4QYJA

Structure of phenylacetaldehyde dehydrogenase from pseudomonas putida s12
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
481
structure length
481
Chain Sequence
b'QMLIGGQWVSAQSGKTLNVYNPATGDILTEVPDGDVEDVNAAVESAAATLRSDTWRRMPPSARERILLRLADLLEVHGDELARLETLNNGKLLIYSKLMEVGASAQWLRYMAGWATKLTGSTLDLSLPLPPEVRSRASTQRVPVGVVAAIIPWNFPLLMAVWKIAPALACGNTVVLKPAEETPLTALRLAELAMEAGLPAGALNVVTGRGETAGDALVRHPKVAKVAFTGSTEVGRIIGSACGRSLKAVSLELGGKSPVIVLADCDPQEAAEGAAAAIFFNHGQVCTAGSRLYVHESIYEDVIQRLAVIGESIVVGSGLEQGVHMGPMVSKKHHENVLRHIRNGIEDGADLICGGTEAPCAQGFFVKPTIFANREKKDIRLLSQEVFGPVLVATPFSDIAEVVNEANRSVYGLGASIWTNDLSAALRINDELEAGTVWVNTHNMVDPNLPFGGFKDSGVGREHGAAAIEHYTTTRSLVIAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldehyde dehydrogenase
publication title Structure and biochemistry of phenylacetaldehyde dehydrogenase from the Pseudomonas putida S12 styrene catabolic pathway.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 131
structure length 481
sequence length 481
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4qyjA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4qyjA01
4QJEB 4LH0A 4LH2A 5DBVA 3ZQAA 4PXLB 1T90A 4QJEA 5J78A 1UXUA 3JZ4A 3VZ1A 2QE0A 2EUHA 4PXLA 1O02A 4I1WA 3IWKA 3RHMA 2EIWA 4L2OA 4ZVXA 5ABMA 4I3UA 3I44A 3RHRA 3RHPA 1NZZA 1UXTA 2Y5DA 1WNDA 2O2QA 3JU8A 4I26A 4I2RA 4IDSA 4NU9A 4CBBA 1O01A 2W8NA 4GO3A 4IYMA 4O5HA 5L2OA 1WNBA 4V37A 4IDMA 3ROSA 1NZWA 4PXNA 1BPWA 3ETFA 2EJDA 2IY6A 4I9BA 4LH1A 3U4JA 4CAZA 2Y53A 5A2DC 2W8RA 4GO0A 3RHDA 3RHJA 4I3VA 4NPIA 3B4WA 5EXFA 4X2QA 3RJLA 2Y51A 5KLKA 4V3FC 4JZ6A 4ZVWA 3EK1A 2BHQA 4I8QA 3EFVA 4ZULA 4QN2A 3VZ2A 1QI1A 4DNGA 4ZVYA 2EITA 3N83A 1UXNA 4I3XA 3V4CA 5KF0A 2EJ6A 3R64A 4OHTA 3SZAA 5A2DA 2ONMA 4H80A 1QI6A 4MPYA 4QTOA 1NZXA 2XDRA 3V9LA 2VROA 4C3SA 5KLMA 1CW3A 4IT9A 4V3FA 1O04A 3V9JA 3MY7A 3V9KA 2H5GA 3V9HA 4ZZ7A 4OE6A 2W8QA 4DALA 3RHQA 1AG8A 2ONPA 4X0TA 4WPNA 2IMPA 2ONNA 2ONOA 4ITBA 4E4GA 4WB9A 5AC1A 5J6BA 3K9DA 1UZBA 2JG7A 5AC2A 4X0UA 3RHHA 1O9JA 5L13A 3IWJA 4KNAA 4ZUKA 1UXQA 2WMEC 4O6RA 2EHQA 3N81A 4JBEA 4I8PA 4Q92A 1A4ZA 4A0MA 3TY7A 4F3XA 4I3TA 4FR8A 2HG2A 4I25A 3VZ0A 3PRLA 4YWUA 2BJAA 2BJKA 5DRUA 3R31A 1O20A 4FQFA 4IHIA 4X4LA 3VZ3A 1EZ0A 2ILUA 2J6LA 4KWGA 4QGKA 5F2CA 4GNZA 1BI9A 4ITAA 2EJLA 2WMEA 3PQAA 4ZXUA 3N80A 4E3XA 4WP7A 2O2PA 5A2DD 4NEAA 5EKCA 5AC0A 5JRYA 3SZBA 2BHPA 5KLLA 4MPBA 3RHLA 1AD3A 5EUYA 4YWVA 4OU2A 2VLEA 1EYYA 2ESDA 5KJ5A 4H7NA 5J7IA 2WOXA 5KLOA 4LH3A 4PZ2A 4ZWLA 5KLNA 3K2WA 2EHUA 4I3WA 3SZ9A 3V9IA 5FHZA 3INLA 4LIHA 1ZUMA 5EK6A 5EZ4A 3N82A 5DIBA 4YWEA 1KY8A 4JDCA 5EEBA 4NS3A 4OGDA 5L2NA 1VLUA 4QETA 3RH9A 1UXPA 1UXRA 1UXVA 3QANA 4L1OA 4OE2A 4NMJA 4OE4A 1O00A 2J40A 3V9GA 1EUHA 4QF6A 4K57A 2OPXA 2ID2A 2W8PA 4KWFA 4NMKA 4OE5A 4U3WA 3RHOA 2Y52A 4LEMA 4OUBA 4WJ9A 2W8OA 3INJA 4QYJA 5L2MA 4H73A 5EYUA 1BXSA 1A4SA 1O05A 4GHKA 4LGZA 2O2RA 2D4EA 2EIIA 2J5NA 4GO4A 4GO2A
chains in the Genus database with same CATH superfamily
4QJEB 4LH0A 4LH2A 5DBVA 3ZQAA 4PXLB 1T90A 4QJEA 5J78A 1UXUA 3JZ4A 3VZ1A 2QE0A 2EUHA 4PXLA 1O02A 4I1WA 3IWKA 3RHMA 2EIWA 4L2OA 4ZVXA 5ABMA 4I3UA 3I44A 3RHRA 3RHPA 1NZZA 1UXTA 2Y5DA 1WNDA 2O2QA 3JU8A 4I26A 4I2RA 4IDSA 4NU9A 4CBBA 1O01A 2W8NA 4GO3A 4IYMA 4O5HA 5L2OA 1WNBA 4V37A 4IDMA 3ROSA 1NZWA 4PXNA 1BPWA 3ETFA 2EJDA 2IY6A 4I9BA 4LH1A 3U4JA 4CAZA 2Y53A 5A2DC 2W8RA 4GO0A 3RHDA 3RHJA 4I3VA 4NPIA 3B4WA 5EXFA 4X2QA 3RJLA 2Y51A 5KLKA 4V3FC 4JZ6A 4ZVWA 3EK1A 2BHQA 4I8QA 3EFVA 4ZULA 4QN2A 3VZ2A 1QI1A 4DNGA 4ZVYA 2EITA 3N83A 1UXNA 4I3XA 3V4CA 5KF0A 2EJ6A 3R64A 4OHTA 3SZAA 5A2DA 2ONMA 4H80A 1QI6A 4MPYA 4QTOA 1NZXA 2XDRA 3V9LA 2VROA 4C3SA 5KLMA 1CW3A 4IT9A 4V3FA 1O04A 3V9JA 3MY7A 3V9KA 2H5GA 3V9HA 4ZZ7A 4OE6A 2W8QA 4DALA 3RHQA 1AG8A 2ONPA 4X0TA 4WPNA 2IMPA 2ONNA 2ONOA 4ITBA 4E4GA 4WB9A 5AC1A 5J6BA 3K9DA 1UZBA 2JG7A 5AC2A 4X0UA 3RHHA 1O9JA 5L13A 3IWJA 4KNAA 4ZUKA 1UXQA 2WMEC 4O6RA 2EHQA 3N81A 4JBEA 4I8PA 4Q92A 1A4ZA 4A0MA 3TY7A 4F3XA 4I3TA 4FR8A 2HG2A 4I25A 3VZ0A 3PRLA 4YWUA 2BJAA 2BJKA 5DRUA 3R31A 1O20A 4FQFA 4IHIA 4X4LA 3VZ3A 1EZ0A 2ILUA 2J6LA 4KWGA 4QGKA 5F2CA 4GNZA 1BI9A 4ITAA 2EJLA 2WMEA 3PQAA 4ZXUA 3N80A 4E3XA 4WP7A 2O2PA 5A2DD 4NEAA 5EKCA 5AC0A 5JRYA 3SZBA 2BHPA 5KLLA 4MPBA 3RHLA 1AD3A 5EUYA 4YWVA 4OU2A 2VLEA 1EYYA 2ESDA 5KJ5A 4H7NA 5J7IA 2WOXA 5KLOA 4LH3A 4PZ2A 4ZWLA 5KLNA 3K2WA 2EHUA 4I3WA 3SZ9A 3V9IA 5FHZA 3INLA 4LIHA 1ZUMA 5EK6A 5EZ4A 3N82A 5DIBA 4YWEA 1KY8A 4JDCA 5EEBA 4NS3A 4OGDA 5L2NA 1VLUA 4QETA 3RH9A 1UXPA 1UXRA 1UXVA 3QANA 4L1OA 4OE2A 4NMJA 4OE4A 1O00A 2J40A 3V9GA 1EUHA 4QF6A 4K57A 2OPXA 2ID2A 2W8PA 4KWFA 4NMKA 4OE5A 4U3WA 3RHOA 2Y52A 4LEMA 4OUBA 4WJ9A 2W8OA 3INJA 4QYJA 5L2MA 4H73A 5EYUA 1BXSA 1A4SA 1O05A 4GHKA 4LGZA 2O2RA 2D4EA 2EIIA 2J5NA 4GO4A 4GO2A
chains in the Genus database with same CATH topology
4QJEB 4LH0A 4LH2A 5DBVA 3ZQAA 4PXLB 1T90A 4QJEA 5J78A 1UXUA 3JZ4A 3VZ1A 2QE0A 2EUHA 4PXLA 1O02A 4I1WA 3IWKA 3RHMA 2EIWA 4L2OA 4ZVXA 5ABMA 4I3UA 3I44A 3RHRA 3RHPA 1NZZA 1UXTA 2Y5DA 1WNDA 2O2QA 3JU8A 4I26A 4I2RA 4IDSA 4NU9A 4CBBA 1O01A 2W8NA 4GO3A 4IYMA 4O5HA 5L2OA 1WNBA 4V37A 4IDMA 3ROSA 1NZWA 4PXNA 1BPWA 3ETFA 2EJDA 2IY6A 4I9BA 4LH1A 3U4JA 4CAZA 2Y53A 5A2DC 2W8RA 4GO0A 3RHDA 3RHJA 4I3VA 4NPIA 3B4WA 5EXFA 4X2QA 3RJLA 2Y51A 5KLKA 4V3FC 4JZ6A 4ZVWA 3EK1A 2BHQA 4I8QA 3EFVA 4ZULA 4QN2A 3VZ2A 1QI1A 4DNGA 4ZVYA 2EITA 3N83A 1UXNA 4I3XA 3V4CA 5KF0A 2EJ6A 3R64A 4OHTA 3SZAA 5A2DA 2ONMA 4H80A 1QI6A 4MPYA 4QTOA 1NZXA 2XDRA 3V9LA 2VROA 4C3SA 5KLMA 1CW3A 4IT9A 4V3FA 1O04A 3V9JA 3MY7A 3V9KA 2H5GA 3V9HA 4ZZ7A 4OE6A 2W8QA 4DALA 3RHQA 1AG8A 2ONPA 4X0TA 4WPNA 2IMPA 2ONNA 2ONOA 4ITBA 4E4GA 4WB9A 5AC1A 5J6BA 3K9DA 1UZBA 2JG7A 5AC2A 4X0UA 3RHHA 1O9JA 5L13A 3IWJA 4KNAA 4ZUKA 1UXQA 2WMEC 4O6RA 2EHQA 3N81A 4JBEA 4I8PA 4Q92A 1A4ZA 4A0MA 3TY7A 4F3XA 4I3TA 4FR8A 2HG2A 4I25A 3VZ0A 3PRLA 4YWUA 2BJAA 2BJKA 5DRUA 3R31A 1O20A 4FQFA 4IHIA 4X4LA 3VZ3A 1EZ0A 2ILUA 2J6LA 4KWGA 4QGKA 5F2CA 4GNZA 1BI9A 4ITAA 2EJLA 2WMEA 3PQAA 4ZXUA 3N80A 4E3XA 4WP7A 2O2PA 5A2DD 4NEAA 5EKCA 5AC0A 5JRYA 3SZBA 2BHPA 5KLLA 4MPBA 3RHLA 1AD3A 5EUYA 4YWVA 4OU2A 2VLEA 1EYYA 2ESDA 5KJ5A 4H7NA 5J7IA 2WOXA 5KLOA 4LH3A 4PZ2A 4ZWLA 5KLNA 3K2WA 2EHUA 4I3WA 3SZ9A 3V9IA 5FHZA 3INLA 4LIHA 1ZUMA 5EK6A 5EZ4A 3N82A 5DIBA 4YWEA 1KY8A 4JDCA 5EEBA 4NS3A 4OGDA 5L2NA 1VLUA 4QETA 3RH9A 1UXPA 1UXRA 1UXVA 3QANA 4L1OA 4OE2A 4NMJA 4OE4A 1O00A 2J40A 3V9GA 1EUHA 4QF6A 4K57A 2OPXA 2ID2A 2W8PA 4KWFA 4NMKA 4OE5A 4U3WA 3RHOA 2Y52A 4LEMA 4OUBA 4WJ9A 2W8OA 3INJA 4QYJA 5L2MA 4H73A 5EYUA 1BXSA 1A4SA 1O05A 4GHKA 4LGZA 2O2RA 2D4EA 2EIIA 2J5NA 4GO4A 4GO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJE B;  4LH0 A;  4LH2 A;  5DBV A;  3ZQA A;  4PXL B;  1T90 A;  4QJE A;  5J78 A;  1UXU A;  3JZ4 A;  3VZ1 A;  2QE0 A;  2EUH A;  4PXL A;  1O02 A;  4I1W A;  3IWK A;  3RHM A;  2EIW A;  4L2O A;  4ZVX A;  5ABM A;  4I3U A;  3I44 A;  3RHR A;  3RHP A;  1NZZ A;  1UXT A;  2Y5D A;  1WND A;  2O2Q A;  3JU8 A;  4I26 A;  4I2R A;  4IDS A;  4NU9 A;  4CBB A;  1O01 A;  2W8N A;  4GO3 A;  4IYM A;  4O5H A;  5L2O A;  1WNB A;  4V37 A;  4IDM A;  3ROS A;  1NZW A;  4PXN A;  1BPW A;  3ETF A;  2EJD A;  2IY6 A;  4I9B A;  4LH1 A;  3U4J A;  4CAZ A;  2Y53 A;  5A2D C;  2W8R A;  4GO0 A;  3RHD A;  3RHJ A;  4I3V A;  4NPI A;  3B4W A;  5EXF A;  4X2Q A;  3RJL A;  2Y51 A;  5KLK A;  4V3F C;  4JZ6 A;  4ZVW A;  3EK1 A;  2BHQ A;  4I8Q A;  3EFV A;  4ZUL A;  4QN2 A;  3VZ2 A;  1QI1 A;  4DNG A;  4ZVY A;  2EIT A;  3N83 A;  1UXN A;  4I3X A;  3V4C A;  5KF0 A;  2EJ6 A;  3R64 A;  4OHT A;  3SZA A;  5A2D A;  2ONM A;  4H80 A;  1QI6 A;  4MPY A;  4QTO A;  1NZX A;  2XDR A;  3V9L A;  2VRO A;  4C3S A;  5KLM A;  1CW3 A;  4IT9 A;  4V3F A;  1O04 A;  3V9J A;  3MY7 A;  3V9K A;  2H5G A;  3V9H A;  4ZZ7 A;  4OE6 A;  2W8Q A;  4DAL A;  3RHQ A;  1AG8 A;  2ONP A;  4X0T A;  4WPN A;  2IMP A;  2ONN A;  2ONO A;  4ITB A;  4E4G A;  4WB9 A;  5AC1 A;  5J6B A;  3K9D A;  1UZB A;  2JG7 A;  5AC2 A;  4X0U A;  3RHH A;  1O9J A;  5L13 A;  3IWJ A;  4KNA A;  4ZUK A;  1UXQ A;  2WME C;  4O6R A;  2EHQ A;  3N81 A;  4JBE A;  4I8P A;  4Q92 A;  1A4Z A;  4A0M A;  3TY7 A;  4F3X A;  4I3T A;  4FR8 A;  2HG2 A;  4I25 A;  3VZ0 A;  3PRL A;  4YWU A;  2BJA A;  2BJK A;  5DRU A;  3R31 A;  1O20 A;  4FQF A;  4IHI A;  4X4L A;  3VZ3 A;  1EZ0 A;  2ILU A;  2J6L A;  4KWG A;  4QGK A;  5F2C A;  4GNZ A;  1BI9 A;  4ITA A;  2EJL A;  2WME A;  3PQA A;  4ZXU A;  3N80 A;  4E3X A;  4WP7 A;  2O2P A;  5A2D D;  4NEA A;  5EKC A;  5AC0 A;  5JRY A;  3SZB A;  2BHP A;  5KLL A;  4MPB A;  3RHL A;  1AD3 A;  5EUY A;  4YWV A;  4OU2 A;  2VLE A;  1EYY A;  2ESD A;  5KJ5 A;  4H7N A;  5J7I A;  2WOX A;  5KLO A;  4LH3 A;  4PZ2 A;  4ZWL A;  5KLN A;  3K2W A;  2EHU A;  4I3W A;  3SZ9 A;  3V9I A;  5FHZ A;  3INL A;  4LIH A;  1ZUM A;  5EK6 A;  5EZ4 A;  3N82 A;  5DIB A;  4YWE A;  1KY8 A;  4JDC A;  5EEB A;  4NS3 A;  4OGD A;  5L2N A;  1VLU A;  4QET A;  3RH9 A;  1UXP A;  1UXR A;  1UXV A;  3QAN A;  4L1O A;  4OE2 A;  4NMJ A;  4OE4 A;  1O00 A;  2J40 A;  3V9G A;  1EUH A;  4QF6 A;  4K57 A;  2OPX A;  2ID2 A;  2W8P A;  4KWF A;  4NMK A;  4OE5 A;  4U3W A;  3RHO A;  2Y52 A;  4LEM A;  4OUB A;  4WJ9 A;  2W8O A;  3INJ A;  4QYJ A;  5L2M A;  4H73 A;  5EYU A;  1BXS A;  1A4S A;  1O05 A;  4GHK A;  4LGZ A;  2O2R A;  2D4E A;  2EII A;  2J5N A;  4GO4 A;  4GO2 A; 
#chains in the Genus database with same CATH topology
 4QJE B;  4LH0 A;  4LH2 A;  5DBV A;  3ZQA A;  4PXL B;  1T90 A;  4QJE A;  5J78 A;  1UXU A;  3JZ4 A;  3VZ1 A;  2QE0 A;  2EUH A;  4PXL A;  1O02 A;  4I1W A;  3IWK A;  3RHM A;  2EIW A;  4L2O A;  4ZVX A;  5ABM A;  4I3U A;  3I44 A;  3RHR A;  3RHP A;  1NZZ A;  1UXT A;  2Y5D A;  1WND A;  2O2Q A;  3JU8 A;  4I26 A;  4I2R A;  4IDS A;  4NU9 A;  4CBB A;  1O01 A;  2W8N A;  4GO3 A;  4IYM A;  4O5H A;  5L2O A;  1WNB A;  4V37 A;  4IDM A;  3ROS A;  1NZW A;  4PXN A;  1BPW A;  3ETF A;  2EJD A;  2IY6 A;  4I9B A;  4LH1 A;  3U4J A;  4CAZ A;  2Y53 A;  5A2D C;  2W8R A;  4GO0 A;  3RHD A;  3RHJ A;  4I3V A;  4NPI A;  3B4W A;  5EXF A;  4X2Q A;  3RJL A;  2Y51 A;  5KLK A;  4V3F C;  4JZ6 A;  4ZVW A;  3EK1 A;  2BHQ A;  4I8Q A;  3EFV A;  4ZUL A;  4QN2 A;  3VZ2 A;  1QI1 A;  4DNG A;  4ZVY A;  2EIT A;  3N83 A;  1UXN A;  4I3X A;  3V4C A;  5KF0 A;  2EJ6 A;  3R64 A;  4OHT A;  3SZA A;  5A2D A;  2ONM A;  4H80 A;  1QI6 A;  4MPY A;  4QTO A;  1NZX A;  2XDR A;  3V9L A;  2VRO A;  4C3S A;  5KLM A;  1CW3 A;  4IT9 A;  4V3F A;  1O04 A;  3V9J A;  3MY7 A;  3V9K A;  2H5G A;  3V9H A;  4ZZ7 A;  4OE6 A;  2W8Q A;  4DAL A;  3RHQ A;  1AG8 A;  2ONP A;  4X0T A;  4WPN A;  2IMP A;  2ONN A;  2ONO A;  4ITB A;  4E4G A;  4WB9 A;  5AC1 A;  5J6B A;  3K9D A;  1UZB A;  2JG7 A;  5AC2 A;  4X0U A;  3RHH A;  1O9J A;  5L13 A;  3IWJ A;  4KNA A;  4ZUK A;  1UXQ A;  2WME C;  4O6R A;  2EHQ A;  3N81 A;  4JBE A;  4I8P A;  4Q92 A;  1A4Z A;  4A0M A;  3TY7 A;  4F3X A;  4I3T A;  4FR8 A;  2HG2 A;  4I25 A;  3VZ0 A;  3PRL A;  4YWU A;  2BJA A;  2BJK A;  5DRU A;  3R31 A;  1O20 A;  4FQF A;  4IHI A;  4X4L A;  3VZ3 A;  1EZ0 A;  2ILU A;  2J6L A;  4KWG A;  4QGK A;  5F2C A;  4GNZ A;  1BI9 A;  4ITA A;  2EJL A;  2WME A;  3PQA A;  4ZXU A;  3N80 A;  4E3X A;  4WP7 A;  2O2P A;  5A2D D;  4NEA A;  5EKC A;  5AC0 A;  5JRY A;  3SZB A;  2BHP A;  5KLL A;  4MPB A;  3RHL A;  1AD3 A;  5EUY A;  4YWV A;  4OU2 A;  2VLE A;  1EYY A;  2ESD A;  5KJ5 A;  4H7N A;  5J7I A;  2WOX A;  5KLO A;  4LH3 A;  4PZ2 A;  4ZWL A;  5KLN A;  3K2W A;  2EHU A;  4I3W A;  3SZ9 A;  3V9I A;  5FHZ A;  3INL A;  4LIH A;  1ZUM A;  5EK6 A;  5EZ4 A;  3N82 A;  5DIB A;  4YWE A;  1KY8 A;  4JDC A;  5EEB A;  4NS3 A;  4OGD A;  5L2N A;  1VLU A;  4QET A;  3RH9 A;  1UXP A;  1UXR A;  1UXV A;  3QAN A;  4L1O A;  4OE2 A;  4NMJ A;  4OE4 A;  1O00 A;  2J40 A;  3V9G A;  1EUH A;  4QF6 A;  4K57 A;  2OPX A;  2ID2 A;  2W8P A;  4KWF A;  4NMK A;  4OE5 A;  4U3W A;  3RHO A;  2Y52 A;  4LEM A;  4OUB A;  4WJ9 A;  2W8O A;  3INJ A;  4QYJ A;  5L2M A;  4H73 A;  5EYU A;  1BXS A;  1A4S A;  1O05 A;  4GHK A;  4LGZ A;  2O2R A;  2D4E A;  2EII A;  2J5N A;  4GO4 A;  4GO2 A; 
#chains in the Genus database with same CATH homology
 4QJE B;  4LH0 A;  4LH2 A;  5DBV A;  3ZQA A;  4PXL B;  1T90 A;  4QJE A;  5J78 A;  1UXU A;  3JZ4 A;  3VZ1 A;  2QE0 A;  2EUH A;  4PXL A;  1O02 A;  4I1W A;  3IWK A;  3RHM A;  2EIW A;  4L2O A;  4ZVX A;  5ABM A;  4I3U A;  3I44 A;  3RHR A;  3RHP A;  1NZZ A;  1UXT A;  2Y5D A;  1WND A;  2O2Q A;  3JU8 A;  4I26 A;  4I2R A;  4IDS A;  4NU9 A;  4CBB A;  1O01 A;  2W8N A;  4GO3 A;  4IYM A;  4O5H A;  5L2O A;  1WNB A;  4V37 A;  4IDM A;  3ROS A;  1NZW A;  4PXN A;  1BPW A;  3ETF A;  2EJD A;  2IY6 A;  4I9B A;  4LH1 A;  3U4J A;  4CAZ A;  2Y53 A;  5A2D C;  2W8R A;  4GO0 A;  3RHD A;  3RHJ A;  4I3V A;  4NPI A;  3B4W A;  5EXF A;  4X2Q A;  3RJL A;  2Y51 A;  5KLK A;  4V3F C;  4JZ6 A;  4ZVW A;  3EK1 A;  2BHQ A;  4I8Q A;  3EFV A;  4ZUL A;  4QN2 A;  3VZ2 A;  1QI1 A;  4DNG A;  4ZVY A;  2EIT A;  3N83 A;  1UXN A;  4I3X A;  3V4C A;  5KF0 A;  2EJ6 A;  3R64 A;  4OHT A;  3SZA A;  5A2D A;  2ONM A;  4H80 A;  1QI6 A;  4MPY A;  4QTO A;  1NZX A;  2XDR A;  3V9L A;  2VRO A;  4C3S A;  5KLM A;  1CW3 A;  4IT9 A;  4V3F A;  1O04 A;  3V9J A;  3MY7 A;  3V9K A;  2H5G A;  3V9H A;  4ZZ7 A;  4OE6 A;  2W8Q A;  4DAL A;  3RHQ A;  1AG8 A;  2ONP A;  4X0T A;  4WPN A;  2IMP A;  2ONN A;  2ONO A;  4ITB A;  4E4G A;  4WB9 A;  5AC1 A;  5J6B A;  3K9D A;  1UZB A;  2JG7 A;  5AC2 A;  4X0U A;  3RHH A;  1O9J A;  5L13 A;  3IWJ A;  4KNA A;  4ZUK A;  1UXQ A;  2WME C;  4O6R A;  2EHQ A;  3N81 A;  4JBE A;  4I8P A;  4Q92 A;  1A4Z A;  4A0M A;  3TY7 A;  4F3X A;  4I3T A;  4FR8 A;  2HG2 A;  4I25 A;  3VZ0 A;  3PRL A;  4YWU A;  2BJA A;  2BJK A;  5DRU A;  3R31 A;  1O20 A;  4FQF A;  4IHI A;  4X4L A;  3VZ3 A;  1EZ0 A;  2ILU A;  2J6L A;  4KWG A;  4QGK A;  5F2C A;  4GNZ A;  1BI9 A;  4ITA A;  2EJL A;  2WME A;  3PQA A;  4ZXU A;  3N80 A;  4E3X A;  4WP7 A;  2O2P A;  5A2D D;  4NEA A;  5EKC A;  5AC0 A;  5JRY A;  3SZB A;  2BHP A;  5KLL A;  4MPB A;  3RHL A;  1AD3 A;  5EUY A;  4YWV A;  4OU2 A;  2VLE A;  1EYY A;  2ESD A;  5KJ5 A;  4H7N A;  5J7I A;  2WOX A;  5KLO A;  4LH3 A;  4PZ2 A;  4ZWL A;  5KLN A;  3K2W A;  2EHU A;  4I3W A;  3SZ9 A;  3V9I A;  5FHZ A;  3INL A;  4LIH A;  1ZUM A;  5EK6 A;  5EZ4 A;  3N82 A;  5DIB A;  4YWE A;  1KY8 A;  4JDC A;  5EEB A;  4NS3 A;  4OGD A;  5L2N A;  1VLU A;  4QET A;  3RH9 A;  1UXP A;  1UXR A;  1UXV A;  3QAN A;  4L1O A;  4OE2 A;  4NMJ A;  4OE4 A;  1O00 A;  2J40 A;  3V9G A;  1EUH A;  4QF6 A;  4K57 A;  2OPX A;  2ID2 A;  2W8P A;  4KWF A;  4NMK A;  4OE5 A;  4U3W A;  3RHO A;  2Y52 A;  4LEM A;  4OUB A;  4WJ9 A;  2W8O A;  3INJ A;  4QYJ A;  5L2M A;  4H73 A;  5EYU A;  1BXS A;  1A4S A;  1O05 A;  4GHK A;  4LGZ A;  2O2R A;  2D4E A;  2EII A;  2J5N A;  4GO4 A;  4GO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...