4QYZJ

Crystal structure of a crispr rna-guided surveillance complex, cascade, bound to a ssdna target
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
195
Chain Sequence
MRSYLILRLAGPMQAWGQPTGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSESVQFAVRCDELILRRVSVTGLRDYHTVLIQTWREYLCDASFTVALWLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQPQKALLNYEPVGGDIYSEESVHLKFTARDEPMITLPRQFASREWYVIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/dna/rna
total genus 38
structure length 195
sequence length 219
ec nomenclature
pdb deposition date 2014-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qyzJ00
4F3MA 4QYZJ 3VZHA 4N77A 4U7UK 3KG4A 3VZIA 4R0JA 5H9FJ 5CD4H 5H9EJ
chains in the Genus database with same CATH superfamily
1N36F 1DTTB 4ECUA 2MKYA 4ECVA 2BJ8A 2G1HA 3QJJA 2CUYA 3HVRA 1ROFA 1EZZB 3DRXA 4DPTA 4XPCA 2AQ4A 1V3RA 3A4TA 1C2PA 1XERA 3PEHA 1YZ6A 1TKDA 1UVMA 4JB8B 5GAGU 4R5PA 2WB4A 1PJ6A 1T7PA 1JIHA 4LF9J 5DG7A 2GMLA 2VPWB 1EIYB 1E6VB 2OGUA 4RZRA 2QL9B 2CZ9A 4KFBB 3R7BB 2H54B 3D3CJ 2COLA 2UUCF 3T5KA 3QRRA 4ZHRB 1XNQJ 1NSPA 2CNOB 2HLUA 2OPQB 3A8IA 1HFEL 4ZPVR 4G6VB 2VDHA 1NK4A 1XMOJ 2RHSB 1SV5B 4K4VA 2YKNA 1SJRA 1C1CA 1JLQB 4V19J 5KFZA 3QT8A 4HKQA 1NK9A 3C46A 2DHGA 3A3NB 2CPJA 1K73T 4LSLB 1R43A 2P5VA 1HMVB 2W4DA 3I6PA 1KKHA 5KFWA 2ZOMA 2ATCB 2EFVA 3JSRA 3DU5A 4C0BA 3TZXA 2VKRA 5E3RA 1S10A 5C25B 3VV2B 3N5FA 4M5LA 2HBZB 1BLUA 2F4FA 2YXLA 2LQBA 1XC9A 3P45B 1TKTA 4CWBA 4I1TA 1V5VA 4KBIA 5H9EK 3DDIA 3MM9A 5KT5A 4GC6A 4C7QA 1BD6A 1Y3JA 3W5YA 4R8UA 2QG9B 1N32F 2E5HA 2O3DA 1K44A 2B56A 2XM3A 3AH6A 2CQIA 5IM0A 5KG4A 1RE1B 4F3OA 4E0DA 1AYEA 1L3SA 2WSCC 2CVEA 2WOMB 2CQ4A 5KFHA 3G8QA 3MMAB 2XCPA 4AT1B 2QJ3A 5D0HA 4UUXA 4CLUA 4OYBA 3QFHA 2RT3A 1TL4A 4IH6A 4ZCLA 4X66J 4V1Ak 2DH7A 4J7CA 5HQ8A 3H5XA 3PW2A 2JLFA 4RBUA 4U8YA 2RB7A 1BQNB 2DPIA 4DL7A 3QAUA 3TANA 5K8MA 1UW4A 2LA4A 3L09A 4J9QA 4RW7A 1VHFA 4DV1J 3QGGA 2E1PA 1IUJA 4EFAC 2UXDF 4WYLA 2E1RA 2HQ3A 3PRDA 2L3MA 2J0SD 3D3BJ 2HURA 3PYGA 4Z7CA 3MEKA 2C2MB 4N56A 3B4MA 5RUBA 2LXFA 2IDEA 3OW2R 4ZLPA 1EJ7L 2ZH9A 3R5AA 3ZZYA 3RW6A 4IFYB 3I0RB 2JL9A 4W92B 1YG0A 2HAFA 2AJ0A 3DOKA 2RRAA 1Q8LA 4P72A 1N36J 2E29A 4PXBA 3TZWA 2AHOB 3BSOA 3BGRB 4C3LA 1B0PA 3HFZB 4X4OA 3LF0A 4WFYA 3NGRA 2WVBA 4RR5A 3KKFA 2BJ3A 4DV4J 3UNYA 4EZ6A 1WF2A 3GPAA 4DUZJ 3IS9A 2FVRA 3TX8A 1N33J 4Z2XA 1NDCA 3T9ZA 4ALZA 2QE5A 1HNVB 1WTFA 4YFUA 2DGWA 2ZWOA 5LM7E 1P1LA 1IWAA 4DCJB 3FCWA 2KYZA 1Q16B 4I6AA 1JNRB 4QR2A 1KLMB 4X4QA 3TZYA 4QQBA 1Y7PA 3AT1B 3A3PB 3R5JB 4C8KA 1W25A 3NCPA 2ZITA 5HAOA 1FKPA 6FD1A 3PVXA 1Q4RA 3VF0B 4EK2A 2CQPA 2MQLA 2OLWA 3NBPB 2EG1A 4FYXB 3SQGA 2FJWA 1T3OA 3ZZRA 3POTB 1T11A 3QJPA 5JXSA 3OV7A 5C42B 3BO2A 3IFEA 4F4YA 4BC9A 1LV5A 2VH7A 1FDNA 1SB6A 4AL6A 3I5CA 4DQSA 5CQGA 2CYYA 2YKAA 4QJVA 1OQ3A 4PABA 1QTMA 1RAJA 3D66A 4B9SA 1LWCB 4KPCA 3KHRA 5ITHA 2JWNA 1PJ7A 4GO7X 1U8SA 3V81B 5B0CA 2F4VF 2A3JA 3RRHA 4A8WA 3OUYB 3Q22A 2ZDOA 1UCNA 3SQOP 2BUNA 1TUGB 1X4AA 3DXBA 1C0UB 3N01A 1RA7A 4DF4A 1N32J 3Q8VA 4PXEA 3M8SA 4YB5A 3E01B 2OAUA 4ETXA 1WNEA 4P73A 2KVQE 4B9TA 2C2OB 4WWSA 4NE9C 4CH7A 3LTOA 4F02A 4LRFA 5KAKA 3ZTQA 2CJXB 3U27A 3CCRS 2YY3A 4P2XA 2VJVA 2D3OR 5HANA 5ETKA 4FPIA 1REVA 2LQ8A 3EVWA 2A2CA 2HIYA 4TYAA 3J7YI 2VBXA 2VICA 4X4NA 2VBWA 1WC1A 3C6TB 1OY8A 2AZ3A 3DRSA 4B9VA 2CJAA 2UU9F 4LF4F 1KS2A 1MROA 1FEEA 1LW2A 3VAKA 5CAAA 4ZK7M 2X1AA 3CJKA 5KFPA 3N28A 1HNXF 4JI5F 3NNAA 2ZBCA 1LKZA 1JLAB 2HVEA 2PMHA 4C8MA 3PR5B 1VGYA 4PQUB 5C24A 5GAHU 1YJRA 1NB2A 3S8SA 4U8VA 5F41A 4JOUA 3FQKA 2YNGB 3CCMS 5H9EJ 5E3QA 1VQMS 2MMYA 3HHDA 2VB6A 4WTYA 2M8DB 1FO1A 5J2QB 3A8KA 4CNYA 4QIGA 5H9FK 2V68A 2ASJA 2J6SA 2L48A 1P27B 2EVZA 1S49A 4ITSA 1CJUA 3B78A 3D5MA 1RWPB 1GMWD 4LR9A 1YJNS 1M90T 3EX7B 4EMDA 1O8BA 1FWLA 2DNKA 3MD3A 2HBQB 4ZVHA 1KVIA 2Z58B 4ED1A 2JH3A 1LNQA 2ZD1A 4LVOP 3CJQA 3DLKB 2NLWA 2Y1JA 3W60A 2IRUA 1JK9B 3IXQA 1ZAXA 2FDNA 4X65F 1K9MT 4FF4A 2HNZA 3DLHA 2DHHA 1H98A 5IT4A 4FZVA 3SFGA 2UXBF 3JSYA 2J6TA 1QY7A 2W4PA 5AJ3J 3HM9A 3L7UA 2HQGA 3IMQJ 3J7Z5 1WEXA 2R8IA 3M1VB 5B0DA 2CG4A 2AP6A 1PSDA 5C5JA 2V2VA 5I3QA 1V6HA 3CCQS 1S1XB 2AKWB 2Q1LA 2R3VA 3HT0A 4K5SA 4ED3A 1SH0A 2R2UA 5CD4A 2B9XA 3UPFA 1QE1A 3NGSA 3ZZZA 2W4CA 4M5GA 2AGPA 4QYZJ 1NDKA 3KLIB 3IRXA 3KLFB 3THTA 2W7AA 2A0FB 2VG5B 2F4VJ 3GILA 2UUTA 4ZVEA 3UCUP 1N52B 4I2QB 1FTCA 4WP3A 3ZZOA 2DEIA 3HFKA 1VLYA 2J0QD 3DLGA 4TQRA 3PFEA 3OL9A 1WACA 3M32B 1RACB 3DC2A 2BEFA 2VONA 1IBLF 4TKTA 1BQMB 1B4SA 4I7FA 5FJ4A 4OYMA 2IBKA 1G1XA 1ZETA 4B08A 4G1QB 1UFKA 5IQQA 3NCRA 5KFSA 1OPIA 3D2WA 4RNOA 3D7SB 2CXEA 2KG0A 4ES2A 3GYNA 5L39A 1J2VA 5KFNA 1TK5A 1B70B 3G86A 2I5JB 2RRNA 1K1QA 3IGNA 3M9MB 2VPXB 4C11A 1KFDA 1UFLA 1FX2A 2R8JA 1CJTA 4D3HA 4LR7A 3LQVA 3GG1A 1SQEA 3GSIA 4IG3B 1C1BB 5FLXU 1BY9A 4OZ2A 3CMAS 3C14A 3W9JA 3VAJA 2DTJA 1ZZNA 3PM9A 3ELHA 1R8AA 1PAEX 1Q81T 4B9LA 1Q5VA 2GJFA 3R5DA 4UZBA 3PV8A 1HNZF 2MGZA 3DRYA 1H74A 4LRBA 2LXIA 4DLGA 3ZTSA 2WB1D 4J9PA 4BHQA 2G2YA 1RAEB 1OS5A 4ECWA 4ZIVA 4KH1B 4PPDA 3VGVA 3DOMB 2AD9A 1CG2A 2HBRB 1TP7A 1RP5A 1S97A 2HGLA 3C6UB 3T5JA 2B6AB 3VQTA 1I94J 1TL5A 2Y0SD 3HHLB 1CC7A 3MPUB 1O5JA 3MM5A 2QL7B 3JAMY 1N88A 4MFBA 1XR5A 4OI3A 5G4DA 2AJ2A 2JEJA 3OLAA 4ERDA 1YSJA 1WKLA 4O0IA 4B3RJ 2G2ZA 1FA0A 5BJRA 5HBMA 2HBYB 4WFNQ 3BKFA 4QWCA 2Y8YA 2NXCA 1Q7YT 1UEUA 4ZMMA 3MD1A 3OFEA 4I6YA 3SDEB 3M8PB 5KT2A 3MAAA 2HQCA 1GX6A 5J2PB 4ED6A 1X8DA 1VDHA 3TAMA 3BQ0A 2VOPA 4CO1A 4OZ5A 4ETZA 3KYLA 1TL7A 2JFKA 2VFVA 2KU7A 2JEGA 2RUGA 2KL8A 1X9WA 4TU9A 1RI7A 2D74B 4H4KC 1X0FA 4JI4F 3LA0A 3F44A 3MMCA 3AD9C 4ANDA 4DV3F 1QUVA 2BA9A 2GGPB 3FSIA 3MAHA 2WAQD 4CLYA 1U4BA 4QW9A 2MZQA 3B82A 3MMJA 1W7WA 3S01A 5KFTA 2XSFA 3CJRA 1N5SA 2LEAA 2XYPB 1T03A 1HQUA 2MKJA 3T9NA 4GVLA 2GVZA 1RBOB 1W26A 3MM6A 1NAQA 4LSNB 1WI6A 2GHWA 1XWLA 2H5JB 2XMKA 4R0JA 1H7WA 3G6VA 1CQMA 4C8YA 1DFDA 1IBLJ 1T0TV 2EC0A 1KOOA 2Z2LA 3QO9B 3ZO7A 3TVYA 1VRQC 4L73A 7AT1B 1RYSA 3OLBA 4CLWA 2B51A 1NPKA 3FKBA 4O44B 1YBTA 1IKWB 1GMVA 2ZC4A 3JAMU 2QFIA 1ZBTA 2P8IA 3TA0A 2LU1A 5A76A 5DDOC 1XN9A 1GXTA 3WDOA 1NXIA 4R5PB 3QAEA 2D41A 1RAGB 1NU4A 1UWAA 2OFGX 2R7SA 1NKCA 1X5SA 1FESA 1Q8BA 4ED8A 2R42A 4OFZA 4JP8A 5GAEU 3V4IA 4TN2A 2CADA 3HCXA 3UR0A 4FN5A 2AYMA 1NO8A 4NYPA 1NDLA 1NH8A 4OI4A 5DZ6A 4WU3A 4WK1A 1YTYA 3QT7A 4E2FB 3M6VA 3GJSB 3KUGA 2R7UA 2YKNB 1C1CB 4N77A 1F9FA 4X4VA 2Z2ZA 1L3TA 2LU2A 3GFYA 2AW0A 1RAFB 3I9ZA 5I3PA 4IH5A 2VD3A 2H1YA 4I0WA 2DNYA 2GAHC 1I1GA 3DLBA 2H4YB 2C2EA 5IWAJ 2N3OA 2D1CA 3Q89A 2DD8S 5D0GA 1S1WA 1ZPWX 4BS2A 5ETOA 3A8JA 4X4RA 3D0GE 2HIQA 5BYRA 1RT3A 4NZ0A 1SJ4P 2CPEA 3PJWA 2YH0A 3DRRA 4GRSA 1R89A 1TKTB 1YX2A 2PA3A 2E5LF 2HFNA 3CUNA 2EFGA 1WC3A 5E7OB 1HI8A 4PRFA 3MM9B 5KFDA 4C3MA 5KFXA 2PI4A 3PX4A 3D6FB 2A18A 4IOAQ 4R8UB 2RKIA 5L46A 4Q8FA 1M5HA 1YRXA 2GVDA 2PE8A 5IM0B 3A3OB 4U67Q 2DVIA 3DLLQ 2K2PA 4Q45A 4NCAA 3H0PA 4KHPF 1HKAA 4X4PA 2HZAA 2HFSA 4CDIA 2WSEC 1I6JA 4B3TJ 4KGKA 4HACA 3T1AA 3EWGA 2VQFF 1QM9A 4RUAA 2CAJA 5DDRC 1RTDA 3T1HJ 4Z7YA 1T9YA 1AUSL 2QX0A 3VALA 3TAPA 3CCTA 3VGUA 2CQ1A 3AHPA 2DXEA 2HQDA 3NL0A 3M05A 1S77D 4RW7B 1F0XA 3CW2C 3ISNC 5ETVA 1RISA 3G8TA 2D3O1 1HR0J 1RUSA 1ZM2A 1T02A 3LAMA 3OQ2A 2I8EA 4A8MP 4CLLA 3BGUA 4LIRA 2MHNA 5IC6B 5A2QU 2PFDA 2W01A 2WVCA 4WJBA 2YWGA 2K7JA 3S7RA 4Y2MA 2CNKB 4NRTA 1T9XA 3A13A 2HHVA 1NJWA 2DYAA 2JLGA 2J7KA 3SV4A 1P6TA 1WWHA 1HNWF 2ZZNA 4KSEB 4NA3A 2BJ1A 1FJGF 4F4AA 3UVJA 1RWXB 4DV5F 4CI0B 1M5KC 2CG8A 4USTA 2Z30B 3CNQP 3GR0A 1EP4A 4J90A 2FGOA 1TL1A 3QQCD 2ALYB 4IRDA 3MCNA 2DR9A 2XGQA 3M2UA 1BXNA 3IS9B 3CDUA 1NK0A 1RJJA 2ZBPA 4DOZA 1U45A 4GKJF 2VZ9A 1FKOA 1RYRA 4HH0A 1HW9A 1IVZA 1IJFB 5F8JA 3M30A 2JOQA 4NI2A 2A6MA 3TUZC 2UV8G 2V8GA 2YNFA 1PILA 5HO4A 2YH1A 1XNRJ 2YX7A 2B9WA 2OMOA 3CJ5A 3ILOA 2XB2D 5B0AA 2PFFB 4ID5A 1Q8IA 2PMZD 3ZZ0A 4ZVRB 1FD2A 2FUG9 4TU7A 1FKPB 2F8MA 2W2NP 4J9VA 2FJVA 3EVOA 2HPUA 1SCJB 4WXWA 3SQGB 2BANA 2LXUA 1IBKF 3NNHA 1JQGA 4J9NA 4WBFA 2FZKB 3MECA 5KFAA 1XR7A 3AB4B 1HL6A 3LO3A 2MTLA 3THPA 4GMKA 3RW7A 1SC6A 4MKAA 3LPEA 2XMWA 4ZJOA 5HQLA 2CIMA 1GMUA 3OVSA 1YJWS 4IRKA 2FJDB 4OYWA 2CNNB 1OO0B 3HK2A 3ILIA 4WCEQ 2FQQB 1VCTA 1RXOB 4RW4A 4MKVA 5B08A 3NGDA 2XMAA 4P7TA 4YR3A 2C2KB 2O01C 3KHHA 4FXDA 4HDHA 4HH1A 3NS7B 1S6QA 2N7YA 2HHPA 2DKOB 1M5VC 3N9UC 4ED2A 1HIYA 4F3QA 4YB7A 1JLEA 4CTAA 4OI2A 4IUFA 3FGVA 3CO0P 2AYEA 2PMWA 4K4YA 4WF9Q 3JTPA 3RG6A 3TVZA 5KG1A 4DN0A 2BE2B 2NYHA 1XBWA 1BGXT 3MOZA 4DX8H 1REVB 2OH2A 2V94A 3NXZA 4LRDA 3RU0A 5LOQA 2Q66A 4NWBA 3IR7B 3MWBA 3LPYA 2BOPA 4KY3A 3H8YA 5E0OA 2BYCA 1OY9A 5J1PA 3GMGA 4NXNJ 5D4PA 2VFSA 3M6WA 3DRSB 3GFZA 2KH9A 3RAQA 1MROB 1LW2B 5F9NA 3CJKB 3ZNUA 3ZZPA 2IMOA 3NLCA 1XJWB 5B09A 4QOTA 4ZP9A 2M9KA 2YVSA 4F8RA 3G82A 1TL3A 4Z37A 4ZLLA 2CQHA 1M5OC 5MLCV 4M5NA 4NLYA 5HK4A 5ETLA 1CULA 3SBMA 4E98A 5C24B 2ZJRQ 2HQIA 3JQMA 1ICEB 2MKIA 4TLQA 2W8LA 3UD5A 1IKVA 1N54B 2AMCB 2IBOA 2UUBF 4NA2A 5AE1A 3G4SS 1ULRA 1HNWJ 9ATCB 3TQEA 3WQPA 2IDLA 3EZUA 2KRBA 1FJGJ 3QT6A 4LFAJ 2NPIA 2HSEB 2PO4A 2LMIA 3UDEA 2RE1A 1CJUB 2HG4A 4RW9A 2W1BA 1UWBA 1PJ5A 4EBCA 1Q0NA 1SUQA 4FS2A 2ADCA 2W2QP 2FVPA 2MJUA 2VQEJ 3CDAA 5DM7Q 3GIIA 2DNQA 3UO0A 1LWFA 2ZD1B 2E7WA 1UA1A 2HGNA 2RILA 3ISND 3W9HA 4O4GA 5LT5A 2W9BA 5KFVA 2R8KA 1X4FA 3MR3A 1I3OB 4JI1J 1FEHA 1RAAB 1JWWA 2HNZB 1PBAA 3DLEA 4ELUA 1S12A 1K47A 3ONQA 5DM6Q 1YRTA 3TAQA 2IY5B 2FHJD 1NMEB 2NQPA 3R6GB 3D0HE 3BGOP 5DJBA 1VLOA 1FCAA 3J7AN 1RTIA 1APSA 4GC7A 2BQ3A 2E1MC 2BQRA 2AJQA 4B9UA 2R8HA 3DN9A 3TEHB 1RT7A 4NASA 3V6KA 1JLGB 1RHUB 1NJXA 4FDFA 4M63A 1QE1B 4QIVA 2VHGA 3MPYA 3VQSA 2XMTA 4FF2A 2FJAB 3OTBA 2NR0A 3IRXB 3M8YA 1JXEA 4O4RA 1UJ4A 4I6WA 4NMLA 4M5DA 3KJQB 4IH7A 3E2EA 3GZ7A 2P9EA 4RPFA 3DLGB 1VRUA 1GK8A 2C3PA 3OT9A 1DY3A 2X51A 4NLSA 4OLOA 2M8HA 3IO1A 4USMA 1X0PA 4ELTA 2QSWA 3O1LA 3FDSA 5KG7A 2MQQA 5KFUA 4DUTA 1JLBA 3Q8YA 3MEEA 4I7FB 4J9KA 5KFOA 2CQBA 5F8HA 3D1OA 4G3IA 5LJ5Y 4DFMA 5DG8A 2D3UA 3VGSA 3BEGB 5CHCB 5A6WA 5D78A 1KR4A 2GIQA 1WHWA 2IAJA 1LW0A 2O5DA 4RU9A 1Q82T 3KLVA 1D9FA 4OJHA 3DRPB 1GQEA 2I38A 4C11B 3NG8A 1PC5A 1CJTB 2BMBA 4Q2LA 3HD2A 2XSJA 3CEDA 4RUCA 3C14B 4CYUA 3MTJA 1T8EA 5G0RA 5KFMA 3CIMA 1TKZA 1XR6A 2FYXA 3J7A1 4X64F 1AROP 5DLGA 2MGZB 4K0KF 2ZVIA 4IR1A 1N6QA 4HT5A 2F8HA 3IM9A 4F4ZA 2V5HG 5FDLA 4OX8A 1ZM3A 3EGWB 3C19A 1VQ6S 4OZLA 3K5NA 4O3RA 3M2VA 4EYIB 2DK2A 4Y00A 2V8PA 4AUKA 1GFWB 5BR8F 2ZH2A 1RHMB 4B9NA 1CC8A 4YOEA 1VQSA 4LF5J 2CQ0A 4DXLA 4CLZA 3MM5B 3MUMP 1A0OB 3CXCR 3QGIA 4MFBB 4TXSA 4N5SA 2HLTA 1VK3A 2ILYA 4OQJA 1P8GA 4TQSA 1FNXH 1M0SA 2XZTB 3AA9A 1MN7A 2V4JA 1GH8A 2KFZA 2JEFA 5E3CA 5HBMB 4UW2A 4JI8F 4C48A 3NWGA 3PTWA 2EXUA 3DI6A 3CJ0A 3UDVA 1U1KA 3UDCA 2ZHBA 3F0NA 2ZBRA 4IO9Q 4OL8A 4PEOA 2HFVA 1Q7LB 5D77A 3DNCA 3RAMA 1D9AA 3RZAA 3TAMB 4NEZA 5K8PA 4ZVPB 4DR1J 2ZHAA 2XWXA 1RADB 1NSAA 1W2IA 1TL7B 3PYEA 3A1YG 4NLGA 4M5JA 1J5EF 3MMBA 2DGUA 2CRLA 2VPZB 4FF3A 1BMQB 3H90A 3L4BC 3NOGA 5DETA 1HLWA 1K8AT 3MMCB 4DR3F 3D0IE 4DL5A 2F65A 3P5BP 3WX4A 1F2GA 2MYFA 2KO1A 1T05A 1H2UX 1N48A 4ECZA 2C3MA 2WVFA 4OX6A 3P96A 4RJVA 3LALA 4KGXB 3EZOA 2DCLA 3X3UA 2XNRA 4AD6A 5U47A 3BBCA 1GT8A 4MAKA 2E5IA 2J8AA 4DR6F 4O3QA 2ACMA 1RWMB 3KOAA 1T03B 3H2VE 2V8VA 1HQUB 4F7VA 4M5KA 3K89A 1UP1A 2GVZB 2JX2A 3MM6B 3BH7B 1FTRA 4OHXA 4JYAF 3CCUS 2IM1A 2B5JA 2OPSA 5HN0A 2LFVA 4DQQA 3FSXA 1U2RA 2W2MP 4UF4A 1N56A 5HLFA 4F3MA 1SL0A 2CQ2A 1U24A 1S9EA 5KOXA 2W8KA 4LUBA 1OSCA 3W7BA 4JV0A 3U7JA 4LBIA 1KD1T 3GIRA 4NCBA 2Q6CA 2X1FA 1OYEA 3CDWA 3QZ8A 2OSQA 2RAQA 3M8WA 1AW0A 2B8PA 5F3ZA 1QSSA 3QWUA 5DRKA 1U0SA 4AL5A 2VUGA 1VQ8S 2JHEA 5GMKa 3PJXA 5GMEA 1Y5IB 3FFIA 3AOAA 3PXGa 5DDQC 2HS0A 1VI7A 1UVKA 3PG9A 2FVCA 2JC1A 2JEIA 4RLEA 2ZWPA 2Z56B 1KP6A 4G1IA 3KHGA 4AXIA 4U9RA 2LCWA 4M5HA 3AD7C 3MFIA 1DHMA 1H3DA 5DGBA 2XLJA 5J2NA 2E5GA 3AFGA 4M1KA 4N8NA 3DGVA 4X64J 4LFBJ 4UZCA 5KFBA 3PFOA 2AYBA 1RKJA 4B3SJ 4ANEA 2B9YA 4DFKA 4JI6F 2DNHA 1R8CA 4X4UA 2BBEA 1BHNA 1TVRB 3W2WA 2NZCA 4H4KA 5CA5A 3Q8SB 1F5AA 4OZ0A 3HZEA 3BKUA 4CH1A 4ZKAA 3PRVA 2BE9B 4DR5F 5I4MA 4ZPAA 5M2UA 2R8GA 2ZM6J 3EGVA 3G87A 3QMQA 1S1WB 1CSJA 1JXLA 1MU2A 2BW7A 4J91A 4ZOSA 3LP0A 4JI0F 1T9WA 5L38A 1OYDA 4TLRA 1FWPA 3KMSA 2DB1A 3HJVA 1FXDA 4OYAA 1ZH5A 1RT3B 2IVFB 3US5A 1R8HA 3HHKA 3DRRB 2PGCA 4PUOB 2HHUA 1PO6A 2BJEA 1N0UA 1DARA 4I2PA 2RVJA 5LL6d 3BGFA 6AT1B 3BH6B 3HX9A 5MAOA 2R7RA 3H7HB 3EICA 1LXNA 1AXQA 1KC8T 1MLAA 2CQGA 5F8LA 2RKIB 3IBCB 2BKPA 2GVDB 2BKOA 3HFVA 4USKA 2DRAA 2AJ1A 4BWJA 2BABA 2GO9A 4NLDA 4FXVA 3EPGA 1WSRA 3BF4A 5KFYA 2MY7A 1BWVA 3DKDA 4DR3J 3OFFA 2KDOA 1I5OB 4HACB 2FC9A 1WG1A 1GEHA 3JSMA 1PG5B 3EYZA 2LVWA 1JKHB 5AXNA 2CWKA 3PW0A 5GADI 3WHIA 5KG6A 5D8HB 2H5EA 4DR6J 2Q3PA 4L74A 1IN0A 2R2SA 5KT3A 2MQ8A 3N5BA 2GMHA 3TI0A 4NLOA 4WZMA 4C0OC 3RBEA 4QCLA 5B0BA 4A8SA 5IFMA 1SIWB 4O0NA 3JB9k 3CO9A 1GTHA 4Q8EA 4LFCJ 4P6QA 1KONA 1BQXA 2Q79A 3GU0A 4GO5X 3FEXB 2GMJA 3TEGA 4EEYA 2EEYA 4J9LA 3C15A 3ZNJ1 4DFPA 5KFRA 3E51A 3MFHA 2RF2A 3H2UB 1S48A 1F3VA 4ZP8A 2RU9A 5HMXA 2ROPA 4K4WA 3OTOF 1F5BA 3W8GA 5HMYA 2IJFA 3ZFVA 2AT1B 1EP4B 1U48A 1JX4A 4RUBA 4UY8T 2BZ2A 3G96A 3I4HX 5CYMA 3K17A 1TL1B 2FVSA 1HWKA 1S7HA 5DS7A 3M2UB 2MJNA 1NKBA 4AL7A 1P1TA 1IR2A 3PRBA 4YR2A 3ILLA 2ERRA 1FKOB 2MB0B 1T9VA 4URQU 2N7CA 3ISZA 3M30B 4ER8A 4NI2B 4S0MA 2G2OA 3VGTA 2YNFB 3HLUA 3RBXA 2RH3A 2FJEB 4P74A 1TMMA 1S4FA 4OI1A 4QR0A 2VL1A 2C3OA 3CT9A 4ZLNA 2PIIA 3PCOB 4ID5B 3BDPA 2YNIA 4O3NA 4AYBD 3OTEA 1UZDA 3GV5B 2Z4PA 2CQ3A 2V0NA 4F25A 2W9AA 4N7TA 1ZAVA 2NXUA 2CZVC 4DUYF 3R5BA 1RT5A 2M0GB 1UEKA 1X4DA 2DY9A 1S6PA 1R7IA 2BANB 3FRZA 1NZAA 5L1LA 3BYRA 3K59A 1VRTA 1RZMA 1S99A 4Q44A 4Y2CA 2DR8A 1VQNS 3ET6A 4DPYA 3PDNA 2QN6B 4USWA 1F1BB 3AAWB 3DFEA 1XQIA 4ZN1A 5K8OA 1EX8A 2P6SA 3CC2S 2PDAA 3EE3A 3C16A 1RBLA 3ITHA 3OHAA 2C2ZB 4RW4B 3D1HA 1HMVA 1HWJA 1HPZA 2CQDA 1VQLS 4DV2F 2GQ2A 4PPZA 2QLXA 5AE2A 2M7SA 5AT1B 2PN6A 4TYBA 1MMLA 4C98A 3D68A 4TY8B 1S6QB 1S1UA 5LSRA 4PG4A 1S0VA 2B7CB 2FHJA 2XZDB 4F36A 2MKKA 1JLEB 4CTAB 2MY8A 3KK1A 3K5OA 1AFJA 2ZBIA 4LBHA 1O51A 4WFBQ 4WU2A 2CDRB 2DO4A 1U1PA 1TFYA 1WF1A 4IDKA 2JNJA 3NGTA 3Q23A 3V6JA 3BPSP 1S59A 2B43A 4PKDB 2V63A 5KFQA 2CPIA 3SCLE 4HHHA 2MLXA 5CZXA 3GB0A 1IBMJ 4F04B 3O3LA 3EZ5A 2GNKA 1KWMA 1TKXA 3SI8A 3J7ZT 3S1TA 2EFNA 2F40A 2X3GA 4DL6A 4YDDB 1TAUA 3IRWP 2YKMA 3MPDA 1YGYA 5LXRA 1RT6A 1RTJA 3TUJC 1AZSA 1QTNB 4I67A 3G82B 2DJWA 1TL3B 5JJBA 3G2XA 2R7VA 1X7VA 5F3TA 3J81Y 1RU2A 1CULB 2R7OA 1KVJA 1HYSA 1XEZA 1F9HA 4X4TA 4QBUA 1ELOA 3QGPA 1R0CB 1WI8A 2AV5A 3BREA 3KMQA 5KTQA 3JTNA 4OYIA 1VC5A 1M1HA 4FKYA 1ZYQA 2XMUA 1IKVB 2GJIA 3HSJA 4U7UD 3BKTA 1VQKS 3R3TA 3QWPA 4ZVTB 4RNNA 4FVMA 3SSSA 3RB0A 2HZVA 4EU0A 2IM2A 4B3MF 5LMUJ 5E3PA 2HWIA 5D0RA 3GSDA 2KZMA 3I0RA 4RW9B 4PWWA 1O0PA 1UWBB 4EYHB 2OELA 3O6QA 5EWFA 1B0VA 3H4BA 1SUQB 2LQ9A 4E8UA 4PCQA 3SXLA 2G13A 5D3GA 1LWFB 3BR8A 2Y1LB 3V4MA 2MSSA 3QZ7A 2ZJPQ 3MUVP 1RHJB 4JV5J 3UCGA 1LWEA 3H59A 1RBAA 3WIVA 2W9BB 4C8LA 1QAJA 2PEBA 2E9TA 5ETSA 3UW1A 3PIPQ 2QA4G 2OJ3A 1JLFA 3GTYX 3DLEB 1QAIA 4QZVB 5D0EA 4EGLA 3D67A 4PWDA 4DR7F 4P7VA 1RTIB 4TNOA 1HHTP 3L9ZA 3BPDA 4DPUA 4TY9A 2U2FA 2V67A 3UCZP 3DOLA 1KTQA 2MXYA 3KK3B 4QYZK 2XS2A 2BV3A 3KLGA 1RT7B 3FRYA 2F7VA 3DGPA 5SZTA 4UOHA 1AA1B 1U6ZA 3CULA 2KXNB 4WE1A 4CLKA 3OVAA 2FHOB 1P9YA 2HRUA 2YQ1A 2ACYA 3RR7A 2GX8A 2KRRA 4M5DB 3PW7A 2CVIA 1TMJA 2YQ3A 3H40A 4DV2J 2XYGB 1WKKA 3R97A 3K5LA 2DRDA 3J81U 4N76A 2ZBQA 1S6UA 2W2OP 3LGHA 2UUCJ 2IC3A 1DJ0A 2NUUG 3MZIA 1JLBB 3MEEB 1MW7A 4QWDA 3KLHA 5DO2A 2M3DA 1QSLA 4HR2A 1XMQF 1MN9A 5GAGI 2ZNYA 3PO5A 2W2PP 4DU7A 1C0UA 1DURA 5K8NA 2OPPA 3KG4A 4ZVGA 1FT8A 5EDWA 2KHCA 2IAJB 2LKZA 3CDEA 1LW0B 3V2UC 3TRGA 3BYPA 2H9ZA 4BLGA 4PG8A 2MZ1A 1X5PA 4NYOA 1U1NA 1N0VC 3OVBA 3MDFA 2ZFHA 4DR2F 3OL7A 1U6BA 1TAQA 1RT2A 3D4JA 4OZNA 1Q79A 3CSKA 1IKYB 2APOA 1CJVA 1B7FA 2XSJB 1Q53A 3I55S 1OJ4A 5G0RB 4NL5A 4YMEA 2NXNA 2MSTA 1TKZB 4Y34A 2BQUA 4WFAQ 2DT9A 2L41A 3ULHA 3RTVA 2VBZA 1MSWD 2HRTA 3RR8A 4QR1A 3HT3A 3D28A 4CT8A 2UXCF 2ZH3A 4MMOA 5KT6A 2FHKA 5DQIA 2EWHA 3PYFA 1N6QB 1LK5A 3HMJG 4MIBA 4UY85 5IOLA 4UQTA 2E5JA 3GIKA 2DH8A 4F0HA 4CO2A 4ILRA 4YY3F 2HHTA 3M2VB 1D09B 1UVLA 2BM1A 1T94A 3MM8A 2DISA 5DLFA 3V6DA 3N6NA 1M5PC 2KG1A 4YN3B 2XYHB 2FY1A 3PKYA 1DRZA 5EX0A 1WHXA 1JLCB 1X9MA 3W1YC 1F3FA 3D6MB 2V4JB 3NAIA 1S1TA 2XI2A 4M5MA 1NNDA 4YDXA 2ZEJA 3OTDA 3DI6B 5LXYA 4LMZA 5I3UA 1L3KA 2HZCA 5IT0A 3BQ2A 2QL5B 2JLEA 3OXLA 4EO8A 4CLTA 1TTHB 1HWUA 1U2CA 1WD6A 2RS2A 4U96A 2MZTA 4B3OA 1RQ0A 2UXDJ 3ENVA 1NKEA 1WTBA 1F5CA 3G6XA 4W4MA 4CO4A 3B4DA 4U95A 2IMWP 1HBMA 2AEMA 3OPKA 4DSJA 3K0JA 4DPOA 2V9KA 1OMSA 2DNRA 2QZ8A 3MMBB 4KR0B 1F6TA 4CT9A 1S1VA 2DGTA 3FC9A 2IIHA 3OL8A 2MPUA 3IA0A 4WXOA 3R8YA 1PIEA 1FDDA 4A8FA 1NLKL 3P8BB 1T05B 3G9CA 1VQ5S 1R31A 1TUWA 3ETOA 4JV1A 3EPIA 5A0YA 3VAFA 3M6XA 4OX9F 2BJ7A 5K20B 4A4JA 5A8KA 2CDQA 3MCMA 1X9SA 5HJYA 4QIEA 2N4CA 1RLDA 2F9JA 1ZAWA 1SKWA 1WG5A 1WEZA 2B5JB 2OPSB 1MMDA 4YHHF 5B0FA 3CJ2A 2XY6A 1V9OA 3HVTA 4MT1A 4DQIA 3GFXA 2OUGA 5A8RA 2WW8A 4ECSA 5EWGA 5HLFB 5AXLA 4QIWD 1A7GE 1SKUB 3AOCA 5HVFA 1S9EB 4OX7A 3H25A 1PAUB 3CCSS 1R8BA 4CO5A 4O3PA 2CPHA 2IA0A 3VVUA 5AXMA 1VS3A 1QVFR 1XMQJ 1KBRA 4WFXA 1Y11A 2BJ9A 1SKRA 2EK6A 3W66A 3KK2A 3GJTB 4ICLA 5F9LA 4GVBA 4K4UA 1S79A 4LF7F 1HBNA 4EBEA 1LOUA 3VWSA 5IXUA 2ASDA 3GJQB 3FFIB 2HQFA 1EQ0A 4DR2J 1UPMB 1OSDA 1X4BA 3B54A 3IR5B 1FVSA 2POKA 4KC5A 3TA2A 4CLFA 1VMBA 2MQOA 1SKSA 1FFGB 2BE7D 1FRXA 3HKWA 1RWNB 5L8RC 3LWMA 2MZSA 2VA2A 3LOUA 4DWIA 2G0CA 4USHA 5J2NB 4IOCQ 2QTWA 1XK8A 5ETMA 1MWYA 1LQ9A 3MCSA 5HQMA 4F2RA 2CFXA 5IT9Y 4DG1A 4DSEA 5FD1A 5KFJA 3IC1A 1N5VA 4OV1A 1KQGB 3TJAA 2XWYA 2E9RX 1MMNA 3W2WB 3NNCA 3FBFA 1GXUA 4LSZB 1CS4A 4EI2A 3TJ8A 2BX6A 2B4UA 4KJIA 4RWWA 4MYUA 1SJFA 2CPYA 2K1RA 2RDIA 2XBPA 4A48A 4WK3A 3K58A 3QNWB 1MU2B 4ECQA 5F0WA 2DGOA 3HP6A 3LP0B 4WIIA 2DNMA 3WC0A 2DEJA 5K14A 3BSNA 1YJVA 1NK6A 2M70A 1C0TA 2BACA 1FI4A 5D4OA 2V8DA 1HI0P 1X31C 2UU9J 4LF4J 2J8SA 4DQPA 1F60B 4Q0BB 3HF5A 5L1KA 3NRBA 3KTQA 2C1EB 4I2PB 1FX4A 1HNXJ 4JI5J 4HVZA 4HEA9 3KUEA 2XCAA 2DPJA 5T14A 2GV1A 2GAGC 3QLHA 4NPOA 2YWEA 1S0NA 4N8OA 4WTOB 1NRKA 5F8GA 4NCGA 1YI2S 3Q8UA 3BGLA 3T1YF 2FZCB 4CZCA 1D9DA 1Q5YA 4RBVA 5J2PA 4IG0A 1U0HB 2MQNA 4B9MA 2DCUB 2EI5A 5K5MA 3SSRA 2CJBA 5KOWA 1SQFA 1TUVA 1D8ZA 4A46A 3KDNA 3TX0A 5C7PA 1U02A 3DMJA 3JSMB 2BM0A 5I42A 2FPHX 4OX9J 3HVWA 1OPZA 2DHSA 4HT7A 3R2CJ 3HJFA 4WIQA 3OJUA 1Q1KA 3LGMA 4ZPBA 3JTOA 3PYDA 4H54A 4JI2F 3KDOA 1CQNA 4X66F 3KG0A 4PZVA 2MZJA 1AUDA 3AD8C 5IT9U 2GS8A 1SVDA 1HWIA 1FWKA 3HZGA 4RKUC 4X65J 2YNHA 3C15B 2QYGA 3BQ1A 2UXBJ 1PCAA 2QMWA 4LIWA 2RF2B 2VBYA 4Q5VA 4IRCA 2ZKUA 3DHWC 1R6YA 1O6XA 4MKBA 2J6UA 4QWAA 3AODA 4LF7J 5IV4A 3EGZA 3W62A 2PD1A 4V19X 3HI9A 1DLOA 1FVQA 3QRQA 4P9SA 5CYMB 1HBUA 4ZCIA 2L9DA 1SJ1A 1PC4A 2XMJA 4KB7A 3IM8A 4QWBA 1JXVA 1M1GA 2RIJA 2P9CA 5JVGQ 2HHHF 4YQWA 2C2RA 3IWXA 2YTCA 2CNLB 5J1EB 2FJXA 2KI2A 3SCJE 1MG7A 2YKPA 4OYPA 4J9UE 1QUPA 3GYXB 2NUHA 5KFEA 2FC8A 1PYOB 2HVZA 1VR6A 2QSFA 4DV4F 3MM7A 4DUZF 2YNIB 2WVDA 4N41A 4XK8C 2RUSA 3H4DA 1N33F 3PNIA 3MI7X 4MK9A 2RDDA 4P2SA 5HROA 3OHBA 4DPWA 1RT5B 1JMTA 2VF3A 2B8QA 2RSQA 5ADZA 2KKHA 4KKOA 4ZDNA 1S6PB 3GCXP 5DG9A 3PHTA 2HVHA 3T5HA 4UOCA 4EO6A 1FE4A 1OIAA 1VRTB 3BM7A 3DM2A 3BBBA 2AEJA 3ET6B 3O2IA 3EXCX 1SBRA 3R5GA 3CCZA 3R27A 2QC3A 2XHWA 4A8XA 1EKSA 4UTGA 2HHSA 2WHOA 3FCVA 3OXGA 3TR5A 2Y8WA 1KSPA 3CF5Q 3C16B 3ITHB 2Y1IA 1GNKA 2KZZA 4DSFA 3NMRA 4C8ZA 1HPZB 2XULA 1XMBA 4NA1A 3IG1A 3QGHA 2KXFA 1S1UB 1FRKA 2Q6BA 2M4MA 3M6UA 2ZVSA 1EB0A 5C2GA 4QPTA 3BR9A 1YVFA 2R7QA 2PSZA 1HNZJ 1NK8A 1QSYA 3KK1B 3ZTOA 3MOJB 1RSCA 2OEJA 1IM4A 1N5YA 3KWMA 4PWUA 4X84A 1OY6A 5E3AA 3J7YU 1VQ9S 1WUUA 4IDKB 3T1YJ 4LBPA 1PBUA 1JB0C 3IWLA 1I51B 2QRRA 2RRBA 1WC0A 1KQKA 2BRLA 4USIA 4ZP7A 2AJ4A 2DGQA 4DN9A 4Y3CA 1VC6A 2EFOA 5KG0A 4JI7F 5HMWA 1EETA 2V6AA 3MUTP 2XY7A 4WP8A 4ZVUB 2EFQA 1WDTA 2R4FA 3NGKA 1TKXB 3J81j 1FNMA 2QA2A 1RLCL 4KGZB 3M4XA 2YWKA 1WG4A 3UDLA 1RTHA 2YKMB 1RT6B 1RTJB 2NSCA 1AZSB 1Y5LB 3I5AA 3NWRA 4JI2J 4FNIA 4DX5A 2DNZA 3RRKA 4DFJA 5DZ7A 4CO3A 2AEFA 3MURP 5E5NA 4OI0A 5EUHA 4DU8A 4ZPTR 1HYSB 3LP2A 2RQCA 3K57A 3MR5A 2AJFE 4OJ3A 4FNHA 1QDUB 3JQJA 2PC6A 2HK3A 9RUBA 3T6JA 2ZKTA 1WHYA 1M1KT 3GLJA 1U1RA 3RYLA 3CD5A 4DCOB 1SJQA 4YP3A 2V8HA 2HNYA 4PQAA 1X60A 2F1FA 2ZOFA 2V4RA 3NS5A 1H2TZ 3QIDA 2H65B 3CD7A 3QJLA 4JI4J 2YWWA 1T9TA 1UKUA 2E7XA 2YWFA 4N47A 4DV3J 1RAHB 2AYGA 4B02A 5SUHA 3TVKA 1NSKL 2GQCA 2HHHJ 1HW8A 2FLLA 4DMZA 5KFLA 5D3GB 3NEKA 2PT0A 3QBCA 3P4UB 3CD6S 1VIXA 2HGMA 1LWEB 4J9OA 1N5TA 2LDIA 1U25A 5DGAA 1IJEB 2EBEA 1B64A 1JLFB 3SFUA 1EQMA 1ZZFA 3W5ZA 2F8EX 4USUA 3BN7A 2CJQA 1N4LA 4TU8A 2RQ4A 1UL3A 1SL1A 4PWDB 2E1CA 1AT1B 3OBIA 3N0VA 1Z2ZA 2HRYA 3H5SA 1N34F 4CLPA 3OR2A 5KG3A 3H42A 3Q83A 8AT1B 2W24A 1HD1A 2DHXA 4ED5A 3DOLB 3DOKB 2OTJS 2JZ5A 1WOPA 2A6OA 1H73A 5IS2A 4WKRA 2EG2A 1NH7A 3KLGB 4KO0A 4ELVA 1IWGA 3DGPB 3GJRB 5AJ3F 4R25A 4K8RA 5DDPC 4WE1B 1U47A 3UD4P 3KXDA 1TFWA 5CXTA 2OD6A 2D69A 1J27A 2HK2A 3OR1A 4CM0A 4PR6A 3M2RA 3VZHA 2VA3A 1YBUA 4XAKA 4Y2IA 3WX8A 1NPPA 3FEYB 2ZH6A 4KHRA 2UVRA 1LWXA 4ZVQB 2QLJB 3QIPA 1VISA 2OEMA 2HHXA 2IC3B 5E33A 2EKYA 3BS9A 3VAHA 3ENAA 2KFYA 2WTFA 1ZTWA 4C97A 4DPXA 1B99A 3KLHB 2GZOA 4FP9A 3TP2A 1UVIA 1C4CA 3GFHA 4I64A 4K4TA 2RDJA 2YPYA 4K4XA 4O3OA 5LSLA 2AZ1A 3NAHA 2OPPB 3U1LA 2V9WA 4KTQA 3WBZA 2J5AA 4OZ3A 1Q78A 1S0OA 4LF2A 3Q2TC 3PJ9A 2ASLA 2A10A 4JI7J 4KV8A 1HA1A 4FYYB 4ZJLA 2AU0A 1EHWA 3CE8A 2KM8B 5GAEI 3HSGA 2HFUA 5J1NA 2JRSA 3F56A 1GMWA 3HSZA 1RT2B 2BE2A 3TUPA 1CJVB 1Z1ZA 1RHQB 2KVIA 2ZZMA 4JUZA 5ETRA 1A9NB 3FBBA 2J0XA 3RGIA 2B4VA 4KE5A 3Q8QB 5KT4A 1EKRA 2HFOA 2JSXA 2AWZA 2HVDA 1RAOA 1YJ7A 3ZZUA 2VU5A 2E5LJ 2CJYB 1YHQS 1WORA 3LP1A 3QATA 1R0AA 3SIPB 1H0HB 2HW3A 5DQHA 3DHXA 5GMDA 3D54A 4NYZA 3AJ1A 5HSPA 3R1LA 1FK9A 1RWKB 4DR4F 4HYKA 1S4EA 4OJGA 4DV7F 3MM8B 1DQ9A 3UD3P 5CYQA 3V6DB 4KHPJ 5C2CA 4H4OA 2KT3A 2FB0A 3LAKA 5GVQA 4F4KA 2LECA 2OHDA 3P6YC 4OLPA 1NBEB 2XGPA 2KHDA 3UNGC 3M8RA 2VQFJ 4H4MA 3MXHP 2MLZA 2DXFA 5HJXA 1RT1A 4DV6F 1S1TB 1SIZA 2KFNA 1I94F 4ATNA 4IYQA 5BYQA 2ZJQQ 3FJ2A 1WSVA 3BJYA 2ABYA 1KLNA 5I3UB 3HHEA 1BC6A 4DS5A 4QYRA 2J7UA 4WP9A 1IR0A 3TQ1A 2KTQA 1CLFA 3L7PA 4B3OB 2VC1A 1TELA 2O67A 4B3RF 2XEXA 1RHRB 4DL2A 3E3XA 4U6PA 3D9BA 3GV7B 1HBMB 5FLXY 4WZQA 1UJ5A 1YJTA 1N34J 2VFUA 2W7PA 4C4WA 2CKWA 2A1BA 1S1VB 3CC4S 3UWTA 1S5ZA 4YB1P 4Q7AA 2NPFA 4PXDA 4M5IA 3QSYB 1W2BR 2D3ZA 4DV5J 3I0SA 4I69A 2VIHA 4HL9A 5JVHQ 1YJ9S 2J9CA 5A0YB 1HBOA 5M2RA 5A8WA 2VOOA 1FHTA 3R7SB 2Y0BB 4ED7A 4DF8A 5A8KB 3RBDA 2ZNZA 5HVGA 5EX3A 4DCPB 2BDPA 2GO8A 4GKJJ 3UN3A 1JLGA 1RA6A 4J9MA 1RWVB 2K7KA 3BZQA 5CZVA 2J76E 1FFWB 4ED4A 4PAAA 4MJKA 3FZBA 3HVTB 5A8RB 4C9DA 1YITS 1FRMA 2JJ4D 2RJZA 2DNGA 1BE4A 3H20A 1AFIA 4XTTA 1RAIB 5KT7A 5KFCA 2M88A 1KOHA 4KYZA 4DV0F 4DI6A 1UETA 1DTQA 3MR6A 4FYWB 4HLBA 3KK2B 4ICLB 4GVBB 3U02A 4ZVFA 2FHMA 1IBKJ 4URGA 2R7XA 3GIMA 2OP5A 1HBNB 1NHUA 1R8PA 4IO1A 2OIHA 4NMXA 3EUNA 2YKOA 4YS2A 1WDDA 5IZHA 2GHVC 4Y6IA 3UE2A 2RHQB 2MHEA 4DX7A 2PA8D 1X5OA 3PEJA 3ZC4A 4HTIA 2NXJA 1FJ7A 1WOOA 2P6TA 3DRPA 1HNIA 2JFDA 1X4CA 3P3DA 2C22A 5HMZA 3AOBA 2IJNA 1KVKA 4A8KA 2SXLA 1IBCB 5HI7A 4DG1B 2UP1A 1IKXA 2Z0GA 5EN1A 5HVHA 4DR4J 2M5YA 2JVRA 4DV7J 4X62F 4HDGA 2HKEA 4BC7A 3FEZA 2ZUAA 1CS4B 4NLPA 4LF1A 4CH0S 2FZGB 1VQPS 1KN6A 2K1RB 4WKYA 1FXLA 2B3TB 3IN5A 4ED0A 3U1MA 3L7OA 3W5XA 3ADAC 5ETNA 3VAIA 1ZA1B 4QU6A 5K14B 1WC5A 5D6GA 3ETMA 2ILZA 4DV6J 2IYGA 3HXMA 5EHHA 1C0TB 1HQ2A 3MF5A 3QYYA 2KT5A 1SQGA 5AE3A 3H98A 3KJVA 3K2YA 4A47A 5IWAF 4XO0A 3UN5A 2Z57B 2RD5C 5E2QA 3G71S 1TK8A 1J5OA 2Y1RI 2KXHA 1H6KX 4F67A 4ZCKA 1YWXA 1Q95G 4LF6F 4L3KA 1HI1A 1NHVA 3KG1A 4F0MA 3QLHB 4ZPWR 2KT2A 4QIFA 4DQRA 1WOSA 4DL4A 3JS9A 5CH7B 2DR7A 3W64A 1TU0B 4NCGB 2QEXS 4AQYF 3AJ2A 3CMQA 1GTEA 1PYSB 4MIAA 1VIOA 4ZIWA 5L1IA 2DITA 2V34A 2LYVA 2UUBJ 4IG0B 5CABA 3AB2B 2YPZA 4DDFA 1F9EB 3EM1A 3NP5A 2Q43A 2C3YA 3DMJB 4HI1A 4NLXA 4RW8A 5I42B 2MDAA 1NB7A 3MEDA 2QLFB 3DYAA 3E8OA 4C2MA 2VPYB 1H38A 2LDYA 3QPIA 3FCHA 2LEPA 1QD1A 1FERA 2IRYA 4B3TF 2WZ1A 4NEYA 1FF2A 2WBMA 2DIVA 4DSIA 1R6VA 1NK7A 1VOMA 2FLOA 3T1HF 2V2QA 4ZA1A 3FBCA 3ZTPA 3DXSX 2J9EA 3BSCA 3DLJA 2R9LA 3FVYA 3MCOA 3MAAB 4P75A 2CJKA 1SI9A 1VK8A 3FMWA 2YNHB 5H9FJ 3AQPA 4P2FA 4G65A 3JYTA 3M8QA 1RABB 2HMIA 2ZH7A 4C8OA 4EWTA 3Q2SC 4YB6A 4DV0J 3BBFA 4Y65A 3L95X 3TUIC 1L5UA 4RO0A 1HR0F 5IQ6A 4KGMA 2IM0A 1U09A 4K4SA 2VJUA 2QGFB 4L72B 2F63A 3K5MA 2XS5A 1VBXA 1VYAA 1JJ2R 2DGSA 2HNDA 1DLOB 3VVTA 2O1PA 1UA0A 4QWEA 1HBUB 5D4LA 4OV6A 1U7LA 4IFVA 4KIAA 4P71A 4OIXA 4ILMA 3IAM9 2CJ9A 2XO6A 3CCJS 3PHEA 5LMNF 2AIRB 2XMVA 3S6EA 3EJMA 5M2PA 3PKMA 2W9CA 4RNHA 2VDIA 1HHQA 2OTLS 2OFHX 3RB3A 2DGVA 3HHLC 3LH2S 1TK0A 4KT0C 2X1GA 3MM7B 4NLQA 2ATLA 1U26A 3IGVA 1D8YA 4CM2A 2CWXA 3KJFB 1FXRA 3MGJA 5HROB 4F26A 1FNOA 1YKWA 2QA1A 2EC2A 2F9DA 4KKOB 1XNRF 3GWCA 2CPFA 2ASYA 4X62J 1BWEA 1LFPA 1HWLA 3P5TL 4A8YA 5HL7Q 4BCAA 4L3NA 2IM3A 1YQHA 3SCKE 3W8PA 1KNZA 3DM2B 2AF6A 4X4SA 1GX5A 2BOAA 3PX6A 5A2QY 1U6FA 2V2ZA 1FRLA 1RWWB 2D7SA 3GE9A 4A8OA 1QVGR 4ANCA 1B3TA 5B7WA 2UV8A 1TVRA 1F2HA 4DBQA 3RB4A 1LFWA 1RT4A 3OL6A 5ETQA 3D6HB 4LQ9A 1XIQA 2I2YA 1DBDA 3CJ3A 1S9GA 3BO4A 3T19A 2C3UA 1LXJA 3NMAA 3C2PA 3IG1B 1SC4B 2VC0A 1VJWA 3VZIA 1YJUA 3SEOA 3I9V9 3SMZA 1RCOB 1JJHA 3W63A 3N79A 3V4IB 5F8IA 1BUXA 4LF6J 1WEYA 5THWA 2C2DA 4JV2A 2CPXA 2KN4A 1PYTA 4K0KJ 1WHVA 2QO3A 4IOBA 2WONA 4PUOA 1N5YB 2DR5A 1B0TA 4AQYJ 4ZPDA 4F4WA 4EZ9A 3R9LA 4DSLA 1HQEA 3EDQB 4KPYA 3MEGA 4K5RA 5BR8J 2EK1A 1T95A 3LWLA 3NCQA 2RQKA 3SV3A 2EKNA 1EETB 1KRPA 2GC8A 1X5TA 4GKKF 2DNOA 1RTHB 2ROGA 3CJ8A 3AJDA 4LRAA 2B7BB 4LT6A 2ZH1A 3OTCA 5HP1A 4JI8J 1Y3KA 4K4ZA 2LQ5A 4OHWA 4RW6A 4NXNF 1JKHA 3KNGA 3O5TB 3AY0A 3IBWA 3LP2B 5F8NA 3M9OB 3K7RA 2HVIA 1NUEA 2C28A 2OPRA 4CP5A 2GQQA 3FBEA 2MKSA 3OD2A 3NOCA 3I87A 5J2MA 3OSPA 3IP0A 1G7CB 4M8LA 1L3VA 1J5EJ 4OYOA 3I56S 2HNYB 3KLEA 3CJTA 4EUVA 2RU3A 4URSA 1NJZA 1E6YA 4NRUA 2UVWA 2GIFA 1UPPA 3G8SA 3TWZA 2WSFC 1RK8A 2VFRA 2DNLA 2Z8QA 3C3LA 1RTDB 2DO0A 2ZDPA 3LGNA 2Z2YB 4LFAF 3TW0A 4L6V3 5LMNJ 2VG6A 3T3FA 1CJKA 2P2CB 1EARA 1WC4A 3RB6A 3OFHA 2F3JA 4O3SA 3BN4A 2Y3YA 4RBTA 2J9DA 4U7UK 4JYAJ 2ZUGA 1V3ZA 3BB5A 3DCAA 1IR1A 4M94A 2BKNA 1Q86T 1JJCB 3FNNA 1YLXA 2VQEF 3CMES 4DL3A 2CA9A 1CEZA 4A8QA 2WW4A 2VG7A 3NGUA 3K8WA 2QLWA 4FKXA 1KDNA 5D15A 1KTVA 4PYAA 3OR2B 2ROEA 2DRBA 2ZE2A 4K2XA 3ILJA 3JXOA 4JI1F 4PYDA 1TV6A 2X3DA 1Z2LA 5BYSA 1T3NA 1Z4UA 1VBKA 1NCLA 3W2VA 4KO0B 3PW4A 1FJEB 2WCXA 3UVJB 1TZ0A 2OKQA 4ECTA 2EBGA 5KFGA 1NHKL 5A6PA 3LANA 1FFSB 4Y28C 2FY8A 3V5RA 3D1QA 2FVQA 4RU2A 5T7LA 1YRUA 2OO4A 1H72C 3OR1B 3W65A 2HHWA 3M2RB 2X1BA 3G6ES 1VC0A 3BO3A 1HARA 1DTTA 2WBRA 4ES1A 4LVNP 3TO8A 3QIPB 4LF8F 3KNAA 3I32A 1Y10A 3FK4A 2GJ2A 8ATCB 2NZ4A 6FDRA 2GHPA 3WC2A 5KG2A 4Q43A 4W90B 3HHLD 3GONA 2AGQA 3K5PA 2W7OA 2XMMA 2FTRA 1UFWA 4NLUA 2YQ0A 3M7VA 5ETTA 2IHR1 5D4NA 2I9SA 3B6BA 3PR4A 2MQMA 1RB0A 1NEEA 3GYGA 4K59A 3GIJA 1E6VA 2F5GA 2D9PA 1VFJA 4KFBA 4ZVOB 4JI6J 1X4HA 3W3SA 4TY8A 2NS1B 4OI6A 2XTJP 4K2JA 3TOQA 3L3CA 4ZHRA 2VODA 2OPQA 1CPZA 2QMXA 3MECB 4MKYA 2LA6A 5B0GA 4DR5J 4KV8B 2XQCA 4MIWA 3TYTA 2JC0A 1SV5A 3BSAA 4USJC 2DH9A 4DL0C 1YIJS 1JLQA 2YX1A 1VBZA 4UOFA 1NJIT 4XIUA 4JI0J 4GKKJ 4DZ6A 3N6MA 4NLTA 1NM2A 3QSIA 1N5QA 4J9RA 3ZZTA 2ZH4A 1QAXA 2KJWA 4LSLA 5E41A 4BWMA 1FRJA 3FSYA 2ZOGA 2C2NA 3LP1B 7FDRA 1R0AB 3CCES 4OMFG 3HD1A 2H4WB 4CNZA 4DZDA 2QFJA 5L9XA 3CGIA 5C25A 1FK9B 4L76A 1RHKB 5F8MA 4MH8A 1SC1B 2KB2A 5H1SV 2NSBA 4KRWA 5CYQB 1UZHA 2DGXA 4H4OB 5KFFA 2RNEA 1WELA 2WRMA 2M52A 3EDRB 4OZ1A 5FIIA 3K8VA 4TVAB 1URNA 1IXKA 4UOGA 4IQMA 1X4GA 2IFXA 1REGX 4H4MB 2FGCA 1FRHA 1RT1B 2IRXA 2UUAF 2VV5A 2RQMA 3N6LA 1UEVA 1S6OA 3MR7A 4ILLA 3NY0A 2WOMA 2HEKA 4LF5F 3R7NB 3MMAA 2M2BA 2MKHA 3M8ZA 1K1SA 4HHJA 1DQAA 1ZPVA 4OHYA 2L08A 2IPOB 3TARA 2UUWA 2KM8C 4F50A 4MTPA 4C8NA 2BR0A 1R0BG 4NX9A 2HS4A 1BQNA 3DDNA 3PY8A 4RNMA 1DQ8A 4RUHA 1VBYA 3GP9A 3CCLS 1S57A 2MZRA 2CPDA 2DR6A 1B7YB 4L75A 2QIFA 4C3KA 2HWTA 1QLNA 4DEZA 1G2EA 2V4QA 1ACMB 2XZWA 8RUCA 4DR1F 4ZPCA 3J80Y 3OTOJ 3O44A 3R6LB 4W98A 3M9NB 1YK9A 2B0GA 3I0SB 3B8HA 2CPZA 1HBOB 1FJCA 4IFYA 5A8WB 4DJBA 1P9QC 3MPWA 5CCLA 2ZH5A 3MHYA 4DS4A 4J37A 1WJ9A 3KK3A 3CPWR 1H2VZ 2K06A 2XY5A 3PIOQ 1ZM9A 4LF8J 4F2SA 3BGRA 2KJVA 1CBKA 4NXMF 3THVA 2QT7A 4KQZA 4O4GB 4Q2MA 2R2RA 2IA6A 1MWQA 4QW8A 1JNZB 4CO0A 2A2DA 3GV8B 2OD4A 3QT5A 3VCDA 3CTRA 2R7TA 2OI2A 2ZH8A 4LJMA 2E66A 3A12A 4OHZA 1HNVA 4XPEA 4I68A 4XDDA 4KGVB 4DUYJ 1OQ6A 1DTQB 1NDPA 3Q86A 1KFSA 3X1LB 2H5IB 3PO4A 1KLMA 1FE0A 1C4AA 3NS6A 4YEAA 2Z2MA 3SYZA 3PACA 2UZAA 2N3LA 2V2KA 1WKJA 4IR9A 3OJSA 4BBYA 2FLNA 1HHSA 3NBPA 3FQLA 1Y9OA 4HHUA 2I1RA 1D3WA 2BRKA 3POTA 2HHQA 2GW8A 2OSRA 4P2MA 5C42A 3AXMA 2ZC3A 1HNIB 1VRUB 4NOHA 4KAIA 4KH0B 4OJ1A 2GCFA 3CVKA 1G4CA 1IKYA 2DY1A 3T5LA 4YUDA 1IKXB 1LWCA 4ENOA 3C66A 3I82A 2FLPA 3V81A 1U8WA 4U7CA 3OUYA 4K7QA 1UJ6A 3AQOA 2HYIB 3TZZA 1M5SA 2OMLA 1RGVA 4LFBF 3J80U 1U1LA 3UN2A 2AX0A 3LUYA 4B3SF 1U1QA 2XG8A 4PG7A 3E01A 1YZ7A 1S9FA 2UUAJ 2P9GA 3CDBA 4ZP6A 1R27B 3UFCX 1KQSR 3VAGA 4NLRA 3KJVB 2CZ4A 2XO7A 2ZM6F 3HSDA 3CC7S 4LQ3A 4CYUB 5EWEA 1NSQA 3DU6A 1J5OB 3F41A 1JLCA 2YX4A 1UW9A 2HWHA 2ADBA 2E1AA 1ZTTA 2RS8A 1ZA2B 4AE5A 4ECXA 4P10A 3EMTA 2L9WA 1RDRA 3C6TA 3H5YA 2HFZA 5DQGA 2YKQA 4RWXA 3OSNA 3KHLA 1PGZA 1SJ3P 3C8YA 1S76D 4FF1A 3UQSA 5FDLB 3CD0A 5CD4H 3QRPA 2V69A 1JLAA 3Q8PB 3CCWA 5JUMA 5GADU 3HHNB 1FKAF 2AX1A 2MLYA 1S0MA 2IJRA 4ZCMA 3PW5A 3MR2A 1VJQA 4G1PA 4PQUA 4RW8B 1SH2A 1QJHA 4B3MJ 4Y0FA 3P49B 3DDKA 4NZ6A 2W25A 3MEDB 2QLBB 4QPXA 4OYXA 3DYAB 2H48B 4RL1A 2YNGA 2QYCA 2K3KA 3GQCA 1D1UA 3V6HA 2BW2A 4M95A 2WVEA 4NLVA 5J2QA 1RKIA 2VFTA 3WIUA 4PXCA 2PI5A 4HTJA 2G1DA 3QFWA 3LW5C 3AA8A 4NXMJ 4ZS6A 1IQTA 2LLZA 2O66A 3NKYA 4CCHA 1FDAA 5B0EA 3SSQA 4C0HA 2NYIA 1K0TA 3D6TB 2NCKL 2GFFA 3JYTB 5F0UA 3M8QB 4CQ1A 1HD0A 2HMIB 1EAYC 1H7XA 5K9FA 1VQ4S 3ICLA 1UTAA 4IKAA 4DR7J 2R2TA 3DLKA 2IVMA 2B4PA 4LFCF 3IAS9 4XDCA 2BXJA 1YBAA 2QMUB 1FRIA 5IV3A 3CJSA 2CQCA 4ZITA 2HNDB 1K0VA 3TNVA 1S72S 3PX0A 1QAYA 4P52A 1GXLA 3TA1A 1NZ8A 2DBBA 4RX6A 2DIUA 4IFVB 3T41A 4QU7A 4WPAA 2LEBA 3VAMA 2E9ZA 2XI3A 3M1VA 2I0XA 3BV8A 3MAQA 4DSKA 2K8GA 1V5IB 1RCXB 1S1XA 2W9CB 4IQXA 2Y9HA 1G3OA 2XS7A 4MK8A 2XHCA 1U1OA 3JSBA 4LR8A 1YDLA 2XNQA 1TR0A 2D9OA 1FD8A 3RAXA 2EFPA 4NZ7A 3KLIA 2NXEA 3KLFA 1ZOTA 2DHAA 1UAWA 2VG5A 3GCWP 2ALZA 4FYVB 4YR0A 3WZ0A 4I2QA 1VHIA 2BJDA 4EBDA 4ZJQA 4NLWA 1N8RT 1Y5NB 2FIUA 2MQPA 2G0JA 2DNPA 1SXLA 3M32A 2RMLA 4FVCA 1JJ4A 3H5UA 1S7IA 1XTZA 2WK4A 4BDPA 1NJYA 1UVNA 1Y00A 5BXIA 2GA7A 1BQMA 2ZHOA 3HPOA 4J9SA 3BDEA 3ENQA 3HULA 2J7WA 4Y2KA 1NK5A 4G1QA 2DXDA 2G0IA 3SZ2A 1UVJA 1RT4B 3VTIA 4JI3F 2L9NA 4PG5A 1MWZA 5CCMA 3A8EA 3H2LA 1S9GB 5AXKA 1GAOA 3HVAA 4UUWA 2U1AA 2HS3A 5HATA 2KYXA 1LEOA 4ZVSB 4O23A 2E7VA 4Y2AA 1R3NA 1KHWA 3MPVA 5LSOA 3CIZA 3R5CA 5L1JA 2V50A 2I5JA 1OWXA 2LP4A 1G6BA 5JMNA 3KFWX 1UMJA 1A6LA 2XC9A 1U2FA 2G4BA 4FYDA 2UXCJ 2R7WA 4LF9F 4IG3A 1C1BA 3I96A 3EXYA 4Q0BA 2WONB 3PZPA 1AB8A 2H51B 5KFIA 4FXWA 4LRCA 3JQKA 4ECRA 3IBFB 2N4DA 1RWUA 4YY3J 1HQEB 2YWHA 1XNQF 1SC3B 2FD2A 3GG0A 3MEGB 2MKCA 3Q0AA 3RUBL 2UVUA 1SH3A 1XMOF 4AXJA 1L3UA 5L9NA 4ZN3A 4MK7A 3HO1A 4FBTA 1ITPA 3HDSA 1VQ7S 3DOMA 3RBZA 2X7IA 5CYJA 4DHVA 2EW9A 3Q24A 3KUHA 1U0HA 3OXFA 3C6UA 2B6AA 1DZ5A 3I5BA 5HP1B 3UR3C 4AFFA 2OEKA 4RW6B 3HHLA 3FZ2A 2XLKA 1VQYA 1IBMF 2AGOA 2MEWA 3F73A 2H3EB 3W9IA 3GR1A 1VQOS 5LJ3Y 1IQZA 2OPRB 3OFGA 2UVVA 1NPRA 4HI2A 1SL2A 4CIOA 2QV6A 2BVZA 5J2MB 3EVMA 3CCVS 1CVJA 1SPBP 1LK7A 4USVA 4OHVA 4UQGA 3R2DJ 4ES3A 5T41A 1URRA 1WF0A 4R0EA 1Q8KA 2J0WA 3SDEA 3KLEB 3M8PA 3N4WA 3CB4A 3G6YA 1E6YB 5KFKA 4DLEA 2NREA 1ZM4A 1RTZA 2YBVA 1WC6A 4FPRA 3RJMB 3T6BA 2I6WA 4MYTA 3ZXWA 2N82B 4JBCA 4I56A 4I4BA 1RU1A 3EGNA 3CJ4A 2FJBB 4ZLJA 4KHMA 2VG6B 1Y0HA 2K3IA 1CJKB 4K50A 2IVYA 3VR1A 3I31A 3ENWA 5LMUF 5EGYA 4LREA 5GAHI 3ZTRA 2GIRA 3SCIE 1TQLA 4OZJA 4CRJA 4DX6A 4X2BA 1Y4ZB 2PEHA 3Q8RB 2GGPA 2EPIA 4RNFA 3UI3A 2HAIA 1U1MA 4B17A 2LQJA 4YHHJ 3HKZD 2JDJA 2B9EA 5KG5A 3AXKA 2VASA 2JVOA 1FDBA 4WFZA 4UT4A 1X4EA 1KHVA 1RWOB 2VG7B 5J1EA 3IR6B 3IWNC 4JV5F 3W61A 1U49A 2G9OA 1KQFB 3O8WA 7FD1A 2IYIA 4C6AA 2DNNA 4CLSA 3I4PA 4LSNA 4DV1F 2ZE2B 2C42A 1TV6B 1MNEA 1V3SA 4ID8A 1KEKA 3TJ9A 4WYWA 3RRGA 2B4OA 2ZZTA 4J5OA 3MTKA 3W2VB 1ZS6A 4D3GA 3R1HA 2VKZG 1T9UA 3CWJA 4FBUA 2J9DE 3FUYA 3KJNB 1DAXA 3QO9A 1IM6A 5IC4B 1PKUA 4ECYA 5T7LB 2E44A 3FMBA 4F0KA 3U1NA 4PG6A 4JI3J 1D0EA 4F4XA 4FS1A 4OYZA 4O44A 2XLIA 2QA4S 3VHQA 5ETPA 1IKWA
chains in the Genus database with same CATH topology
1S6QA 1N36F 2N7YA 1DTTB 4ECUA 2HMIA 1JLCB 1X9MA 2HHPA 2ZH7A 4C8OA 4EWTA 3Q2SC 4YB6A 1M5VC 3N9UC 4ED2A 4ECVA 4Y65A 3L95X 3TUIC 1L5UA 3QJJA 1HR0F 5IQ6A 2V4JB 1ROFA 3NAIA 4F3QA 3HVRA 1S1TA 3DRXA 4YB7A 1JLEA 4KGMA 2IM0A 2XI2A 4CTAA 4OI2A 4XPCA 4IUFA 1NNDA 1U09A 4K4SA 2AQ4A 1V3RA 3FGVA 4YDXA 1C2PA 1XERA 2AYEA 3PEHA 4K4YA 4L72B 4WF9Q 3JTPA 1TKDA 1UVMA 3K5MA 2XS5A 5GAGU 3OTDA 3TVZA 4R5PA 1VBXA 3DI6B 5KG1A 4DN0A 5LXYA 1JJ2R 4LMZA 5I3UA 1L3KA 2DGSA 2HNDA 1DLOB 2WB4A 2O1PA 1UA0A 1T7PA 2HZCA 4QWEA 2BE2B 5IT0A 3BQ2A 1JIHA 2JLEA 3OXLA 1HBUB 5D4LA 4EO8A 5DG7A 1XBWA 2GMLA 1BGXT 2VPWB 1HWUA 1E6VB 1WD6A 4RZRA 2RS2A 1U7LA 3MOZA 4DX8H 1REVB 2MZTA 4IFVA 4KIAA 2OH2A 4B3OA 1RQ0A 4KFBB 2V94A 3RU0A 2Q66A 4OIXA 4NWBA 3IR7B 3MWBA 4ILMA 3ENVA 3IAM9 2COLA 3LPYA 2CJ9A 1WTBA 1F5CA 1NKEA 2UUCF 3CCJS 2BOPA 3H8YA 3PHEA 3G6XA 5E0OA 3T5KA 4CO4A 2BYCA 3B4DA 5LMNF 2IMWP 2XMVA 5J1PA 3GMGA 3S6EA 1HBMA 4ZHRB 3OPKA 4DSJA 3K0JA 4DPOA 5D4PA 2HLUA 2V9KA 2DNRA 2VFSA 2OPQB 3M6WA 2QZ8A 1HFEL 4ZPVR 4G6VB 3DRSB 3MMBB 5M2PA 3PKMA 2W9CA 4KR0B 3GFZA 4RNHA 1NK4A 2KH9A 3RAQA 1MROB 2OTLS 1LW2B 2OFHX 5F9NA 4CT9A 3RB3A 2DGVA 3HHLC 3LH2S 1TK0A 1S1VA 3CJKB 2DGTA 4KT0C 1SV5B 3ZZPA 4K4VA 2X1GA 3MM7B 4NLQA 2YKNA 2IMOA 2MPUA 3IA0A 1SJRA 4WXOA 3NLCA 3OL8A 1C1CA 5B09A 1FDDA 4QOTA 1JLQB 4ZP9A 2ATLA 4A8FA 4V19J 2M9KA 2YVSA 1U26A 3IGVA 4F8RA 5KFZA 1T05B 1TL3A 4Z37A 1D8YA 3G9CA 1VQ5S 2CQHA 4HKQA 1NK9A 1M5OC 1FXRA 3MGJA 1R31A 5HROB 5MLCV 3ETOA 4F26A 1FNOA 3C46A 4JV1A 2DHGA 2QA1A 4NLYA 3EPIA 5A0YA 2CPJA 1K73T 3VAFA 2F9DA 3M6XA 4KKOB 1XNRF 4LSLB 3GWCA 4OX9F 1R43A 4E98A 2P5VA 2CPFA 1HMVB 5C24B 2W4DA 3I6PA 2ASYA 1BWEA 2ZJRQ 1LFPA 1HWLA 4A4JA 3P5TL 5A8KA 2CDQA 2HQIA 4A8YA 5HL7Q 5KFWA 2ZOMA 4BCAA 4L3NA 3JSRA 2EFVA 1X9SA 4QIEA 2N4CA 3DU5A 4C0BA 2MKIA 2IM3A 4TLQA 1YQHA 3SCKE 2F9JA 1ZAWA 2W8LA 2VKRA 1SKWA 1WG5A 1KNZA 3DM2B 5E3RA 1IKVA 1N54B 2IBOA 2AF6A 2UUBF 4X4SA 4NA2A 5AE1A 1GX5A 3G4SS 1ULRA 1WEZA 3PX6A 2B5JB 2OPSB 5A2QY 1S10A 5C25B 1MMDA 1U6FA 4YHHF 1FRLA 5B0FA 3CJ2A 2D7SA 3N5FA 2XY6A 1BLUA 3EZUA 2KRBA 3GE9A 4A8OA 1QVGR 1V9OA 3HVTA 4DQIA 3GFXA 2NPIA 2LQBA 2UV8A 5B7WA 1TVRA 2WW8A 2PO4A 5A8RA 1XC9A 4ECSA 5EWGA 5HLFB 5AXLA 1TKTA 4QIWD 1A7GE 4DBQA 4I1TA 1LFWA 1RT4A 1S9EB 3OL6A 3RB4A 4OX7A 2LMIA 3H25A 3CCSS 2RE1A 4LQ9A 2I2YA 1R8BA 4CO5A 4KBIA 1DBDA 2CPHA 4O3PA 3CJ3A 1S9GA 3BO4A 2HG4A 4RW9A 3T19A 5KT5A 3MM9A 2C3UA 4GC6A 1UWBA 2IA0A 4C7QA 5AXMA 4EBCA 1LXJA 1BD6A 3NMAA 3C2PA 1VS3A 1QVFR 3IG1B 2VC0A 1SUQA 1VJWA 3VZIA 1YJUA 3SEOA 4FS2A 1Y3JA 2ADCA 3I9V9 4R8UA 2FVPA 4WFXA 1SKRA 2EK6A 2MJUA 3SMZA 1N32F 3CDAA 1JJHA 2E5HA 3KK2A 5DM7Q 2O3DA 3GIIA 2B56A 4ICLA 3AH6A 2CQIA 5IM0A 5F9LA 3N79A 2DNQA 3V4IB 4K4UA 5F8IA 5KG4A 1LWFA 1S79A 2ZD1B 4LF7F 2E7WA 1WEYA 4F3OA 5THWA 1UA1A 2HGNA 2C2DA 1HBNA 2CPXA 4E0DA 4JV2A 2RILA 2KN4A 3ISND 1L3SA 2WSCC 2CVEA 4EBEA 1LOUA 2WOMB 4O4GA 3VWSA 5IXUA 2CQ4A 5LT5A 5KFVA 5KFHA 2W9BA 2ASDA 3G8QA 1WHVA 3MMAB 3FFIB 2XCPA 2R8KA 2QO3A 1X4FA 4IOBA 3MR3A 2WONA 4PUOA 1N5YB 2DR5A 1B0TA 1FEHA 1JWWA 2HNZB 1OSDA 4ZPDA 3DLEA 4ELUA 1X4BA 4UUXA 4F4WA 3IR5B 1FVSA 2POKA 3ONQA 4KC5A 5DM6Q 1YRTA 3TAQA 3TA2A 4EZ9A 2RT3A 1VMBA 2MQOA 1TL4A 2FHJD 4IH6A 4ZCLA 1SKSA 4DSLA 1FRXA 2NQPA 3HKWA 2DH7A 1HQEA 3D0HE 5L8RC 5HQ8A 3H5XA 3PW2A 5DJBA 1FCAA 3LWMA 2JLFA 4KPYA 3MEGA 2MZSA 4K5RA 2VA2A 1RTIA 2EK1A 1T95A 3LOUA 4RBUA 1APSA 3LWLA 3NCQA 4GC7A 4DWIA 2RB7A 1BQNB 2G0CA 2DPIA 2BQ3A 2RQKA 4DL7A 4USHA 5J2NB 4IOCQ 3SV3A 2E1MC 3QAUA 1XK8A 2BQRA 1EETB 2AJQA 1MWYA 1LQ9A 3MCSA 3TANA 4B9UA 1KRPA 5K8MA 1UW4A 2LA4A 4F2RA 2R8HA 3L09A 2GC8A 3DN9A 4J9QA 1X5TA 2CFXA 5IT9Y 1RT7A 4RW7A 1VHFA 3V6KA 1JLGB 4GKKF 3QGGA 4DG1A 2DNOA 4DSEA 1IUJA 5FD1A 5KFJA 1RTHB 2ROGA 4EFAC 3IC1A 2UXDF 1NJXA 4WYLA 2E1RA 1N5VA 2B7BB 1QE1B 4M63A 4QIVA 4LT6A 2ZH1A 3OTCA 2HQ3A 4OV1A 1KQGB 5HP1A 3MPYA 1Y3KA 3PRDA 3VQSA 2L3MA 4K4ZA 2XMTA 2XWYA 2E9RX 1MMNA 2J0SD 4FF2A 2LQ5A 4OHWA 2FJAB 3W2WB 4RW6A 3OTBA 3MEKA 4N56A 3NNCA 3B4MA 2LXFA 4NXNF 3OW2R 2NR0A 4ZLPA 3IRXB 1JKHA 4K50A 3KNGA 1JXEA 3O5TB 4O4RA 3AY0A 3IBWA 1UJ4A 2ZH9A 3R5AA 1GXUA 4I6WA 4NMLA 3ZZYA 3RW6A 3LP2B 4M5DA 5F8NA 4IFYB 3I0RB 2JL9A 4W92B 4IH7A 1YG0A 3M9OB 3E2EA 2B4UA 3GZ7A 4KJIA 2P9EA 4RWWA 3K7RA 3DLGB 4MYUA 1VRUA 1SJFA 2HVIA 2CPYA 2K1RA 2AJ0A 2RDIA 2C3PA 2XBPA 4A48A 2C28A 2OPRA 3DOKA 4WK3A 2GQQA 2RRAA 3K58A 1Q8LA 2MKSA 2X51A 1MU2B 4NLSA 4OLOA 2M8HA 3IO1A 4ECQA 5F0WA 2DGOA 3I87A 1X0PA 3HP6A 4ELTA 3LP0B 2E29A 5J2MA 2QSWA 4PXBA 4WIIA 2DNMA 3O1LA 3OSPA 3FDSA 3WC0A 5KG7A 2MQQA 1G7CB 5K14A 5KFUA 1JLBA 3BSOA 3BGRB 4C3LA 3MEEA 3BSNA 1YJVA 1B0PA 4I7FB 2M70A 1NK6A 4X4OA 3LF0A 4J9KA 4WFYA 1C0TA 4M8LA 2BACA 5KFOA 2CQBA 1L3VA 5D4OA 5F8HA 3D1OA 2V8DA 3KKFA 1HI0P 3I56S 2HNYB 3KLEA 4DQPA 1F60B 4EUVA 4EZ6A 4G3IA 2RU3A 4URSA 5LJ5Y 1WF2A 3HF5A 1NJZA 4Q0BB 1E6YA 5L1KA 3NRBA 4NRUA 2UVWA 4DFMA 5DG8A 3KTQA 2D3UA 3IS9A 4I2PB 2FVRA 3BEGB 3TX8A 3G8SA 5CHCB 5A6WA 4Z2XA 2WSFC 5D78A 1RK8A 3T9ZA 1KR4A 4ALZA 4HVZA 2QE5A 1HNVB 2GIQA 1WTFA 2VFRA 1WHWA 4YFUA 2DGWA 2IAJA 2DNLA 1P1LA 1LW0A 2O5DA 4HEA9 4RU9A 1Q82T 3KLVA 2Z8QA 3C3LA 2XCAA 2DPJA 1RTDB 5T14A 1D9FA 4OJHA 2DO0A 2GV1A 2ZDPA 3QLHA 4NPOA 3DRPB 1GQEA 2YWEA 3LGNA 4N8OA 1S0NA 2KYZA 1NRKA 4LFAF 2I38A 1Q16B 4I6AA 3TW0A 4L6V3 2VG6A 1JNRB 4C11B 4QR2A 3T3FA 3NG8A 1PC5A 1KLMB 5F8GA 4NCGA 3RB6A 3OFHA 4X4QA 1YI2S 2F3JA 4O3SA 3BGLA 3T1YF 4QQBA 3BN4A 4CZCA 1Y7PA 4RBTA 1D9DA 2J9DA 4Q2LA 4U7UK 4C8KA 1W25A 3NCPA 4RBVA 2XSJA 2ZITA 1FKPA 5J2PA 6FD1A 4IG0A 2ZUGA 1V3ZA 3CEDA 3BB5A 3DCAA 4RUCA 4M94A 1Q86T 3PVXA 2MQNA 1Q4RA 3MTJA 3VF0B 1T8EA 4B9MA 3FNNA 2DCUB 2EI5A 5G0RA 5K5MA 2VQEF 3SSRA 2CJBA 2CQPA 5KOWA 5KFMA 3CMES 2MQLA 3CIMA 2OLWA 1D8ZA 1TUVA 3NBPB 4A46A 2EG1A 4DL3A 1TKZA 1CEZA 3DMJA 4A8QA 3JSMB 3SQGA 2FJWA 1T3OA 1XR6A 2BM0A 3ZZRA 5I42A 2VG7A 3POTB 3J7A1 4X64F 3QJPA 1AROP 3K8WA 2FPHX 5JXSA 2QLWA 5DLGA 2MGZB 3OV7A 5C42B 3BO2A 3IFEA 4K0KF 3HVWA 4F4YA 1KTVA 4BC9A 1OPZA 3OR2B 1LV5A 2VH7A 1FDNA 2DHSA 1SB6A 4HT7A 2ROEA 4AL6A 4IR1A 3HJFA 2DRBA 2ZE2A 4K2XA 4JI1F 1N6QA 4HT5A 3OJUA 1TV6A 1Z2LA 3I5CA 5BYSA 2F8HA 1Q1KA 3LGMA 1T3NA 4ZPBA 4F4ZA 3JTOA 2V5HG 4H54A 5FDLA 4OX8A 5CQGA 1Z4UA 4DQSA 1ZM3A 2CYYA 2YKAA 3EGWB 4KO0B 4QJVA 1OQ3A 4JI2F 3W2VA 3PW4A 1CQNA 2WCXA 1FJEB 1QTMA 4X66F 1TZ0A 2OKQA 3KG0A 4OZLA 1VQ6S 4ECTA 1RAJA 3K5NA 2EBGA 4O3RA 4B9SA 5KFGA 3M2VA 4EYIB 1LWCB 2MZJA 2DK2A 4Y00A 5A6PA 3KHRA 1AUDA 3LANA 5ITHA 4AUKA 2JWNA 4Y28C 5BR8F 2ZH2A 4GO7X 4B9NA 4YOEA 1CC8A 1U8SA 3V5RA 5B0CA 3V81B 2F4VF 2A3JA 3D1QA 4A8WA 3RRHA 2FVQA 3OUYB 4RU2A 1VQSA 3Q22A 1HWIA 2ZDOA 3HZGA 5T7LA 1YRUA 2BUNA 2CQ0A 2OO4A 4RKUC 3OR1B 2HHWA 3MM5B 1X4AA 3M2RB 2YNHA 3MUMP 3CXCR 3QGIA 4MFBB 3BQ1A 2X1BA 3G6ES 1VC0A 4TXSA 3BO3A 4N5SA 1HARA 3DXBA 1C0UB 3N01A 1DTTA 2HLTA 2QMWA 2WBRA 4LIWA 1VK3A 2ILYA 4LVNP 2RF2B 4OQJA 1P8GA 4ES1A 2VBYA 4TQSA 3TO8A 4Q5VA 1M0SA 3QIPB 1RA7A 2ZKUA 1FNXH 3DHWC 1R6YA 3AA9A 4DF4A 4IRCA 4LF8F 2V4JA 3KNAA 3I32A 1GH8A 4MKBA 2GJ2A 2KFZA 2J6UA 2JEFA 2NZ4A 6FDRA 2GHPA 4PXEA 5E3CA 3M8SA 3WC2A 5HBMB 5KG2A 4UW2A 3HHLD 4YB5A 3E01B 4JI8F 2OAUA 4Q43A 4QWAA 3K5PA 4ETXA 2AGQA 2W7OA 1WNEA 2XMMA 2FTRA 3NWGA 1UFWA 3EGZA 2PD1A 4B9TA 4NLUA 4V19X 3HI9A 3DI6A 4CH7A 2IHR1 4F02A 5D4NA 2I9SA 1DLOA 3CJ0A 5KAKA 3PR4A 2MQMA 3U27A 3UDCA 2ZHBA 1U1KA 1NEEA 1FVQA 3CCRS 2YY3A 2D3OR 5CYMB 1HBUA 4ZCIA 2L9DA 4IO9Q 4OL8A 4K59A 1Q7LB 5D77A 1SJ1A 1PC4A 2XMJA 4KB7A 3DNCA 3GIJA 1E6VA 2D9PA 3RAMA 4QWBA 1D9AA 1REVA 3RZAA 3TAMB 1VFJA 5K8PA 4KFBA 2RIJA 2A2CA 1X4HA 2ZHAA 2P9CA 3W3SA 2XWXA 4TYAA 3J7YI 2VBXA 5JVGQ 4TY8A 2HHHF 4YQWA 2NS1B 1W2IA 2C2RA 4X4NA 4OI6A 3IWXA 2YTCA 3TOQA 5J1EB 2FJXA 3L3CA 4ZHRA 2VBWA 2KI2A 3SCJE 3A1YG 2OPQA 4NLGA 2YKPA 2VODA 1CPZA 2QMXA 3MECB 4MKYA 1QUPA 3C6TB 3GYXB 2NUHA 5KFEA 3DRSA 2FC8A 3MMBA 2DGUA 2LA6A 5B0GA 1J5EF 4B9VA 2CJAA 4KV8B 2UU9F 2CRLA 4LF4F 2HVZA 1KS2A 1MROA 1FEEA 1LW2A 3VAKA 2QSFA 2VPZB 4MIWA 4ZK7M 4DV4F 4FF3A 2X1AA 5DETA 3TYTA 2JC0A 3CJKA 1K8AT 1SV5A 5KFPA 3MM7A 4DUZF 2YNIB 3BSAA 4N41A 4USJC 4XK8C 2DH9A 4DL0C 3MMCB 1YIJS 3N28A 3H4DA 3D0IE 4DR3F 1JLQA 4DL5A 1N33F 3WX4A 2YX1A 1HNXF 1VBZA 3PNIA 4JI5F 2MYFA 2KO1A 1NJIT 3NNAA 1F2GA 1T05A 1H2UX 4XIUA 2ZBCA 1N48A 3MI7X 1LKZA 4MK9A 1JLAB 4ECZA 2C3MA 3N6MA 4NLTA 4P2SA 5HROA 4OX6A 3P96A 3OHBA 1N5QA 4J9RA 2PMHA 1RT5B 3ZZTA 1JMTA 3LALA 2ZH4A 1QAXA 4C8MA 2DCLA 3X3UA 2RSQA 2XNRA 5ADZA 2KKHA 3PR5B 2KJWA 4KKOA 5U47A 4ZDNA 4LSLA 1VGYA 1S6PB 1GT8A 4PQUB 4MAKA 2E5IA 2J8AA 5E41A 5C24A 4BWMA 5DG9A 5GAHU 4DR6F 4O3QA 1FRJA 3KOAA 1T03B 3FSYA 3H2VE 2V8VA 1YJRA 1HQUB 2ZOGA 2HVHA 3T5HA 4UOCA 4EO6A 1FE4A 1OIAA 1VRTB 3LP1B 3S8SA 1UP1A 3BM7A 7FDRA 1R0AB 5F41A 2JX2A 4JOUA 3MM6B 3CCES 3DM2A 3FQKA 4OMFG 1FTRA 2YNGB 4OHX<