ8A 3CD6A 1I94Q 3G6EA 1WCMH 1V43A 2DUDA 3WWVA 1PH9A 4OX9Q 1Y1WH 2GVAA 1NJIC 4JV5Q 4L5TA 1PV4A 4JI6Q 3CMEA 1HNZL 3I4NG 4YCWA 1EQRA 3HOYG 4B3RL 2N78A 1VQNA 1X3EA 2LSSA 4P73A 2UXDL 4OONA 2KHIA 1FVIA 1CUKA 2YTXA 4X66L 5BR8Q 4HJ5A 1QUQA 4A3KG 1YJNA 5FJ8G 2HT1A 4DR7L 4A3DH 4DV5L 5C44G 2UUCQ 3HOZH 5IP7H 3JC66 2B29A 2NVTH 1WJJA 1SN8A 2YTYA 3M4OH 1NBWA 3H0GG 4JYAL 3GTKH 2IY5B 3BU2A 1EOVA 4L5QA 1PHJA 2I5MX 1Q86C 4LF4Q 4DUYQ 1TWGH 2MNAA 5DLQE 2IX0A 3CPWA 1OXSC 4LFAQ 1W3SA 4DR3Q 3CP0A 1JE5A 1V1QA 2JE6I 4APVA 3AYHB 3E9HA 4DR4Q 1XJVA 2EQSA 1VQPA 3LGJA 4GN4B 4DV6L 1CKMA 1BVSA 2PI2E 2LXJA 2ZM6L 4DV3L 4EX5A 3OW2A 4GKJQ 3KFUA 2HIXA 2R7FA 4YWLA 5FLMG 3S2HH 3UDFA 4RMFA 2A19A 4JG2A 1IBKQ 4RG1A 1HNXL 4IJHA 2F4VQ 1JJGA 1X55A 2JK8A 4DV4L 1Q82C 2BH2A 4X65Q 4A3EH 2JEBI 2WAQG 1S72A 1WYDA 1HR0Q 3I4MG 2HQLA 4GLXA 3KDFA 4C3JH 4JI5L 4DV3Q 2K4KA 2MFIA 3TRZA 4HJ8A 1G51A 4NPSA 4JI3L 1HZ9A 1Q81C 1J6QA 3RZDH 4A93G 1L2FA 4DV7Q 3UDXA 4KHPQ 4DR1Q 1EIYB 3AEVA 2UUAQ 3PO3G 5IYDH 3A0JA 5C0XG 5IE8A 4GN5A 2JA5G 1WOCA 1L1OA 4GLVB 3HKZG 2NVXH 1TWFH 2EXDA 2WFWA 4DR2Q 1PH7A 1K0RA 2V1CC 4KHZA 4GLAC 4JI2L 2ALYB 1SLJA 5IYCG 1PVOA 4BY1G 2R93H 3S24A 1PA6A 1MJEA 5EAYA 4PZ8A 4JI8Q 3PUYA 3HOXH 4DR5L 3H3VH 1IZ6A 1C0AA 2Q2HA 1C7YA 4ALPA 1VCIA 2VS1A 5GQOA 2VQFL 3T1HL 1N33L 3G48A 3U4ZA 4R4TA 4XIGS 4BA1I 3HOWG 1XTDA 2R7ZG 1UE1A 1YHBA 3SGIA 4JI7Q 4JI4L 3S1QH 2XTIA 2ZTEA 3K80C 2Q2UA 1QUQB 5M5WH 2ZTCA 2ZJPA 2KBNA 3PSIA 3MEFA 2YTVA 2Q2TA 3HKSA 1XMQL 4DV0Q 2UUBQ 1IL2A 1FL0A 5LMNQ 1LUZA 1K8GA 1KIXA 4BBRH 3FP9A 4DAMA 1L1OC 1X54A 3U4VA 2NVQH 5E7NA 3J7ZC 3CCEA 1EQQA 2H5XA 5ELOA 4GN3B 2UXBL 3FKIH 3RLNA 5IYBG 3EBEA 3KJOA 1XPUA 1KL9A 4DR6L 3PGZA 3OYYA 4K0KL 2JA8G 4X64L 5GAHC 2Q2IA 3M4PA 4DUZQ 1XPRA 1RL2A 4MZ9A 4UP7A 3CCVA 5AJ3Q 1K3RA 1N32L 3K7UC 3S2DH 2E2HH 3KOJA 4HIMA 3L2PA 1HZCA 5FLXc 1S3OA 4WJ4A 2IHEA 5M5YH 1U0LA 2UXCL 3W5OA 4HJ7A 3U58A 4POGA 4A3LG 1VQBA 4P71A 1X65A 2C35B 2EIFA 5IP9G 1CKNA 3AFQA 2Y0SE 2ASBA 3A5UA 1KD1C 1M1KC 1YITA 3IRBA 4DV2L 3KDFB 1X6OA 4LF9L 1KHIA 4KLKA 5JEAG 5LMUL 3F2DA 1Q1EA 4KI0A 1Z47A 2N49A 3K7AH 3S16H 3S1NH 4A3FH 2KHJA 1SMXA 3D31A 2B63H 1N36Q 1K73C 5C3EH 4DV1L 4GNXA 1L1OB 2K75A 4NB3A 1PH6A 3AFPA 4JCVE 1A8VA 3T1YL 4X62L 1J5EL 1VQGA 4B3SQ 2A8VA 4A3MH 3GTPH 4BY7H 1FJGQ 4YCUA 3ZJYC 1MKHA 3K8AA 4NXMQ 5C0XJ 2VQEL 4A3KH 5C4JH 4LF5Q 3FHWA 4JBMA 4IPCA 4YWKA 4JI0Q 4JI1L 4YWMA 3VDYA 3HOVG 4IFDG 1QZGA 4GOPA 5M3MH 3I2ZA 3MXNB 3H0GH 3UE0A 4DK3C 4UPAA 2Z6KA 5HY6A 1KRTA 5IWAL 3PUZA 2UU9L 2KENA 1AE2A 1NE3A 1VQCA 4FDBA 1NMFA 2K5HA 3ULPA 1Y1WG 1HNZQ 3GTLH 4B3RQ 1PH2A 4P74A 3KYHC 3NEMA 4PZ6A 2F52A 2UXDQ 1KC8C 4X66Q 4GKKQ 4O0AA 4B3ML 4DR7Q 3CW2C 4DV5Q 1N34L 1YJ9A 2YU9H 3AQQA 2OCEA 4A3DG 1CSPA 4L5RC 3B6YA 5IP7G 1R9TH 3GD7A 4GNXC 4JYAQ 3H15A 2E2JH 1C9OA 3OTOL 5ELNA 1I50H 2ZJRA 4XTCS 1T9HA 5GAEC 1RIPA 3EN2A 4IFDI 5C4XH 4DK6C 1VQEA 4AQYL 4Y52H 2XGTA 4HJ9A 3RNUA 1OXTA 3TREA 3G71A 4IPHA 3J81j 1HNWL 4BBSH 4A3BH 2CKZB 1P16A 3M85A 3KJPA 4DV6Q 2I0QA 1JB7A 4GOPC 2K5VA 1N34Q 2PNHA 3KF6A 4C2MH 2R92H 3I4MH 4LF7L 2ZM6Q 4LWCA 2Z6KC 1JMCA 3I7FA 4POFA 3CCJA 5GROA 5GADC 1H95A 2R7DA 3PUXA 3STBD 1XMOL 4OWWB 4OO1G 4QQBX 1DGSA 3M7NA 1VQ6A 2GN5A 1YHQA 3CQZH 4LF8L 4YY3L 4A3JH 1Q1BA 1XPOA 1HNXQ 1OTCA 1MIUA 3UDIA 4DV4Q 2JA5H 1EUJA 2ZJQA 4MNOA 4AYBE 1I3QH 4LFCL 4NXNL 2MO1A 3PUVA 1EWIA 1P8LA 2D0OA 4A3EG 1XNRL 2WB1E 1KRSA 4IO9A 1YZ6A 1WFQA 4JI5Q 1XNQL 2R6GA 4PZ7A 4BY1H 4JI3Q 3RLOA 1UE7A 3CC7A 3RN5A 3GTQH 3RLFA 2QA4A 5JEAJ 4LUVA 3HOUH 4X6AH 4GNXB 1VQ5A 1IBLL 2D62A 1HZAA 3S1RH 4A76A 1G6PA 2F3IA 4R4OA 3ULLA 2VW9A 1D7QA 5IYDG 2NN6G 4Y7NH 4L5SA 4A3CH 4OO1I 3ULJA 3RR5A 4OWXB 3UE1A 1TWAH 1E22A 2CQOA 4JI2Q 5C0XI 2AMCB 3DLLA 3GTOH 3PO2H 2Y0SG 2OTJA 1LTLA 2HHHL 2R93G 4DR5Q 4GOPB 3TS2A 1GKHA 3HOXG 1BBUA 2Z0SA 3KLWA 4LF6L 1K83H 2ID0A 2VUMG 2VQFQ 3T1HQ 3U50C 3CCLA 1PH8A 1N33Q 2JA7H 3PF5A 4JBKA 2AWOA 2QGQA 2E5LL 5J3BA 4IFDJ 1VQIA 1YBYA 2BH8A 1VQMA 2L15A 1E1TA 3GTJH 1YEZA 4JI4Q 1GM5A 2OWOA 2AWNA 2RF4A 4GS3A 4PMWA 3ER0A 1PYSB 4GKKL 1BBWA 2NN6I 3DM3A 1B70B 4HJAA 4DPGA 4QGUA 1XMQQ 1QVFA 3GTGH 1LM0A 4HIOA 4BXXH 1N9WA 3CC2A 3RZOH 2BA0A 2PI2A 2JA6G 4A75A 2OTLA 4LFBL 4BBRG 3A74A 1IXRA 3CF5A 1HZBA 1SR3A 3GTMH 2UXBQ 3HKZE 4OXPA 3H3VI 2PQAA 4MTNA 3FKIG 4DR6Q 1KXLA 2KCMA 1NTGA 1CSQA 3L7ZC 4K0KQ 4QJFA 4X64Q 3KF6B 2AKWB 4LUOA 1GVPA 1S40A 1EYGA 2A1AA 4A3GH 1HJPA 1E24A 2RCNA 5M3FH 1YJWA 4B3TL 2MQHA 3CCSA 2JA9A 1N32Q 4O2DA 1PFSA 4JBWA 4H02A 1I94L 4AH6A 2ES2A 2UXCQ 1QVGA 1Y1VG 4P75A 2ZTDA 3TS0A 1AH9A 4OX9L 3I4NH 1I5FA 4A3IG 4JV5L 2K50A 3HOYH 4JI6L 5GAGC 1A63A 3NBHB 4DV2Q 4LF9Q 3CCQA 5LMUQ 5FJ8H 4JC0A 5BR8L 3S15H 5C44H 1VQAA 2WP8J 2UUCL 3HOVH 4LW1A 1OXXK 4DAYB 3J80c 1YIJA 1WCMG 4IOCA 4A3FG 2B63G 1B8AA 1UE6A 2BA1A 4DV1Q 3D0FA 1IYJB 1Y14B 5C3EG 1CKOA 3T1YQ 4LF4L 4X62Q 3K81C 4DUYL 2RHQB 4C3IH 1J5EQ 4LFAL 1PH1A 4A3MG 3KF8B 4BY7G 2MO0A 3GDEA 4DR3L 2IHFA 2VQEQ 2VNUD 4QY7A 1VS0A 4AYBG 2RHSB 4DR4L 1SRUA 3M4QA 4JI1Q 2QEXA 1EFWA 4J15A 3HOZG 4UP9A 1E7ZA 2WB1G 1PH5A 2ATWA 1PH4A 2VY3A 3G4SA 5JJIA 1VQLA 5M3MG 4QIWE 4GKJL 4UP8A 2GVBA 3Q8DA 5FLMH 5IWAQ 1I6HH 2UU9Q 2CWPA 2YYZA 2YV5A 2CFMA 1KQSA 3W1BA 1IBKL 3EIVA 2F4VL 4B3MQ 3BJUA 4X65L 1AE3A 1HR0L 1ASYA 1X56A 3I4OA 2JEAI 3NELA 2E8GA 1IBML 3RN2A 3OTOQ 4A93H 2CWAA 1UE5A 5LMNW 2PQAB 1VQKA 3CC4A 4DV7L 4AQYQ 1CKNB 3PO3H 4DR1L 4KHPL 5C4XG 1VQJA 3J81i 2UUAL 1HNWQ 1V9PA 4QL5A 3PV0A 1VQ4A 5JJLA 4IPGA 4HIKA 4A3BG 4BBSG 4R4IA 2NVYH 2E2IH 1X3FA 4DR2L 1VQ9A 5IYCH 3CCRA 4LF7Q 2VZAA 2R92G 1NMGA 2DGYA 3UDGA 4ME3A 3NENA 2N8NA 5JJKA 3K0XA 1IBMQ 1XMOQ 3S14H 4JI8L 2NZHA 1B7YB 1YHAA 1UWVA 5K36G 1D8LA 4LF8Q 4YY3Q 2LXKA 3HOWH 1TWCH 5IY0A 1K8AC 1Q12A 4A3JG 3J81c 4LNQA 2R7ZH 3JAMi 4YCVA 2K5NA 1UEBA 1VQFA 2AHOB 2FXQA 4R1JA 4LFCQ 1U5KA 1VQHA 4OWTB 4JI7L 4NXNQ 2D0PA 3PCOB 1XNRQ 3BZKA 1G291 3CCUA 4JOIA 3PUWA 2CCZA 4UY8C 4YHHL 3PIOA 1XNQQ 4DNIA 5HGQA 2JQOA 1LYLA 1W2BA 1TXYA 1VQOA 2I5HA 4DV0L 2UUBL 4AIMA 2OQ0A 4JBJA 5M5XH 2K14A 5LMNL 1IBLQ 3HOUG 2IT1A 2VUMH 2OQKA 1KAWA 1OXUA 3F8TA 4EQ5A 1JJ2A 4DKAC 3F2CA 1N8RC 1BKBA 5IYBH 3W1GA 3JAMc 1HH2P 4A3CG 2WAQE 2JA8H 1QVCA 4HIDA 3J7A5 1SROA 4PG3A 4TVAB 3A5ZB 4A4IA 4YHHQ 3F2BA 3PO2G 1JT8A 2HHHQ 3E9IA 2K52A 3ICEA 4DUZL 4IOAA 4LUZA 1VQ7A 3I56A 1GD7A 5AJ3L 4LF6Q 1WI5A 2JA6H 3CAMA 3CMAA 2IX1A 2I5LX 3ERSX 4R4CA 2E5LQ 2JA7G 2KCTA 1VQDA 2N3SA 3CXCA 4A3LH 3STBC 1SFOH 1Q8KA 4JOIC 2NZOA 1L0WA 5IP9H 1MJCA 3PIPA 4IPDA 1Q7YC 1ASZA 1GO3E 4WJ3M 1Z9FA 2B3GA 3S1MH 1JJCB 1TWHH 3E0EA 3M3YH 5H1SE 1EIFA 4TQUS 4C3HH 4BXXG 4BA2I 4LFBQ 3GO5A 3M9BA 1QZHA 1E1OA 3J80i 5IT9c 1K9MC 3S17H 1O7IA 1YVCA 3PF4A 3HFZB 1Y1VH 3CPFA 1A62A 1Q46A 3I55A 1YI2A 1N36L 1A0IA 4R4QA 4A3IH 1NY4A 1OXVA 3BZCA 1YNXA 4IJLA 2JJQA 1E3PA 4B3SL 2VL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGU A;  2PMZ E;  1FJG L;  1SE8 A;  3TQY A;  3F1Z A;  1X3G A;  1PH3 A;  4NXM L;  1X9N A;  3TEH B;  4P72 A;  4B3T Q;  5M3F G;  3CCM A;  1M90 C;  1HR0 W;  4A3G G;  1PYB A;  2HIV A;  4LF5 L;  4JI0 L;  3L0O A;  1VQ8 A;  3CD6 A;  1I94 Q;  3G6E A;  1WCM H;  1V43 A;  2DUD A;  3WWV A;  1PH9 A;  4OX9 Q;  1Y1W H;  2GVA A;  1NJI C;  4JV5 Q;  4L5T A;  1PV4 A;  4JI6 Q;  3CME A;  1HNZ L;  3I4N G;  4YCW A;  1EQR A;  3HOY G;  4B3R L;  2N78 A;  1VQN A;  1X3E A;  2LSS A;  4P73 A;  2UXD L;  4OON A;  2KHI A;  1FVI A;  1CUK A;  2YTX A;  4X66 L;  5BR8 Q;  4HJ5 A;  1QUQ A;  4A3K G;  1YJN A;  5FJ8 G;  2HT1 A;  4DR7 L;  4A3D H;  4DV5 L;  5C44 G;  2UUC Q;  3HOZ H;  5IP7 H;  3JC6 6;  2B29 A;  2NVT H;  1WJJ A;  1SN8 A;  2YTY A;  3M4O H;  1NBW A;  3H0G G;  4JYA L;  3GTK H;  2IY5 B;  3BU2 A;  1EOV A;  4L5Q A;  1PHJ A;  2I5M X;  1Q86 C;  4LF4 Q;  4DUY Q;  1TWG H;  2MNA A;  5DLQ E;  2IX0 A;  3CPW A;  1OXS C;  4LFA Q;  1W3S A;  4DR3 Q;  3CP0 A;  1JE5 A;  1V1Q A;  2JE6 I;  4APV A;  3AYH B;  3E9H A;  4DR4 Q;  1XJV A;  2EQS A;  1VQP A;  3LGJ A;  4GN4 B;  4DV6 L;  1CKM A;  1BVS A;  2PI2 E;  2LXJ A;  2ZM6 L;  4DV3 L;  4EX5 A;  3OW2 A;  4GKJ Q;  3KFU A;  2HIX A;  2R7F A;  4YWL A;  5FLM G;  3S2H H;  3UDF A;  4RMF A;  2A19 A;  4JG2 A;  1IBK Q;  4RG1 A;  1HNX L;  4IJH A;  2F4V Q;  1JJG A;  1X55 A;  2JK8 A;  4DV4 L;  1Q82 C;  2BH2 A;  4X65 Q;  4A3E H;  2JEB I;  2WAQ G;  1S72 A;  1WYD A;  1HR0 Q;  3I4M G;  2HQL A;  4GLX A;  3KDF A;  4C3J H;  4JI5 L;  4DV3 Q;  2K4K A;  2MFI A;  3TRZ A;  4HJ8 A;  1G51 A;  4NPS A;  4JI3 L;  1HZ9 A;  1Q81 C;  1J6Q A;  3RZD H;  4A93 G;  1L2F A;  4DV7 Q;  3UDX A;  4KHP Q;  4DR1 Q;  1EIY B;  3AEV A;  2UUA Q;  3PO3 G;  5IYD H;  3A0J A;  5C0X G;  5IE8 A;  4GN5 A;  2JA5 G;  1WOC A;  1L1O A;  4GLV B;  3HKZ G;  2NVX H;  1TWF H;  2EXD A;  2WFW A;  4DR2 Q;  1PH7 A;  1K0R A;  2V1C C;  4KHZ A;  4GLA C;  4JI2 L;  2ALY B;  1SLJ A;  5IYC G;  1PVO A;  4BY1 G;  2R93 H;  3S24 A;  1PA6 A;  1MJE A;  5EAY A;  4PZ8 A;  4JI8 Q;  3PUY A;  3HOX H;  4DR5 L;  3H3V H;  1IZ6 A;  1C0A A;  2Q2H A;  1C7Y A;  4ALP A;  1VCI A;  2VS1 A;  5GQO A;  2VQF L;  3T1H L;  1N33 L;  3G48 A;  3U4Z A;  4R4T A;  4XIG S;  4BA1 I;  3HOW G;  1XTD A;  2R7Z G;  1UE1 A;  1YHB A;  3SGI A;  4JI7 Q;  4JI4 L;  3S1Q H;  2XTI A;  2ZTE A;  3K80 C;  2Q2U A;  1QUQ B;  5M5W H;  2ZTC A;  2ZJP A;  2KBN A;  3PSI A;  3MEF A;  2YTV A;  2Q2T A;  3HKS A;  1XMQ L;  4DV0 Q;  2UUB Q;  1IL2 A;  1FL0 A;  5LMN Q;  1LUZ A;  1K8G A;  1KIX A;  4BBR H;  3FP9 A;  4DAM A;  1L1O C;  1X54 A;  3U4V A;  2NVQ H;  5E7N A;  3J7Z C;  3CCE A;  1EQQ A;  2H5X A;  5ELO A;  4GN3 B;  2UXB L;  3FKI H;  3RLN A;  5IYB G;  3EBE A;  3KJO A;  1XPU A;  1KL9 A;  4DR6 L;  3PGZ A;  3OYY A;  4K0K L;  2JA8 G;  4X64 L;  5GAH C;  2Q2I A;  3M4P A;  4DUZ Q;  1XPR A;  1RL2 A;  4MZ9 A;  4UP7 A;  3CCV A;  5AJ3 Q;  1K3R A;  1N32 L;  3K7U C;  3S2D H;  2E2H H;  3KOJ A;  4HIM A;  3L2P A;  1HZC A;  5FLX c;  1S3O A;  4WJ4 A;  2IHE A;  5M5Y H;  1U0L A;  2UXC L;  3W5O A;  4HJ7 A;  3U58 A;  4POG A;  4A3L G;  1VQB A;  4P71 A;  1X65 A;  2C35 B;  2EIF A;  5IP9 G;  1CKN A;  3AFQ A;  2Y0S E;  2ASB A;  3A5U A;  1KD1 C;  1M1K C;  1YIT A;  3IRB A;  4DV2 L;  3KDF B;  1X6O A;  4LF9 L;  1KHI A;  4KLK A;  5JEA G;  5LMU L;  3F2D A;  1Q1E A;  4KI0 A;  1Z47 A;  2N49 A;  3K7A H;  3S16 H;  3S1N H;  4A3F H;  2KHJ A;  1SMX A;  3D31 A;  2B63 H;  1N36 Q;  1K73 C;  5C3E H;  4DV1 L;  4GNX A;  1L1O B;  2K75 A;  4NB3 A;  1PH6 A;  3AFP A;  4JCV E;  1A8V A;  3T1Y L;  4X62 L;  1J5E L;  1VQG A;  4B3S Q;  2A8V A;  4A3M H;  3GTP H;  4BY7 H;  1FJG Q;  4YCU A;  3ZJY C;  1MKH A;  3K8A A;  4NXM Q;  5C0X J;  2VQE L;  4A3K H;  5C4J H;  4LF5 Q;  3FHW A;  4JBM A;  4IPC A;  4YWK A;  4JI0 Q;  4JI1 L;  4YWM A;  3VDY A;  3HOV G;  4IFD G;  1QZG A;  4GOP A;  5M3M H;  3I2Z A;  3MXN B;  3H0G H;  3UE0 A;  4DK3 C;  4UPA A;  2Z6K A;  5HY6 A;  1KRT A;  5IWA L;  3PUZ A;  2UU9 L;  2KEN A;  1AE2 A;  1NE3 A;  1VQC A;  4FDB A;  1NMF A;  2K5H A;  3ULP A;  1Y1W G;  1HNZ Q;  3GTL H;  4B3R Q;  1PH2 A;  4P74 A;  3KYH C;  3NEM A;  4PZ6 A;  2F52 A;  2UXD Q;  1KC8 C;  4X66 Q;  4GKK Q;  4O0A A;  4B3M L;  4DR7 Q;  3CW2 C;  4DV5 Q;  1N34 L;  1YJ9 A;  2YU9 H;  3AQQ A;  2OCE A;  4A3D G;  1CSP A;  4L5R C;  3B6Y A;  5IP7 G;  1R9T H;  3GD7 A;  4GNX C;  4JYA Q;  3H15 A;  2E2J H;  1C9O A;  3OTO L;  5ELN A;  1I50 H;  2ZJR A;  4XTC S;  1T9H A;  5GAE C;  1RIP A;  3EN2 A;  4IFD I;  5C4X H;  4DK6 C;  1VQE A;  4AQY L;  4Y52 H;  2XGT A;  4HJ9 A;  3RNU A;  1OXT A;  3TRE A;  3G71 A;  4IPH A;  3J81 j;  1HNW L;  4BBS H;  4A3B H;  2CKZ B;  1P16 A;  3M85 A;  3KJP A;  4DV6 Q;  2I0Q A;  1JB7 A;  4GOP C;  2K5V A;  1N34 Q;  2PNH A;  3KF6 A;  4C2M H;  2R92 H;  3I4M H;  4LF7 L;  2ZM6 Q;  4LWC A;  2Z6K C;  1JMC A;  3I7F A;  4POF A;  3CCJ A;  5GRO A;  5GAD C;  1H95 A;  2R7D A;  3PUX A;  3STB D;  1XMO L;  4OWW B;  4OO1 G;  4QQB X;  1DGS A;  3M7N A;  1VQ6 A;  2GN5 A;  1YHQ A;  3CQZ H;  4LF8 L;  4YY3 L;  4A3J H;  1Q1B A;  1XPO A;  1HNX Q;  1OTC A;  1MIU A;  3UDI A;  4DV4 Q;  2JA5 H;  1EUJ A;  2ZJQ A;  4MNO A;  4AYB E;  1I3Q H;  4LFC L;  4NXN L;  2MO1 A;  3PUV A;  1EWI A;  1P8L A;  2D0O A;  4A3E G;  1XNR L;  2WB1 E;  1KRS A;  4IO9 A;  1YZ6 A;  1WFQ A;  4JI5 Q;  1XNQ L;  2R6G A;  4PZ7 A;  4BY1 H;  4JI3 Q;  3RLO A;  1UE7 A;  3CC7 A;  3RN5 A;  3GTQ H;  3RLF A;  2QA4 A;  5JEA J;  4LUV A;  3HOU H;  4X6A H;  4GNX B;  1VQ5 A;  1IBL L;  2D62 A;  1HZA A;  3S1R H;  4A76 A;  1G6P A;  2F3I A;  4R4O A;  3ULL A;  2VW9 A;  1D7Q A;  5IYD G;  2NN6 G;  4Y7N H;  4L5S A;  4A3C H;  4OO1 I;  3ULJ A;  3RR5 A;  4OWX B;  3UE1 A;  1TWA H;  1E22 A;  2CQO A;  4JI2 Q;  5C0X I;  2AMC B;  3DLL A;  3GTO H;  3PO2 H;  2Y0S G;  2OTJ A;  1LTL A;  2HHH L;  2R93 G;  4DR5 Q;  4GOP B;  3TS2 A;  1GKH A;  3HOX G;  1BBU A;  2Z0S A;  3KLW A;  4LF6 L;  1K83 H;  2ID0 A;  2VUM G;  2VQF Q;  3T1H Q;  3U50 C;  3CCL A;  1PH8 A;  1N33 Q;  2JA7 H;  3PF5 A;  4JBK A;  2AWO A;  2QGQ A;  2E5L L;  5J3B A;  4IFD J;  1VQI A;  1YBY A;  2BH8 A;  1VQM A;  2L15 A;  1E1T A;  3GTJ H;  1YEZ A;  4JI4 Q;  1GM5 A;  2OWO A;  2AWN A;  2RF4 A;  4GS3 A;  4PMW A;  3ER0 A;  1PYS B;  4GKK L;  1BBW A;  2NN6 I;  3DM3 A;  1B70 B;  4HJA A;  4DPG A;  4QGU A;  1XMQ Q;  1QVF A;  3GTG H;  1LM0 A;  4HIO A;  4BXX H;  1N9W A;  3CC2 A;  3RZO H;  2BA0 A;  2PI2 A;  2JA6 G;  4A75 A;  2OTL A;  4LFB L;  4BBR G;  3A74 A;  1IXR A;  3CF5 A;  1HZB A;  1SR3 A;  3GTM H;  2UXB Q;  3HKZ E;  4OXP A;  3H3V I;  2PQA A;  4MTN A;  3FKI G;  4DR6 Q;  1KXL A;  2KCM A;  1NTG A;  1CSQ A;  3L7Z C;  4K0K Q;  4QJF A;  4X64 Q;  3KF6 B;  2AKW B;  4LUO A;  1GVP A;  1S40 A;  1EYG A;  2A1A A;  4A3G H;  1HJP A;  1E24 A;  2RCN A;  5M3F H;  1YJW A;  4B3T L;  2MQH A;  3CCS A;  2JA9 A;  1N32 Q;  4O2D A;  1PFS A;  4JBW A;  4H02 A;  1I94 L;  4AH6 A;  2ES2 A;  2UXC Q;  1QVG A;  1Y1V G;  4P75 A;  2ZTD A;  3TS0 A;  1AH9 A;  4OX9 L;  3I4N H;  1I5F A;  4A3I G;  4JV5 L;  2K50 A;  3HOY H;  4JI6 L;  5GAG C;  1A63 A;  3NBH B;  4DV2 Q;  4LF9 Q;  3CCQ A;  5LMU Q;  5FJ8 H;  4JC0 A;  5BR8 L;  3S15 H;  5C44 H;  1VQA A;  2WP8 J;  2UUC L;  3HOV H;  4LW1 A;  1OXX K;  4DAY B;  3J80 c;  1YIJ A;  1WCM G;  4IOC A;  4A3F G;  2B63 G;  1B8A A;  1UE6 A;  2BA1 A;  4DV1 Q;  3D0F A;  1IYJ B;  1Y14 B;  5C3E G;  1CKO A;  3T1Y Q;  4LF4 L;  4X62 Q;  3K81 C;  4DUY L;  2RHQ B;  4C3I H;  1J5E Q;  4LFA L;  1PH1 A;  4A3M G;  3KF8 B;  4BY7 G;  2MO0 A;  3GDE A;  4DR3 L;  2IHF A;  2VQE Q;  2VNU D;  4QY7 A;  1VS0 A;  4AYB G;  2RHS B;  4DR4 L;  1SRU A;  3M4Q A;  4JI1 Q;  2QEX A;  1EFW A;  4J15 A;  3HOZ G;  4UP9 A;  1E7Z A;  2WB1 G;  1PH5 A;  2ATW A;  1PH4 A;  2VY3 A;  3G4S A;  5JJI A;  1VQL A;  5M3M G;  4QIW E;  4GKJ L;  4UP8 A;  2GVB A;  3Q8D A;  5FLM H;  5IWA Q;  1I6H H;  2UU9 Q;  2CWP A;  2YYZ A;  2YV5 A;  2CFM A;  1KQS A;  3W1B A;  1IBK L;  3EIV A;  2F4V L;  4B3M Q;  3BJU A;  4X65 L;  1AE3 A;  1HR0 L;  1ASY A;  1X56 A;  3I4O A;  2JEA I;  3NEL A;  2E8G A;  1IBM L;  3RN2 A;  3OTO Q;  4A93 H;  2CWA A;  1UE5 A;  5LMN W;  2PQA B;  1VQK A;  3CC4 A;  4DV7 L;  4AQY Q;  1CKN B;  3PO3 H;  4DR1 L;  4KHP L;  5C4X G;  1VQJ A;  3J81 i;  2UUA L;  1HNW Q;  1V9P A;  4QL5 A;  3PV0 A;  1VQ4 A;  5JJL A;  4IPG A;  4HIK A;  4A3B G;  4BBS G;  4R4I A;  2NVY H;  2E2I H;  1X3F A;  4DR2 L;  1VQ9 A;  5IYC H;  3CCR A;  4LF7 Q;  2VZA A;  2R92 G;  1NMG A;  2DGY A;  3UDG A;  4ME3 A;  3NEN A;  2N8N A;  5JJK A;  3K0X A;  1IBM Q;  1XMO Q;  3S14 H;  4JI8 L;  2NZH A;  1B7Y B;  1YHA A;  1UWV A;  5K36 G;  1D8L A;  4LF8 Q;  4YY3 Q;  2LXK A;  3HOW H;  1TWC H;  5IY0 A;  1K8A C;  1Q12 A;  4A3J G;  3J81 c;  4LNQ A;  2R7Z H;  3JAM i;  4YCV A;  2K5N A;  1UEB A;  1VQF A;  2AHO B;  2FXQ A;  4R1J A;  4LFC Q;  1U5K A;  1VQH A;  4OWT B;  4JI7 L;  4NXN Q;  2D0P A;  3PCO B;  1XNR Q;  3BZK A;  1G29 1;  3CCU A;  4JOI A;  3PUW A;  2CCZ A;  4UY8 C;  4YHH L;  3PIO A;  1XNQ Q;  4DNI A;  5HGQ A;  2JQO A;  1LYL A;  1W2B A;  1TXY A;  1VQO A;  2I5H A;  4DV0 L;  2UUB L;  4AIM A;  2OQ0 A;  4JBJ A;  5M5X H;  2K14 A;  5LMN L;  1IBL Q;  3HOU G;  2IT1 A;  2VUM H;  2OQK A;  1KAW A;  1OXU A;  3F8T A;  4EQ5 A;  1JJ2 A;  4DKA C;  3F2C A;  1N8R C;  1BKB A;  5IYB H;  3W1G A;  3JAM c;  1HH2 P;  4A3C G;  2WAQ E;  2JA8 H;  1QVC A;  4HID A;  3J7A 5;  1SRO A;  4PG3 A;  4TVA B;  3A5Z B;  4A4I A;  4YHH Q;  3F2B A;  3PO2 G;  1JT8 A;  2HHH Q;  3E9I A;  2K52 A;  3ICE A;  4DUZ L;  4IOA A;  4LUZ A;  1VQ7 A;  3I56 A;  1GD7 A;  5AJ3 L;  4LF6 Q;  1WI5 A;  2JA6 H;  3CAM A;  3CMA A;  2IX1 A;  2I5L X;  3ERS X;  4R4C A;  2E5L Q;  2JA7 G;  2KCT A;  1VQD A;  2N3S A;  3CXC A;  4A3L H;  3STB C;  1SFO H;  1Q8K A;  4JOI C;  2NZO A;  1L0W A;  5IP9 H;  1MJC A;  3PIP A;  4IPD A;  1Q7Y C;  1ASZ A;  1GO3 E;  4WJ3 M;  1Z9F A;  2B3G A;  3S1M H;  1JJC B;  1TWH H;  3E0E A;  3M3Y H;  5H1S E;  1EIF A;  4TQU S;  4C3H H;  4BXX G;  4BA2 I;  4LFB Q;  3GO5 A;  3M9B A;  1QZH A;  1E1O A;  3J80 i;  5IT9 c;  1K9M C;  3S17 H;  1O7I A;  1YVC A;  3PF4 A;  3HFZ B;  1Y1V H;  3CPF A;  1A62 A;  1Q46 A;  3I55 A;  1YI2 A;  1N36 L;  1A0I A;  4R4Q A;  4A3I H;  1NY4 A;  1OXV A;  3BZC A;  1YNX A;  4IJL A;  2JJQ A;  1E3P A;  4B3S L;  2VL6 A; 
#chains in the Genus database with same CATH topology
 1LTT D;  3HOX B;  1SE8 A;  2L4N A;  1X3G A;  5G3L D;  1X9N A;  2N88 A;  4P72 A;  3TEH B;  3QOL A;  3K5M A;  3CCM A;  5M3F G;  1HR0 W;  1PYB A;  4B3T Q;  3L0O A;  1WTO A;  1Y8O B;  1PMR A;  3NWT A;  2A6E C;  1WCM H;  1V43 A;  1HFG A;  2DUD A;  3WWV A;  1PH9 A;  3C2P A;  1XX8 A;  4YCW A;  2N78 A;  2IPK D;  1STA A;  2UXD L;  1CUK A;  2HT1 A;  2ZT9 C;  4A3K G;  4DR7 L;  4BBR B;  5FJ8 G;  5C44 G;  1EEF D;  4O1N A;  2MPM A;  3HOZ H;  4K5V A;  2EY5 A;  2YTY A;  2NVT H;  4JYA L;  2HD3 A;  3FKI B;  3GTK H;  1EOV A;  2F0L A;  2L55 A;  4L5Q A;  1Z7T A;  4DUY Q;  1TWG H;  1BCP C;  4IUV A;  3S1M B;  1TWH B;  3M3Y B;  2IX0 A;  4KHV A;  3CPW A;  3V05 A;  4C3H B;  5I6Y A;  1V1Q A;  2JE6 I;  1NR2 A;  1VQP A;  2E2H B;  4GN4 B;  1EEI D;  3GV6 A;  1CKM A;  5KIX A;  1BVS A;  2PI2 E;  3BG3 A;  3BVM A;  5M5Y B;  3OW2 A;  3ND8 A;  1S5B D;  4GKJ Q;  1PTO H;  3VR2 A;  3MA2 B;  3JAM E;  1C48 A;  3S2H H;  3FPU B;  1PZJ D;  4CGY B;  1IBK Q;  4CJ1 B;  1RJT A;  2F0T A;  2NWG A;  4F88 A;  2WAQ G;  1S72 A;  3SK8 A;  4QMG A;  3NTK A;  5KYI A;  4GLX A;  1SE3 A;  5D3D A;  4C3J H;  4DV3 Q;  4BS9 A;  1LT3 D;  3D4W A;  3TRZ A;  1G51 A;  4NPS A;  2G5D A;  1WTQ A;  1SNP A;  4DV7 Q;  1O7L A;  3UDX A;  5IGD A;  4A3M B;  3GTP B;  2JN4 A;  3PO3 G;  2PW5 A;  5EBC A;  2NN6 H;  3A0J A;  1ICW A;  4AYB B;  1PRT D;  4GLV B;  3HKZ G;  4R8I A;  4OGQ C;  1TWF H;  2WB1 B;  4DR2 Q;  4FXK C;  4KHZ A;  4HSP A;  5IYC G;  3C1E A;  2R93 H;  3TZD A;  3V2T A;  1MJE A;  1H9R A;  3HOX H;  4DR5 L;  1RTO A;  1STE A;  1C0A A;  3K57 A;  1C7Y A;  4V19 0;  1KDC A;  2VS1 A;  1N33 L;  4O42 A;  3OWE B;  2VXW A;  4U67 3;  4R4T A;  4ZLT F;  2R7Z G;  1HTL D;  1YHB A;  5LHY 1;  3T56 B;  2YU9 B;  4JI4 L;  2ZTE A;  5M5W H;  3BS1 A;  4XYO A;  5IGE A;  2ZJP A;  4HN7 A;  2ENB A;  1PYW D;  2PQE A;  2UUB Q;  4QUF A;  1K8G A;  3HEJ A;  4BBR H;  3FP9 A;  1L1O C;  1X54 A;  5E7N A;  4GN3 B;  2UXB L;  5LL6 X;  3FKI H;  3BVZ A;  1KL9 A;  2B2V A;  4DR6 L;  3OYY A;  4MN3 A;  1CA5 A;  1SE4 A;  4I7Z C;  2Q2I A;  1WTV A;  3DM1 A;  1LTS D;  1XPR A;  3CCV A;  2WAC A;  3CQZ B;  1K3R A;  1N32 L;  5EJW A;  3S2D H;  2E2H H;  4HIM A;  3L2P A;  1HZC A;  1S3O A;  4FNF A;  2PNR C;  4RKL A;  5M5Y H;  2R3Z A;  4ZRZ A;  2BDO A;  2LKV A;  3R2I A;  3MWY W;  1X65 A;  2NZ1 D;  4HSV A;  2N55 A;  2Z4H A;  5IP9 G;  1MHW C;  3A5U A;  1KD1 C;  3EJI A;  4RGT A;  1UAP A;  4LF9 L;  2EJG C;  4OEL B;  2BE5 C;  1ILP A;  3F2D A;  1EQV A;  1Z47 A;  1NNX A;  2KHJ A;  1SMX A;  2EYP A;  4LAA A;  4GNX A;  1PTO D;  2EY2 A;  4WJW A;  3PO2 B;  4X62 L;  1BXT A;  3GTP H;  4A3M H;  4BY7 H;  5JJZ A;  4NXM Q;  2F4I A;  3NQI A;  4A3K H;  4LF5 Q;  4JBM A;  4IPC A;  3HOV G;  3VDY A;  3WOE A;  4IFD G;  5KNC A;  5M3M H;  3GTJ B;  4UPA A;  2Z6K A;  3PUZ A;  2UU9 L;  1Y1W G;  1WD0 A;  3ULP A;  4ZK9 B;  2K5H A;  1HNZ Q;  2K7V A;  2B2W C;  2F52 A;  1LAC A;  1SE2 A;  2DJF C;  5ISR A;  3CW2 C;  5FLX L;  2YU9 H;  4K8I A;  2OCE A;  3Q6S A;  3B6Y A;  4QIW B;  3EFX D;  2E2J H;  1W6K A;  1C9O A;  1T9H A;  1AEX A;  4F87 A;  3EN2 A;  2CH4 A;  4AQY L;  1EY6 A;  3TBI B;  4DNR B;  4FF4 A;  2F0I A;  3RNU A;  1GUG A;  3G71 A;  3OMC A;  1D5Z C;  2I0Q A;  3QR8 A;  2IY5 B;  1JMC A;  3VA5 A;  5C3E B;  3CCJ A;  2WKC A;  3PUX A;  4OWW B;  4QQB X;  1DGS A;  3CQZ H;  4P2C B;  1ZYR D;  2CQA A;  4LF8 L;  4YY3 L;  3UDI A;  2JP1 A;  4DV4 Q;  4AYB E;  3DXJ C;  2MO1 A;  3PUV A;  1TY0 A;  5C5M A;  2WB1 E;  2K28 A;  3H0G B;  1J8I A;  1YZ6 A;  4JI5 Q;  1XNQ L;  2FIN B;  4JI3 Q;  3RN5 A;  3RLF A;  1VF5 C;  3LWE A;  4GNX B;  2K04 A;  3ULL A;  1D7Q A;  3R93 A;  5IYD G;  4DNT B;  3DMU A;  3K5O A;  4OO1 I;  5AFW A;  3DLL A;  1GXD C;  3PO2 H;  2AMC B;  3KF8 A;  4UDU C;  1G91 A;  1LTL A;  3MFY A;  1EL0 A;  3TP6 A;  3OSO A;  4XYQ A;  3TS2 A;  1BBU A;  4BWG B;  3A7A B;  2VQF Q;  3CCL A;  1ENC A;  2AQ1 B;  3PMF A;  4CJ2 C;  3PF5 A;  4A3B B;  2QGQ A;  5J3B A;  3I4M B;  1TS2 A;  3GTJ H;  3I91 A;  3V96 A;  1K0S A;  2RF4 A;  2Z9H A;  4Q5V A;  2EY1 A;  3ER0 A;  2QEJ C;  4QGU A;  5I2X A;  5JPM C;  4A93 B;  3CC2 A;  1FR3 A;  4WFN 3;  3A74 A;  3E5S A;  3CF5 A;  5FOB B;  3OHX C;  3HKZ E;  1BBX C;  1WD1 A;  1KXL A;  1NTG A;  5E1F A;  4CDD C;  1YNN D;  4X64 Q;  5EGT A;  1B3A A;  3VA7 A;  2AKW B;  4LUO A;  3ITP A;  1GVP A;  4A3G H;  3NHH A;  1TS5 A;  1YJW A;  3S1R B;  4B3T L;  2KED A;  3CCS A;  2EZV A;  2JA9 A;  1A3U A;  1TWC B;  1BF4 A;  3CKI B;  1TWA B;  1SJH D;  3GTO B;  1EZ8 A;  2K1B A;  2A6H C;  5C4Z A;  2QKI C;  2FJ2 A;  4ZUI A;  5LMU Q;  3HP3 A;  3HOV H;  2B2Y C;  3MC0 B;  4DAY B;  4DV1 Q;  1Y14 B;  1CKO A;  4DUY L;  3BYY B;  1CZW A;  1ML0 D;  1PH1 A;  1ET9 A;  3KF8 B;  2L1B A;  3GDE A;  3IFD A;  1G6Z A;  3MFG A;  5EPK A;  5BN4 A;  2RHS B;  3M4Q A;  1TY2 A;  1E7Z A;  1IKL A;  2ATW A;  1VQL A;  4QIW E;  4GKJ L;  4OIJ A;  4TSS A;  3QO2 A;  3NK9 A;  2YV5 A;  3SVM A;  1TS3 A;  4NMZ A;  1IBK L;  1A6X A;  4B3M Q;  3BJU A;  1U4M A;  1HCZ A;  5ELC A;  1EWC A;  3BDO A;  3IL8 A;  3QJY A;  4G7H C;  1KDB A;  1HTP A;  2E8G A;  3C1F A;  3PQI A;  3RN2 A;  1E2W A;  2O4X A;  1Q8I A;  4A93 H;  4DV7 L;  5CMD A;  3KLR A;  5C0X H;  1I4G A;  1ICF B;  1V9P A;  4QL5 A;  3DWP A;  2F0K A;  5JJL A;  1Q3L A;  1PTO C;  4G57 A;  4IPG A;  4YIJ A;  4DR2 L;  1VQ9 A;  1T5X D;  2PCF B;  2R92 G;  3UDG A;  2QCP X;  4C3I B;  1HUN A;  3SHL A;  1YHA A;  1UWV A;  4EQO A;  3Q24 A;  1TWC H;  4LNQ A;  4A3J G;  1EY4 A;  1SNM A;  4NXN Q;  4A3D B;  1U5K A;  3FRP B;  4OWT B;  2D0P A;  1XNR Q;  2NYZ D;  3VYU A;  4JOI A;  4UY8 C;  1E0B A;  2X6L A;  4DNI A;  1I6H B;  2F0M A;  2UUB L;  4AIM A;  1NR4 A;  2OQK A;  1OXU A;  5CV6 A;  3F8T A;  4EQ5 A;  5FO8 B;  2L11 A;  1J9O A;  1BKB A;  4WOR A;  3W1G A;  1HH2 P;  2ICE C;  1PZK D;  3PIO 3;  1DOL A;  3WDN A;  1GHK A;  1SRO A;  1DOM A;  4YHH Q;  1GJX A;  1WTP A;  2LS0 1;  3NSW A;  1FD7 D;  1DOK A;  1GD7 A;  2KUM A;  3CAM A;  1QG7 A;  3CMA A;  2I5L X;  3ERS X;  3KBG A;  4KJN A;  1CQF A;  2N3S A;  2NVY B;  4A3E B;  1CHQ D;  2NZO A;  1S5E D;  1ZYR C;  1QWY A;  1B44 D;  5KNB A;  3O13 A;  3E0E A;  3SE0 A;  5JEA H;  5BN5 A;  3RZD B;  3J81 L;  1QZH A;  1E1O A;  5IT9 c;  2AUK A;  3N6R A;  2IWH A;  2ZXP A;  1YVC A;  1I4H A;  3PF4 A;  3HFZ B;  3CPF A;  1A62 A;  1WTW A;  1YNX A;  4IQZ A;  2JJQ A;  1E3P A;  2A69 C;  3MAQ A;  3F1Z A;  3DEO A;  4NXM L;  1QB5 D;  2EJM A;  3SXH A;  3I3C A;  5CBE E;  2K32 A;  4LF5 L;  3T4A C;  2MP1 A;  5C5L A;  1I94 Q;  4I7A A;  3S1Q B;  1X3Q A;  1ET6 A;  4JV5 Q;  4L5T A;  2DNC A;  1HNZ L;  1EQR A;  1D1K A;  2OEO A;  1O80 A;  2KHI A;  4A3D H;  2IJ0 A;  1PRT B;  4IAL A;  5IP7 H;  2K33 A;  2B29 A;  1SN8 A;  1NBW A;  3KBX A;  1Q86 C;  3MEH A;  5DLQ E;  1SXT A;  1AZQ A;  5KRU A;  1W3S A;  1C8C A;  1XYI A;  5EKL A;  3AYH B;  2EQS A;  1KNA A;  1CI3 M;  2LXJ A;  1K8O A;  2RSN A;  3QIA A;  3SK4 A;  3P1H A;  1CZG A;  4ZCK A;  1JOR A;  2SEB D;  4FO2 A;  4IJH A;  1X55 A;  2JK8 A;  4DV4 L;  1V8Q A;  4NW2 A;  4X65 Q;  4A3E H;  2JEB I;  1HR0 Q;  2DY7 A;  1WYD A;  1KTK A;  3S16 B;  1WCM B;  3S1N B;  4JI5 L;  5CR3 A;  2MFI A;  4JI3 L;  5ELE A;  1Q81 C;  4LK1 C;  3RZD H;  1L2F A;  2OXP A;  4KKS A;  4DFA A;  2EDG A;  4KHP Q;  1STY A;  5IE8 A;  2JA5 G;  5KND A;  5C4J B;  3HOZ B;  1PH7 A;  2WFW A;  2F0J A;  1SLJ A;  5C6A A;  3QWN A;  2B8G A;  3S24 A;  5EAY A;  1TWG B;  4RCN A;  5FLX E;  1IZ6 A;  5K5P A;  1A3T A;  2SOB A;  4DU9 A;  1HHV A;  5GQO A;  2VQF L;  4CDF C;  3U4Z A;  3VYT A;  4XIG S;  3HOW G;  5FO9 B;  1UE1 A;  3UI2 A;  3SGI A;  4JI7 Q;  3ZYY X;  2EYH A;  3S1Q H;  2XTI A;  3K80 C;  2Q2U A;  1HPC A;  1STG A;  2ZTC A;  1PTO B;  4E6I A;  3MEF A;  1H9S B;  1S5F D;  3S2H B;  2X69 A;  5C3W A;  4DV0 Q;  1IL2 A;  1S4Z A;  2K6A A;  1FL0 A;  5LMN Q;  5C4X B;  1KIX A;  1IW7 D;  2I07 B;  2TMP A;  4PV1 C;  2NVQ H;  3J7Z C;  3CCE A;  1EQQ A;  4J8Q A;  4NP5 A;  5ELO A;  4H13 C;  2FMC A;  1WTX A;  1D5X C;  4X64 L;  1AW7 A;  2KHS A;  3BDL A;  3M4P A;  1EZ6 A;  4G7Z C;  1RL2 A;  4WRD A;  4HED A;  3NUC A;  4K8J A;  2KOL A;  3R3O A;  1LTR D;  2KCN A;  5FLX c;  4WJ4 A;  3HRZ C;  2IHE A;  1TWF B;  3W5O A;  2NTS A;  3U58 A;  1VQB A;  4P71 A;  1F2Z A;  1CKN A;  2RDH A;  1Y8N B;  2F0E A;  1TT2 A;  1YIT A;  4PNY A;  1X6O A;  1KHI A;  2F0D A;  5LMU L;  2Z6B A;  4IN3 A;  2F0S A;  4KI0 A;  2N49 A;  3S16 H;  1LT6 D;  3S1N H;  2B2V C;  5M5W B;  3HG9 A;  4DV1 L;  4JCV E;  4X3U A;  1GUO A;  5KGU A;  2A8V A;  2FHT A;  1FJG Q;  3K8A A;  5C0X J;  1GUT A;  5C4J H;  5IGC A;  4B9W A;  4KN4 C;  1QZG A;  4GOP A;  1KRT A;  1NE3 A;  3A54 A;  1PH2 A;  5CBA E;  3GTG B;  3KYH C;  4IUU A;  1NCV A;  2F0V A;  5IT9 L;  1KC8 C;  4B3M L;  3S2D B;  4DV5 Q;  4FP5 D;  1SNC A;  4L5R C;  3GD7 A;  4GNX C;  5ELN A;  2ZJR A;  4XTC S;  1HRJ A;  2XRS D;  1RIP A;  3A8I E;  5C4X H;  1VQE A;  2XGT A;  2RDG A;  4HJ9 A;  4IPH A;  2M2L A;  2CKZ B;  1P16 A;  3D4D A;  4U68 A;  3KJP A;  4DV6 Q;  1N34 Q;  1SBB B;  3D8G A;  2Z6K C;  1H9M A;  3I7F A;  1B9N A;  5GRO A;  5GAD C;  1EIG A;  4OO1 G;  1ESR A;  5EKI A;  4BY7 B;  1YHQ A;  1E2Z A;  1HNX Q;  4CBV A;  4A3K B;  2JA5 H;  5C44 B;  5EPL A;  1IYU A;  4NXN L;  2D0O A;  3NBH A;  1XNR L;  2RA4 A;  5M3M B;  1EFI D;  4XQN A;  3RUZ A;  3NBI A;  4QCL A;  1MSH A;  1WFQ A;  4PZ7 A;  4IUP A;  3RLO A;  1UE7 A;  1H9J A;  5JEA J;  4X6A H;  4ULL A;  1HZA A;  4A76 A;  2F3I A;  4R4O A;  5DAU A;  2VW9 A;  4Y7N H;  4A3C H;  1BOS A;  4CJ0 B;  1E2V A;  4X3S A;  1SNO A;  1E22 A;  1LTA D;  2E2J B;  2ZXR A;  2Y0S G;  2OTJ A;  4GOP B;  1IKM A;  5D14 A;  1GKH A;  4CKB A;  2VUM G;  3T1H Q;  1PH8 A;  5ELB A;  4ZKB B;  3EQL C;  2JA7 H;  4JBK A;  2KCC A;  2GA4 B;  5FO7 B;  2WAQ B;  1E1T A;  2E74 C;  1GM5 A;  2B2T A;  2OWO A;  4GS3 A;  1CA6 A;  3MXU A;  1YNJ D;  2NN6 I;  1B70 B;  2HCC A;  4HJA A;  4DPG A;  1XMQ Q;  3GTG H;  4HIO A;  2F0W A;  2JA6 G;  1Y69 U;  3PO3 B;  3NXW A;  1IHZ A;  1HZB A;  1SR3 A;  3HKZ B;  3GTM H;  1F2Y A;  4C56 C;  5E4X A;  3E3X A;  2CVR A;  1QNK A;  2KCM A;  4K0K Q;  3L7Z C;  1DON A;  3J7Y W;  4DAP A;  4FF2 A;  2E2D C;  2HDL A;  3K6O A;  2A1A A;  5M3F H;  2MQH A;  4O2D A;  1PFS A;  4DK1 A;  2R7Z B;  2A68 D;  4H02 A;  1I94 L;  4AH6 A;  2UXC Q;  1F2L A;  1Y1V G;  4P75 A;  2I46 A;  3DUZ A;  3J7A F;  1EYC A;  3MXP A;  4A3I G;  4JV5 L;  2K50 A;  4HCE A;  3R8B A;  3NBH B;  2PMZ B;  4RHS A;  2WKD A;  5CV7 A;  1HFN A;  5FJ8 H;  5C4H A;  3S15 H;  5C44 H;  1LV9 A;  1OXX K;  1V1O A;  3J80 c;  4J1M A;  4A3F G;  2B63 G;  1B8A A;  1ZXT A;  3D0F A;  4FXD A;  5C3E G;  5J22 A;  1PFN A;  3K81 C;  4ILW A;  2AQ3 B;  4HMI A;  2VQE Q;  1H9K A;  3X3M A;  2QEX A;  4JI1 Q;  2VB2 X;  4N8F A;  1EFW A;  5ELF A;  4IZ8 A;  1PH5 A;  3WOF A;  1PH4 A;  2VY3 A;  4KD3 A;  2HUG A;  3Q8D A;  5IWA Q;  3J81 E;  1JQY D;  5EKK A;  3EIV A;  4A3G B;  1DCZ A;  2L12 A;  1A2T A;  4X65 L;  1HR0 L;  1DJR D;  3I4O A;  2K5W A;  2Q8T A;  2B2U A;  3OTO Q;  3Q22 A;  4MIU A;  1VQK A;  3CC4 A;  3PO3 H;  4KHP L;  3J81 i;  1LT5 D;  1HNW Q;  3PV0 A;  1VQ4 A;  1WVL A;  1HXY D;  2PZT A;  1KLG D;  2XN9 C;  2AUJ D;  3HOV B;  1U4L A;  4A3B G;  4K6L A;  1X3F A;  4UHV A;  4BBS G;  5IYC H;  4LF7 Q;  3Q0A A;  2WIN B;  2DGY A;  2N8N A;  5JJK A;  3K0X A;  1PFB A;  1IBM Q;  1B7Y B;  2M00 A;  5K36 G;  1SSO A;  1D8L A;  2K05 A;  4RWS C;  3BZD B;  5IY0 A;  2R7Z H;  3EA6 A;  1K8A C;  3J81 c;  2G9D A;  4OIK A;  4YCV A;  2K5N A;  4JI7 L;  3T51 B;  1G29 1;  2CCZ A;  3I90 A;  1STH A;  1ONL A;  1MSG A;  3DWQ A;  2KEE A;  5I9O A;  2EY6 A;  2JQO A;  1RTN A;  1TXY A;  4DV0 L;  4K5W A;  2OQ0 A;  5M5X H;  5LMN L;  2K14 A;  1IBL Q;  3HOU G;  2VUM H;  3RMH A;  2XIW A;  3H94 A;  2DJG C;  2SDF A;  2QDB A;  2WAQ E;  4HID A;  5IIF A;  4PG3 A;  3F2B A;  1JT8 A;  4X3K A;  2F0H A;  2XWB B;  2P5Z X;  4LJZ C;  3TP8 A;  3MHB A;  4QB4 A;  4IOA A;  4LUZ A;  1VQ7 A;  3I56 A;  2JA6 H;  5E4W C;  1M4V A;  1BCP F;  4I65 A;  1DYQ A;  2O5J C;  1Q8K A;  4JOI C;  1L0W A;  2X6G A;  1JOO A;  5IP9 H;  4KY6 A;  1GUN A;  1Q7Y C;  2KQ3 A;  4WJ3 M;  1GO3 E;  1Z9F A;  2B3G A;  4ODG A;  1PRT C;  1EIF A;  3I70 A;  4BXX G;  3AB9 A;  3Q23 A;  2G9H D;  4FVM A;  3M9B A;  4LFB Q;  2BCO A;  3S17 H;  2K5D A;  1S5C D;  3URY A;  1Y1V H;  4JVZ A;  4JW0 A;  3PIP 3;  1Q46 A;  4PQX A;  1MBY A;  4H7B A;  1OXV A;  1NY4 A;  4A3I H;  3RR5 A;  2VL6 A;  1FGU A;  2PMZ E;  1FJG L;  3H6M A;  2D2C C;  1BUV T;  1JWM D;  3TQY A;  2VNU D;  4UAI A;  1M90 C;  2RQX A;  2HIV A;  3VR4 A;  4LMQ D;  1I4X A;  4IFD H;  2XNA C;  2CW0 D;  1VQ8 A;  3CD6 A;  5F2D A;  3G6E A;  5I2Y A;  4PMB A;  1T5E A;  4OX9 Q;  1Y1W H;  1AFP A;  2GVA A;  1WTR A;  1PV4 A;  4JI6 Q;  3I4N G;  1CK1 A;  3HOY G;  1X3E A;  1CTM A;  1FVI A;  2YTX A;  4HJ5 A;  1FGB D;  1QUQ A;  1TVX A;  4DV5 L;  2UUC Q;  3JC6 6;  5ELD A;  4N9P A;  3VYS A;  1PHJ A;  3SK5 A;  2I5M X;  4LF4 Q;  3OOC A;  4C3I G;  4N9T A;  4DR3 Q;  1GUS A;  3QOJ A;  1XJV A;  3LGJ A;  4DV6 L;  2XVS A;  4DV3 L;  3KFU A;  1B3Q A;  1BQQ T;  2HIX A;  3M4Y A;  2HCI A;  2R7F A;  5FLM G;  3MTS A;  3IKJ A;  2A19 A;  1A2U A;  4JG2 A;  3LX0 A;  1PFM A;  4XXE A;  2CHB D;  1HNX L;  2F4V Q;  3G7L A;  1JJG A;  3TZU A;  1Q82 C;  4RFB A;  3J80 L;  5JOB A;  3K7A B;  2HQL A;  5LL6 S;  1EY7 A;  1R4Q B;  1HZ9 A;  1J6Q A;  1I4R A;  1UNS A;  1LTI D;  3AEV A;  2UUA Q;  5IYD H;  3ND9 A;  5I6W A;  4GN5 A;  3W2D A;  1FYC A;  2KVM A;  1Q90 A;  2EXD A;  4CDE C;  3W3A A;  5IT9 E;  1PVO A;  4BY1 G;  1LAB A;  2EOT A;  1PA6 A;  4PZ8 A;  4DAV A;  3H3V H;  3CRL C;  4ALP A;  3T1H L;  3MXN A;  2MHV A;  3G48 A;  4BA1 I;  4EVO A;  1LTG D;  5L37 A;  3A56 A;  3H91 A;  3MVV A;  1QUQ B;  1R9T B;  2KBN A;  3PSI A;  5IOC A;  1NSN S;  1VDZ A;  2YTV A;  2Q2T A;  3HKS A;  1XMQ L;  2A6E D;  4KV6 A;  1QE6 A;  1W6J A;  1TU2 B;  3U4V A;  3SR1 A;  2H5X A;  3KK7 A;  4GZY C;  5IYB G;  2DY8 A;  3EBE A;  1O7Y A;  3KJO A;  4C2M B;  3PGZ A;  4K0K L;  2JA8 G;  4KD4 A;  1TQO A;  4F8M A;  5JVH 3;  1KLU D;  1B9M A;  4DUZ Q;  1GUW A;  4OL7 A;  4C1N K;  5AJ3 Q;  4PMC A;  4L63 B;  3K7U C;  2RDF A;  1EYA A;  1K8M A;  1BCP D;  2TSS A;  3T13 A;  4KJO A;  1I3Q B;  1U0L A;  4HJ7 A;  4POG A;  4A3L G;  2UXC L;  3C46 A;  1UUP A;  2C35 B;  3AFQ A;  4Q0F A;  2ASB A;  2EYL A;  1M1K C;  3IRB A;  3H09 A;  3I73 A;  4CHT B;  1F77 A;  1F9Q A;  2NTT A;  3K7A H;  4N8X 1;  3DHQ A;  1K73 C;  5EPJ A;  4NB3 A;  4B08 A;  3P75 A;  4B3S Q;  4YCU A;  3ZJY C;  1EY0 A;  2VQE L;  1B53 A;  4IUR A;  3FHW A;  4YWK A;  1STB A;  4JI0 Q;  2NVQ B;  1KAB A;  4JI1 L;  3MXN B;  2CH4 W;  5I4D A;  3UE0 A;  5HY6 A;  5IWA L;  1AE2 A;  4FDB A;  1NMF A;  4B3R Q;  3R2T A;  2IW3 A;  4PZ6 A;  3NEM A;  1B50 A;  3OMG A;  3RZO B;  4X66 Q;  4GKK Q;  2Z1C A;  2JSO A;  1YNN C;  3AQQ A;  5T1I A;  1UEA B;  1R9T H;  2E76 C;  1D1I A;  3H15 A;  3OTO L;  2KEC A;  4DGZ A;  5M9O A;  3BDC A;  1BO0 A;  4Y52 H;  3OWF A;  2F0P A;  4HR7 B;  1HNW L;  2A73 B;  3TDQ A;  3M85 A;  1QJO A;  4GOP C;  2R92 H;  2PNH A;  3KF6 A;  4C2M H;  2PYK A;  4LF7 L;  2ZM6 Q;  3HS0 C;  1B2T A;  4LWC A;  5I9P A;  4ZYS A;  1H95 A;  1U4R A;  3STB D;  3M7N A;  3MXG A;  1EQT A;  4A3J H;  1OTC A;  1EU4 A;  2ZJQ A;  1EUJ A;  4K5X A;  4MNO A;  1I3Q H;  1EWI A;  1O78 A;  2L9H A;  4IO9 A;  4EGV A;  2R6G A;  4C3J G;  4BY1 H;  4DA2 A;  2PZU A;  5D65 A;  3CC7 A;  1V1P A;  1XXG A;  4JK1 C;  1IBL L;  2D62 A;  1G6P A;  1IYV A;  2NN6 G;  5EBD A;  4L5S A;  1EYD A;  2BE5 D;  4JI2 Q;  1L0Y B;  3AU7 A;  4CKC A;  1SNQ A;  2R93 G;  3HOX G;  4DXG A;  2Z0S A;  3KLW A;  1K83 H;  2ID0 A;  3K5N A;  3D3R A;  2AWO A;  4IFD J;  4HMJ A;  5KEE A;  1YBY A;  1VQM A;  2L15 A;  1YEZ A;  1JIC A;  4FF1 A;  2AWN A;  4KMU C;  4PMW A;  1BNZ A;  1EIH A;  3DM3 A;  3TP5 A;  1QVF A;  5EQ0 A;  5IGF A;  1N9W A;  1CM9 A;  1CFM A;  3RZO H;  2BA0 A;  4K2L A;  5DNF A;  1SYG A;  2MUY A;  4R9W A;  4IUN A;  1RDP D;  4BBR G;  2OTL A;  4LFB L;  2JA5 B;  5FK9 C;  5JAV A;  4IUT A;  4MTN A;  3FKI G;  1ENA A;  2SNM A;  1ZKO A;  1TKW B;  3T53 B;  4EQP A;  2MGS A;  3KF6 B;  3S14 B;  1S40 A;  4DK0 A;  4C3H G;  1HJP A;  2RCN A;  5COY A;  2F0O A;  4J6H A;  4Y7N B;  3MZ5 A;  1SEB D;  5HGT A;  2B2T C;  2ZTD A;  1AH9 A;  4OX9 L;  1SDF A;  2QW7 A;  1I5F A;  4JI6 L;  5GAG C;  2EYF A;  2JXM B;  4DV2 Q;  2O5I C;  2MJ8 A;  3CHB D;  3EVQ A;  2JA7 B;  1V1P B;  1B1Z A;  2UUC L;  1X32 A;  4LW1 A;  1ENF A;  1YIJ A;  4IOC A;  4LF4 L;  3T1Y Q;  1J5E Q;  2RHQ B;  5CV5 A;  4A3M G;  4BY7 G;  4DR3 L;  5COR A;  4QY7 A;  4AYB G;  1SRU A;  3GTM B;  4UP9 A;  2WB1 G;  3G4S A;  1SFO B;  2FMM A;  5M3M G;  2D9U A;  3D6C A;  2C9O A;  5IGB A;  2CWP A;  2YYZ A;  2CFM A;  1KQS A;  2F3V A;  3I4L A;  5M3F B;  2F4V L;  4RA8 A;  2H1E A;  5IGG A;  4RGM A;  1AE3 A;  1ASY A;  1X56 A;  1G8Z D;  1B4O A;  1MD2 D;  1EWH A;  1GHJ A;  3VR3 A;  3GV3 A;  5LMN W;  4NDX A;  1CKN B;  4S3S A;  3VR6 A;  3P20 A;  2KA7 A;  2UUA L;  3S15 B;  2M9V A;  3TME A;  4ME5 A;  4HIK A;  2E2I H;  2F0Q A;  1EU3 A;  2RSO A;  3G6J B;  1NMG A;  4ME3 A;  3NEN A;  4R8N A;  3F2U A;  1NUC A;  1XMO Q;  3S14 H;  2NZH A;  1XWE A;  5DEH A;  2XWJ B;  4RCO A;  5J39 A;  3HOW H;  4L8J A;  1Q12 A;  1SYB A;  3JAM i;  3TSS A;  1VQF A;  2AHO B;  3A55 A;  1PDQ A;  3OPO A;  4LFC Q;  2O2L D;  3CCU A;  1M8A A;  2B2U C;  4YHH L;  3M4O B;  3PIO A;  2L0C A;  5HGQ A;  2A5H A;  1W2B A;  5A2Q L;  2I5H A;  2RBM A;  1VQO A;  2IT1 A;  2A6H D;  3NWS A;  3ONA B;  2E75 C;  1JJ2 A;  2ZXO A;  3F2C A;  3BVG A;  3JAM c;  1D2B A;  3H3V C;  5DM6 3;  1F9S A;  4A4I A;  3A5Z B;  3PO2 G;  2J0T D;  2HHH Q;  3E9I A;  2EJF C;  3ICE A;  4DUZ L;  3J80 E;  4LF6 Q;  5AJ3 L;  1JC7 A;  2C5C A;  1WI5 A;  2LFN A;  2IX3 A;  2PZW A;  3FEW X;  4R4C A;  2E5L Q;  4FYD A;  1VQD A;  2NBF A;  3STB C;  1SFO H;  2EPB A;  1MJC A;  2F03 A;  3S1M H;  3NPP A;  3KLS X;  1TWH H;  3M3Y H;  4TQU S;  2XRQ D;  4C3H H;  3AMU A;  3SDZ A;  3GO5 A;  3J80 i;  1ROD A;  3CRK C;  5FKA C;  1K9M C;  1IL8 A;  2NVX B;  4M1U B;  3I55 A;  1LLR D;  2Y0S B;  3BZC A;  4B3S L;  2OF1 A;  3T16 A;  4FF3 A;  5M5X B;  1PH3 A;  3OIQ A;  4A3G G;  2VUM B;  3A8J E;  3FMC A;  2B8F A;  1FNV A;  4JI0 L;  4ZQ3 A;  1EOT A;  5HUR A;  3DWA A;  1NJI C;  4DF7 A;  1IW7 C;  2DNE A;  1EY5 A;  4TRD A;  3CME A;  4B3R L;  2DN8 A;  1VQN A;  1A15 A;  2LSS A;  3IFT A;  2PW7 A;  4P73 A;  4OON A;  2JA6 B;  4X66 L;  5BR8 Q;  1YJN A;  4GKK L;  1HA6 A;  3K59 A;  1HQM C;  1PLF A;  3GQB A;  1WJJ A;  3M4O H;  3H0G G;  1U4P A;  3BU2 A;  3TP7 A;  1SYC A;  3N52 A;  2MNA A;  2QIL A;  1OXS C;  4LFA Q;  1L0X B;  3CP0 A;  1JE5 A;  4APV A;  3E9H A;  4QF4 A;  4KTA A;  4QUC A;  2F3W A;  4DR4 Q;  3S17 B;  4XT1 B;  3NTH A;  1R4P B;  1Y1V B;  2ZM6 L;  4EX5 A;  4OO1 H;  4A3I B;  2F0U A;  4YWL A;  2PPB C;  3UDF A;  4RMF A;  2D5D A;  4RG1 A;  4KK7 A;  2LMC B;  4RKB A;  1SYE A;  2BH2 A;  3I4M G;  1DM0 B;  4A3F B;  3KDF A;  2B63 B;  2K4K A;  1Y1W B;  5CV9 A;  4HJ8 A;  1BDO A;  4A93 G;  1QNU A;  1AN8 A;  4ZAI A;  4DR1 Q;  1EIY B;  1ESF A;  5C0X G;  1WOC A;  1L1O A;  1BCP B;  2NVX H;  1K0R A;  2V1C C;  4GLA C;  4JI2 L;  1JR0 D;  2ALY B;  1OO9 B;  4JI8 Q;  4OHJ A;  3PUY A;  3OIP A;  1RKN A;  2Q2H A;  3GTL B;  3QB3 A;  1VCI A;  4DAY A;  1TII D;  1XTD A;  5CC4 A;  2A69 D;  1RD9 D;  1LTB D;  1S5D D;  5JPN C;  2R61 A;  2IL8 A;  1I50 B;  3CU7 A;  1LUZ A;  2Z4I A;  3KLS A;  1EY8 A;  4DAM A;  3QG1 A;  4BBS B;  2AQ2 B;  3RLN A;  1XPU A;  3NQT A;  4DN4 M;  2RCF A;  2A74 C;  1I4Q A;  3DEP A;  1II3 A;  1HA5 A;  3A8K E;  5GAH C;  5D3I B;  4MZ9 A;  4UP7 A;  2F0G A;  1QIL A;  3A7L A;  4RH6 A;  2BOS A;  3KOJ A;  1I6V C;  3K0Y A;  5J1Z A;  3L3O C;  5TSS A;  1GOZ A;  2EIF A;  1PXU A;  2Y0S E;  4ZUJ A;  1CHP D;  4DV2 L;  3KDF B;  3GTQ B;  3FDT A;  1AP0 A;  4KLK A;  5JEA G;  3HOU B;  2B2W A;  2V4D A;  3JAM L;  1Q1E A;  4CDC C;  4XDX A;  4A3F H;  2B63 H;  3D31 A;  1N36 Q;  5C3E H;  1L1O B;  2K75 A;  1PH6 A;  1JB3 A;  1XTC D;  3AFP A;  1A8V A;  3D4R A;  3T1Y L;  4RAU C;  1J5E L;  1VQG A;  3I72 A;  3U9S A;  1MKH A;  3ERO A;  1VMC A;  3FPP A;  1YNJ C;  4YWM A;  2HQE A;  1D6E C;  3I2Z A;  3H0G H;  3KUP A;  4DK3 C;  5JVG 3;  4ID6 A;  4B9X A;  1F9P A;  2F0F A;  2KEN A;  1VQC A;  1KDA A;  1LT4 D;  3GTL H;  1C4Q A;  2NUC A;  4P74 A;  4OEM B;  2Z8L A;  2UXD Q;  3M7G A;  3K58 A;  4O0A A;  4DR7 Q;  4K14 A;  1JWS D;  1N34 L;  1YJ9 A;  1SYF A;  3NE5 B;  4A3D G;  1CSP A;  1D5M C;  1ZEQ X;  3TN2 A;  2OT2 A;  5IP7 G;  4JYA Q;  1F9R A;  2NB0 A;  1I50 H;  5GAE C;  1JWU D;  2B39 A;  2A68 C;  4IFD I;  4DK6 C;  4EQN A;  1O7Z A;  1OXT A;  3TRE A;  3J81 j;  4BBS H;  4A3B H;  1SMY D;  1CQV A;  1JB7 A;  5KYL A;  3I4M H;  2K5V A;  2Q8R E;  1DXM A;  4POF A;  4RGO S;  2R7D A;  1XMO L;  3GP7 A;  3I4N B;  3HOY B;  5K36 H;  1VQ6 A;  1K28 A;  1LO5 D;  2GN5 A;  1XPO A;  1Q1B A;  1MIU A;  1JCK B;  5CGK A;  3VR5 A;  1DD2 A;  4LFC L;  1P8L A;  4A3E G;  1KRS A;  1JOK A;  4H44 C;  5A35 A;  4M8A A;  2EYJ A;  3GTQ H;  2QA4 A;  4LUV A;  3HOU H;  1VQ5 A;  3S1R H;  1JOQ A;  4XT3 B;  1A3V A;  3ULJ A;  2K03 A;  4OWX B;  3UE1 A;  1TWA H;  1MI2 A;  2CQO A;  5C0X I;  3GTO H;  4KN7 C;  2HHH L;  4DR5 Q;  4LF6 L;  4KY5 A;  1K3B C;  1N33 Q;  3U50 C;  1SJE D;  2QDL A;  4KKT A;  1CT1 D;  3X3N A;  2E5L L;  1VQI A;  1VMP A;  2R92 B;  2BH8 A;  4JI4 Q;  4RHR A;  2BDN A;  3E0J A;  1PYS B;  1BBW A;  5CYU A;  1LM0 A;  4BXX H;  2PI2 A;  4A75 A;  4A3J B;  1IXR A;  1JE4 A;  2UXB Q;  2B2Y A;  1SAP A;  2J7Z A;  2K01 A;  4OXP A;  3H3V I;  2PQA A;  2PO4 A;  1STN A;  3J7A V;  4DR6 Q;  4FXG C;  1CSQ A;  1U9R A;  4QJF A;  4BY1 B;  1QOH A;  4KY7 A;  1EYG A;  5G3L F;  1E24 A;  1G2T A;  1N32 Q;  4ABN A;  3SK6 A;  4JBW A;  1Y8P B;  5A2Q E;  2ES2 A;  1QVG A;  3TS0 A;  3VYR A;  4KKU A;  3I4N H;  3K5L A;  3HOY H;  1A63 A;  4K6D A;  2EYM A;  1KAA A;  4JPB W;  4NKL A;  3C3L A;  4LF9 Q;  3NP8 A;  3CCQ A;  2KJX A;  1K83 B;  5BR8 L;  4JC0 A;  1HQR D;  2JYO A;  1VQA A;  2SNS A;  3SEB A;  2WP8 J;  3LWU A;  4HTH A;  3P7J A;  1WCM G;  3LNN A;  1BR9 A;  1PZI D;  1UE6 A;  2BA1 A;  1ILQ A;  2JA8 B;  1IYJ B;  1TR5 A;  4X62 Q;  4C3I H;  4IUQ A;  4MHE A;  4LFA L;  1RF2 D;  2MO0 A;  2EYO A;  2IHF A;  5CV8 A;  1VS0 A;  4DR4 L;  3NTI A;  3HOZ G;  4J15 A;  3E6Z X;  2EXZ A;  1H9S A;  5DM7 3;  5C3X A;  5IOD A;  5JJI A;  4UP8 A;  2GVB A;  5FLM H;  1I6H H;  2UU9 Q;  4G7O C;  2L5T A;  1NAP A;  1RCV D;  1MGS A;  3W1B A;  2QF7 A;  2WII B;  1WTH A;  4Z9C B;  4K2K A;  3S9W A;  2JEA I;  4G4K A;  3NEL A;  1IBM L;  4MTK A;  2CWA A;  1UE5 A;  1SYD A;  3D6W A;  2PQA B;  2CW0 C;  3HZX A;  4AQY Q;  3I8Z A;  3IAY A;  4DR1 L;  5C4X G;  1QCB D;  1VQJ A;  1TS4 A;  1G2S A;  1PRT F;  4R4I A;  2NVY H;  1FNU A;  1SND A;  3CCR A;  4C1N I;  2EVB A;  2VZA A;  4JI8 L;  3L9A X;  2EE1 A;  4CKE A;  4L6T B;  2F0N A;  5T1G A;  4LF8 Q;  4YY3 Q;  2J4X A;  2LXK A;  2HDM A;  1EY9 A;  1UEB A;  2FXQ A;  4R1J A;  1VQH A;  1Z6H A;  3PCO B;  3BZK A;  3PUW A;  4V0B A;  1HUM A;  2NVT B;  1XNQ Q;  3GTK B;  2F1M A;  1LYL A;  1X3P A;  4F7X A;  1VF7 A;  4RGN A;  4JBJ A;  3U9O A;  2VB3 X;  1KAW A;  2K5Q A;  3RD4 A;  4DKA C;  3BYT B;  4H0L C;  1N8R C;  5IYB H;  4A3C G;  4DXF A;  5CV4 A;  2JA8 H;  1QVC A;  3J7A 5;  1DZ1 A;  4TVA B;  2Q8I B;  1RHP A;  3FVQ A;  5BN3 A;  2K52 A;  4HAE A;  5NUC A;  2H4O A;  1SMY C;  4ZKC B;  1I4P A;  2IX1 A;  2RKS A;  2FFK B;  2JA7 G;  4HCS A;  2KCT A;  4A3L H;  2RVL A;  3CXC A;  2E2I B;  1F2M A;  2WV6 D;  2ICI A;  3PIP A;  4IPD A;  4TKO B;  4C3J B;  1KNE A;  1ASZ A;  3OW7 A;  5E3F A;  1JJC B;  5H1S E;  2LY7 A;  1FNW A;  2XSC A;  4BA2 I;  3HOW B;  3HGB A;  3ERQ A;  1O7I A;  1PTO F;  4X3T A;  1YI2 A;  4XQJ A;  1N36 L;  1A0I A;  4R4Q A;  4IJL A;  4XQQ A;  1AZP A;  2R93 B; 
#chains in the Genus database with same CATH homology
 1FGU A;  2PMZ E;  1FJG L;  1SE8 A;  3TQY A;  3F1Z A;  1X3G A;  1PH3 A;  4NXM L;  1X9N A;  3TEH B;  4P72 A;  4B3T Q;  5M3F G;  3CCM A;  1M90 C;  1HR0 W;  4A3G G;  1PYB A;  2HIV A;  4LF5 L;  4JI0 L;  3L0O A;  1VQ8 A;  3CD6 A;  1I94 Q;  3G6E A;  1WCM H;  1V43 A;  2DUD A;  3WWV A;  1PH9 A;  4OX9 Q;  1Y1W H;  2GVA A;  1NJI C;  4JV5 Q;  4L5T A;  1PV4 A;  4JI6 Q;  3CME A;  1HNZ L;  3I4N G;  4YCW A;  1EQR A;  3HOY G;  4B3R L;  2N78 A;  1VQN A;  1X3E A;  2LSS A;  4P73 A;  2UXD L;  4OON A;  2KHI A;  1FVI A;  1CUK A;  2YTX A;  4X66 L;  5BR8 Q;  4HJ5 A;  1QUQ A;  4A3K G;  1YJN A;  5FJ8 G;  2HT1 A;  4DR7 L;  4A3D H;  4DV5 L;  5C44 G;  2UUC Q;  3HOZ H;  5IP7 H;  3JC6 6;  2B29 A;  2NVT H;  1WJJ A;  1SN8 A;  2YTY A;  3M4O H;  1NBW A;  3H0G G;  4JYA L;  3GTK H;  2IY5 B;  3BU2 A;  1EOV A;  4L5Q A;  1PHJ A;  2I5M X;  1Q86 C;  4LF4 Q;  4DUY Q;  1TWG H;  2MNA A;  5DLQ E;  2IX0 A;  3CPW A;  1OXS C;  4LFA Q;  1W3S A;  4DR3 Q;  3CP0 A;  1JE5 A;  1V1Q A;  2JE6 I;  4APV A;  3AYH B;  3E9H A;  4DR4 Q;  1XJV A;  2EQS A;  1VQP A;  3LGJ A;  4GN4 B;  4DV6 L;  1CKM A;  1BVS A;  2PI2 E;  2LXJ A;  2ZM6 L;  4DV3 L;  4EX5 A;  3OW2 A;  4GKJ Q;  3KFU A;  2HIX A;  2R7F A;  4YWL A;  5FLM G;  3S2H H;  3UDF A;  4RMF A;  2A19 A;  4JG2 A;  1IBK Q;  4RG1 A;  1HNX L;  4IJH A;  2F4V Q;  1JJG A;  1X55 A;  2JK8 A;  4DV4 L;  1Q82 C;  2BH2 A;  4X65 Q;  4A3E H;  2JEB I;  2WAQ G;  1S72 A;  1WYD A;  1HR0 Q;  3I4M G;  2HQL A;  4GLX A;  3KDF A;  4C3J H;  4JI5 L;  4DV3 Q;  2K4K A;  2MFI A;  3TRZ A;  4HJ8 A;  1G51 A;  4NPS A;  4JI3 L;  1HZ9 A;  1Q81 C;  1J6Q A;  3RZD H;  4A93 G;  1L2F A;  4DV7 Q;  3UDX A;  4KHP Q;  4DR1 Q;  1EIY B;  3AEV A;  2UUA Q;  3PO3 G;  5IYD H;  3A0J A;  5C0X G;  5IE8 A;  4GN5 A;  2JA5 G;  1WOC A;  1L1O A;  4GLV B;  3HKZ G;  2NVX H;  1TWF H;  2EXD A;  2WFW A;  4DR2 Q;  1PH7 A;  1K0R A;  2V1C C;  4KHZ A;  4GLA C;  4JI2 L;  2ALY B;  1SLJ A;  5IYC G;  1PVO A;  4BY1 G;  2R93 H;  3S24 A;  1PA6 A;  1MJE A;  5EAY A;  4PZ8 A;  4JI8 Q;  3PUY A;  3HOX H;  4DR5 L;  3H3V H;  1IZ6 A;  1C0A A;  2Q2H A;  1C7Y A;  4ALP A;  1VCI A;  2VS1 A;  5GQO A;  2VQF L;  3T1H L;  1N33 L;  3G48 A;  3U4Z A;  4R4T A;  4XIG S;  4BA1 I;  3HOW G;  1XTD A;  2R7Z G;  1UE1 A;  1YHB A;  3SGI A;  4JI7 Q;  4JI4 L;  3S1Q H;  2XTI A;  2ZTE A;  3K80 C;  2Q2U A;  1QUQ B;  5M5W H;  2ZTC A;  2ZJP A;  2KBN A;  3PSI A;  3MEF A;  2YTV A;  2Q2T A;  3HKS A;  1XMQ L;  4DV0 Q;  2UUB Q;  1IL2 A;  1FL0 A;  5LMN Q;  1LUZ A;  1K8G A;  1KIX A;  4BBR H;  3FP9 A;  4DAM A;  1L1O C;  1X54 A;  3U4V A;  2NVQ H;  5E7N A;  3J7Z C;  3CCE A;  1EQQ A;  2H5X A;  5ELO A;  4GN3 B;  2UXB L;  3FKI H;  3RLN A;  5IYB G;  3EBE A;  3KJO A;  1XPU A;  1KL9 A;  4DR6 L;  3PGZ A;  3OYY A;  4K0K L;  2JA8 G;  4X64 L;  5GAH C;  2Q2I A;  3M4P A;  4DUZ Q;  1XPR A;  1RL2 A;  4MZ9 A;  4UP7 A;  3CCV A;  5AJ3 Q;  1K3R A;  1N32 L;  3K7U C;  3S2D H;  2E2H H;  3KOJ A;  4HIM A;  3L2P A;  1HZC A;  5FLX c;  1S3O A;  4WJ4 A;  2IHE A;  5M5Y H;  1U0L A;  2UXC L;  3W5O A;  4HJ7 A;  3U58 A;  4POG A;  4A3L G;  1VQB A;  4P71 A;  1X65 A;  2C35 B;  2EIF A;  5IP9 G;  1CKN A;  3AFQ A;  2Y0S E;  2ASB A;  3A5U A;  1KD1 C;  1M1K C;  1YIT A;  3IRB A;  4DV2 L;  3KDF B;  1X6O A;  4LF9 L;  1KHI A;  4KLK A;  5JEA G;  5LMU L;  3F2D A;  1Q1E A;  4KI0 A;  1Z47 A;  2N49 A;  3K7A H;  3S16 H;  3S1N H;  4A3F H;  2KHJ A;  1SMX A;  3D31 A;  2B63 H;  1N36 Q;  1K73 C;  5C3E H;  4DV1 L;  4GNX A;  1L1O B;  2K75 A;  4NB3 A;  1PH6 A;  3AFP A;  4JCV E;  1A8V A;  3T1Y L;  4X62 L;  1J5E L;  1VQG A;  4B3S Q;  2A8V A;  4A3M H;  3GTP H;  4BY7 H;  1FJG Q;  4YCU A;  3ZJY C;  1MKH A;  3K8A A;  4NXM Q;  5C0X J;  2VQE L;  4A3K H;  5C4J H;  4LF5 Q;  3FHW A;  4JBM A;  4IPC A;  4YWK A;  4JI0 Q;  4JI1 L;  4YWM A;  3VDY A;  3HOV G;  4IFD G;  1QZG A;  4GOP A;  5M3M H;  3I2Z A;  3MXN B;  3H0G H;  3UE0 A;  4DK3 C;  4UPA A;  2Z6K A;  5HY6 A;  1KRT A;  5IWA L;  3PUZ A;  2UU9 L;  2KEN A;  1AE2 A;  1NE3 A;  1VQC A;  4FDB A;  1NMF A;  2K5H A;  3ULP A;  1Y1W G;  1HNZ Q;  3GTL H;  4B3R Q;  1PH2 A;  4P74 A;  3KYH C;  3NEM A;  4PZ6 A;  2F52 A;  2UXD Q;  1KC8 C;  4X66 Q;  4GKK Q;  4O0A A;  4B3M L;  4DR7 Q;  3CW2 C;  4DV5 Q;  1N34 L;  1YJ9 A;  2YU9 H;  3AQQ A;  2OCE A;  4A3D G;  1CSP A;  4L5R C;  3B6Y A;  5IP7 G;  1R9T H;  3GD7 A;  4GNX C;  4JYA Q;  3H15 A;  2E2J H;  1C9O A;  3OTO L;  5ELN A;  1I50 H;  2ZJR A;  4XTC S;  1T9H A;  5GAE C;  1RIP A;  3EN2 A;  4IFD I;  5C4X H;  4DK6 C;  1VQE A;  4AQY L;  4Y52 H;  2XGT A;  4HJ9 A;  3RNU A;  1OXT A;  3TRE A;  3G71 A;  4IPH A;  3J81 j;  1HNW L;  4BBS H;  4A3B H;  2CKZ B;  1P16 A;  3M85 A;  3KJP A;  4DV6 Q;  2I0Q A;  1JB7 A;  4GOP C;  2K5V A;  1N34 Q;  2PNH A;  3KF6 A;  4C2M H;  2R92 H;  3I4M H;  4LF7 L;  2ZM6 Q;  4LWC A;  2Z6K C;  1JMC A;  3I7F A;  4POF A;  3CCJ A;  5GRO A;  5GAD C;  1H95 A;  2R7D A;  3PUX A;  3STB D;  1XMO L;  4OWW B;  4OO1 G;  4QQB X;  1DGS A;  3M7N A;  1VQ6 A;  2GN5 A;  1YHQ A;  3CQZ H;  4LF8 L;  4YY3 L;  4A3J H;  1Q1B A;  1XPO A;  1HNX Q;  1OTC A;  1MIU A;  3UDI A;  4DV4 Q;  2JA5 H;  1EUJ A;  2ZJQ A;  4MNO A;  4AYB E;  1I3Q H;  4LFC L;  4NXN L;  2MO1 A;  3PUV A;  1EWI A;  1P8L A;  2D0O A;  4A3E G;  1XNR L;  2WB1 E;  1KRS A;  4IO9 A;  1YZ6 A;  1WFQ A;  4JI5 Q;  1XNQ L;  2R6G A;  4PZ7 A;  4BY1 H;  4JI3 Q;  3RLO A;  1UE7 A;  3CC7 A;  3RN5 A;  3GTQ H;  3RLF A;  2QA4 A;  5JEA J;  4LUV A;  3HOU H;  4X6A H;  4GNX B;  1VQ5 A;  1IBL L;  2D62 A;  1HZA A;  3S1R H;  4A76 A;  1G6P A;  2F3I A;  4R4O A;  3ULL A;  2VW9 A;  1D7Q A;  5IYD G;  2NN6 G;  4Y7N H;  4L5S A;  4A3C H;  4OO1 I;  3ULJ A;  3RR5 A;  4OWX B;  3UE1 A;  1TWA H;  1E22 A;  2CQO A;  4JI2 Q;  5C0X I;  2AMC B;  3DLL A;  3GTO H;  3PO2 H;  2Y0S G;  2OTJ A;  1LTL A;  2HHH L;  2R93 G;  4DR5 Q;  4GOP B;  3TS2 A;  1GKH A;  3HOX G;  1BBU A;  2Z0S A;  3KLW A;  4LF6 L;  1K83 H;  2ID0 A;  2VUM G;  2VQF Q;  3T1H Q;  3U50 C;  3CCL A;  1PH8 A;  1N33 Q;  2JA7 H;  3PF5 A;  4JBK A;  2AWO A;  2QGQ A;  2E5L L;  5J3B A;  4IFD J;  1VQI A;  1YBY A;  2BH8 A;  1VQM A;  2L15 A;  1E1T A;  3GTJ H;  1YEZ A;  4JI4 Q;  1GM5 A;  2OWO A;  2AWN A;  2RF4 A;  4GS3 A;  4PMW A;  3ER0 A;  1PYS B;  4GKK L;  1BBW A;  2NN6 I;  3DM3 A;  1B70 B;  4HJA A;  4DPG A;  4QGU A;  1XMQ Q;  1QVF A;  3GTG H;  1LM0 A;  4HIO A;  4BXX H;  1N9W A;  3CC2 A;  3RZO H;  2BA0 A;  2PI2 A;  2JA6 G;  4A75 A;  2OTL A;  4LFB L;  4BBR G;  3A74 A;  1IXR A;  3CF5 A;  1HZB A;  1SR3 A;  3GTM H;  2UXB Q;  3HKZ E;  4OXP A;  3H3V I;  2PQA A;  4MTN A;  3FKI G;  4DR6 Q;  1KXL A;  2KCM A;  1NTG A;  1CSQ A;  3L7Z C;  4K0K Q;  4QJF A;  4X64 Q;  3KF6 B;  2AKW B;  4LUO A;  1GVP A;  1S40 A;  1EYG A;  2A1A A;  4A3G H;  1HJP A;  1E24 A;  2RCN A;  5M3F H;  1YJW A;  4B3T L;  2MQH A;  3CCS A;  2JA9 A;  1N32 Q;  4O2D A;  1PFS A;  4JBW A;  4H02 A;  1I94 L;  4AH6 A;  2ES2 A;  2UXC Q;  1QVG A;  1Y1V G;  4P75 A;  2ZTD A;  3TS0 A;  1AH9 A;  4OX9 L;  3I4N H;  1I5F A;  4A3I G;  4JV5 L;  2K50 A;  3HOY H;  4JI6 L;  5GAG C;  1A63 A;  3NBH B;  4DV2 Q;  4LF9 Q;  3CCQ A;  5LMU Q;  5FJ8 H;  4JC0 A;  5BR8 L;  3S15 H;  5C44 H;  1VQA A;  2WP8 J;  2UUC L;  3HOV H;  4LW1 A;  1OXX K;  4DAY B;  3J80 c;  1YIJ A;  1WCM G;  4IOC A;  4A3F G;  2B63 G;  1B8A A;  1UE6 A;  2BA1 A;  4DV1 Q;  3D0F A;  1IYJ B;  1Y14 B;  5C3E G;  1CKO A;  3T1Y Q;  4LF4 L;  4X62 Q;  3K81 C;  4DUY L;  2RHQ B;  4C3I H;  1J5E Q;  4LFA L;  1PH1 A;  4A3M G;  3KF8 B;  4BY7 G;  2MO0 A;  3GDE A;  4DR3 L;  2IHF A;  2VQE Q;  2VNU D;  4QY7 A;  1VS0 A;  4AYB G;  2RHS B;  4DR4 L;  1SRU A;  3M4Q A;  4JI1 Q;  2QEX A;  1EFW A;  4J15 A;  3HOZ G;  4UP9 A;  1E7Z A;  2WB1 G;  1PH5 A;  2ATW A;  1PH4 A;  2VY3 A;  3G4S A;  5JJI A;  1VQL A;  5M3M G;  4QIW E;  4GKJ L;  4UP8 A;  2GVB A;  3Q8D A;  5FLM H;  5IWA Q;  1I6H H;  2UU9 Q;  2CWP A;  2YYZ A;  2YV5 A;  2CFM A;  1KQS A;  3W1B A;  1IBK L;  3EIV A;  2F4V L;  4B3M Q;  3BJU A;  4X65 L;  1AE3 A;  1HR0 L;  1ASY A;  1X56 A;  3I4O A;  2JEA I;  3NEL A;  2E8G A;  1IBM L;  3RN2 A;  3OTO Q;  4A93 H;  2CWA A;  1UE5 A;  5LMN W;  2PQA B;  1VQK A;  3CC4 A;  4DV7 L;  4AQY Q;  1CKN B;  3PO3 H;  4DR1 L;  4KHP L;  5C4X G;  1VQJ A;  3J81 i;  2UUA L;  1HNW Q;  1V9P A;  4QL5 A;  3PV0 A;  1VQ4 A;  5JJL A;  4IPG A;  4HIK A;  4A3B G;  4BBS G;  4R4I A;  2NVY H;  2E2I H;  1X3F A;  4DR2 L;  1VQ9 A;  5IYC H;  3CCR A;  4LF7 Q;  2VZA A;  2R92 G;  1NMG A;  2DGY A;  3UDG A;  4ME3 A;  3NEN A;  2N8N A;  5JJK A;  3K0X A;  1IBM Q;  1XMO Q;  3S14 H;  4JI8 L;  2NZH A;  1B7Y B;  1YHA A;  1UWV A;  5K36 G;  1D8L A;  4LF8 Q;  4YY3 Q;  2LXK A;  3HOW H;  1TWC H;  5IY0 A;  1K8A C;  1Q12 A;  4A3J G;  3J81 c;  4LNQ A;  2R7Z H;  3JAM i;  4YCV A;  2K5N A;  1UEB A;  1VQF A;  2AHO B;  2FXQ A;  4R1J A;  4LFC Q;  1U5K A;  1VQH A;  4OWT B;  4JI7 L;  4NXN Q;  2D0P A;  3PCO B;  1XNR Q;  3BZK A;  1G29 1;  3CCU A;  4JOI A;  3PUW A;  2CCZ A;  4UY8 C;  4YHH L;  3PIO A;  1XNQ Q;  4DNI A;  5HGQ A;  2JQO A;  1LYL A;  1W2B A;  1TXY A;  1VQO A;  2I5H A;  4DV0 L;  2UUB L;  4AIM A;  2OQ0 A;  4JBJ A;  5M5X H;  2K14 A;  5LMN L;  1IBL Q;  3HOU G;  2IT1 A;  2VUM H;  2OQK A;  1KAW A;  1OXU A;  3F8T A;  4EQ5 A;  1JJ2 A;  4DKA C;  3F2C A;  1N8R C;  1BKB A;  5IYB H;  3W1G A;  3JAM c;  1HH2 P;  4A3C G;  2WAQ E;  2JA8 H;  1QVC A;  4HID A;  3J7A 5;  1SRO A;  4PG3 A;  4TVA B;  3A5Z B;  4A4I A;  4YHH Q;  3F2B A;  3PO2 G;  1JT8 A;  2HHH Q;  3E9I A;  2K52 A;  3ICE A;  4DUZ L;  4IOA A;  4LUZ A;  1VQ7 A;  3I56 A;  1GD7 A;  5AJ3 L;  4LF6 Q;  1WI5 A;  2JA6 H;  3CAM A;  3CMA A;  2IX1 A;  2I5L X;  3ERS X;  4R4C A;  2E5L Q;  2JA7 G;  2KCT A;  1VQD A;  2N3S A;  3CXC A;  4A3L H;  3STB C;  1SFO H;  1Q8K A;  4JOI C;  2NZO A;  1L0W A;  5IP9 H;  1MJC A;  3PIP A;  4IPD A;  1Q7Y C;  1ASZ A;  1GO3 E;  4WJ3 M;  1Z9F A;  2B3G A;  3S1M H;  1JJC B;  1TWH H;  3E0E A;  3M3Y H;  5H1S E;  1EIF A;  4TQU S;  4C3H H;  4BXX G;  4BA2 I;  4LFB Q;  3GO5 A;  3M9B A;  1QZH A;  1E1O A;  3J80 i;  5IT9 c;  1K9M C;  3S17 H;  1O7I A;  1YVC A;  3PF4 A;  3HFZ B;  1Y1V H;  3CPF A;  1A62 A;  1Q46 A;  3I55 A;  1YI2 A;  1N36 L;  1A0I A;  4R4Q A;  4A3I H;  1NY4 A;  1OXV A;  3BZC A;  1YNX A;  4IJL A;  2JJQ A;  1E3P A;  4B3S L;  2VL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...