4QY7A

Crystal structure of a yoba protein (bsu18810) from bacillus subtilis subsp. subtilis str. 168 at 1.55 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
GDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (yobA) from Bacillus subtilis subsp. subtilis str. 168 at 1.55 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein YobA
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11518 DUF3221 Protein of unknown function (DUF3221)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qy7A01
1Q7YC 4A3KH 3FKIG 5IP9H 1Q86C 1SN8A 1VQ8A 3GTKH 4A3DH 4B3MQ 3S1NH 3KJPA 1ASYA 4IJLA 1O7IA 3T1HQ 3HOVH 1SR3A 2KHJA 4JI3L 4BBRG 4OX9L 5C4XH 3HOXH 1C9OA 2R92G 3I4NH 1HZ9A 1VQ9A 5C3EG 1XTDA 1KIXA 2Q2UA 1X3EA 5IYCG 4WJ3M 4JCVE 3H3VI 2MQHA 3TEHB 4DV2Q 4KI0A 1NE3A 1K0RA 4A3IG 3OYYA 1WCMH 1K9MC 4NXML 3DM3A 4P73A 3CXCA 5C0XI 2NZHA 2EXDA 4X64L 4QQBX 1JJCB 2VL6A 1Q1BA 2WP8J 4BY1H 2D62A 5M3FH 4IPDA 3S24A 1NBWA 4X62L 4B3TL 4A3BG 4DAYB 4JOIA 2A19A 4LF9L 1KRSA 4LFBL 1WOCA 3GD7A 5H1SE 4GNXC 1B70B 2UUCL 3TQYA 3S16H 2JA8H 4RG1A 2D0OA 4TVAB 2I5HA 4P74A 4HJAA 1VQNA 2OQKA 1Y1WG 1DGSA 1K83H 1PH7A 4OXPA 1D8LA 5M3MG 2PI2E 2R7DA 5IYBG 3CC4A 4OX9Q 4BY7H 1TWAH 1AE2A 3STBC 2A1AA 4FDBA 3PF5A 3HOVG 1HR0W 3HOWH 2KHIA 3W1BA 2DUDA 4DR2L 4JI0L 2UUBQ 1BBWA 3I4MH 4PZ7A 1FVIA 5FJ8H 4DV7L 3NBHB 5BR8Q 1XJVA 5E7NA 1E22A 2E2IH 1V9PA 3KF6A 2I0QA 4DAMA 3K0XA 5IYDG 1VQFA 5ELOA 1QVFA 4HJ8A 1GD7A 1JE5A 1BVSA 3GTJH 3CMEA 2N8NA 2RF4A 4A93H 4A3LG 1Z9FA 4BBSH 3HOUG 4BXXH 1HR0L 2FXQA 1CKNB 4DNIA 1YEZA 1PHJA 1YBYA 4L5TA 2EIFA 4YCWA 3DLLA 4P75A 4A3JG 1BKBA 3UE1A 1JB7A 1VQGA 4HIMA 1B8AA 2OQ0A 5C4XG 4LUVA 4JI0Q 4JI1L 1YJNA 3U4VA 4LFAL 4DPGA 3CQZH 4IPHA 2JA5G 3HOYH 1OXXK 1VS0A 4QJFA 5GAEC 5IP7G 1UE6A 1C0AA 2JEAI 2NVTH 3W5OA 1AE3A 4HIKA 4A3FH 3FKIH 1U0LA 3TS0A 4DR7L 1HR0Q 4NPSA 2YTVA 1WCMG 3LGJA 3UDIA 4MZ9A 3RR5A 1G6PA 3F2DA 3S2DH 4AQYQ 5GAHC 3G6EA 1GM5A 4JI4Q 2ZM6L 1A62A 1SFOH 4DV3Q 4JI3Q 1E7ZA 2IX0A 3L0OA 1D7QA 3J81j 3PGZA 3E9HA 4DV4L 4LF8Q 4DR4Q 3B6YA 1VQEA 4PZ6A 4UP7A 1FL0A 4JC0A 1I94Q 1XMQQ 1PH9A 4EQ5A 2B63H 4KHPQ 3KOJA 2UXCL 2JA9A 1Q81C 2WAQE 1N34L 2ZM6Q 1S72A 5IYBH 4BY7G 1MJEA 4IO9A 2YTXA 4HJ5A 1VQOA 1CSQA 4B3TQ 3PUVA 3ICEA 4L5QA 1WYDA 4LFBQ 2PI2A 3I7FA 4NXNL 1VQKA 3CCEA 1SROA 5GROA 4YCVA 4JI2L 3Q8DA 1KHIA 2MFIA 4BY1G 2OTLA 3KF6B 4JI6Q 3A5UA 1I5FA 5M3FG 1PH1A 5J3BA 2Q2HA 5IY0A 3T1YQ 4DKAC 1PH6A 3I56A 4WJ4A 1PYSB 1QVCA 5K36G 1S3OA 5DLQE 1K8AC 2JA8G 1QVGA 5IP7H 3H15A 4YWLA 1Q82C 1L1OA 4MNOA 5LMNW 1I6HH 2ZTDA 1UWVA 3HFZB 1N34Q 2IY5B 4HJ9A 3FP9A 4JI5L 2RHSB 1GKHA 5IP9G 5M5YH 2ZJQA 2KBNA 5M3MH 3KDFA 4DR3Q 2Z6KC 3CCSA 4OWWB 3GTLH 4DK3C 4GN5A 1YHAA 2BA1A 3G48A 4LFAQ 3EIVA 2YTYA 5AJ3L 5LMUL 3BZKA 3T1YL 2E5LL 1MKHA 3BJUA 1EIYB 4K0KL 4JBWA 4LF5Q 2PQAA 4BA1I 3K7UC 3H0GG 3UE0A 1IBLQ 5HY6A 4A3FG 1IYJB 4LUZA 2Y0SG 3KFUA 4YY3L 4JI5Q 1HNXQ 2Y0SE 2VQEQ 1Z47A 2N3SA 4DR3L 1CSPA 2R6GA 4OONA 2ZTEA 3S1MH 3W1GA 4LF6Q 4POGA 3HOZH 3F8TA 2RCNA 1VQMA 1VQDA 1NMGA 4IFDG 2ASBA 4L5SA 3CCLA 4B3RL 4OO1I 1I50H 1NTGA 3CF5A 5LMUQ 4AYBE 1N32L 1PVOA 3M7NA 1VQ5A 2EQSA 2VZAA 4LF9Q 5ELNA 4JV5Q 3PUZA 4JYAQ 3S17H 4IFDJ 1I3QH 1CUKA 3PSIA 2YV5A 3PO3G 1OXUA 1Y1VH 4QGUA 3AFPA 4ME3A 1UEBA 4PG3A 2IHFA 3ZJYC 3KJOA 4GS3A 3SGIA 1PFSA 3NELA 3D0FA 3U50C 1EIFA 1YJWA 1IBKQ 3CC2A 3L7ZC 3I4MG 1JMCA 1L1OC 3GTGH 5IE8A 5C44H 5BR8L 5C44G 1VQ4A 2ZTCA 3AFQA 5GADC 1XNRQ 5JEAJ 2WB1G 4GNXB 1HZAA 4DR2Q 3F1ZA 1YHBA 5GQOA 2HT1A 1I94L 1EYGA 1HNWQ 4A3LH 1QZHA 1Q8KA 4L5RC 4BA2I 3STBD 2ES2A 5IYDH 1OTCA 4GOPA 3M9BA 3EN2A 1IBML 1VQHA 1EOVA 1Y14B 4O0AA 1V43A 1TWCH 2L15A 4YWMA 3RLOA 1J5EL 3KLWA 4JI8Q 4UPAA 2VQFL 3RN2A 2R7ZH 2R7ZG 2AKWB 3MEFA 5M5WH 2JK8A 1E3PA 1N8RC 4Y52H 1N9WA 4YHHQ 2BH2A 3I4NG 4R4TA 4JG2A 2UUCQ 1TWFH 4A3EH 1P16A 1N33Q 2R92H 1UE5A 4DR7Q 4A3IH 1VQCA 4DV5L 1A63A 2I5MX 2N49A 1YNXA 3PV0A 1IBKL 3CCVA 2JA7H 4R1JA 3WWVA 4JBMA 2GVBA 1L2FA 3M3YH 1TWGH 4OO1G 5M5XH 2Q2TA 5FJ8G 5JJKA 1LYLA 1TXYA 2E5LQ 1KC8C 1XMOL 2K52A 4DV6L 1NJIC 5FLMH 2VQFQ 4YHHL 4ALPA 3L2PA 3CD6A 3PO2H 4AQYL 2I5LX 2UXBQ 4A3JH 2HHHQ 3CP0A 3I4OA 4DV5Q 1XPOA 2VQEL 4DV0L 1YZ6A 2BH8A 4C3IH 1YJ9A 4C3HH 1SMXA 3CPFA 5GAGC 1R9TH 5IT9c 3HOZG 1PH4A 1JT8A 3J81c 3OTOL 4LF5L 2K14A 1HNXL 2B3GA 3GDEA 2NVXH 3J7A5 1N33L 1Q46A 4QL5A 3J81i 2K5VA 1YIJA 2E2JH 3U4ZA 2F4VQ 1PH8A 3EBEA 2GVAA 1U5KA 4IPGA 3JAMc 4DV6Q 3A0JA 2UXDQ 1E24A 1WI5A 4IPCA 1EQQA 4R4CA 3M4PA 3PUYA 4JOIC 4LFCL 2JJQA 4GKKL 2PMZE 4RMFA 1SLJA 4DUYQ 3PO3H 1V1QA 3K7AH 3S14H 4GNXA 2OTJA 4A3CH 4A3CG 1LM0A 1TWHH 2D0PA 4GLXA 4IJHA 3H0GH 3S1RH 1VQ7A 4LF4L 2JA7G 1VQIA 3D31A 3PUXA 4GLAC 3J80c 1J6QA 4UY8C 4A3MG 1ASZA 1UE7A 1JJ2A 4GOPB 1EFWA 1HNWL 4R4IA 3K81C 4DR6L 4A3DG 1A8VA 1VQ6A 2E8GA 3H3VH 4JI4L 1VQBA 1S40A 1FGUA 1C7YA 5FLXc 3ER0A 2K50A 4B3SQ 2N78A 2WFWA 1EWIA 4AYBG 2UUAQ 2WB1E 2CKZB 2PNHA 4H02A 4R4OA 1WFQA 1CKMA 4DV4Q 4LF8L 1PH5A 1X65A 3CAMA 4YY3Q 3JAMi 4OWXB 3GTOH 2LSSA 3CW2C 1IL2A 3GTQH 1MJCA 2IT1A 1IBLL 1OXSC 2AHOB 4YCUA 1E1OA 3ULJA 2H5XA 4LFCQ 1J5EQ 2QA4A 3CMAA 2ZJRA 2UU9L 3TS2A 3S2HH 3JC66 1QUQB 2UUBL 2CQOA 2HIXA 2CCZA 4GN3B 4JI8L 3M4QA 2Q2IA 1XMQL 1OXTA 1M1KC 3UDFA 4APVA 1YVCA 1PH2A 4C2MH 4DUZL 1KQSA 2DGYA 5LMNL 1YHQA 3HOUH 1GO3E 4BXXG 2UUAL 3CCRA 1XPUA 1BBUA 4A75A 1N32Q 4X65Q 3VDYA 1AH9A 1SE8A 2AMCB 2MO0A 3PCOB 2AWNA 4GLVB 3T1HL 2OWOA 4B3RQ 1X3GA 2MNAA 4B3ML 4JI6L 4GOPC 3I2ZA 1X54A 3PUWA 3F2CA 2LXKA 5JJLA 4JBKA 4LNQA 4JI2Q 3OTOQ 1VQLA 2NVYH 1PA6A 1RIPA 1X55A 3AYHB 1HJPA 2C35B 4JV5L 5IYCH 1KRTA 3HKSA 3CCUA 1KXLA 4JI1Q 4QIWE 5C4JH 3RZOH 1WJJA 4DK6C 4EX5A 2NN6G 2HHHL 4BBSG 3NEMA 1X6OA 1P8LA 3UDGA 1YITA 1UE1A 2B29A 4GN4B 3M4OH 4A3GH 3KF8B 2AWOA 4JI7L 4A4IA 5IWAL 3HKZG 3PO2G 4IFDI 2JEBI 1RL2A 5LMNQ 4LF4Q 1NMFA 2UXDL 4LWCA 3CCMA 4HIDA 4P72A 4X66Q 2K4KA 1PH3A 2NN6I 3E9IA 2VUMG 2K5NA 2XGTA 2VW9A 4YWKA 1XNQQ 4NB3A 4Y7NH 3UDXA 4DV1L 4IOCA 4P71A 1FJGL 2JE6I 2YYZA 2Z0SA 4PZ8A 4DV7Q 2RHQB 1EUJA 3G71A 3ULLA 4DV3L 4DR4L 2MO1A 1N36Q 4TQUS 3FHWA 5AJ3Q 1VQPA 2IX1A 1PV4A 1GVPA 1YI2A 3RN5A 4BBRH 1SRUA 4C3JH 4JI7Q 4KLKA 5HGQA 4KHPL 2UXCQ 2Z6KA 1A0IA 3IRBA 4A76A 1JJGA 4DV1Q 1KD1C 2QEXA 4A3BH 1QUQA 2F52A 3RLFA 2V1CC 5C0XG 1E1TA 2K5HA 1M90C 4NXNQ 4MTNA 4QY7A 4B3SL 2VS1A 2IHEA 1Q12A 2ID0A 1B7YB 2UXBL 4AH6A 4A3MH 2CWAA 3K80C 1N36L 1XNRL 2KCMA 1NY4A 2A8VA 4PMWA 2F3IA 2JA5H 3G4SA 1L1OB 1K3RA 4HIOA 2JA6H 3M85A 4XIGS 2LXJA 4DUZQ 1IZ6A 1G51A 1W3SA 2BA0A 4AIMA 1HNZQ 3KDFB 4KHZA 2R7FA 1QZGA 4X64Q 3BU2A 3GTMH 2QGQA 2VNUD 1X3FA 3NENA 4A3KG 1IBMQ 1L0WA 1Y1VG 2KCTA 4JBJA 4DR1L 1X9NA 4LF7Q 2R93G 1VCIA 2NVQH 1MIUA 4DUYL 2OCEA 1Q1EA 3CPWA 3RNUA 2F4VL 3GTPH 5C3EH 3CCJA 4X6AH 1XPRA 1PYBA 2PQAB 3J7ZC 1KL9A 3AEVA 4LUOA 1K73C 1LUZA 4LW1A 3PIPA 5JJIA 1HH2P 1EQRA 2VUMH 3A74A 1HZBA 1HNZL 4R4QA 1OXVA 4POFA 3RLNA 3KYHC 4UP9A 4XTCS 2VY3A 3F2BA 3OW2A 1W2BA 2E2HH 3TRZA 3K8AA 3PIOA 4DR5Q 2HQLA 3S15H 2JQOA 4A3GG 1LTLA 3U58A 3CCQA 3HOYG 5JEAG 4K0KQ 2YU9H 4LF7L 4DR6Q 3TREA 5IWAQ 4GKJL 3BZCA 3S1QH 1G291 4HJ7A 2WAQG 2GN5A 4UP8A 3A5ZB 1Y1WH 4DR1Q 1FJGQ 2CFMA 3HOXG 1CKOA 4J15A 1XNQL 4IOAA 2R93H 4A3EG 4LF6L 1X56A 5C0XJ 3I55A 2K75A 4DV0Q 2HIVA 4X66L 4A93G 1KAWA 1HZCA 3J80i 2ATWA 2CWPA 2UU9Q 4JYAL 1T9HA 3E0EA 3HOWG 4OWTB 3GO5A 3ULPA 1K8GA 2KENA 1IXRA 2NZOA 1XMOQ 4GKJQ 1H95A 3PF4A 4X62Q 3CC7A 3RZDH 4X65L 4NXMQ 1CKNA 5FLMG 4O2DA 3AQQA 4DV2L 2B63G 1VQAA 5EAYA 2JA6G 4DR5L 2ZJPA 3HKZE 3ERSX 3MXNB 2ALYB 1VQJA 4GKKQ 2XTIA
chains in the Genus database with same CATH superfamily
4A3KH 1EEID 2JA7B 3S1RB 5IP9H 1ASYA 4A3EB 1O7IA 4K5WA 4JI3L 1AZPA 4WJ3M 2MQHA 3TEHB 4KI0A 1PTOC 2NZ1D 2DJFC 2RSOA 3DM3A 4P73A 4NXML 5C0XI 2NYZD 4X64L 3OMGA 3QO2A 2WAQB 3T16A 1WOCA 3GD7A 5FKAC 5H1SE 1B70B 1VMPA 5C6AA 3TQYA 4Y7NB 4BS9A 3TBIB 2I5HA 4P74A 2OQKA 1Y1WG 1DGSA 4ZLTF 1D8LA 5M3MG 2PI2E 1SDFA 1PDQA 4BY7H 5C4HA 4FF2A 1AE2A 2QCPX 3STBC 3HOVG 3HOWH 1OO9B 4TRDA 1DCZA 2UUBQ 1BBWA 5BR8Q 4WFN3 2F0IA 1VDZA 2I0QA 1JOOA 3K0XA 4M1UB 1QVFA 5ELOA 1IKMA 4EQOA 2N8NA 1Z7TA 3K59A 4DNIA 4QB4A 4L5TA 2EIFA 2C5CA 3OW7A 3UE1A 5C3XA 1B8AA 2OQ0A 4LUVA 3U4VA 3CQZH 2IWHA 1AE3A 1HFGA 4A3FH 3FKIH 4DR7L 1HR0Q 4OHJA 4C56C 1Q3LA 3UDIA 3S2DH 2RDGA 3GTOB 3DWAA 1Z6HA 5CMDA 1D1KA 1QNUA 2DNCA 1E7ZA 1YNND 3L0OA 4DV4L 3DWQA 1KDAA 2EY5A 4DR4Q 4K8IA 1U4RA 4A3JB 1JB3A 1TS2A 3NK9A 1FL0A 5C3WA 1G2TA 1I94Q 2G9DA 2Q8IB 4KHPQ 3KBXA 2Z9HA 2WAQE 2EZVA 1MJEA 3Q24A 4KKUA 3TP8A 1LTGD 1WTWA 4KJNA 1WYDA 2PI2A 2AQ2B 2HDMA 1Y8NB 2OTLA 1LTBD 3D4WA 1F9PA 5M5WB 2A6HC 4RWSC 1F9SA 2IX3A 1I5FA 3T1YQ 1PH6A 1PYSB 2PQEA 3VYTA 1B9NA 5IP7H 3H15A 1Q82C 4MNOA 5LMNW 4V190 2ZTDA 2F3WA 3DHQA 2RHSB 1K3BC 4DR3Q 4ZKBB 3GTLH 1FYCA 4GN5A 4LFAQ 1JOQA 5KGUA 3T1YL 2OXPA 1B1ZA 2M9VA 3N6RA 1IBLQ 3V96A 4RGMA 3R2IA 3KFUA 4ZYSA 4JI5Q 4KTAA 1I4RA 1Z47A 1E2WA 4K5XA 4OONA 2ZTEA 3W1GA 4QUFA 2F0WA 3VR4A 1JE4A 4L5SA 2PZUA 4B3RL 4KHVA 4OO1I 3D8GA 2NTSA 5EKKA 3FDTA 4AYBE 3M7NA 2VZAA 1PMRA 3M7GA 3PUZA 4IFDJ 1I3QH 3TP5A 1LLRD 3OHXC 1Y1VH 4IUVA 2B2WA 3P20A 1RD9D 2F0NA 4ME3A 4PG3A 3CXCA 4GS3A 1EIFA 2WACA 1JMCA 5EPLA 3GTGB 3I70A 3CQZB 1GHKA 3F1ZA 2HT1A 2E2DC 4NW2A 3DWPA 3STBD 2ES2A 2IL8A 2F4IA 3EN2A 1VQHA 1EOVA 4O0AA 2F0KA 4RFBA 3Q23A 4MIUA 1J5EL 4UPAA 2AKWB 5M5WH 1DOLA 1H9SA 3HOXB 4Y52H 2BH2A 3EQLC 5T1GA 4XT3B 1LTSD 4MN3A 4DV5L 1A63A 2I5MX 5CBAE 1XYIA 4R1JA 3QOLA 4JBMA 3S1NB 4OO1G 3VYRA 5AFWA 4YHHL 1ESFA 1U4LA 3CD6A 1SMYD 2G9HD 1RODA 2CH4A 4A3JH 2IJ0A 1I6VC 2B2TC 3OIQA 1YZ6A 2BH8A 4C3HH 2RDFA 1R9TH 3BVMA 5J22A 1PH4A 2QW7A 2Q8RE 3GDEA 3J7A5 1JQYD 3J81i 2K5VA 2E2JH 1B4OA 2F0QA 2F4VQ 1SE2A 4QIWB 4IPGA 4DV6Q 2UXDQ 3A0JA 5I9PA 5I4DA 1W6KA 2WV6D 5FOBB 4GKKL 4LFCL 4RMFA 1SLJA 4A3FB 3VR3A 2HCCA 2OTJA 4HSPA 3M4YA 3RUZA 3OWEB 4FF3A 2D0PA 1A6XA 3C46A 3S1RH 3HG9A 1UNSA 1IHZA 2SNMA 2F0UA 4GLAC 2KQ3A 3J80c 1EWHA 4A3MG 1JJ2A 4G4KA 3BYTB 4JVZA 4H0LC 2B63B 3D6CA 4JI4L 3H3VH 1VQBA 4KK7A 1GUOA 2K50A 4B3SQ 4AYBG 4ME5A 4FYDA 2IPKD 2PNHA 1WFQA 1PH5A 1O7YA 3CAMA 4OWXB 3HOWB 3CW2C 3GTQH 2IT1A 3ULJA 4YCUA 2H5XA 3DUZA 3CMAA 2UUBL 3K5MA 5KNDA 2CQOA 4GN3B 3KUPA 3M4QA 4H44C 4I65A 1AN8A 1TY0A 2EY2A 1EZ8A 4BXXG 2DGYA 1GO3E 1PTOB 2WIIB 1XPUA 1TT2A 1AH9A 3VDYA 2LY7A 4GLVB 2AWNA 4ZUJA 2E76C 2F3VA 2N88A 4JI2Q 3OTOQ 3D6WA 3AYHB 4CJ1B 5IYCH 3C1EA 1S5BD 5C4JH 3I4MB 1WJJA 4EX5A 1UE1A 2B29A 5E1FA 1TWAB 2AWOA 4JI7L 4N8X1 4A3KB 4DNTB 4XYQA 3ERQA 3OPOA 1RL2A 3BVGA 1F2YA 3D4RA 4A3MB 1PH3A 4DU9A 3E9IA 3RZDB 5C4JB 4YWKA 3U9OA 2QDLA 4RHRA 1EY9A 1PZJD 2YYZA 2Z0SA 1EUJA 3E5SA 3G71A 3ULLA 3Q0AA 1B9MA 2MO1A 1JWUD 4TQUS 3FHWA 4IUNA 2IX1A 1GVPA 3MEHA 4B08A 1EYAA 1SRUA 4KHPL 2K03A 1JJGA 4A3BH 1M90C 4RGOS 1E1TA 4QY7A 4F8MA 3C3LA 2A68D 2VS1A 2IHEA 3TSSA 4NMZA 5ELBA 2CWAA 1XNRL 3BDLA 4PMWA 2F3IA 5IGEA 4NDXA 2JA6H 1LT6D 3M85A 4XIGS 1RKNA 1MI2A 3GTQB 1IZ6A 5FO7B 4K5VA 2CH4W 2OT2A 2F0VA 3RZOB 2R7FA 5EGTA 3BU2A 2QGQA 1X3FA 5C4ZA 4JK1C 3V05A 2R93G 4JBJA 1X9NA 1BQQT 4IURA 2NVQH 5IODA 3RNUA 2PQAB 1JR0D 4O1NA 1IL8A 5T1IA 1LUZA 2Z1CA 1BDOA 5JJIA 3EROA 3A74A 4R8NA 4R4QA 1S5DD 1OXVA 2WINB 2HCIA 1Y1WB 3NPPA 4UP9A 4XTCS 3F2BA 1W2BA 3LX0A 3TRZA 3NHHA 1TS3A 3K8AA 4Z9CB 5NUCA 3DMUA 3T4AC 3PIOA 1K28A 1LTLA 3U58A 2L4NA 1AW7A 1UUPA 2A74C 4K0KQ 5BN5A 4ABNA 5DAUA 3S2HB 2GN5A 2CQAA 4UP8A 4DR1Q 3I72A 3SXHA 2LKVA 1CKOA 1RCVD 4LF6L 1IYVA 5C0XJ 4DV0Q 2EY1A 2HIVA 4A93G 1KAWA 4C3HB 3E0EA 2FJ2A 5BN3A 3TP6A 4KKSA 3CC7A 3D3RA 3QOJA 5FLMG 4HAEA 5IIFA 4HR7B 4K8JA 4ZCKA 2B63G 1Y69U 1LTID 3BYYB 2L11A 3S1NH 1X3PA 4Q0FA 1VQJA 3T13A 2XTIA 3I4LA 1FD7D 1Q7YC 1H9KA 4TKOB 3H0GB 1VQ8A 4A3DH 3KK7A 2F0JA 4ZRZA 3KJPA 1LTRD 2RA4A 3T1HQ 2F0FA 3HOVH 4OX9L 2PCFB 2RKSA 5C4XH 5KNBA 3HOXH 1QJOA 1A3UA 1VQ9A 1XTDA 4IUQA 3IFTA 4HMIA 4FXGC 1K0RA 4X3SA 1K9MC 1W6JA 2NVXB 2EXDA 2B2VC 4B3TL 2F0LA 4A3BG 4DAYB 4JOIA 2F1MA 4LFBL 1SBBB 1YNJD 3PO2B 5L37A 1SJED 2JA8H 4CKBA 5FLXE 1K8OA 1R4QB 1DOMA 1K83H 1TWGB 4CJ0B 2X6GA 4OXPA 3CC4A 4RKBA 5IYBG 4E6IA 4OX9Q 1SNQA 1Y1VB 2F0SA 1PFNA 2NB0A 5CV6A 5D3IB 1HR0W 3W1BA 4JI0L 1H9MA 1FVIA 3MC0B 4NP5A 1XJVA 5E7NA 1E22A 3KF6A 4DAMA 1Y8OB 4YIJA 2R7ZB 4HJ8A 3CMEA 3GTJH 1STBA 2RF4A 4IFDH 2F0MA 1HTPA 2XRSD 3FVQA 4ZKCB 3HOUG 4DFAA 4CDEC 1CKNB 1ENFA 1ENAA 4YCWA 3C2PA 1JB7A 5A2QL 1VQGA 2DNEA 5C4XG 4JI0Q 2PW7A 4IPHA 1OXXK 2RVLA 1UE6A 4KMUC 1C0AA 2B2TA 2EYFA 3GTLB 1U4PA 4U68A 1B3AA 1GXDC 2LFNA 4MZ9A 2CW0C 2NTTA 3H94A 3F2DA 4AQYQ 3LWUA 4KV6A 2ZM6L 1A62A 2XSCA 3BDOA 3PGZA 1STHA 1GJXA 4C3IG 1BCPB 1ESRA 2F0PA 4PZ6A 4UP7A 1XMQQ 3KLSX 3MXUA 1Q81C 4RKLA 2ZM6Q 1D2BA 5M5XB 3J7AF 2NUCA 3PUVA 4HMJA 2ENBA 4LFBQ 1EY6A 2A6ED 1BCPD 2BCOA 3Q8DA 1I4PA 1KHIA 2MFIA 3KF6B 1A3TA 2P5ZX 5M5YB 1FNVA 1KNEA 4G57A 3SEBA 5M3FG 5J3BA 2Q2HA 5IY0A 3I56A 5K36G 1QVCA 2MUYA 5DLQE 1WVLA 1H9JA 3NUCA 3PQIA 4C3IB 1N34Q 2EJGC 2ZJQA 2Q8TA 1A2UA 2Z6KC 1BR9A 5ELEA 1J8IA 1STYA 3L9AX 3PIO3 1CFMA 1SXTA 3BZKA 5FO9B 3SK8A 1WTXA 3NQIA 1MKHA 1EIYB 4K0KL 1B44D 1EWCA 5HY6A 4A3FG 1R4PB 1SYBA 4DR3L 1CSPA 1STEA 4I7AA 1PRTC 4LF6Q 4POGA 3HOZH 4CDDC 3F8TA 1KDCA 1NMGA 2ASBA 5KYLA 3CF5A 5LMUQ 3SK5A 2TMPA 1PVOA 3O13A 4LF9Q 5ELNA 1SFOB 1NCVA 3S17H 4JYAQ 1A15A 1CUKA 3MZ5A 1LO5D 1OXUA 2B2YA 3OWFA 4QGUA 1UEBA 4RGTA 1YJWA 3SGIA 2H4OA 3NBIA 2Z4HA 3L7ZC 5BR8L 1VQ4A 2HDLA 3AFQA 4DXGA 1WTHA 5GADC 1SNMA 1XNRQ 2WB1G 4UAIA 1SMYC 1YHBA 3K57A 1HNWQ 1EYDA 1I4HA 1O7ZA 1Q8KA 1QZHA 5CYUA 1ZYRD 4GOPA 4XYOA 1OTCA 1PZID 2MP1A 5LHY1 2GA4B 1V43A 1TWCH 3RLOA 4JI8Q 1FR3A 4A93B 2VQFL 3MEFA 2JK8A 2FHTA 1G91A 1N8RC 3S1MB 1HA5A 4YHHQ 1ZKOA 1HXYD 4JG2A 1TWFH 4A3EH 2UUCQ 1U4MA 1F9RA 2N49A 1HUNA 1M4VA 2JA7H 1L2FA 1BF4A 1LYLA 4DAYA 1XMOL 1KC8C 4QUCA 5KYIA 1NJIC 4ALPA 1CK1A 2QILA 2I5LX 3IFDA 2UXBQ 1F2ZA 1SYDA 1GUNA 1CHPD 4QMGA 1SMXA 3CPFA 4LMQD 3SVMA 5IT9c 3KLSA 4QF4A 4BY1B 1JT8A 3OTOL 3E0JA 2SDFA 1VMCA 1Q46A 1TQOA 1DYQA 5BN4A 1E24A 4OEMB 3M4PA 3PUYA 4JOIC 1HFNA 2JJQA 2PMZE 5CORA 3K7AH 1IW7C 1QG7A 1A3VA 1IYUA 1ONLA 1TWHH 4BWGB 4GLXA 4LF4L 4I7ZC 1VQIA 1J6QA 4UY8C 2BDOA 1O7LA 1EFWA 1RF2D 4R4IA 3K81C 4DR6L 1JWSD 4A3DG 1A8VA 1VQ6A 1S40A 1FGUA 5FLXc 1VF7A 1DZ1A 2XIWA 2N78A 2I46A 3DM1A 2KVMA 2D5DA 3NWTA 3I90A 4KY5A 4H02A 1RDPD 4DV4Q 1O78A 2L12A 2LSSA 1IL2A 1MJCA 1IBLL 4H7BA 4HTHA 5A2QE 1J5EQ 2ZJRA 2UU9L 3MA2B 4IZ8A 2B2WC 4M8AA 2F0HA 3E6ZX 1XMQL 1OXTA 1M1KC 1UAPA 1KQSA 3VR2A 1JWMD 4DUZL 3K0YA 1YHQA 5HURA 3CCRA 1CA5A 1WD0A 1BBUA 1II3A 4X65Q 1I4QA 1SE8A 5CV8A 2AMCB 3NWSA 2OWOA 4JI6L 4KKTA 4BBSB 1EEFD 4GOPC 3PUWA 1GUWA 4JBKA 4EVOA 1PA6A 1HJPA 3CCUA 4N8FA 4JI1Q 3CHBD 1BO0A 4DK6C 3UDGA 1X6OA 1P8LA 5JAVA 2KEDA 1TKWB 3WDNA 2K28A 3HKZG 4LF4Q 4FO2A 2UXDL 4LWCA 4P72A 4WJWA 3MFYA 3J80L 1XNQQ 4NB3A 4IOCA 4FXDA 4DV7Q 2BOSA 1BXTA 4C3HG 3R93A 4DV3L 4DR4L 4PQXA 1PV4A 1CT1D 2AQ1B 1L0XB 1YI2A 4FF4A 4BBRH 4C3JH 1KABA 5HGQA 2EPBA 5M9OA 1WCMB 2Z6KA 1A0IA 3IRBA 4K6LA 1HTLD 1PYWD 1A2TA 2QEXA 3PIP3 5C0XG 4R9WA 2KEEA 2ID0A 1TIID 5CV9A 1N36L 2E2HB 2A8VA 3A56A 1K3RA 1D6EC 2LXJA 3M4OB 2VB3X 4KHZA 2PW5A 3E3XA 1QZGA 1YNNC 3NENA 4A3KG 1MD2D 1Y1VG 4LF7Q 4DUYL 2OCEA 2F4VL 3GTPH 5C3EH 1EIHA 3CCJA 1D1IA 2EJMA 3J7ZC 3PIPA 5KEEA 1HH2P 1ICFB 2VUMH 1LT4D 3EJIA 4POFA 3RLNA 3X3NA 2QF7A 3HOUB 5I6YA 2B2YC 2JQOA 2XNAC 3HOYG 3S14B 3TREA 5JPMC 1ILQA 3S1QH 1KNAA 4HJ7A 3A5ZB 2A6HD 1FJGQ 4J15A 1HQRD 3I55A 2K75A 4X66L 3F2UA 5C3EB 2EYOA 1F2LA 1XMOQ 3DXJC 1PXUA 3EFXD 3KLRA 1EL0A 2XN9C 1EIGA 4XQNA 1BUVT 4O2DA 2KCCA 3M3YB 3HKZE 4WRDA 1CZGA 5G3LF 1I6HH 1MBYA 5IOCA 3X3MA 3FKIG 1SN8A 1DOKA 3GTKH 4B3MQ 3OSOA 1LTTD 2KOLA 5COYA 1SR3A 3PO3B 2KHJA 4BBRG 2R92G 2ZXOA 3I4NH 1KIXA 1DXMA 1QOHA 2NVYB 5DM63 1NE3A 3NTHA 3OYYA 1WCMH 4C1NI 2NZHA 4RH6A 1JJCB 1Q1BA 2WP8J 5M3FH 4FF1A 2MPMA 1NBWA 2CHBD 2A68C 5EBCA 4X62L 1E0BA 2UUCL 1STGA 4C2MB 4EQNA 1IKLA 4PV1C 3S16H 5EQ0A 4RG1A 2RQXA 5KNCA 2D0OA 1F2MA 4H13C 1PH7A 1EU3A 2R7DA 3ND9A 1S4ZA 2A1AA 4FDBA 1HQMC 2KHIA 4J1MA 1WTOA 5FLXL 1RTOA 2ICEC 2K32A 5I6WA 2RCFA 1VQFA 4RCOA 3J81L 3MHBA 5TSSA 1Z9FA 4BBSH 1HR0L 1YEZA 1PHJA 2JP1A 4IALA 4IUTA 4P75A 4HIMA 1YJNA 3J7AV 4DPGA 3HOYH 1VS0A 5CV5A 4QJFA 5JOBA 4EQPA 5GAEC 2FMMA 3GP7A 3W3AA 2NVTH 2SOBA 5KIXA 1ET9A 2EYHA 4NPSA 3LGJA 1WCMG 2O5IC 3GQBA 3RR5A 1G6PA 4C1NK 5GAHC 1GM5A 5ELCA 4JPBW 5I2XA 2AUJD 1QCBD 4DV3Q 3QIAA 3CKIB 4NKLA 4PMBA 3J81j 5IGBA 1SYCA 4IN3A 1VQEA 4RCNA 3G7LA 4JC0A 1TS5A 1Y8PB 3OMCA 4K14A 2UXCL 3H3VC 3HGBA 1N34L 3ONAB 5IYBH 4MHEA 4IO9A 5CV4A 4F7XA 1CSQA 4X3TA 1Q90A 5E4WC 3FEWX 2MHVA 4A3IB 1RJTA 3I7FA 3CCEA 4IQZA 4CBVA 3K7AB 5GROA 5C0XH 2D9UA 1PFMA 2DN8A 1AP0A 4JI6Q 1EZ6A 3K5LA 1B2TA 2EY6A 3RMHA 4DK1A 3IL8A 4WJ4A 1S3OA 5DEHA 3HFZB 3TN2A 2IY5B 4HJ9A 3FP9A 1GKHA 5IP9G 5M3MH 3KDFA 4B9XA 3CCSA 4OWWB 1YHAA 3EIVA 2YTYA 5C44B 2E5LL 3BJUA 4G7OC 2QKIC 4LF5Q 2C9OA 4CDCC 2PMZB 3UE0A 1LT5D 3Q22A 4L8JA 1D5XC 4DAVA 2Y0SE 3MAQA 2VQEQ 1EOTA 5CR3A 1TWFB 4RGNA 3K5NA 3BDCA 3S1MH 2PPBC 3IKJA 1I50H 1NTGA 3DEPA 2E2IB 1TWCB 5K36H 1TY2A 2EQSA 4JV5Q 3VR6A 3HEJA 3PSIA 3PO3G 3AFPA 1FNWA 3NSWA 4CJ2C 1PFSA 3NELA 3D0FA 3CC2A 3I4MG 1L1OC 2WB1B 5C44H 5C44G 2NVTB 3J80E 4HSVA 2CVRA 4C3JG 3N52A 1HZAA 2H1EA 1NUCA 4DR2Q 1XTCD 3HOYB 2JSOA 5M3MB 5GQOA 1EYGA 4A3LH 4L5RC 4BA2I 5IYDH 3M9BA 4IUUA 4HCEA 1IBML 2SEBD 4DA2A 4CKCA 5D14A 4DAPA 2Z8LA 3RN2A 1KLUD 3HP3A 4FNFA 1RHPA 1T5EA 3PMFA 4G7HC 2E74C 3I4NG 2R92H 1N33Q 4PNYA 1UE5A 5ISRA 4A3IH 1VQCA 5EPKA 1NR2A 1DJRD 1BCPC 3CCVA 2KJXA 2O4XA 2DJGC 2GVBA 2I07B 2XRQD 3UI2A 5I2YA 4DV6L 2VQFQ 3BVZA 4DN4M 3L2PA 4ODGA 3HKZB 3K5OA 2HHHQ 1Q8IA 3I4OA 3R8BA 4DV5Q 2F0EA 1XPOA 2VQEL 4DV0L 4C3IH 1WTPA 5GAGC 2E75C 1NNXA 4K6DA 3MVVA 3J81c 4LF5L 3I73A 2R93B 1JC7A 1CQVA 2B3GA 1B53A 1N33L 4QL5A 1YIJA 1WTVA 4DK0A 3U4ZA 3EBEA 3CRLC 1U5KA 3JAMc 4IPCA 2A69D 5EKIA 1EQQA 3I4NB 5K5PA 4R4CA 1SE4A 3PO3H 4DUYQ 3S9WA 2K01A 3A54A 1LM0A 3GTKB 1YNJC 1DD2A 4IJHA 2JA7G 3EVQA 3PUXA 3VYUA 1S5FD 2KCNA 5ELDA 1XX8A 5CC4A 1X32A 2N55A 2K1BA 4ZAIA 1VF5C 3IAYA 2K05A 2WFWA 2UUAQ 2CKZB 2J0TD 4R4OA 3VR5A 4LF8L 2KHSA 2L9HA 4YY3Q 2Z6BA 2G5DA 3T51B 1E1OA 4LFCQ 4OO1H 2JA5B 3BG3A 3J7YW 3JC66 2HIXA 4JI8L 3VA7A 5F2DA 1D5ZC 2Q2IA 4O42A 1ICWA 1HUMA 1CQFA 1F77A 1YVCA 4C2MH 5D3DA 5LMNL 3HOUH 2RDHA 3MTSA 1GUGA 4A75A 1AFPA 5EJWA 1LABA 3PCOB 4DF7A 5JEAH 3H91A 4B3RQ 5M3FB 3A8KE 1LT3D 4CGYB 4B3ML 5EBDA 3I2ZA 3F2CA 5JJLA 2LXKA 3GTJB 3GTPB 1PRTB 3TMEA 1QNKA 1VQLA 2NVYH 1F9QA 1STNA 4HN7A 2C35B 1ZXTA 1KXLA 4QIWE 2NN6G 3NEMA 1YITA 2EE1A 2K7VA 5JJZA 4GN4B 3M4OH 3I91A 4A3GH 5IWAL 3PO2G 4IFDI 2JEBI 4Q5VA 4A3GB 1NMFA 1QILA 1V8QA 3CCMA 4HIDA 1M8AA 2EJFC 2K4KA 4X66Q 2K5NA 4LAAA 2XGTA 2VW9A 4DV1L 4P71A 1FJGL 1KDBA 2JE6I 4PZ8A 2RHQB 4J6HA 1N36Q 5AJ3Q 3NTKA 3ZYYX 4KY6A 4JI7Q 4KLKA 2UXCQ 4A76A 1IW7D 3CRKC 4N9TA 1KD1C 2V1CC 3S1QB 5C4XB 4MTNA 3URYA 2ICIA 3H09A 3MXGA 3WOFA 4K2LA 1ZYRC 1SNOA 2A73B 3K80C 1O80A 3MXNA 1E2VA 2Y0SB 2JA5H 3G4SA 1L1OB 4J8QA 2CW0D 4HIOA 3VA5A 1G51A 4KD3A 1W3SA 4AIMA 3V2TA 2WKDA 1HNZQ 1V1OA 3RD4A 4X64Q 2EVBA 2VNUD 4KN7C 4PMCA 4DR1L 1VCIA 2DY7A 1PYBA 4CHTB 4IUPA 3AEVA 3VYSA 4LW1A 1K73C 4ZQ3A 1EQRA 1HZBA 2BE5C 5ELFA 3KYHC 3OW2A 2E2HH 1HCZA 3SE0A 4DR5Q 2HQLA 1GHJA 4A3GG 3SHLA 2FMCA 1PTOD 1ZEQX 3QG1A 5IWAQ 4GKJL 1H9SB 3BZCA 3T56B 2WAQG 1WD1A 2LS01 1Y1WH 1SNPA 4TSSA 4IOAA 1XNQL 2R93H 4A3EG 3SDZA 1X56A 4C3JB 4X3UA 1AZQA 3H6MA 2JXMB 3J80i 2UU9Q 1T9HA 1E2ZA 3HOWG 4OWTB 2NVQB 3GO5A 2HQEA 2NZOA 1NR4A 4DGZA 5EPJA 1H95A 5FK9C 4X62Q 1MSGA 2X69A 4NXMQ 1CKNA 1ILPA 3AQQA 4FVMA 1B50A 3K6OA 2ZJPA 1BBXC 3ERSX 3MXNB 2ALYB 2TSSA 3NQTA 2JA6B 1Q86C 1TWHB 1QWYA 4IJLA 1HRJA 4DXFA 2R92B 4K2KA 4LJZC 1C9OA 1HZ9A 2Q2UA 5C3EG 2ZXRA 1X3EA 3ITPA 5IYCG 4JCVE 3H3VI 4DV2Q 4KN4C 4A3IG 1J9OA 1CTMA 3HS0C 4QQBX 2VL6A 4BY1H 2D62A 4IPDA 3S24A 5A35A 5C5MA 2A19A 4LF9L 1KRSA 4GNXC 5J1ZA 4LK1C 3I3CA 2B8FA 3K58A 2A5HA 1GUTA 4TVAB 3DEOA 3AB9A 2EXZA 3U9SA 4HJAA 1VQNA 3FRPB 2BDNA 2O5JC 2EYJA 1L0YB 1TWAH 3PF5A 4OIJA 2DUDA 4CDFC 3JAME 4DR2L 3I4MH 2M2LA 4PZ7A 5FJ8H 4DV7L 3NBHB 4OELB 1SNCA 2E2IH 1I50B 1LV9A 1UEAB 1V9PA 5IT9L 2RBMA 1PZKD 5IYDG 3WOEA 4A93H 1GD7A 1JE5A 1BVSA 3OIPA 2VB2X 4A3LG 4BXXH 2FXQA 2X6LA 1HA6A 1PLFA 1YBYA 4S3SA 1ENCA 3DLLA 1D5MC 4A3JG 1BKBA 5IT9E 3NE5B 4JI1L 4LFAL 2LMCB 2JA5G 5IP7G 2JEAI 3W5OA 2L5TA 4HIKA 1U0LA 3TS0A 1X3QA 2KUMA 3BZDB 2YTVA 2K5QA 3TZDA 2F0DA 4GZYC 2NWGA 3A7LA 3G6EA 4OIKA 4JI4Q 1SFOH 2ZXPA 3A7AB 4JI3Q 1FNUA 2IX0A 1PRTD 1D7QA 4LF8Q 3E9HA 4XQJA 2K04A 3ND8A 2MJ8A 3B6YA 3P1HA 4FXKC 2EDGA 1PH9A 4EQ5A 2B63H 3KOJA 2JA9A 1S72A 4BY7G 2YTXA 4HJ5A 1VQOA 4B3TQ 3ICEA 1V1PB 4L5QA 4UDUC 3A8JE 4NXNL 1VQKA 1SYEA 3NBHA 1SROA 4YCVA 1AEXA 2QDBA 4JI2L 4BY1G 4RAUC 5IGFA 4X3KA 1TVXA 2E2JB 3A5UA 4P2CB 1PH1A 4DKAC 2O2LD 1K8AC 2JA8G 2PNRC 4UHVA 1QVGA 1R9TB 2OEOA 2PZWA 4YWLA 1L1OA 2KECA 1UWVA 3OOCA 4JI5L 1STAA 5M5YH 3L3OC 2KBNA 3FPUB 4WORA 4DK3C 3NTIA 2BA1A 3G48A 3GV6A 5AJ3L 5LMUL 4FP5D 2MGSA 3C1FA 5DM73 4JBWA 2PO4A 1EY7A 2PQAA 4BA1I 3K7UC 3H0GG 1IYJB 4LUZA 2Y0SG 5JPNC 4YY3L 5I9OA 1HNXQ 3S17B 2N3SA 1FGBD 2R6GA 1CHQD 1DM0B 1KTKA 5IGCA 2RCNA 1VQMA 1S5CD 1VQDA 4IFDG 1KAAA 1BCPF 3CCLA 2AQ3B 3HOZB 2L55A 3KBGA 2EOTA 1N32L 5IGGA 1VQ5A 2D2CC 1GUSA 2ZT9C 2YV5A 4V0BA 3J81E 1PRTF 1SYGA 3KJOA 1CA6A 1V1PA 2IHFA 1SJHD 1ET6A 3ZJYC 3U50C 1IBKQ 4ZUIA 2B2VA 4KJOA 3GTGH 5IE8A 2ZTCA 5JEAJ 4GNXB 5HGTA 3Q6SA 3S16B 3I8ZA 1T5XD 1I94L 2EYMA 3P7JA 5C5LA 1DONA 1EY8A 1I3QB 1GOZA 1G2SA 1Y14B 2L15A 4YWMA 3KLWA 2FFKB 2R7ZG 2F0GA 2R7ZH 4EGVA 5JVH3 1H9RA 2IW3A 1E3PA 3SR1A 1N9WA 4R4TA 1P16A 3HZXA 5D65A 4DR7Q 4DNRB 4N9PA 1SAPA 1YNXA 3PV0A 1CI3M 4XT1B 3TZUA 4F88A 1IBKL 3WWVA 1I6HB 3NP8A 3M3YH 1TWGH 1K83B 5M5XH 2Q2TA 1EU4A 5FJ8G 5JJKA 1TXYA 4OL7A 2E5LQ 2K52A 2XWBB 2L0CA 5FLMH 2R61A 3PO2H 4AQYL 2K33A 2JN4A 3CP0A 1BNZA 3AMUA 2A6EC 1YJ9A 3HOZG 3R2TA 5CBEE 2K14A 1HNXL 2NVXH 3HRZC 1CM9A 1PH8A 2GVAA 2XVSA 1MSHA 1JCKB 1WI5A 1ML0D 2B2UC 2AUKA 3HOVB 1V1QA 3S14H 4L63B 4RHSA 4F87A 4GNXA 4A3CH 4A3CG 3MFGA 4A3DB 1EQTA 1XXGA 3H0GH 2Z4IA 4B9WA 1VQ7A 1EFID 3D31A 3KF8A 1JICA 2J4XA 1ASZA 1UE7A 4GOPB 3GV3A 1HNWL 2VUMB 2M00A 5G3LD 2EYPA 5JVG3 2E8GA 5DNFA 1C4QA 1EY0A 4ULLA 1C7YA 4QCLA 3ER0A 3NXWA 5J39A 5FO8B 2PYKA 1EWIA 3D4DA 2WB1E 1CKMA 1SYFA 1X65A 1MHWC 3JAMi 3GTOH 3S2DB 1OXSC 2AHOB 1KLGD 5KRUA 1SNDA 5LL6S 4KY7A 2QA4A 1JORA 3TS2A 3S2HH 3QJYA 1QUQB 4CKEA 1C8CA 3FKIB 2B39A 2CCZA 2F0TA 2BE5D 2JA8B 3UDFA 4APVA 1I4XA 1PH2A 2QEJC 1S5ED 2JYOA 2UUAL 1HHVA 1TU2B 1N32Q 2RSNA 2MO0A 1PFBA 3T1HL 1X3GA 2MNAA 4BBRB 5EKLA 1NSNS 4ZK9B 1X54A 4R8IA 1I4GA 4LNQA 1RIPA 1X55A 2F03A 4JV5L 1B3QA 1KRTA 3EA6A 3HKSA 4G7ZC 2R3ZA 2VXWA 1WTRA 3RZOH 2K6AA 4BBSG 2L1BA 2HHHL 2NBFA 2KA7A 2HUGA 1K0SA 3FPPA 5E4XA 3KF8B 4A4IA 4BY7B 2HD3A 1K8MA 5LMNQ 2EYLA 1EYCA 3MXPA 2NN6I 2VUMG 1BOSA 3FMCA 1EQVA 4Y7NH 3UDXA 5CGKA 1C48A 2FINB 3MWYW 4L6TB 1VQPA 1G8ZD 3RN5A 3JAML 1LTAD 2WKCA 1JOKA 1PTOF 4AYBB 4DV1Q 3G6JB 1QUQA 2F52A 3P75A 3RLFA 3BS1A 1QE6A 2K5HA 4NXNQ 3T53B 4B3SL 3SK6A 2SNSA 2K5WA 1Q12A 2UXBL 1B7YB 2B2UA 2DY8A 4AH6A 4A3MH 4JW0A 2KCMA 1NY4A 4ILWA 2V4DA 3TDQA 3LWEA 3TP7A 4XXEA 1NAPA 4DUZQ 2BA0A 1G6ZA 3A8IE 3KDFB 1U9RA 2XWJB 3GTMH 1IBMQ 1LACA 2OF1A 1L0WA 2KCTA 1TR5A 4HCSA 1WTQA 1MIUA 2B8GA 4OGQC 1Q1EA 3CPWA 1SE3A 4U673 2NN6H 1XPRA 4X6AH 2PZTA 1KL9A 3QWNA 4LUOA 1HNZL 1HPCA 1PTOH 3CU7A 2VY3A 4ID6A 1QB5D 3S15H 2YU9B 3R3OA 3CCQA 5JEAG 2F0OA 2YU9H 4LF7L 4DR6Q 1XWEA 3S15B 2A69C 2K5DA 1G291 5E3FA 1MGSA 4A3BB 1CZWA 3A55A 1EY4A 2CFMA 4RA8A 3SK4A 3HOXG 1SEBD 4HEDA 1SSOA 1TS4A 1HZCA 3QR8A 2ATWA 3W2DA 2CWPA 4JYAL 4MTKA 5LL6X 3ULPA 1K8GA 3LNNA 4XQQA 2KENA 1IXRA 4GKJQ 1EY5A 2J7ZA 3PF4A 3GTMB 5CV7A 5IGDA 3RZDH 4XDXA 4X65L 4KD4A 3AU7A 3QB3A 4DV2L 2JA6G 1VQAA 5EAYA 4DR5L 1RTNA 4GKKQ
chains in the Genus database with same CATH topology
1Q7YC 4A3KH 3FKIG 5IP9H 1Q86C 1SN8A 1VQ8A 3GTKH 4A3DH 4B3MQ 3S1NH 3KJPA 1ASYA 4IJLA 1O7IA 3T1HQ 3HOVH 1SR3A 2KHJA 4JI3L 4BBRG 4OX9L 5C4XH 3HOXH 1C9OA 2R92G 3I4NH 1HZ9A 1VQ9A 5C3EG 1XTDA 1KIXA 2Q2UA 1X3EA 5IYCG 4WJ3M 4JCVE 3H3VI 2MQHA 3TEHB 4DV2Q 4KI0A 1NE3A 1K0RA 4A3IG 3OYYA 1WCMH 1K9MC 4NXML 3DM3A 4P73A 3CXCA 5C0XI 2NZHA 2EXDA 4X64L 4QQBX 1JJCB 2VL6A 1Q1BA 2WP8J 4BY1H 2D62A 5M3FH 4IPDA 3S24A 1NBWA 4X62L 4B3TL 4A3BG 4DAYB 4JOIA 2A19A 4LF9L 1KRSA 4LFBL 1WOCA 3GD7A 5H1SE 4GNXC 1B70B 2UUCL 3TQYA 3S16H 2JA8H 4RG1A 2D0OA 4TVAB 2I5HA 4P74A 4HJAA 1VQNA 2OQKA 1Y1WG 1DGSA 1K83H 1PH7A 4OXPA 1D8LA 5M3MG 2PI2E 2R7DA 5IYBG 3CC4A 4OX9Q 4BY7H 1TWAH 1AE2A 3STBC 2A1AA 4FDBA 3PF5A 3HOVG 1HR0W 3HOWH 2KHIA 3W1BA 2DUDA 4DR2L 4JI0L 2UUBQ 1BBWA 3I4MH 4PZ7A 1FVIA 5FJ8H 4DV7L 3NBHB 5BR8Q 1XJVA 5E7NA 1E22A 2E2IH 1V9PA 3KF6A 2I0QA 4DAMA 3K0XA 5IYDG 1VQFA 5ELOA 1QVFA 4HJ8A 1GD7A 1JE5A 1BVSA 3GTJH 3CMEA 2N8NA 2RF4A 4A93H 4A3LG 1Z9FA 4BBSH 3HOUG 4BXXH 1HR0L 2FXQA 1CKNB 4DNIA 1YEZA 1PHJA 1YBYA 4L5TA 2EIFA 4YCWA 3DLLA 4P75A 4A3JG 1BKBA 3UE1A 1JB7A 1VQGA 4HIMA 1B8AA 2OQ0A 5C4XG 4LUVA 4JI0Q 4JI1L 1YJNA 3U4VA 4LFAL 4DPGA 3CQZH 4IPHA 2JA5G 3HOYH 1OXXK 1VS0A 4QJFA 5GAEC 5IP7G 1UE6A 1C0AA 2JEAI 2NVTH 3W5OA 1AE3A 4HIKA 4A3FH 3FKIH 1U0LA 3TS0A 4DR7L 1HR0Q 4NPSA 2YTVA 1WCMG 3LGJA 3UDIA 4MZ9A 3RR5A 1G6PA 3F2DA 3S2DH 4AQYQ 5GAHC 3G6EA 1GM5A 4JI4Q 2ZM6L 1A62A 1SFOH 4DV3Q 4JI3Q 1E7ZA 2IX0A 3L0OA 1D7QA 3J81j 3PGZA 3E9HA 4DV4L 4LF8Q 4DR4Q 3B6YA 1VQEA 4PZ6A 4UP7A 1FL0A 4JC0A 1I94Q 1XMQQ 1PH9A 4EQ5A 2B63H 4KHPQ 3KOJA 2UXCL 2JA9A 1Q81C 2WAQE 1N34L 2ZM6Q 1S72A 5IYBH 4BY7G 1MJEA 4IO9A 2YTXA 4HJ5A 1VQOA 1CSQA 4B3TQ 3PUVA 3ICEA 4L5QA 1WYDA 4LFBQ 2PI2A 3I7FA 4NXNL 1VQKA 3CCEA 1SROA 5GROA 4YCVA 4JI2L 3Q8DA 1KHIA 2MFIA 4BY1G 2OTLA 3KF6B 4JI6Q 3A5UA 1I5FA 5M3FG 1PH1A 5J3BA 2Q2HA 5IY0A 3T1YQ 4DKAC 1PH6A 3I56A 4WJ4A 1PYSB 1QVCA 5K36G 1S3OA 5DLQE 1K8AC 2JA8G 1QVGA 5IP7H 3H15A 4YWLA 1Q82C 1L1OA 4MNOA 5LMNW 1I6HH 2ZTDA 1UWVA 3HFZB 1N34Q 2IY5B 4HJ9A 3FP9A 4JI5L 2RHSB 1GKHA 5IP9G 5M5YH 2ZJQA 2KBNA 5M3MH 3KDFA 4DR3Q 2Z6KC 3CCSA 4OWWB 3GTLH 4DK3C 4GN5A 1YHAA 2BA1A 3G48A 4LFAQ 3EIVA 2YTYA 5AJ3L 5LMUL 3BZKA 3T1YL 2E5LL 1MKHA 3BJUA 1EIYB 4K0KL 4JBWA 4LF5Q 2PQAA 4BA1I 3K7UC 3H0GG 3UE0A 1IBLQ 5HY6A 4A3FG 1IYJB 4LUZA 2Y0SG 3KFUA 4YY3L 4JI5Q 1HNXQ 2Y0SE 2VQEQ 1Z47A 2N3SA 4DR3L 1CSPA 2R6GA 4OONA 2ZTEA 3S1MH 3W1GA 4LF6Q 4POGA 3HOZH 3F8TA 2RCNA 1VQMA 1VQDA 1NMGA 4IFDG 2ASBA 4L5SA 3CCLA 4B3RL 4OO1I 1I50H 1NTGA 3CF5A 5LMUQ 4AYBE 1N32L 1PVOA 3M7NA 1VQ5A 2EQSA 2VZAA 4LF9Q 5ELNA 4JV5Q 3PUZA 4JYAQ 3S17H 4IFDJ 1I3QH 1CUKA 3PSIA 2YV5A 3PO3G 1OXUA 1Y1VH 4QGUA 3AFPA 4ME3A 1UEBA 4PG3A 2IHFA 3ZJYC 3KJOA 4GS3A 3SGIA 1PFSA 3NELA 3D0FA 3U50C 1EIFA 1YJWA 1IBKQ 3CC2A 3L7ZC 3I4MG 1JMCA 1L1OC 3GTGH 5IE8A 5C44H 5BR8L 5C44G 1VQ4A 2ZTCA 3AFQA 5GADC 1XNRQ 5JEAJ 2WB1G 4GNXB 1HZAA 4DR2Q 3F1ZA 1YHBA 5GQOA 2HT1A 1I94L 1EYGA 1HNWQ 4A3LH 1QZHA 1Q8KA 4L5RC 4BA2I 3STBD 2ES2A 5IYDH 1OTCA 4GOPA 3M9BA 3EN2A 1IBML 1VQHA 1EOVA 1Y14B 4O0AA 1V43A 1TWCH 2L15A 4YWMA 3RLOA 1J5EL 3KLWA 4JI8Q 4UPAA 2VQFL 3RN2A 2R7ZH 2R7ZG 2AKWB 3MEFA 5M5WH 2JK8A 1E3PA 1N8RC 4Y52H 1N9WA 4YHHQ 2BH2A 3I4NG 4R4TA 4JG2A 2UUCQ 1TWFH 4A3EH 1P16A 1N33Q 2R92H 1UE5A 4DR7Q 4A3IH 1VQCA 4DV5L 1A63A 2I5MX 2N49A 1YNXA 3PV0A 1IBKL 3CCVA 2JA7H 4R1JA 3WWVA 4JBMA 2GVBA 1L2FA 3M3YH 1TWGH 4OO1G 5M5XH 2Q2TA 5FJ8G 5JJKA 1LYLA 1TXYA 2E5LQ 1KC8C 1XMOL 2K52A 4DV6L 1NJIC 5FLMH 2VQFQ 4YHHL 4ALPA 3L2PA 3CD6A 3PO2H 4AQYL 2I5LX 2UXBQ 4A3JH 2HHHQ 3CP0A 3I4OA 4DV5Q 1XPOA 2VQEL 4DV0L 1YZ6A 2BH8A 4C3IH 1YJ9A 4C3HH 1SMXA 3CPFA 5GAGC 1R9TH 5IT9c 3HOZG 1PH4A 1JT8A 3J81c 3OTOL 4LF5L 2K14A 1HNXL 2B3GA 3GDEA 2NVXH 3J7A5 1N33L 1Q46A 4QL5A 3J81i 2K5VA 1YIJA 2E2JH 3U4ZA 2F4VQ 1PH8A 3EBEA 2GVAA 1U5KA 4IPGA 3JAMc 4DV6Q 3A0JA 2UXDQ 1E24A 1WI5A 4IPCA 1EQQA 4R4CA 3M4PA 3PUYA 4JOIC 4LFCL 2JJQA 4GKKL 2PMZE 4RMFA 1SLJA 4DUYQ 3PO3H 1V1QA 3K7AH 3S14H 4GNXA 2OTJA 4A3CH 4A3CG 1LM0A 1TWHH 2D0PA 4GLXA 4IJHA 3H0GH 3S1RH 1VQ7A 4LF4L 2JA7G 1VQIA 3D31A 3PUXA 4GLAC 3J80c 1J6QA 4UY8C 4A3MG 1ASZA 1UE7A 1JJ2A 4GOPB 1EFWA 1HNWL 4R4IA 3K81C 4DR6L 4A3DG 1A8VA 1VQ6A 2E8GA 3H3VH 4JI4L 1VQBA 1S40A 1FGUA 1C7YA 5FLXc 3ER0A 2K50A 4B3SQ 2N78A 2WFWA 1EWIA 4AYBG 2UUAQ 2WB1E 2CKZB 2PNHA 4H02A 4R4OA 1WFQA 1CKMA 4DV4Q 4LF8L 1PH5A 1X65A 3CAMA 4YY3Q 3JAMi 4OWXB 3GTOH 2LSSA 3CW2C 1IL2A 3GTQH 1MJCA 2IT1A 1IBLL 1OXSC 2AHOB 4YCUA 1E1OA 3ULJA 2H5XA 4LFCQ 1J5EQ 2QA4A 3CMAA 2ZJRA 2UU9L 3TS2A 3S2HH 3JC66 1QUQB 2UUBL 2CQOA 2HIXA 2CCZA 4GN3B 4JI8L 3M4QA 2Q2IA 1XMQL 1OXTA 1M1KC 3UDFA 4APVA 1YVCA 1PH2A 4C2MH 4DUZL 1KQSA 2DGYA 5LMNL 1YHQA 3HOUH 1GO3E 4BXXG 2UUAL 3CCRA 1XPUA 1BBUA 4A75A 1N32Q 4X65Q 3VDYA 1AH9A 1SE8A 2AMCB 2MO0A 3PCOB 2AWNA 4GLVB 3T1HL 2OWOA 4B3RQ 1X3GA 2MNAA 4B3ML 4JI6L 4GOPC 3I2ZA 1X54A 3PUWA 3F2CA 2LXKA 5JJLA 4JBKA 4LNQA 4JI2Q 3OTOQ 1VQLA 2NVYH 1PA6A 1RIPA 1X55A 3AYHB 1HJPA 2C35B 4JV5L 5IYCH 1KRTA 3HKSA 3CCUA 1KXLA 4JI1Q 4QIWE 5C4JH 3RZOH 1WJJA 4DK6C 4EX5A 2NN6G 2HHHL 4BBSG 3NEMA 1X6OA 1P8LA 3UDGA 1YITA 1UE1A 2B29A 4GN4B 3M4OH 4A3GH 3KF8B 2AWOA 4JI7L 4A4IA 5IWAL 3HKZG 3PO2G 4IFDI 2JEBI 1RL2A 5LMNQ 4LF4Q 1NMFA 2UXDL 4LWCA 3CCMA 4HIDA 4P72A 4X66Q 2K4KA 1PH3A 2NN6I 3E9IA 2VUMG 2K5NA 2XGTA 2VW9A 4YWKA 1XNQQ 4NB3A 4Y7NH 3UDXA 4DV1L 4IOCA 4P71A 1FJGL 2JE6I 2YYZA 2Z0SA 4PZ8A 4DV7Q 2RHQB 1EUJA 3G71A 3ULLA 4DV3L 4DR4L 2MO1A 1N36Q 4TQUS 3FHWA 5AJ3Q 1VQPA 2IX1A 1PV4A 1GVPA 1YI2A 3RN5A 4BBRH 1SRUA 4C3JH 4JI7Q 4KLKA 5HGQA 4KHPL 2UXCQ 2Z6KA 1A0IA 3IRBA 4A76A 1JJGA 4DV1Q 1KD1C 2QEXA 4A3BH 1QUQA 2F52A 3RLFA 2V1CC 5C0XG 1E1TA 2K5HA 1M90C 4NXNQ 4MTNA 4QY7A 4B3SL 2VS1A 2IHEA 1Q12A 2ID0A 1B7YB 2UXBL 4AH6A 4A3MH 2CWAA 3K80C 1N36L 1XNRL 2KCMA 1NY4A 2A8VA 4PMWA 2F3IA 2JA5H 3G4SA 1L1OB 1K3RA 4HIOA 2JA6H 3M85A 4XIGS 2LXJA 4DUZQ 1IZ6A 1G51A 1W3SA 2BA0A 4AIMA 1HNZQ 3KDFB 4KHZA 2R7FA 1QZGA 4X64Q 3BU2A 3GTMH 2QGQA 2VNUD 1X3FA 3NENA 4A3KG 1IBMQ 1L0WA 1Y1VG 2KCTA 4JBJA 4DR1L 1X9NA 4LF7Q 2R93G 1VCIA 2NVQH 1MIUA 4DUYL 2OCEA 1Q1EA 3CPWA 3RNUA 2F4VL 3GTPH 5C3EH 3CCJA 4X6AH 1XPRA 1PYBA 2PQAB 3J7ZC 1KL9A 3AEVA 4LUOA 1K73C 1LUZA 4LW1A 3PIPA 5JJIA 1HH2P 1EQRA 2VUMH 3A74A 1HZBA 1HNZL 4R4QA 1OXVA 4POFA 3RLNA 3KYHC 4UP9A 4XTCS 2VY3A 3F2BA 3OW2A 1W2BA 2E2HH 3TRZA 3K8AA 3PIOA 4DR5Q 2HQLA 3S15H 2JQOA 4A3GG 1LTLA 3U58A 3CCQA 3HOYG 5JEAG 4K0KQ 2YU9H 4LF7L 4DR6Q 3TREA 5IWAQ 4GKJL 3BZCA 3S1QH 1G291 4HJ7A 2WAQG 2GN5A 4UP8A 3A5ZB 1Y1WH 4DR1Q 1FJGQ 2CFMA 3HOXG 1CKOA 4J15A 1XNQL 4IOAA 2R93H 4A3EG 4LF6L 1X56A 5C0XJ 3I55A 2K75A 4DV0Q 2HIVA 4X66L 4A93G 1KAWA 1HZCA 3J80i 2ATWA 2CWPA 2UU9Q 4JYAL 1T9HA 3E0EA 3HOWG 4OWTB 3GO5A 3ULPA 1K8GA 2KENA 1IXRA 2NZOA 1XMOQ 4GKJQ 1H95A 3PF4A 4X62Q 3CC7A 3RZDH 4X65L 4NXMQ 1CKNA 5FLMG 4O2DA 3AQQA 4DV2L 2B63G 1VQAA 5EAYA 2JA6G 4DR5L 2ZJPA 3HKZE 3ERSX 3MXNB 2ALYB 1VQJA 4GKKQ 2XTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y C;  4A3K H;  3FKI G;  5IP9 H;  1Q86 C;  1SN8 A;  1VQ8 A;  3GTK H;  4A3D H;  4B3M Q;  3S1N H;  3KJP A;  1ASY A;  4IJL A;  1O7I A;  3T1H Q;  3HOV H;  1SR3 A;  2KHJ A;  4JI3 L;  4BBR G;  4OX9 L;  5C4X H;  3HOX H;  1C9O A;  2R92 G;  3I4N H;  1HZ9 A;  1VQ9 A;  5C3E G;  1XTD A;  1KIX A;  2Q2U A;  1X3E A;  5IYC G;  4WJ3 M;  4JCV E;  3H3V I;  2MQH A;  3TEH B;  4DV2 Q;  4KI0 A;  1NE3 A;  1K0R A;  4A3I G;  3OYY A;  1WCM H;  1K9M C;  4NXM L;  3DM3 A;  4P73 A;  3CXC A;  5C0X I;  2NZH A;  2EXD A;  4X64 L;  4QQB X;  1JJC B;  2VL6 A;  1Q1B A;  2WP8 J;  4BY1 H;  2D62 A;  5M3F H;  4IPD A;  3S24 A;  1NBW A;  4X62 L;  4B3T L;  4A3B G;  4DAY B;  4JOI A;  2A19 A;  4LF9 L;  1KRS A;  4LFB L;  1WOC A;  3GD7 A;  5H1S E;  4GNX C;  1B70 B;  2UUC L;  3TQY A;  3S16 H;  2JA8 H;  4RG1 A;  2D0O A;  4TVA B;  2I5H A;  4P74 A;  4HJA A;  1VQN A;  2OQK A;  1Y1W G;  1DGS A;  1K83 H;  1PH7 A;  4OXP A;  1D8L A;  5M3M G;  2PI2 E;  2R7D A;  5IYB G;  3CC4 A;  4OX9 Q;  4BY7 H;  1TWA H;  1AE2 A;  3STB C;  2A1A A;  4FDB A;  3PF5 A;  3HOV G;  1HR0 W;  3HOW H;  2KHI A;  3W1B A;  2DUD A;  4DR2 L;  4JI0 L;  2UUB Q;  1BBW A;  3I4M H;  4PZ7 A;  1FVI A;  5FJ8 H;  4DV7 L;  3NBH B;  5BR8 Q;  1XJV A;  5E7N A;  1E22 A;  2E2I H;  1V9P A;  3KF6 A;  2I0Q A;  4DAM A;  3K0X A;  5IYD G;  1VQF A;  5ELO A;  1QVF A;  4HJ8 A;  1GD7 A;  1JE5 A;  1BVS A;  3GTJ H;  3CME A;  2N8N A;  2RF4 A;  4A93 H;  4A3L G;  1Z9F A;  4BBS H;  3HOU G;  4BXX H;  1HR0 L;  2FXQ A;  1CKN B;  4DNI A;  1YEZ A;  1PHJ A;  1YBY A;  4L5T A;  2EIF A;  4YCW A;  3DLL A;  4P75 A;  4A3J G;  1BKB A;  3UE1 A;  1JB7 A;  1VQG A;  4HIM A;  1B8A A;  2OQ0 A;  5C4X G;  4LUV A;  4JI0 Q;  4JI1 L;  1YJN A;  3U4V A;  4LFA L;  4DPG A;  3CQZ H;  4IPH A;  2JA5 G;  3HOY H;  1OXX K;  1VS0 A;  4QJF A;  5GAE C;  5IP7 G;  1UE6 A;  1C0A A;  2JEA I;  2NVT H;  3W5O A;  1AE3 A;  4HIK A;  4A3F H;  3FKI H;  1U0L A;  3TS0 A;  4DR7 L;  1HR0 Q;  4NPS A;  2YTV A;  1WCM G;  3LGJ A;  3UDI A;  4MZ9 A;  3RR5 A;  1G6P A;  3F2D A;  3S2D H;  4AQY Q;  5GAH C;  3G6E A;  1GM5 A;  4JI4 Q;  2ZM6 L;  1A62 A;  1SFO H;  4DV3 Q;  4JI3 Q;  1E7Z A;  2IX0 A;  3L0O A;  1D7Q A;  3J81 j;  3PGZ A;  3E9H A;  4DV4 L;  4LF8 Q;  4DR4 Q;  3B6Y A;  1VQE A;  4PZ6 A;  4UP7 A;  1FL0 A;  4JC0 A;  1I94 Q;  1XMQ Q;  1PH9 A;  4EQ5 A;  2B63 H;  4KHP Q;  3KOJ A;  2UXC L;  2JA9 A;  1Q81 C;  2WAQ E;  1N34 L;  2ZM6 Q;  1S72 A;  5IYB H;  4BY7 G;  1MJE A;  4IO9 A;  2YTX A;  4HJ5 A;  1VQO A;  1CSQ A;  4B3T Q;  3PUV A;  3ICE A;  4L5Q A;  1WYD A;  4LFB Q;  2PI2 A;  3I7F A;  4NXN L;  1VQK A;  3CCE A;  1SRO A;  5GRO A;  4YCV A;  4JI2 L;  3Q8D A;  1KHI A;  2MFI A;  4BY1 G;  2OTL A;  3KF6 B;  4JI6 Q;  3A5U A;  1I5F A;  5M3F G;  1PH1 A;  5J3B A;  2Q2H A;  5IY0 A;  3T1Y Q;  4DKA C;  1PH6 A;  3I56 A;  4WJ4 A;  1PYS B;  1QVC A;  5K36 G;  1S3O A;  5DLQ E;  1K8A C;  2JA8 G;  1QVG A;  5IP7 H;  3H15 A;  4YWL A;  1Q82 C;  1L1O A;  4MNO A;  5LMN W;  1I6H H;  2ZTD A;  1UWV A;  3HFZ B;  1N34 Q;  2IY5 B;  4HJ9 A;  3FP9 A;  4JI5 L;  2RHS B;  1GKH A;  5IP9 G;  5M5Y H;  2ZJQ A;  2KBN A;  5M3M H;  3KDF A;  4DR3 Q;  2Z6K C;  3CCS A;  4OWW B;  3GTL H;  4DK3 C;  4GN5 A;  1YHA A;  2BA1 A;  3G48 A;  4LFA Q;  3EIV A;  2YTY A;  5AJ3 L;  5LMU L;  3BZK A;  3T1Y L;  2E5L L;  1MKH A;  3BJU A;  1EIY B;  4K0K L;  4JBW A;  4LF5 Q;  2PQA A;  4BA1 I;  3K7U C;  3H0G G;  3UE0 A;  1IBL Q;  5HY6 A;  4A3F G;  1IYJ B;  4LUZ A;  2Y0S G;  3KFU A;  4YY3 L;  4JI5 Q;  1HNX Q;  2Y0S E;  2VQE Q;  1Z47 A;  2N3S A;  4DR3 L;  1CSP A;  2R6G A;  4OON A;  2ZTE A;  3S1M H;  3W1G A;  4LF6 Q;  4POG A;  3HOZ H;  3F8T A;  2RCN A;  1VQM A;  1VQD A;  1NMG A;  4IFD G;  2ASB A;  4L5S A;  3CCL A;  4B3R L;  4OO1 I;  1I50 H;  1NTG A;  3CF5 A;  5LMU Q;  4AYB E;  1N32 L;  1PVO A;  3M7N A;  1VQ5 A;  2EQS A;  2VZA A;  4LF9 Q;  5ELN A;  4JV5 Q;  3PUZ A;  4JYA Q;  3S17 H;  4IFD J;  1I3Q H;  1CUK A;  3PSI A;  2YV5 A;  3PO3 G;  1OXU A;  1Y1V H;  4QGU A;  3AFP A;  4ME3 A;  1UEB A;  4PG3 A;  2IHF A;  3ZJY C;  3KJO A;  4GS3 A;  3SGI A;  1PFS A;  3NEL A;  3D0F A;  3U50 C;  1EIF A;  1YJW A;  1IBK Q;  3CC2 A;  3L7Z C;  3I4M G;  1JMC A;  1L1O C;  3GTG H;  5IE8 A;  5C44 H;  5BR8 L;  5C44 G;  1VQ4 A;  2ZTC A;  3AFQ A;  5GAD C;  1XNR Q;  5JEA J;  2WB1 G;  4GNX B;  1HZA A;  4DR2 Q;  3F1Z A;  1YHB A;  5GQO A;  2HT1 A;  1I94 L;  1EYG A;  1HNW Q;  4A3L H;  1QZH A;  1Q8K A;  4L5R C;  4BA2 I;  3STB D;  2ES2 A;  5IYD H;  1OTC A;  4GOP A;  3M9B A;  3EN2 A;  1IBM L;  1VQH A;  1EOV A;  1Y14 B;  4O0A A;  1V43 A;  1TWC H;  2L15 A;  4YWM A;  3RLO A;  1J5E L;  3KLW A;  4JI8 Q;  4UPA A;  2VQF L;  3RN2 A;  2R7Z H;  2R7Z G;  2AKW B;  3MEF A;  5M5W H;  2JK8 A;  1E3P A;  1N8R C;  4Y52 H;  1N9W A;  4YHH Q;  2BH2 A;  3I4N G;  4R4T A;  4JG2 A;  2UUC Q;  1TWF H;  4A3E H;  1P16 A;  1N33 Q;  2R92 H;  1UE5 A;  4DR7 Q;  4A3I H;  1VQC A;  4DV5 L;  1A63 A;  2I5M X;  2N49 A;  1YNX A;  3PV0 A;  1IBK L;  3CCV A;  2JA7 H;  4R1J A;  3WWV A;  4JBM A;  2GVB A;  1L2F A;  3M3Y H;  1TWG H;  4OO1 G;  5M5X H;  2Q2T A;  5FJ8 G;  5JJK A;  1LYL A;  1TXY A;  2E5L Q;  1KC8 C;  1XMO L;  2K52 A;  4DV6 L;  1NJI C;  5FLM H;  2VQF Q;  4YHH L;  4ALP A;  3L2P A;  3CD6 A;  3PO2 H;  4AQY L;  2I5L X;  2UXB Q;  4A3J H;  2HHH Q;  3CP0 A;  3I4O A;  4DV5 Q;  1XPO A;  2VQE L;  4DV0 L;  1YZ6 A;  2BH8 A;  4C3I H;  1YJ9 A;  4C3H H;  1SMX A;  3CPF A;  5GAG C;  1R9T H;  5IT9 c;  3HOZ G;  1PH4 A;  1JT8 A;  3J81 c;  3OTO L;  4LF5 L;  2K14 A;  1HNX L;  2B3G A;  3GDE A;  2NVX H;  3J7A 5;  1N33 L;  1Q46 A;  4QL5 A;  3J81 i;  2K5V A;  1YIJ A;  2E2J H;  3U4Z A;  2F4V Q;  1PH8 A;  3EBE A;  2GVA A;  1U5K A;  4IPG A;  3JAM c;  4DV6 Q;  3A0J A;  2UXD Q;  1E24 A;  1WI5 A;  4IPC A;  1EQQ A;  4R4C A;  3M4P A;  3PUY A;  4JOI C;  4LFC L;  2JJQ A;  4GKK L;  2PMZ E;  4RMF A;  1SLJ A;  4DUY Q;  3PO3 H;  1V1Q A;  3K7A H;  3S14 H;  4GNX A;  2OTJ A;  4A3C H;  4A3C G;  1LM0 A;  1TWH H;  2D0P A;  4GLX A;  4IJH A;  3H0G H;  3S1R H;  1VQ7 A;  4LF4 L;  2JA7 G;  1VQI A;  3D31 A;  3PUX A;  4GLA C;  3J80 c;  1J6Q A;  4UY8 C;  4A3M G;  1ASZ A;  1UE7 A;  1JJ2 A;  4GOP B;  1EFW A;  1HNW L;  4R4I A;  3K81 C;  4DR6 L;  4A3D G;  1A8V A;  1VQ6 A;  2E8G A;  3H3V H;  4JI4 L;  1VQB A;  1S40 A;  1FGU A;  1C7Y A;  5FLX c;  3ER0 A;  2K50 A;  4B3S Q;  2N78 A;  2WFW A;  1EWI A;  4AYB G;  2UUA Q;  2WB1 E;  2CKZ B;  2PNH A;  4H02 A;  4R4O A;  1WFQ A;  1CKM A;  4DV4 Q;  4LF8 L;  1PH5 A;  1X65 A;  3CAM A;  4YY3 Q;  3JAM i;  4OWX B;  3GTO H;  2LSS A;  3CW2 C;  1IL2 A;  3GTQ H;  1MJC A;  2IT1 A;  1IBL L;  1OXS C;  2AHO B;  4YCU A;  1E1O A;  3ULJ A;  2H5X A;  4LFC Q;  1J5E Q;  2QA4 A;  3CMA A;  2ZJR A;  2UU9 L;  3TS2 A;  3S2H H;  3JC6 6;  1QUQ B;  2UUB L;  2CQO A;  2HIX A;  2CCZ A;  4GN3 B;  4JI8 L;  3M4Q A;  2Q2I A;  1XMQ L;  1OXT A;  1M1K C;  3UDF A;  4APV A;  1YVC A;  1PH2 A;  4C2M H;  4DUZ L;  1KQS A;  2DGY A;  5LMN L;  1YHQ A;  3HOU H;  1GO3 E;  4BXX G;  2UUA L;  3CCR A;  1XPU A;  1BBU A;  4A75 A;  1N32 Q;  4X65 Q;  3VDY A;  1AH9 A;  1SE8 A;  2AMC B;  2MO0 A;  3PCO B;  2AWN A;  4GLV B;  3T1H L;  2OWO A;  4B3R Q;  1X3G A;  2MNA A;  4B3M L;  4JI6 L;  4GOP C;  3I2Z A;  1X54 A;  3PUW A;  3F2C A;  2LXK A;  5JJL A;  4JBK A;  4LNQ A;  4JI2 Q;  3OTO Q;  1VQL A;  2NVY H;  1PA6 A;  1RIP A;  1X55 A;  3AYH B;  1HJP A;  2C35 B;  4JV5 L;  5IYC H;  1KRT A;  3HKS A;  3CCU A;  1KXL A;  4JI1 Q;  4QIW E;  5C4J H;  3RZO H;  1WJJ A;  4DK6 C;  4EX5 A;  2NN6 G;  2HHH L;  4BBS G;  3NEM A;  1X6O A;  1P8L A;  3UDG A;  1YIT A;  1UE1 A;  2B29 A;  4GN4 B;  3M4O H;  4A3G H;  3KF8 B;  2AWO A;  4JI7 L;  4A4I A;  5IWA L;  3HKZ G;  3PO2 G;  4IFD I;  2JEB I;  1RL2 A;  5LMN Q;  4LF4 Q;  1NMF A;  2UXD L;  4LWC A;  3CCM A;  4HID A;  4P72 A;  4X66 Q;  2K4K A;  1PH3 A;  2NN6 I;  3E9I A;  2VUM G;  2K5N A;  2XGT A;  2VW9 A;  4YWK A;  1XNQ Q;  4NB3 A;  4Y7N H;  3UDX A;  4DV1 L;  4IOC A;  4P71 A;  1FJG L;  2JE6 I;  2YYZ A;  2Z0S A;  4PZ8 A;  4DV7 Q;  2RHQ B;  1EUJ A;  3G71 A;  3ULL A;  4DV3 L;  4DR4 L;  2MO1 A;  1N36 Q;  4TQU S;  3FHW A;  5AJ3 Q;  1VQP A;  2IX1 A;  1PV4 A;  1GVP A;  1YI2 A;  3RN5 A;  4BBR H;  1SRU A;  4C3J H;  4JI7 Q;  4KLK A;  5HGQ A;  4KHP L;  2UXC Q;  2Z6K A;  1A0I A;  3IRB A;  4A76 A;  1JJG A;  4DV1 Q;  1KD1 C;  2QEX A;  4A3B H;  1QUQ A;  2F52 A;  3RLF A;  2V1C C;  5C0X G;  1E1T A;  2K5H A;  1M90 C;  4NXN Q;  4MTN A;  4QY7 A;  4B3S L;  2VS1 A;  2IHE A;  1Q12 A;  2ID0 A;  1B7Y B;  2UXB L;  4AH6 A;  4A3M H;  2CWA A;  3K80 C;  1N36 L;  1XNR L;  2KCM A;  1NY4 A;  2A8V A;  4PMW A;  2F3I A;  2JA5 H;  3G4S A;  1L1O B;  1K3R A;  4HIO A;  2JA6 H;  3M85 A;  4XIG S;  2LXJ A;  4DUZ Q;  1IZ6 A;  1G51 A;  1W3S A;  2BA0 A;  4AIM A;  1HNZ Q;  3KDF B;  4KHZ A;  2R7F A;  1QZG A;  4X64 Q;  3BU2 A;  3GTM H;  2QGQ A;  2VNU D;  1X3F A;  3NEN A;  4A3K G;  1IBM Q;  1L0W A;  1Y1V G;  2KCT A;  4JBJ A;  4DR1 L;  1X9N A;  4LF7 Q;  2R93 G;  1VCI A;  2NVQ H;  1MIU A;  4DUY L;  2OCE A;  1Q1E A;  3CPW A;  3RNU A;  2F4V L;  3GTP H;  5C3E H;  3CCJ A;  4X6A H;  1XPR A;  1PYB A;  2PQA B;  3J7Z C;  1KL9 A;  3AEV A;  4LUO A;  1K73 C;  1LUZ A;  4LW1 A;  3PIP A;  5JJI A;  1HH2 P;  1EQR A;  2VUM H;  3A74 A;  1HZB A;  1HNZ L;  4R4Q A;  1OXV A;  4POF A;  3RLN A;  3KYH C;  4UP9 A;  4XTC S;  2VY3 A;  3F2B A;  3OW2 A;  1W2B A;  2E2H H;  3TRZ A;  3K8A A;  3PIO A;  4DR5 Q;  2HQL A;  3S15 H;  2JQO A;  4A3G G;  1LTL A;  3U58 A;  3CCQ A;  3HOY G;  5JEA G;  4K0K Q;  2YU9 H;  4LF7 L;  4DR6 Q;  3TRE A;  5IWA Q;  4GKJ L;  3BZC A;  3S1Q H;  1G29 1;  4HJ7 A;  2WAQ G;  2GN5 A;  4UP8 A;  3A5Z B;  1Y1W H;  4DR1 Q;  1FJG Q;  2CFM A;  3HOX G;  1CKO A;  4J15 A;  1XNQ L;  4IOA A;  2R93 H;  4A3E G;  4LF6 L;  1X56 A;  5C0X J;  3I55 A;  2K75 A;  4DV0 Q;  2HIV A;  4X66 L;  4A93 G;  1KAW A;  1HZC A;  3J80 i;  2ATW A;  2CWP A;  2UU9 Q;  4JYA L;  1T9H A;  3E0E A;  3HOW G;  4OWT B;  3GO5 A;  3ULP A;  1K8G A;  2KEN A;  1IXR A;  2NZO A;  1XMO Q;  4GKJ Q;  1H95 A;  3PF4 A;  4X62 Q;  3CC7 A;  3RZD H;  4X65 L;  4NXM Q;  1CKN A;  5FLM G;  4O2D A;  3AQQ A;  4DV2 L;  2B63 G;  1VQA A;  5EAY A;  2JA6 G;  4DR5 L;  2ZJP A;  3HKZ E;  3ERS X;  3MXN B;  2ALY B;  1VQJ A;  4GKK Q;  2XTI A; 
#chains in the Genus database with same CATH topology
 4A3K H;  1EEI D;  2JA7 B;  3S1R B;  5IP9 H;  1ASY A;  4A3E B;  1O7I A;  4K5W A;  4JI3 L;  1AZP A;  4WJ3 M;  2MQH A;  3TEH B;  4KI0 A;  1PTO C;  2NZ1 D;  2DJF C;  2RSO A;  3DM3 A;  4P73 A;  4NXM L;  5C0X I;  2NYZ D;  4X64 L;  3OMG A;  3QO2 A;  2WAQ B;  3T16 A;  1WOC A;  3GD7 A;  5FKA C;  5H1S E;  1B70 B;  1VMP A;  5C6A A;  3TQY A;  4Y7N B;  4BS9 A;  3TBI B;  2I5H A;  4P74 A;  2OQK A;  1Y1W G;  1DGS A;  4ZLT F;  1D8L A;  5M3M G;  2PI2 E;  1SDF A;  1PDQ A;  4BY7 H;  5C4H A;  4FF2 A;  1AE2 A;  2QCP X;  3STB C;  3HOV G;  3HOW H;  1OO9 B;  4TRD A;  1DCZ A;  2UUB Q;  1BBW A;  5BR8 Q;  4WFN 3;  2F0I A;  1VDZ A;  2I0Q A;  1JOO A;  3K0X A;  4M1U B;  1QVF A;  5ELO A;  1IKM A;  4EQO A;  2N8N A;  1Z7T A;  3K59 A;  4DNI A;  4QB4 A;  4L5T A;  2EIF A;  2C5C A;  3OW7 A;  3UE1 A;  5C3X A;  1B8A A;  2OQ0 A;  4LUV A;  3U4V A;  3CQZ H;  2IWH A;  1AE3 A;  1HFG A;  4A3F H;  3FKI H;  4DR7 L;  1HR0 Q;  4OHJ A;  4C56 C;  1Q3L A;  3UDI A;  3S2D H;  2RDG A;  3GTO B;  3DWA A;  1Z6H A;  5CMD A;  1D1K A;  1QNU A;  2DNC A;  1E7Z A;  1YNN D;  3L0O A;  4DV4 L;  3DWQ A;  1KDA A;  2EY5 A;  4DR4 Q;  4K8I A;  1U4R A;  4A3J B;  1JB3 A;  1TS2 A;  3NK9 A;  1FL0 A;  5C3W A;  1G2T A;  1I94 Q;  2G9D A;  2Q8I B;  4KHP Q;  3KBX A;  2Z9H A;  2WAQ E;  2EZV A;  1MJE A;  3Q24 A;  4KKU A;  3TP8 A;  1LTG D;  1WTW A;  4KJN A;  1WYD A;  2PI2 A;  2AQ2 B;  2HDM A;  1Y8N B;  2OTL A;  1LTB D;  3D4W A;  1F9P A;  5M5W B;  2A6H C;  4RWS C;  1F9S A;  2IX3 A;  1I5F A;  3T1Y Q;  1PH6 A;  1PYS B;  2PQE A;  3VYT A;  1B9N A;  5IP7 H;  3H15 A;  1Q82 C;  4MNO A;  5LMN W;  4V19 0;  2ZTD A;  2F3W A;  3DHQ A;  2RHS B;  1K3B C;  4DR3 Q;  4ZKB B;  3GTL H;  1FYC A;  4GN5 A;  4LFA Q;  1JOQ A;  5KGU A;  3T1Y L;  2OXP A;  1B1Z A;  2M9V A;  3N6R A;  1IBL Q;  3V96 A;  4RGM A;  3R2I A;  3KFU A;  4ZYS A;  4JI5 Q;  4KTA A;  1I4R A;  1Z47 A;  1E2W A;  4K5X A;  4OON A;  2ZTE A;  3W1G A;  4QUF A;  2F0W A;  3VR4 A;  1JE4 A;  4L5S A;  2PZU A;  4B3R L;  4KHV A;  4OO1 I;  3D8G A;  2NTS A;  5EKK A;  3FDT A;  4AYB E;  3M7N A;  2VZA A;  1PMR A;  3M7G A;  3PUZ A;  4IFD J;  1I3Q H;  3TP5 A;  1LLR D;  3OHX C;  1Y1V H;  4IUV A;  2B2W A;  3P20 A;  1RD9 D;  2F0N A;  4ME3 A;  4PG3 A;  3CXC A;  4GS3 A;  1EIF A;  2WAC A;  1JMC A;  5EPL A;  3GTG B;  3I70 A;  3CQZ B;  1GHK A;  3F1Z A;  2HT1 A;  2E2D C;  4NW2 A;  3DWP A;  3STB D;  2ES2 A;  2IL8 A;  2F4I A;  3EN2 A;  1VQH A;  1EOV A;  4O0A A;  2F0K A;  4RFB A;  3Q23 A;  4MIU A;  1J5E L;  4UPA A;  2AKW B;  5M5W H;  1DOL A;  1H9S A;  3HOX B;  4Y52 H;  2BH2 A;  3EQL C;  5T1G A;  4XT3 B;  1LTS D;  4MN3 A;  4DV5 L;  1A63 A;  2I5M X;  5CBA E;  1XYI A;  4R1J A;  3QOL A;  4JBM A;  3S1N B;  4OO1 G;  3VYR A;  5AFW A;  4YHH L;  1ESF A;  1U4L A;  3CD6 A;  1SMY D;  2G9H D;  1ROD A;  2CH4 A;  4A3J H;  2IJ0 A;  1I6V C;  2B2T C;  3OIQ A;  1YZ6 A;  2BH8 A;  4C3H H;  2RDF A;  1R9T H;  3BVM A;  5J22 A;  1PH4 A;  2QW7 A;  2Q8R E;  3GDE A;  3J7A 5;  1JQY D;  3J81 i;  2K5V A;  2E2J H;  1B4O A;  2F0Q A;  2F4V Q;  1SE2 A;  4QIW B;  4IPG A;  4DV6 Q;  2UXD Q;  3A0J A;  5I9P A;  5I4D A;  1W6K A;  2WV6 D;  5FOB B;  4GKK L;  4LFC L;  4RMF A;  1SLJ A;  4A3F B;  3VR3 A;  2HCC A;  2OTJ A;  4HSP A;  3M4Y A;  3RUZ A;  3OWE B;  4FF3 A;  2D0P A;  1A6X A;  3C46 A;  3S1R H;  3HG9 A;  1UNS A;  1IHZ A;  2SNM A;  2F0U A;  4GLA C;  2KQ3 A;  3J80 c;  1EWH A;  4A3M G;  1JJ2 A;  4G4K A;  3BYT B;  4JVZ A;  4H0L C;  2B63 B;  3D6C A;  4JI4 L;  3H3V H;  1VQB A;  4KK7 A;  1GUO A;  2K50 A;  4B3S Q;  4AYB G;  4ME5 A;  4FYD A;  2IPK D;  2PNH A;  1WFQ A;  1PH5 A;  1O7Y A;  3CAM A;  4OWX B;  3HOW B;  3CW2 C;  3GTQ H;  2IT1 A;  3ULJ A;  4YCU A;  2H5X A;  3DUZ A;  3CMA A;  2UUB L;  3K5M A;  5KND A;  2CQO A;  4GN3 B;  3KUP A;  3M4Q A;  4H44 C;  4I65 A;  1AN8 A;  1TY0 A;  2EY2 A;  1EZ8 A;  4BXX G;  2DGY A;  1GO3 E;  1PTO B;  2WII B;  1XPU A;  1TT2 A;  1AH9 A;  3VDY A;  2LY7 A;  4GLV B;  2AWN A;  4ZUJ A;  2E76 C;  2F3V A;  2N88 A;  4JI2 Q;  3OTO Q;  3D6W A;  3AYH B;  4CJ1 B;  5IYC H;  3C1E A;  1S5B D;  5C4J H;  3I4M B;  1WJJ A;  4EX5 A;  1UE1 A;  2B29 A;  5E1F A;  1TWA B;  2AWO A;  4JI7 L;  4N8X 1;  4A3K B;  4DNT B;  4XYQ A;  3ERQ A;  3OPO A;  1RL2 A;  3BVG A;  1F2Y A;  3D4R A;  4A3M B;  1PH3 A;  4DU9 A;  3E9I A;  3RZD B;  5C4J B;  4YWK A;  3U9O A;  2QDL A;  4RHR A;  1EY9 A;  1PZJ D;  2YYZ A;  2Z0S A;  1EUJ A;  3E5S A;  3G71 A;  3ULL A;  3Q0A A;  1B9M A;  2MO1 A;  1JWU D;  4TQU S;  3FHW A;  4IUN A;  2IX1 A;  1GVP A;  3MEH A;  4B08 A;  1EYA A;  1SRU A;  4KHP L;  2K03 A;  1JJG A;  4A3B H;  1M90 C;  4RGO S;  1E1T A;  4QY7 A;  4F8M A;  3C3L A;  2A68 D;  2VS1 A;  2IHE A;  3TSS A;  4NMZ A;  5ELB A;  2CWA A;  1XNR L;  3BDL A;  4PMW A;  2F3I A;  5IGE A;  4NDX A;  2JA6 H;  1LT6 D;  3M85 A;  4XIG S;  1RKN A;  1MI2 A;  3GTQ B;  1IZ6 A;  5FO7 B;  4K5V A;  2CH4 W;  2OT2 A;  2F0V A;  3RZO B;  2R7F A;  5EGT A;  3BU2 A;  2QGQ A;  1X3F A;  5C4Z A;  4JK1 C;  3V05 A;  2R93 G;  4JBJ A;  1X9N A;  1BQQ T;  4IUR A;  2NVQ H;  5IOD A;  3RNU A;  2PQA B;  1JR0 D;  4O1N A;  1IL8 A;  5T1I A;  1LUZ A;  2Z1C A;  1BDO A;  5JJI A;  3ERO A;  3A74 A;  4R8N A;  4R4Q A;  1S5D D;  1OXV A;  2WIN B;  2HCI A;  1Y1W B;  3NPP A;  4UP9 A;  4XTC S;  3F2B A;  1W2B A;  3LX0 A;  3TRZ A;  3NHH A;  1TS3 A;  3K8A A;  4Z9C B;  5NUC A;  3DMU A;  3T4A C;  3PIO A;  1K28 A;  1LTL A;  3U58 A;  2L4N A;  1AW7 A;  1UUP A;  2A74 C;  4K0K Q;  5BN5 A;  4ABN A;  5DAU A;  3S2H B;  2GN5 A;  2CQA A;  4UP8 A;  4DR1 Q;  3I72 A;  3SXH A;  2LKV A;  1CKO A;  1RCV D;  4LF6 L;  1IYV A;  5C0X J;  4DV0 Q;  2EY1 A;  2HIV A;  4A93 G;  1KAW A;  4C3H B;  3E0E A;  2FJ2 A;  5BN3 A;  3TP6 A;  4KKS A;  3CC7 A;  3D3R A;  3QOJ A;  5FLM G;  4HAE A;  5IIF A;  4HR7 B;  4K8J A;  4ZCK A;  2B63 G;  1Y69 U;  1LTI D;  3BYY B;  2L11 A;  3S1N H;  1X3P A;  4Q0F A;  1VQJ A;  3T13 A;  2XTI A;  3I4L A;  1FD7 D;  1Q7Y C;  1H9K A;  4TKO B;  3H0G B;  1VQ8 A;  4A3D H;  3KK7 A;  2F0J A;  4ZRZ A;  3KJP A;  1LTR D;  2RA4 A;  3T1H Q;  2F0F A;  3HOV H;  4OX9 L;  2PCF B;  2RKS A;  5C4X H;  5KNB A;  3HOX H;  1QJO A;  1A3U A;  1VQ9 A;  1XTD A;  4IUQ A;  3IFT A;  4HMI A;  4FXG C;  1K0R A;  4X3S A;  1K9M C;  1W6J A;  2NVX B;  2EXD A;  2B2V C;  4B3T L;  2F0L A;  4A3B G;  4DAY B;  4JOI A;  2F1M A;  4LFB L;  1SBB B;  1YNJ D;  3PO2 B;  5L37 A;  1SJE D;  2JA8 H;  4CKB A;  5FLX E;  1K8O A;  1R4Q B;  1DOM A;  1K83 H;  1TWG B;  4CJ0 B;  2X6G A;  4OXP A;  3CC4 A;  4RKB A;  5IYB G;  4E6I A;  4OX9 Q;  1SNQ A;  1Y1V B;  2F0S A;  1PFN A;  2NB0 A;  5CV6 A;  5D3I B;  1HR0 W;  3W1B A;  4JI0 L;  1H9M A;  1FVI A;  3MC0 B;  4NP5 A;  1XJV A;  5E7N A;  1E22 A;  3KF6 A;  4DAM A;  1Y8O B;  4YIJ A;  2R7Z B;  4HJ8 A;  3CME A;  3GTJ H;  1STB A;  2RF4 A;  4IFD H;  2F0M A;  1HTP A;  2XRS D;  3FVQ A;  4ZKC B;  3HOU G;  4DFA A;  4CDE C;  1CKN B;  1ENF A;  1ENA A;  4YCW A;  3C2P A;  1JB7 A;  5A2Q L;  1VQG A;  2DNE A;  5C4X G;  4JI0 Q;  2PW7 A;  4IPH A;  1OXX K;  2RVL A;  1UE6 A;  4KMU C;  1C0A A;  2B2T A;  2EYF A;  3GTL B;  1U4P A;  4U68 A;  1B3A A;  1GXD C;  2LFN A;  4MZ9 A;  2CW0 C;  2NTT A;  3H94 A;  3F2D A;  4AQY Q;  3LWU A;  4KV6 A;  2ZM6 L;  1A62 A;  2XSC A;  3BDO A;  3PGZ A;  1STH A;  1GJX A;  4C3I G;  1BCP B;  1ESR A;  2F0P A;  4PZ6 A;  4UP7 A;  1XMQ Q;  3KLS X;  3MXU A;  1Q81 C;  4RKL A;  2ZM6 Q;  1D2B A;  5M5X B;  3J7A F;  2NUC A;  3PUV A;  4HMJ A;  2ENB A;  4LFB Q;  1EY6 A;  2A6E D;  1BCP D;  2BCO A;  3Q8D A;  1I4P A;  1KHI A;  2MFI A;  3KF6 B;  1A3T A;  2P5Z X;  5M5Y B;  1FNV A;  1KNE A;  4G57 A;  3SEB A;  5M3F G;  5J3B A;  2Q2H A;  5IY0 A;  3I56 A;  5K36 G;  1QVC A;  2MUY A;  5DLQ E;  1WVL A;  1H9J A;  3NUC A;  3PQI A;  4C3I B;  1N34 Q;  2EJG C;  2ZJQ A;  2Q8T A;  1A2U A;  2Z6K C;  1BR9 A;  5ELE A;  1J8I A;  1STY A;  3L9A X;  3PIO 3;  1CFM A;  1SXT A;  3BZK A;  5FO9 B;  3SK8 A;  1WTX A;  3NQI A;  1MKH A;  1EIY B;  4K0K L;  1B44 D;  1EWC A;  5HY6 A;  4A3F G;  1R4P B;  1SYB A;  4DR3 L;  1CSP A;  1STE A;  4I7A A;  1PRT C;  4LF6 Q;  4POG A;  3HOZ H;  4CDD C;  3F8T A;  1KDC A;  1NMG A;  2ASB A;  5KYL A;  3CF5 A;  5LMU Q;  3SK5 A;  2TMP A;  1PVO A;  3O13 A;  4LF9 Q;  5ELN A;  1SFO B;  1NCV A;  3S17 H;  4JYA Q;  1A15 A;  1CUK A;  3MZ5 A;  1LO5 D;  1OXU A;  2B2Y A;  3OWF A;  4QGU A;  1UEB A;  4RGT A;  1YJW A;  3SGI A;  2H4O A;  3NBI A;  2Z4H A;  3L7Z C;  5BR8 L;  1VQ4 A;  2HDL A;  3AFQ A;  4DXG A;  1WTH A;  5GAD C;  1SNM A;  1XNR Q;  2WB1 G;  4UAI A;  1SMY C;  1YHB A;  3K57 A;  1HNW Q;  1EYD A;  1I4H A;  1O7Z A;  1Q8K A;  1QZH A;  5CYU A;  1ZYR D;  4GOP A;  4XYO A;  1OTC A;  1PZI D;  2MP1 A;  5LHY 1;  2GA4 B;  1V43 A;  1TWC H;  3RLO A;  4JI8 Q;  1FR3 A;  4A93 B;  2VQF L;  3MEF A;  2JK8 A;  2FHT A;  1G91 A;  1N8R C;  3S1M B;  1HA5 A;  4YHH Q;  1ZKO A;  1HXY D;  4JG2 A;  1TWF H;  4A3E H;  2UUC Q;  1U4M A;  1F9R A;  2N49 A;  1HUN A;  1M4V A;  2JA7 H;  1L2F A;  1BF4 A;  1LYL A;  4DAY A;  1XMO L;  1KC8 C;  4QUC A;  5KYI A;  1NJI C;  4ALP A;  1CK1 A;  2QIL A;  2I5L X;  3IFD A;  2UXB Q;  1F2Z A;  1SYD A;  1GUN A;  1CHP D;  4QMG A;  1SMX A;  3CPF A;  4LMQ D;  3SVM A;  5IT9 c;  3KLS A;  4QF4 A;  4BY1 B;  1JT8 A;  3OTO L;  3E0J A;  2SDF A;  1VMC A;  1Q46 A;  1TQO A;  1DYQ A;  5BN4 A;  1E24 A;  4OEM B;  3M4P A;  3PUY A;  4JOI C;  1HFN A;  2JJQ A;  2PMZ E;  5COR A;  3K7A H;  1IW7 C;  1QG7 A;  1A3V A;  1IYU A;  1ONL A;  1TWH H;  4BWG B;  4GLX A;  4LF4 L;  4I7Z C;  1VQI A;  1J6Q A;  4UY8 C;  2BDO A;  1O7L A;  1EFW A;  1RF2 D;  4R4I A;  3K81 C;  4DR6 L;  1JWS D;  4A3D G;  1A8V A;  1VQ6 A;  1S40 A;  1FGU A;  5FLX c;  1VF7 A;  1DZ1 A;  2XIW A;  2N78 A;  2I46 A;  3DM1 A;  2KVM A;  2D5D A;  3NWT A;  3I90 A;  4KY5 A;  4H02 A;  1RDP D;  4DV4 Q;  1O78 A;  2L12 A;  2LSS A;  1IL2 A;  1MJC A;  1IBL L;  4H7B A;  4HTH A;  5A2Q E;  1J5E Q;  2ZJR A;  2UU9 L;  3MA2 B;  4IZ8 A;  2B2W C;  4M8A A;  2F0H A;  3E6Z X;  1XMQ L;  1OXT A;  1M1K C;  1UAP A;  1KQS A;  3VR2 A;  1JWM D;  4DUZ L;  3K0Y A;  1YHQ A;  5HUR A;  3CCR A;  1CA5 A;  1WD0 A;  1BBU A;  1II3 A;  4X65 Q;  1I4Q A;  1SE8 A;  5CV8 A;  2AMC B;  3NWS A;  2OWO A;  4JI6 L;  4KKT A;  4BBS B;  1EEF D;  4GOP C;  3PUW A;  1GUW A;  4JBK A;  4EVO A;  1PA6 A;  1HJP A;  3CCU A;  4N8F A;  4JI1 Q;  3CHB D;  1BO0 A;  4DK6 C;  3UDG A;  1X6O A;  1P8L A;  5JAV A;  2KED A;  1TKW B;  3WDN A;  2K28 A;  3HKZ G;  4LF4 Q;  4FO2 A;  2UXD L;  4LWC A;  4P72 A;  4WJW A;  3MFY A;  3J80 L;  1XNQ Q;  4NB3 A;  4IOC A;  4FXD A;  4DV7 Q;  2BOS A;  1BXT A;  4C3H G;  3R93 A;  4DV3 L;  4DR4 L;  4PQX A;  1PV4 A;  1CT1 D;  2AQ1 B;  1L0X B;  1YI2 A;  4FF4 A;  4BBR H;  4C3J H;  1KAB A;  5HGQ A;  2EPB A;  5M9O A;  1WCM B;  2Z6K A;  1A0I A;  3IRB A;  4K6L A;  1HTL D;  1PYW D;  1A2T A;  2QEX A;  3PIP 3;  5C0X G;  4R9W A;  2KEE A;  2ID0 A;  1TII D;  5CV9 A;  1N36 L;  2E2H B;  2A8V A;  3A56 A;  1K3R A;  1D6E C;  2LXJ A;  3M4O B;  2VB3 X;  4KHZ A;  2PW5 A;  3E3X A;  1QZG A;  1YNN C;  3NEN A;  4A3K G;  1MD2 D;  1Y1V G;  4LF7 Q;  4DUY L;  2OCE A;  2F4V L;  3GTP H;  5C3E H;  1EIH A;  3CCJ A;  1D1I A;  2EJM A;  3J7Z C;  3PIP A;  5KEE A;  1HH2 P;  1ICF B;  2VUM H;  1LT4 D;  3EJI A;  4POF A;  3RLN A;  3X3N A;  2QF7 A;  3HOU B;  5I6Y A;  2B2Y C;  2JQO A;  2XNA C;  3HOY G;  3S14 B;  3TRE A;  5JPM C;  1ILQ A;  3S1Q H;  1KNA A;  4HJ7 A;  3A5Z B;  2A6H D;  1FJG Q;  4J15 A;  1HQR D;  3I55 A;  2K75 A;  4X66 L;  3F2U A;  5C3E B;  2EYO A;  1F2L A;  1XMO Q;  3DXJ C;  1PXU A;  3EFX D;  3KLR A;  1EL0 A;  2XN9 C;  1EIG A;  4XQN A;  1BUV T;  4O2D A;  2KCC A;  3M3Y B;  3HKZ E;  4WRD A;  1CZG A;  5G3L F;  1I6H H;  1MBY A;  5IOC A;  3X3M A;  3FKI G;  1SN8 A;  1DOK A;  3GTK H;  4B3M Q;  3OSO A;  1LTT D;  2KOL A;  5COY A;  1SR3 A;  3PO3 B;  2KHJ A;  4BBR G;  2R92 G;  2ZXO A;  3I4N H;  1KIX A;  1DXM A;  1QOH A;  2NVY B;  5DM6 3;  1NE3 A;  3NTH A;  3OYY A;  1WCM H;  4C1N I;  2NZH A;  4RH6 A;  1JJC B;  1Q1B A;  2WP8 J;  5M3F H;  4FF1 A;  2MPM A;  1NBW A;  2CHB D;  2A68 C;  5EBC A;  4X62 L;  1E0B A;  2UUC L;  1STG A;  4C2M B;  4EQN A;  1IKL A;  4PV1 C;  3S16 H;  5EQ0 A;  4RG1 A;  2RQX A;  5KNC A;  2D0O A;  1F2M A;  4H13 C;  1PH7 A;  1EU3 A;  2R7D A;  3ND9 A;  1S4Z A;  2A1A A;  4FDB A;  1HQM C;  2KHI A;  4J1M A;  1WTO A;  5FLX L;  1RTO A;  2ICE C;  2K32 A;  5I6W A;  2RCF A;  1VQF A;  4RCO A;  3J81 L;  3MHB A;  5TSS A;  1Z9F A;  4BBS H;  1HR0 L;  1YEZ A;  1PHJ A;  2JP1 A;  4IAL A;  4IUT A;  4P75 A;  4HIM A;  1YJN A;  3J7A V;  4DPG A;  3HOY H;  1VS0 A;  5CV5 A;  4QJF A;  5JOB A;  4EQP A;  5GAE C;  2FMM A;  3GP7 A;  3W3A A;  2NVT H;  2SOB A;  5KIX A;  1ET9 A;  2EYH A;  4NPS A;  3LGJ A;  1WCM G;  2O5I C;  3GQB A;  3RR5 A;  1G6P A;  4C1N K;  5GAH C;  1GM5 A;  5ELC A;  4JPB W;  5I2X A;  2AUJ D;  1QCB D;  4DV3 Q;  3QIA A;  3CKI B;  4NKL A;  4PMB A;  3J81 j;  5IGB A;  1SYC A;  4IN3 A;  1VQE A;  4RCN A;  3G7L A;  4JC0 A;  1TS5 A;  1Y8P B;  3OMC A;  4K14 A;  2UXC L;  3H3V C;  3HGB A;  1N34 L;  3ONA B;  5IYB H;  4MHE A;  4IO9 A;  5CV4 A;  4F7X A;  1CSQ A;  4X3T A;  1Q90 A;  5E4W C;  3FEW X;  2MHV A;  4A3I B;  1RJT A;  3I7F A;  3CCE A;  4IQZ A;  4CBV A;  3K7A B;  5GRO A;  5C0X H;  2D9U A;  1PFM A;  2DN8 A;  1AP0 A;  4JI6 Q;  1EZ6 A;  3K5L A;  1B2T A;  2EY6 A;  3RMH A;  4DK1 A;  3IL8 A;  4WJ4 A;  1S3O A;  5DEH A;  3HFZ B;  3TN2 A;  2IY5 B;  4HJ9 A;  3FP9 A;  1GKH A;  5IP9 G;  5M3M H;  3KDF A;  4B9X A;  3CCS A;  4OWW B;  1YHA A;  3EIV A;  2YTY A;  5C44 B;  2E5L L;  3BJU A;  4G7O C;  2QKI C;  4LF5 Q;  2C9O A;  4CDC C;  2PMZ B;  3UE0 A;  1LT5 D;  3Q22 A;  4L8J A;  1D5X C;  4DAV A;  2Y0S E;  3MAQ A;  2VQE Q;  1EOT A;  5CR3 A;  1TWF B;  4RGN A;  3K5N A;  3BDC A;  3S1M H;  2PPB C;  3IKJ A;  1I50 H;  1NTG A;  3DEP A;  2E2I B;  1TWC B;  5K36 H;  1TY2 A;  2EQS A;  4JV5 Q;  3VR6 A;  3HEJ A;  3PSI A;  3PO3 G;  3AFP A;  1FNW A;  3NSW A;  4CJ2 C;  1PFS A;  3NEL A;  3D0F A;  3CC2 A;  3I4M G;  1L1O C;  2WB1 B;  5C44 H;  5C44 G;  2NVT B;  3J80 E;  4HSV A;  2CVR A;  4C3J G;  3N52 A;  1HZA A;  2H1E A;  1NUC A;  4DR2 Q;  1XTC D;  3HOY B;  2JSO A;  5M3M B;  5GQO A;  1EYG A;  4A3L H;  4L5R C;  4BA2 I;  5IYD H;  3M9B A;  4IUU A;  4HCE A;  1IBM L;  2SEB D;  4DA2 A;  4CKC A;  5D14 A;  4DAP A;  2Z8L A;  3RN2 A;  1KLU D;  3HP3 A;  4FNF A;  1RHP A;  1T5E A;  3PMF A;  4G7H C;  2E74 C;  3I4N G;  2R92 H;  1N33 Q;  4PNY A;  1UE5 A;  5ISR A;  4A3I H;  1VQC A;  5EPK A;  1NR2 A;  1DJR D;  1BCP C;  3CCV A;  2KJX A;  2O4X A;  2DJG C;  2GVB A;  2I07 B;  2XRQ D;  3UI2 A;  5I2Y A;  4DV6 L;  2VQF Q;  3BVZ A;  4DN4 M;  3L2P A;  4ODG A;  3HKZ B;  3K5O A;  2HHH Q;  1Q8I A;  3I4O A;  3R8B A;  4DV5 Q;  2F0E A;  1XPO A;  2VQE L;  4DV0 L;  4C3I H;  1WTP A;  5GAG C;  2E75 C;  1NNX A;  4K6D A;  3MVV A;  3J81 c;  4LF5 L;  3I73 A;  2R93 B;  1JC7 A;  1CQV A;  2B3G A;  1B53 A;  1N33 L;  4QL5 A;  1YIJ A;  1WTV A;  4DK0 A;  3U4Z A;  3EBE A;  3CRL C;  1U5K A;  3JAM c;  4IPC A;  2A69 D;  5EKI A;  1EQQ A;  3I4N B;  5K5P A;  4R4C A;  1SE4 A;  3PO3 H;  4DUY Q;  3S9W A;  2K01 A;  3A54 A;  1LM0 A;  3GTK B;  1YNJ C;  1DD2 A;  4IJH A;  2JA7 G;  3EVQ A;  3PUX A;  3VYU A;  1S5F D;  2KCN A;  5ELD A;  1XX8 A;  5CC4 A;  1X32 A;  2N55 A;  2K1B A;  4ZAI A;  1VF5 C;  3IAY A;  2K05 A;  2WFW A;  2UUA Q;  2CKZ B;  2J0T D;  4R4O A;  3VR5 A;  4LF8 L;  2KHS A;  2L9H A;  4YY3 Q;  2Z6B A;  2G5D A;  3T51 B;  1E1O A;  4LFC Q;  4OO1 H;  2JA5 B;  3BG3 A;  3J7Y W;  3JC6 6;  2HIX A;  4JI8 L;  3VA7 A;  5F2D A;  1D5Z C;  2Q2I A;  4O42 A;  1ICW A;  1HUM A;  1CQF A;  1F77 A;  1YVC A;  4C2M H;  5D3D A;  5LMN L;  3HOU H;  2RDH A;  3MTS A;  1GUG A;  4A75 A;  1AFP A;  5EJW A;  1LAB A;  3PCO B;  4DF7 A;  5JEA H;  3H91 A;  4B3R Q;  5M3F B;  3A8K E;  1LT3 D;  4CGY B;  4B3M L;  5EBD A;  3I2Z A;  3F2C A;  5JJL A;  2LXK A;  3GTJ B;  3GTP B;  1PRT B;  3TME A;  1QNK A;  1VQL A;  2NVY H;  1F9Q A;  1STN A;  4HN7 A;  2C35 B;  1ZXT A;  1KXL A;  4QIW E;  2NN6 G;  3NEM A;  1YIT A;  2EE1 A;  2K7V A;  5JJZ A;  4GN4 B;  3M4O H;  3I91 A;  4A3G H;  5IWA L;  3PO2 G;  4IFD I;  2JEB I;  4Q5V A;  4A3G B;  1NMF A;  1QIL A;  1V8Q A;  3CCM A;  4HID A;  1M8A A;  2EJF C;  2K4K A;  4X66 Q;  2K5N A;  4LAA A;  2XGT A;  2VW9 A;  4DV1 L;  4P71 A;  1FJG L;  1KDB A;  2JE6 I;  4PZ8 A;  2RHQ B;  4J6H A;  1N36 Q;  5AJ3 Q;  3NTK A;  3ZYY X;  4KY6 A;  4JI7 Q;  4KLK A;  2UXC Q;  4A76 A;  1IW7 D;  3CRK C;  4N9T A;  1KD1 C;  2V1C C;  3S1Q B;  5C4X B;  4MTN A;  3URY A;  2ICI A;  3H09 A;  3MXG A;  3WOF A;  4K2L A;  1ZYR C;  1SNO A;  2A73 B;  3K80 C;  1O80 A;  3MXN A;  1E2V A;  2Y0S B;  2JA5 H;  3G4S A;  1L1O B;  4J8Q A;  2CW0 D;  4HIO A;  3VA5 A;  1G51 A;  4KD3 A;  1W3S A;  4AIM A;  3V2T A;  2WKD A;  1HNZ Q;  1V1O A;  3RD4 A;  4X64 Q;  2EVB A;  2VNU D;  4KN7 C;  4PMC A;  4DR1 L;  1VCI A;  2DY7 A;  1PYB A;  4CHT B;  4IUP A;  3AEV A;  3VYS A;  4LW1 A;  1K73 C;  4ZQ3 A;  1EQR A;  1HZB A;  2BE5 C;  5ELF A;  3KYH C;  3OW2 A;  2E2H H;  1HCZ A;  3SE0 A;  4DR5 Q;  2HQL A;  1GHJ A;  4A3G G;  3SHL A;  2FMC A;  1PTO D;  1ZEQ X;  3QG1 A;  5IWA Q;  4GKJ L;  1H9S B;  3BZC A;  3T56 B;  2WAQ G;  1WD1 A;  2LS0 1;  1Y1W H;  1SNP A;  4TSS A;  4IOA A;  1XNQ L;  2R93 H;  4A3E G;  3SDZ A;  1X56 A;  4C3J B;  4X3U A;  1AZQ A;  3H6M A;  2JXM B;  3J80 i;  2UU9 Q;  1T9H A;  1E2Z A;  3HOW G;  4OWT B;  2NVQ B;  3GO5 A;  2HQE A;  2NZO A;  1NR4 A;  4DGZ A;  5EPJ A;  1H95 A;  5FK9 C;  4X62 Q;  1MSG A;  2X69 A;  4NXM Q;  1CKN A;  1ILP A;  3AQQ A;  4FVM A;  1B50 A;  3K6O A;  2ZJP A;  1BBX C;  3ERS X;  3MXN B;  2ALY B;  2TSS A;  3NQT A;  2JA6 B;  1Q86 C;  1TWH B;  1QWY A;  4IJL A;  1HRJ A;  4DXF A;  2R92 B;  4K2K A;  4LJZ C;  1C9O A;  1HZ9 A;  2Q2U A;  5C3E G;  2ZXR A;  1X3E A;  3ITP A;  5IYC G;  4JCV E;  3H3V I;  4DV2 Q;  4KN4 C;  4A3I G;  1J9O A;  1CTM A;  3HS0 C;  4QQB X;  2VL6 A;  4BY1 H;  2D62 A;  4IPD A;  3S24 A;  5A35 A;  5C5M A;  2A19 A;  4LF9 L;  1KRS A;  4GNX C;  5J1Z A;  4LK1 C;  3I3C A;  2B8F A;  3K58 A;  2A5H A;  1GUT A;  4TVA B;  3DEO A;  3AB9 A;  2EXZ A;  3U9S A;  4HJA A;  1VQN A;  3FRP B;  2BDN A;  2O5J C;  2EYJ A;  1L0Y B;  1TWA H;  3PF5 A;  4OIJ A;  2DUD A;  4CDF C;  3JAM E;  4DR2 L;  3I4M H;  2M2L A;  4PZ7 A;  5FJ8 H;  4DV7 L;  3NBH B;  4OEL B;  1SNC A;  2E2I H;  1I50 B;  1LV9 A;  1UEA B;  1V9P A;  5IT9 L;  2RBM A;  1PZK D;  5IYD G;  3WOE A;  4A93 H;  1GD7 A;  1JE5 A;  1BVS A;  3OIP A;  2VB2 X;  4A3L G;  4BXX H;  2FXQ A;  2X6L A;  1HA6 A;  1PLF A;  1YBY A;  4S3S A;  1ENC A;  3DLL A;  1D5M C;  4A3J G;  1BKB A;  5IT9 E;  3NE5 B;  4JI1 L;  4LFA L;  2LMC B;  2JA5 G;  5IP7 G;  2JEA I;  3W5O A;  2L5T A;  4HIK A;  1U0L A;  3TS0 A;  1X3Q A;  2KUM A;  3BZD B;  2YTV A;  2K5Q A;  3TZD A;  2F0D A;  4GZY C;  2NWG A;  3A7L A;  3G6E A;  4OIK A;  4JI4 Q;  1SFO H;  2ZXP A;  3A7A B;  4JI3 Q;  1FNU A;  2IX0 A;  1PRT D;  1D7Q A;  4LF8 Q;  3E9H A;  4XQJ A;  2K04 A;  3ND8 A;  2MJ8 A;  3B6Y A;  3P1H A;  4FXK C;  2EDG A;  1PH9 A;  4EQ5 A;  2B63 H;  3KOJ A;  2JA9 A;  1S72 A;  4BY7 G;  2YTX A;  4HJ5 A;  1VQO A;  4B3T Q;  3ICE A;  1V1P B;  4L5Q A;  4UDU C;  3A8J E;  4NXN L;  1VQK A;  1SYE A;  3NBH A;  1SRO A;  4YCV A;  1AEX A;  2QDB A;  4JI2 L;  4BY1 G;  4RAU C;  5IGF A;  4X3K A;  1TVX A;  2E2J B;  3A5U A;  4P2C B;  1PH1 A;  4DKA C;  2O2L D;  1K8A C;  2JA8 G;  2PNR C;  4UHV A;  1QVG A;  1R9T B;  2OEO A;  2PZW A;  4YWL A;  1L1O A;  2KEC A;  1UWV A;  3OOC A;  4JI5 L;  1STA A;  5M5Y H;  3L3O C;  2KBN A;  3FPU B;  4WOR A;  4DK3 C;  3NTI A;  2BA1 A;  3G48 A;  3GV6 A;  5AJ3 L;  5LMU L;  4FP5 D;  2MGS A;  3C1F A;  5DM7 3;  4JBW A;  2PO4 A;  1EY7 A;  2PQA A;  4BA1 I;  3K7U C;  3H0G G;  1IYJ B;  4LUZ A;  2Y0S G;  5JPN C;  4YY3 L;  5I9O A;  1HNX Q;  3S17 B;  2N3S A;  1FGB D;  2R6G A;  1CHQ D;  1DM0 B;  1KTK A;  5IGC A;  2RCN A;  1VQM A;  1S5C D;  1VQD A;  4IFD G;  1KAA A;  1BCP F;  3CCL A;  2AQ3 B;  3HOZ B;  2L55 A;  3KBG A;  2EOT A;  1N32 L;  5IGG A;  1VQ5 A;  2D2C C;  1GUS A;  2ZT9 C;  2YV5 A;  4V0B A;  3J81 E;  1PRT F;  1SYG A;  3KJO A;  1CA6 A;  1V1P A;  2IHF A;  1SJH D;  1ET6 A;  3ZJY C;  3U50 C;  1IBK Q;  4ZUI A;  2B2V A;  4KJO A;  3GTG H;  5IE8 A;  2ZTC A;  5JEA J;  4GNX B;  5HGT A;  3Q6S A;  3S16 B;  3I8Z A;  1T5X D;  1I94 L;  2EYM A;  3P7J A;  5C5L A;  1DON A;  1EY8 A;  1I3Q B;  1GOZ A;  1G2S A;  1Y14 B;  2L15 A;  4YWM A;  3KLW A;  2FFK B;  2R7Z G;  2F0G A;  2R7Z H;  4EGV A;  5JVH 3;  1H9R A;  2IW3 A;  1E3P A;  3SR1 A;  1N9W A;  4R4T A;  1P16 A;  3HZX A;  5D65 A;  4DR7 Q;  4DNR B;  4N9P A;  1SAP A;  1YNX A;  3PV0 A;  1CI3 M;  4XT1 B;  3TZU A;  4F88 A;  1IBK L;  3WWV A;  1I6H B;  3NP8 A;  3M3Y H;  1TWG H;  1K83 B;  5M5X H;  2Q2T A;  1EU4 A;  5FJ8 G;  5JJK A;  1TXY A;  4OL7 A;  2E5L Q;  2K52 A;  2XWB B;  2L0C A;  5FLM H;  2R61 A;  3PO2 H;  4AQY L;  2K33 A;  2JN4 A;  3CP0 A;  1BNZ A;  3AMU A;  2A6E C;  1YJ9 A;  3HOZ G;  3R2T A;  5CBE E;  2K14 A;  1HNX L;  2NVX H;  3HRZ C;  1CM9 A;  1PH8 A;  2GVA A;  2XVS A;  1MSH A;  1JCK B;  1WI5 A;  1ML0 D;  2B2U C;  2AUK A;  3HOV B;  1V1Q A;  3S14 H;  4L63 B;  4RHS A;  4F87 A;  4GNX A;  4A3C H;  4A3C G;  3MFG A;  4A3D B;  1EQT A;  1XXG A;  3H0G H;  2Z4I A;  4B9W A;  1VQ7 A;  1EFI D;  3D31 A;  3KF8 A;  1JIC A;  2J4X A;  1ASZ A;  1UE7 A;  4GOP B;  3GV3 A;  1HNW L;  2VUM B;  2M00 A;  5G3L D;  2EYP A;  5JVG 3;  2E8G A;  5DNF A;  1C4Q A;  1EY0 A;  4ULL A;  1C7Y A;  4QCL A;  3ER0 A;  3NXW A;  5J39 A;  5FO8 B;  2PYK A;  1EWI A;  3D4D A;  2WB1 E;  1CKM A;  1SYF A;  1X65 A;  1MHW C;  3JAM i;  3GTO H;  3S2D B;  1OXS C;  2AHO B;  1KLG D;  5KRU A;  1SND A;  5LL6 S;  4KY7 A;  2QA4 A;  1JOR A;  3TS2 A;  3S2H H;  3QJY A;  1QUQ B;  4CKE A;  1C8C A;  3FKI B;  2B39 A;  2CCZ A;  2F0T A;  2BE5 D;  2JA8 B;  3UDF A;  4APV A;  1I4X A;  1PH2 A;  2QEJ C;  1S5E D;  2JYO A;  2UUA L;  1HHV A;  1TU2 B;  1N32 Q;  2RSN A;  2MO0 A;  1PFB A;  3T1H L;  1X3G A;  2MNA A;  4BBR B;  5EKL A;  1NSN S;  4ZK9 B;  1X54 A;  4R8I A;  1I4G A;  4LNQ A;  1RIP A;  1X55 A;  2F03 A;  4JV5 L;  1B3Q A;  1KRT A;  3EA6 A;  3HKS A;  4G7Z C;  2R3Z A;  2VXW A;  1WTR A;  3RZO H;  2K6A A;  4BBS G;  2L1B A;  2HHH L;  2NBF A;  2KA7 A;  2HUG A;  1K0S A;  3FPP A;  5E4X A;  3KF8 B;  4A4I A;  4BY7 B;  2HD3 A;  1K8M A;  5LMN Q;  2EYL A;  1EYC A;  3MXP A;  2NN6 I;  2VUM G;  1BOS A;  3FMC A;  1EQV A;  4Y7N H;  3UDX A;  5CGK A;  1C48 A;  2FIN B;  3MWY W;  4L6T B;  1VQP A;  1G8Z D;  3RN5 A;  3JAM L;  1LTA D;  2WKC A;  1JOK A;  1PTO F;  4AYB B;  4DV1 Q;  3G6J B;  1QUQ A;  2F52 A;  3P75 A;  3RLF A;  3BS1 A;  1QE6 A;  2K5H A;  4NXN Q;  3T53 B;  4B3S L;  3SK6 A;  2SNS A;  2K5W A;  1Q12 A;  2UXB L;  1B7Y B;  2B2U A;  2DY8 A;  4AH6 A;  4A3M H;  4JW0 A;  2KCM A;  1NY4 A;  4ILW A;  2V4D A;  3TDQ A;  3LWE A;  3TP7 A;  4XXE A;  1NAP A;  4DUZ Q;  2BA0 A;  1G6Z A;  3A8I E;  3KDF B;  1U9R A;  2XWJ B;  3GTM H;  1IBM Q;  1LAC A;  2OF1 A;  1L0W A;  2KCT A;  1TR5 A;  4HCS A;  1WTQ A;  1MIU A;  2B8G A;  4OGQ C;  1Q1E A;  3CPW A;  1SE3 A;  4U67 3;  2NN6 H;  1XPR A;  4X6A H;  2PZT A;  1KL9 A;  3QWN A;  4LUO A;  1HNZ L;  1HPC A;  1PTO H;  3CU7 A;  2VY3 A;  4ID6 A;  1QB5 D;  3S15 H;  2YU9 B;  3R3O A;  3CCQ A;  5JEA G;  2F0O A;  2YU9 H;  4LF7 L;  4DR6 Q;  1XWE A;  3S15 B;  2A69 C;  2K5D A;  1G29 1;  5E3F A;  1MGS A;  4A3B B;  1CZW A;  3A55 A;  1EY4 A;  2CFM A;  4RA8 A;  3SK4 A;  3HOX G;  1SEB D;  4HED A;  1SSO A;  1TS4 A;  1HZC A;  3QR8 A;  2ATW A;  3W2D A;  2CWP A;  4JYA L;  4MTK A;  5LL6 X;  3ULP A;  1K8G A;  3LNN A;  4XQQ A;  2KEN A;  1IXR A;  4GKJ Q;  1EY5 A;  2J7Z A;  3PF4 A;  3GTM B;  5CV7 A;  5IGD A;  3RZD H;  4XDX A;  4X65 L;  4KD4 A;  3AU7 A;  3QB3 A;  4DV2 L;  2JA6 G;  1VQA A;  5EAY A;  4DR5 L;  1RTN A;  4GKK Q; 
#chains in the Genus database with same CATH homology
 1Q7Y C;  4A3K H;  3FKI G;  5IP9 H;  1Q86 C;  1SN8 A;  1VQ8 A;  3GTK H;  4A3D H;  4B3M Q;  3S1N H;  3KJP A;  1ASY A;  4IJL A;  1O7I A;  3T1H Q;  3HOV H;  1SR3 A;  2KHJ A;  4JI3 L;  4BBR G;  4OX9 L;  5C4X H;  3HOX H;  1C9O A;  2R92 G;  3I4N H;  1HZ9 A;  1VQ9 A;  5C3E G;  1XTD A;  1KIX A;  2Q2U A;  1X3E A;  5IYC G;  4WJ3 M;  4JCV E;  3H3V I;  2MQH A;  3TEH B;  4DV2 Q;  4KI0 A;  1NE3 A;  1K0R A;  4A3I G;  3OYY A;  1WCM H;  1K9M C;  4NXM L;  3DM3 A;  4P73 A;  3CXC A;  5C0X I;  2NZH A;  2EXD A;  4X64 L;  4QQB X;  1JJC B;  2VL6 A;  1Q1B A;  2WP8 J;  4BY1 H;  2D62 A;  5M3F H;  4IPD A;  3S24 A;  1NBW A;  4X62 L;  4B3T L;  4A3B G;  4DAY B;  4JOI A;  2A19 A;  4LF9 L;  1KRS A;  4LFB L;  1WOC A;  3GD7 A;  5H1S E;  4GNX C;  1B70 B;  2UUC L;  3TQY A;  3S16 H;  2JA8 H;  4RG1 A;  2D0O A;  4TVA B;  2I5H A;  4P74 A;  4HJA A;  1VQN A;  2OQK A;  1Y1W G;  1DGS A;  1K83 H;  1PH7 A;  4OXP A;  1D8L A;  5M3M G;  2PI2 E;  2R7D A;  5IYB G;  3CC4 A;  4OX9 Q;  4BY7 H;  1TWA H;  1AE2 A;  3STB C;  2A1A A;  4FDB A;  3PF5 A;  3HOV G;  1HR0 W;  3HOW H;  2KHI A;  3W1B A;  2DUD A;  4DR2 L;  4JI0 L;  2UUB Q;  1BBW A;  3I4M H;  4PZ7 A;  1FVI A;  5FJ8 H;  4DV7 L;  3NBH B;  5BR8 Q;  1XJV A;  5E7N A;  1E22 A;  2E2I H;  1V9P A;  3KF6 A;  2I0Q A;  4DAM A;  3K0X A;  5IYD G;  1VQF A;  5ELO A;  1QVF A;  4HJ8 A;  1GD7 A;  1JE5 A;  1BVS A;  3GTJ H;  3CME A;  2N8N A;  2RF4 A;  4A93 H;  4A3L G;  1Z9F A;  4BBS H;  3HOU G;  4BXX H;  1HR0 L;  2FXQ A;  1CKN B;  4DNI A;  1YEZ A;  1PHJ A;  1YBY A;  4L5T A;  2EIF A;  4YCW A;  3DLL A;  4P75 A;  4A3J G;  1BKB A;  3UE1 A;  1JB7 A;  1VQG A;  4HIM A;  1B8A A;  2OQ0 A;  5C4X G;  4LUV A;  4JI0 Q;  4JI1 L;  1YJN A;  3U4V A;  4LFA L;  4DPG A;  3CQZ H;  4IPH A;  2JA5 G;  3HOY H;  1OXX K;  1VS0 A;  4QJF A;  5GAE C;  5IP7 G;  1UE6 A;  1C0A A;  2JEA I;  2NVT H;  3W5O A;  1AE3 A;  4HIK A;  4A3F H;  3FKI H;  1U0L A;  3TS0 A;  4DR7 L;  1HR0 Q;  4NPS A;  2YTV A;  1WCM G;  3LGJ A;  3UDI A;  4MZ9 A;  3RR5 A;  1G6P A;  3F2D A;  3S2D H;  4AQY Q;  5GAH C;  3G6E A;  1GM5 A;  4JI4 Q;  2ZM6 L;  1A62 A;  1SFO H;  4DV3 Q;  4JI3 Q;  1E7Z A;  2IX0 A;  3L0O A;  1D7Q A;  3J81 j;  3PGZ A;  3E9H A;  4DV4 L;  4LF8 Q;  4DR4 Q;  3B6Y A;  1VQE A;  4PZ6 A;  4UP7 A;  1FL0 A;  4JC0 A;  1I94 Q;  1XMQ Q;  1PH9 A;  4EQ5 A;  2B63 H;  4KHP Q;  3KOJ A;  2UXC L;  2JA9 A;  1Q81 C;  2WAQ E;  1N34 L;  2ZM6 Q;  1S72 A;  5IYB H;  4BY7 G;  1MJE A;  4IO9 A;  2YTX A;  4HJ5 A;  1VQO A;  1CSQ A;  4B3T Q;  3PUV A;  3ICE A;  4L5Q A;  1WYD A;  4LFB Q;  2PI2 A;  3I7F A;  4NXN L;  1VQK A;  3CCE A;  1SRO A;  5GRO A;  4YCV A;  4JI2 L;  3Q8D A;  1KHI A;  2MFI A;  4BY1 G;  2OTL A;  3KF6 B;  4JI6 Q;  3A5U A;  1I5F A;  5M3F G;  1PH1 A;  5J3B A;  2Q2H A;  5IY0 A;  3T1Y Q;  4DKA C;  1PH6 A;  3I56 A;  4WJ4 A;  1PYS B;  1QVC A;  5K36 G;  1S3O A;  5DLQ E;  1K8A C;  2JA8 G;  1QVG A;  5IP7 H;  3H15 A;  4YWL A;  1Q82 C;  1L1O A;  4MNO A;  5LMN W;  1I6H H;  2ZTD A;  1UWV A;  3HFZ B;  1N34 Q;  2IY5 B;  4HJ9 A;  3FP9 A;  4JI5 L;  2RHS B;  1GKH A;  5IP9 G;  5M5Y H;  2ZJQ A;  2KBN A;  5M3M H;  3KDF A;  4DR3 Q;  2Z6K C;  3CCS A;  4OWW B;  3GTL H;  4DK3 C;  4GN5 A;  1YHA A;  2BA1 A;  3G48 A;  4LFA Q;  3EIV A;  2YTY A;  5AJ3 L;  5LMU L;  3BZK A;  3T1Y L;  2E5L L;  1MKH A;  3BJU A;  1EIY B;  4K0K L;  4JBW A;  4LF5 Q;  2PQA A;  4BA1 I;  3K7U C;  3H0G G;  3UE0 A;  1IBL Q;  5HY6 A;  4A3F G;  1IYJ B;  4LUZ A;  2Y0S G;  3KFU A;  4YY3 L;  4JI5 Q;  1HNX Q;  2Y0S E;  2VQE Q;  1Z47 A;  2N3S A;  4DR3 L;  1CSP A;  2R6G A;  4OON A;  2ZTE A;  3S1M H;  3W1G A;  4LF6 Q;  4POG A;  3HOZ H;  3F8T A;  2RCN A;  1VQM A;  1VQD A;  1NMG A;  4IFD G;  2ASB A;  4L5S A;  3CCL A;  4B3R L;  4OO1 I;  1I50 H;  1NTG A;  3CF5 A;  5LMU Q;  4AYB E;  1N32 L;  1PVO A;  3M7N A;  1VQ5 A;  2EQS A;  2VZA A;  4LF9 Q;  5ELN A;  4JV5 Q;  3PUZ A;  4JYA Q;  3S17 H;  4IFD J;  1I3Q H;  1CUK A;  3PSI A;  2YV5 A;  3PO3 G;  1OXU A;  1Y1V H;  4QGU A;  3AFP A;  4ME3 A;  1UEB A;  4PG3 A;  2IHF A;  3ZJY C;  3KJO A;  4GS3 A;  3SGI A;  1PFS A;  3NEL A;  3D0F A;  3U50 C;  1EIF A;  1YJW A;  1IBK Q;  3CC2 A;  3L7Z C;  3I4M G;  1JMC A;  1L1O C;  3GTG H;  5IE8 A;  5C44 H;  5BR8 L;  5C44 G;  1VQ4 A;  2ZTC A;  3AFQ A;  5GAD C;  1XNR Q;  5JEA J;  2WB1 G;  4GNX B;  1HZA A;  4DR2 Q;  3F1Z A;  1YHB A;  5GQO A;  2HT1 A;  1I94 L;  1EYG A;  1HNW Q;  4A3L H;  1QZH A;  1Q8K A;  4L5R C;  4BA2 I;  3STB D;  2ES2 A;  5IYD H;  1OTC A;  4GOP A;  3M9B A;  3EN2 A;  1IBM L;  1VQH A;  1EOV A;  1Y14 B;  4O0A A;  1V43 A;  1TWC H;  2L15 A;  4YWM A;  3RLO A;  1J5E L;  3KLW A;  4JI8 Q;  4UPA A;  2VQF L;  3RN2 A;  2R7Z H;  2R7Z G;  2AKW B;  3MEF A;  5M5W H;  2JK8 A;  1E3P A;  1N8R C;  4Y52 H;  1N9W A;  4YHH Q;  2BH2 A;  3I4N G;  4R4T A;  4JG2 A;  2UUC Q;  1TWF H;  4A3E H;  1P16 A;  1N33 Q;  2R92 H;  1UE5 A;  4DR7 Q;  4A3I H;  1VQC A;  4DV5 L;  1A63 A;  2I5M X;  2N49 A;  1YNX A;  3PV0 A;  1IBK L;  3CCV A;  2JA7 H;  4R1J A;  3WWV A;  4JBM A;  2GVB A;  1L2F A;  3M3Y H;  1TWG H;  4OO1 G;  5M5X H;  2Q2T A;  5FJ8 G;  5JJK A;  1LYL A;  1TXY A;  2E5L Q;  1KC8 C;  1XMO L;  2K52 A;  4DV6 L;  1NJI C;  5FLM H;  2VQF Q;  4YHH L;  4ALP A;  3L2P A;  3CD6 A;  3PO2 H;  4AQY L;  2I5L X;  2UXB Q;  4A3J H;  2HHH Q;  3CP0 A;  3I4O A;  4DV5 Q;  1XPO A;  2VQE L;  4DV0 L;  1YZ6 A;  2BH8 A;  4C3I H;  1YJ9 A;  4C3H H;  1SMX A;  3CPF A;  5GAG C;  1R9T H;  5IT9 c;  3HOZ G;  1PH4 A;  1JT8 A;  3J81 c;  3OTO L;  4LF5 L;  2K14 A;  1HNX L;  2B3G A;  3GDE A;  2NVX H;  3J7A 5;  1N33 L;  1Q46 A;  4QL5 A;  3J81 i;  2K5V A;  1YIJ A;  2E2J H;  3U4Z A;  2F4V Q;  1PH8 A;  3EBE A;  2GVA A;  1U5K A;  4IPG A;  3JAM c;  4DV6 Q;  3A0J A;  2UXD Q;  1E24 A;  1WI5 A;  4IPC A;  1EQQ A;  4R4C A;  3M4P A;  3PUY A;  4JOI C;  4LFC L;  2JJQ A;  4GKK L;  2PMZ E;  4RMF A;  1SLJ A;  4DUY Q;  3PO3 H;  1V1Q A;  3K7A H;  3S14 H;  4GNX A;  2OTJ A;  4A3C H;  4A3C G;  1LM0 A;  1TWH H;  2D0P A;  4GLX A;  4IJH A;  3H0G H;  3S1R H;  1VQ7 A;  4LF4 L;  2JA7 G;  1VQI A;  3D31 A;  3PUX A;  4GLA C;  3J80 c;  1J6Q A;  4UY8 C;  4A3M G;  1ASZ A;  1UE7 A;  1JJ2 A;  4GOP B;  1EFW A;  1HNW L;  4R4I A;  3K81 C;  4DR6 L;  4A3D G;  1A8V A;  1VQ6 A;  2E8G A;  3H3V H;  4JI4 L;  1VQB A;  1S40 A;  1FGU A;  1C7Y A;  5FLX c;  3ER0 A;  2K50 A;  4B3S Q;  2N78 A;  2WFW A;  1EWI A;  4AYB G;  2UUA Q;  2WB1 E;  2CKZ B;  2PNH A;  4H02 A;  4R4O A;  1WFQ A;  1CKM A;  4DV4 Q;  4LF8 L;  1PH5 A;  1X65 A;  3CAM A;  4YY3 Q;  3JAM i;  4OWX B;  3GTO H;  2LSS A;  3CW2 C;  1IL2 A;  3GTQ H;  1MJC A;  2IT1 A;  1IBL L;  1OXS C;  2AHO B;  4YCU A;  1E1O A;  3ULJ A;  2H5X A;  4LFC Q;  1J5E Q;  2QA4 A;  3CMA A;  2ZJR A;  2UU9 L;  3TS2 A;  3S2H H;  3JC6 6;  1QUQ B;  2UUB L;  2CQO A;  2HIX A;  2CCZ A;  4GN3 B;  4JI8 L;  3M4Q A;  2Q2I A;  1XMQ L;  1OXT A;  1M1K C;  3UDF A;  4APV A;  1YVC A;  1PH2 A;  4C2M H;  4DUZ L;  1KQS A;  2DGY A;  5LMN L;  1YHQ A;  3HOU H;  1GO3 E;  4BXX G;  2UUA L;  3CCR A;  1XPU A;  1BBU A;  4A75 A;  1N32 Q;  4X65 Q;  3VDY A;  1AH9 A;  1SE8 A;  2AMC B;  2MO0 A;  3PCO B;  2AWN A;  4GLV B;  3T1H L;  2OWO A;  4B3R Q;  1X3G A;  2MNA A;  4B3M L;  4JI6 L;  4GOP C;  3I2Z A;  1X54 A;  3PUW A;  3F2C A;  2LXK A;  5JJL A;  4JBK A;  4LNQ A;  4JI2 Q;  3OTO Q;  1VQL A;  2NVY H;  1PA6 A;  1RIP A;  1X55 A;  3AYH B;  1HJP A;  2C35 B;  4JV5 L;  5IYC H;  1KRT A;  3HKS A;  3CCU A;  1KXL A;  4JI1 Q;  4QIW E;  5C4J H;  3RZO H;  1WJJ A;  4DK6 C;  4EX5 A;  2NN6 G;  2HHH L;  4BBS G;  3NEM A;  1X6O A;  1P8L A;  3UDG A;  1YIT A;  1UE1 A;  2B29 A;  4GN4 B;  3M4O H;  4A3G H;  3KF8 B;  2AWO A;  4JI7 L;  4A4I A;  5IWA L;  3HKZ G;  3PO2 G;  4IFD I;  2JEB I;  1RL2 A;  5LMN Q;  4LF4 Q;  1NMF A;  2UXD L;  4LWC A;  3CCM A;  4HID A;  4P72 A;  4X66 Q;  2K4K A;  1PH3 A;  2NN6 I;  3E9I A;  2VUM G;  2K5N A;  2XGT A;  2VW9 A;  4YWK A;  1XNQ Q;  4NB3 A;  4Y7N H;  3UDX A;  4DV1 L;  4IOC A;  4P71 A;  1FJG L;  2JE6 I;  2YYZ A;  2Z0S A;  4PZ8 A;  4DV7 Q;  2RHQ B;  1EUJ A;  3G71 A;  3ULL A;  4DV3 L;  4DR4 L;  2MO1 A;  1N36 Q;  4TQU S;  3FHW A;  5AJ3 Q;  1VQP A;  2IX1 A;  1PV4 A;  1GVP A;  1YI2 A;  3RN5 A;  4BBR H;  1SRU A;  4C3J H;  4JI7 Q;  4KLK A;  5HGQ A;  4KHP L;  2UXC Q;  2Z6K A;  1A0I A;  3IRB A;  4A76 A;  1JJG A;  4DV1 Q;  1KD1 C;  2QEX A;  4A3B H;  1QUQ A;  2F52 A;  3RLF A;  2V1C C;  5C0X G;  1E1T A;  2K5H A;  1M90 C;  4NXN Q;  4MTN A;  4QY7 A;  4B3S L;  2VS1 A;  2IHE A;  1Q12 A;  2ID0 A;  1B7Y B;  2UXB L;  4AH6 A;  4A3M H;  2CWA A;  3K80 C;  1N36 L;  1XNR L;  2KCM A;  1NY4 A;  2A8V A;  4PMW A;  2F3I A;  2JA5 H;  3G4S A;  1L1O B;  1K3R A;  4HIO A;  2JA6 H;  3M85 A;  4XIG S;  2LXJ A;  4DUZ Q;  1IZ6 A;  1G51 A;  1W3S A;  2BA0 A;  4AIM A;  1HNZ Q;  3KDF B;  4KHZ A;  2R7F A;  1QZG A;  4X64 Q;  3BU2 A;  3GTM H;  2QGQ A;  2VNU D;  1X3F A;  3NEN A;  4A3K G;  1IBM Q;  1L0W A;  1Y1V G;  2KCT A;  4JBJ A;  4DR1 L;  1X9N A;  4LF7 Q;  2R93 G;  1VCI A;  2NVQ H;  1MIU A;  4DUY L;  2OCE A;  1Q1E A;  3CPW A;  3RNU A;  2F4V L;  3GTP H;  5C3E H;  3CCJ A;  4X6A H;  1XPR A;  1PYB A;  2PQA B;  3J7Z C;  1KL9 A;  3AEV A;  4LUO A;  1K73 C;  1LUZ A;  4LW1 A;  3PIP A;  5JJI A;  1HH2 P;  1EQR A;  2VUM H;  3A74 A;  1HZB A;  1HNZ L;  4R4Q A;  1OXV A;  4POF A;  3RLN A;  3KYH C;  4UP9 A;  4XTC S;  2VY3 A;  3F2B A;  3OW2 A;  1W2B A;  2E2H H;  3TRZ A;  3K8A A;  3PIO A;  4DR5 Q;  2HQL A;  3S15 H;  2JQO A;  4A3G G;  1LTL A;  3U58 A;  3CCQ A;  3HOY G;  5JEA G;  4K0K Q;  2YU9 H;  4LF7 L;  4DR6 Q;  3TRE A;  5IWA Q;  4GKJ L;  3BZC A;  3S1Q H;  1G29 1;  4HJ7 A;  2WAQ G;  2GN5 A;  4UP8 A;  3A5Z B;  1Y1W H;  4DR1 Q;  1FJG Q;  2CFM A;  3HOX G;  1CKO A;  4J15 A;  1XNQ L;  4IOA A;  2R93 H;  4A3E G;  4LF6 L;  1X56 A;  5C0X J;  3I55 A;  2K75 A;  4DV0 Q;  2HIV A;  4X66 L;  4A93 G;  1KAW A;  1HZC A;  3J80 i;  2ATW A;  2CWP A;  2UU9 Q;  4JYA L;  1T9H A;  3E0E A;  3HOW G;  4OWT B;  3GO5 A;  3ULP A;  1K8G A;  2KEN A;  1IXR A;  2NZO A;  1XMO Q;  4GKJ Q;  1H95 A;  3PF4 A;  4X62 Q;  3CC7 A;  3RZD H;  4X65 L;  4NXM Q;  1CKN A;  5FLM G;  4O2D A;  3AQQ A;  4DV2 L;  2B63 G;  1VQA A;  5EAY A;  2JA6 G;  4DR5 L;  2ZJP A;  3HKZ E;  3ERS X;  3MXN B;  2ALY B;  1VQJ A;  4GKK Q;  2XTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...