4QYZJ

Crystal structure of a crispr rna-guided surveillance complex, cascade, bound to a ssdna target
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
195
Chain Sequence
MRSYLILRLAGPMQAWGQPTGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSESVQFAVRCDELILRRVSVTGLRDYHTVLIQTWREYLCDASFTVALWLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQPQKALLNYEPVGGDIYSEESVHLKFTARDEPMITLPRQFASREWYVIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/dna/rna
total genus 38
structure length 195
sequence length 219
ec nomenclature
pdb deposition date 2014-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qyzJ00
4F3MA 4U7UK 3VZIA 4QYZJ 3KG4A 4R0JA 5CD4H 4N77A 3VZHA 5H9EJ 5H9FJ
chains in the Genus database with same CATH superfamily
2J0WA 4N5SA 1ZETA 1WJ9A 1TVRB 4U7UD 2D69A 2XS7A 3VCDA 3N5FA 3AOAA 2DGWA 3SDEA 4B3RJ 2JLGA 2G9OA 4GO7X 1TKZA 4LBPA 3Q0AA 4CI0B 5EX3A 1Q16B 4DSLA 4OQJA 3R3TA 2UU9F 5FLXY 2QV6A 3H5UA 3JSBA 2AKWB 3UW1A 1WG5A 3LP0B 3ISND 4J9MA 2XHCA 1HNVA 1N5QA 1TKXA 2X1AA 5I3PA 2MLZA 1L3TA 4UW2A 3UD4P 1SPBP 1RHJB 3IM8A 4KE5A 4RNMA 2M70A 3QAEA 4OI6A 4ZITA 2W2PP 2GIFA 3VV2B 4N76A 4HI2A 2CQGA 4HVZA 2KFZA 3MEGA 1UETA 2VKZG 1YBTA 3ET6B 1RXOB 1VC0A 4MMOA 2OHDA 1YJUA 1RHKB 4UY85 4EGLA 1UW4A 2DBBA 3MMAA 5IZHA 1XR5A 1HNZF 2MQ8A 5KFCA 4FF2A 2M0GB 5B0AA 3KUGA 5E3RA 3BKUA 1WEZA 1SH0A 2YQ1A 3MM6A 1PC5A 1VC6A 3AOBA 2C3OA 3DLKA 1FRXA 1V9OA 2O01C 3NGDA 4RUHA 1Y7PA 3I31A 3TA1A 4YQWA 4X4SA 1ROFA 2PE8A 1T3OA 2ASJA 2VQFF 2QZ8A 1BWEA 4E98A 4OHZA 2DHSA 2IYGA 4GMKA 4CO1A 1FJGJ 1WNEA 1FHTA 1FTCA 2QLXA 4CDIA 2YWWA 4PXEA 2KL8A 1RAHB 3L9ZA 4E0DA 2ILZA 3JYTB 1HWUA 1G1XA 1FRKA 1I94J 4NASA 1L5UA 2OLWA 3FQLA 3ZZ0A 1S5ZA 1VRTB 4OI2A 1GEHA 2KRRA 1K1SA 3IG1A 1CLFA 3RW7A 5EX0A 1CS4A 2DPJA 4P73A 4A8MP 3UFCX 4NEZA 1LWCA 4ECSA 5I3UA 3R27A 2ZBCA 1HBNA 1CULA 3WDOA 2BM0A 2HEKA 1S0NA 1YGYA 3EJMA 5IFMA 4J5OA 4FKXA 5HP1A 4GC6A 1HQUA 5C7PA 2AJFE 2RKIA 2DNRA 4BLGA 4G6VB 2YNFA 1P6TA 2MXYA 3J81Y 3RB3A 4DS5A 2VZ9A 1JLQB 1LW2A 3Q8RB 1AZSA 4EI2A 4LREA 2POKA 2DEJA 3NBPA 1KOHA 2KT5A 2DGQA 1IKYB 2ZBRA 4JOUA 1C1CA 1RT2B 1TTHB 5ETLA 1VQ7S 3THTA 2BKPA 3KHLA 3KG1A 1S59A 3K17A 1AUDA 1K9MT 4OI1A 1PAUB 3AXMA 2BQRA 3V2UC 3ILOA 2RHQB 3LP2A 4F0HA 1BQMA 1TKTB 3DYAB 4F25A 2PSZA 3TRGA 2Z0GA 3A3OB 2OMOA 2R4FA 3CB4A 4DR5F 4ZVFA 4DDFA 3KK2A 3ADAC 2XLIA 1U1OA 3V6JA 4LF4J 1QVGR 4K4VA 4FPIA 3CT9A 1PJ7A 3P96A 2XCAA 1SKWA 2VV5A 2EBGA 1YI2S 1CVJA 2HLTA 2ZOFA 4A8YA 1H3DA 4QU7A 2BE2B 1X31C 3BS9A 2ZFHA 2M9KA 2XI3A 1C0TA 4LFBJ 2WOMB 2AGOA 4OYWA 4LMZA 2ADCA 2OPRA 4CM2A 3EGVA 4OIXA 3SIPB 1NMEB 3D6MB 2ROGA 2FHJA 3MZIA 1BWVA 4NCGB 3R2CJ 4CLSA 1CS4B 2HVEA 1ZPWX 2IJNA 1XIQA 2Q6BA 3DRSA 3HJVA 5D0EA 1CQMA 1Y3JA 3T3FA 1XQIA 2JFDA 3OR1B 4UZBA 2EC2A 1YBAA 4X4TA 2F3JA 4LVOP 3DLEA 2QYGA 3H5SA 4YMEA 1RAIB 2FJVA 2ILYA 1IM6A 4R0EA 4CH7A 3M1VB 3CCJS 4JI5F 3CJ2A 3OVBA 2HG4A 2V6AA 2BJ1A 2NXCA 4NLVA 5LMUJ 4Y34A 2GIRA 2ZOMA 1ZBTA 2GVZB 3ZZTA 1KS2A 2PA8D 1H7WA 3PW5A 1XMOJ 1AZSB 1EAYC 1NEEA 4UY8T 5IC6B 3Q2SC 1V3RA 1BQXA 4DV1J 1O6XA 2XLJA 1C1CB 4ANDA 4USMA 1SJQA 4KY3A 3UCZP 2FLOA 2UVRA 4R8UA 2W2QP 3B6BA 4F2SA 1VOMA 1JKHB 4DV0J 4HH0A 3QSIA 4ECVA 4FXVA 3RRGA 1IJEB 1MWYA 2IDLA 5ETKA 4C48A 3IRWP 3TI0A 1AROP 2R7VA 1S77D 3HPOA 5HAOA 5J2QB 1X4DA 4LR9A 2X1BA 1BQMB 4MJKA 2JWNA 6FDRA 4K59A 1S6QA 3UVJB 2I2YA 1RTIA 3LPEA 3DRRB 3FMBA 2OEMA 2BRKA 2W4DA 2HS4A 2F1FA 4RU2A 2V4RA 2FC9A 1EHWA 3G6ES 3OXFA 1BXNA 4J9NA 2UXCF 4XAKA 2PIIA 5F8IA 4DPXA 5D3GA 2PI4A 2DY9A 3EUNA 1N36F 2DGOA 3VGUA 2HNYA 4NMXA 3MM5B 3DDNA 2EFVA 1YRXA 3PVXA 2MKIA 2XY7A 3PO4A 2RHSB 1FD8A 4LQ3A 2OD4A 2RUGA 5J1NA 4ZPAA 2HHTA 2IFXA 4K8RA 3BSCA 2D1CA 4O3RA 4F67A 2JC0A 3DRSB 2V50A 3NCPA 2J7KA 3C8YA 3BYPA 3EDRB 3DRPB 3Q22A 1U25A 4H4OB 1NUEA 3V6HA 1FF2A 1PAEX 2ZD1B 5JVHQ 1IKWB 3D7SB 1U2FA 3VHQA 5SZTA 3T1AA 2LXFA 2AEMA 2GMHA 2YWGA 4FYWB 1YBUA 4C0HA 4B3SJ 2QL9B 2JLFA 3EWGA 2A6OA 1SJRA 3SQGA 3R8YA 1EZZB 2EKNA 1HHTP 4NYZA 4O4GB 4C11B 1SJFA 2QFJA 2FJWA 5K8PA 2FHMA 1OJ4A 3GV7B 1S1UB 2HHUA 1G6BA 4LF9J 3FBFA 5KFPA 3H2VE 2EI5A 3GJQB 1FNXH 5IT4A 4QR1A 4TU8A 2HQCA 4C0OC 1NLKL 2BE9B 2MJUA 4ZPDA 3VVTA 4QJVA 1E6YA 2BANA 2UUTA 2VFTA 4USUA 1VIXA 1RTIB 2HHHF 1U0HB 3F0NA 2AD9A 3VF0B 2CPHA 4AL6A 4GVLA 2FY1A 1HKAA 1UVKA 4ZPTR 1D8YA 4WJBA 4RBTA 3LO3A 5A8RB 3CXCR 2J9DA 4K2XA 1VRUB 2YNGA 5DDQC 1YJ7A 2QLFB 3D6TB 3TUIC 5CAAA 1X5PA 4P2SA 1Y10A 1DAXA 1U1NA 3H90A 4X4PA 3TA0A 3CCQS 1KLNA 4I6WA 2J6UA 4DXLA 1FKOA 3R5GA 2DPIA 4EU0A 1VQ8S 3Q86A 3HHNB 2MY8A 1RT5B 3UD5A 5E3PA 5CA5A 2XO7A 4Q8FA 3AD7C 3DNCA 4IR1A 5CCLA 4KFBA 5CZXA 1IWAA 2O1PA 5C2CA 1B4SA 4G3IA 2ZJQQ 1B0TA 3V6DB 5HROA 1X4AA 2W2OP 3FJ2A 4W92B 4LFAF 4LF5J 2JEFA 1VQ5S 1KOOA 4JV0A 1YJRA 3DDIA 2FLPA 2F8MA 2J8SA 1C1BB 3QJPA 1M5OC 2HQDA 2C2RA 5CYMA 4AXIA 2WK4A 1MN9A 3I4PA 1M1KT 2DT9A 1HWIA 4KSEB 4X4UA 5C24B 4JB8B 4J9VA 1FESA 3K58A 1HI1A 2B7BB 2W9CB 2VQEJ 3IP0A 1S1XB 5AJ3F 1OY9A 2A10A 4DEZA 1OPZA 1SC3B 5FLXU 5J2NA 2JHEA 2VC0A 5HVHA 1UZDA 4EBEA 2CQ0A 1EIYB 2UUAF 3TOQA 2C2EA 5B0GA 3HVAA 1WF0A 3GILA 4DN0A 5L1LA 1NB2A 1U47A 2ZH6A 1ZM9A 4JI2J 3UDEA 1NZAA 3KLFB 5J1PA 3C14B 4C8KA 2R8IA 4F4WA 1HIYA 3IBFB 1FDDA 5KG5A 1HBMA 3NMAA 2GX8A 5J2MA 1RWPB 3GG1A 2ALYB 2YWHA 4OYPA 1RWNB 2HNDB 3IBCB 1FWKA 1NM2A 1DY3A 2E5IA 5DS7A 2K3KA 3NL0A 1P27B 5D4LA 3UDVA 3MEEA 4P2FA 2C3MA 3H4DA 3A1YG 2B9YA 4ED6A 3CJ3A 3AOCA 3EVWA 1A6LA 1QJHA 2J7WA 3HSDA 5HL7Q 4OYIA 3CJ0A 1RTJB 1WELA 1X0PA 3BM7A 1H73A 4PG5A 1X8DA 2X3DA 2HNZB 1LNQA 1Q82T 3MM9B 3GSIA 2KO1A 5JVGQ 3WZ0A 3D67A 4JYAJ 2HFSA 2MHEA 1NNDA 4ZPCA 3OVSA 1RT4A 3ZTRA 3NEKA 5BYQA 1SH2A 2NSBA 5IXUA 1RWKB 2C1EB 4LSLB 3US5A 4DI6A 3KG0A 3BZQA 3D0IE 4F3OA 4M5DB 3MECB 3PYGA 1K47A 1TMMA 4RW4B 1HBUA 2ZH1A 5C5JA 4KT0C 1S9EB 2HWIA 1JJ2R 2RNEA 4TU7A 4WE1B 2B9XA 1P9YA 2KTQA 2GQ2A 3K89A 3AJ1A 3N6NA 4ZOSA 1ELOA 3TVKA 3DKDA 4GKJJ 1NJYA 4DR1J 2BABA 5E3AA 4N56A 2H51B 1NSKL 2AJ4A 2PFDA 3DLHA 5F8NA 2GJ2A 1W26A 4NA3A 3T9ZA 2V9KA 2J0SD 2MEWA 3FGVA 2FVRA 1S0MA 3MPDA 4ZDNA 1DQ9A 5KFAA 3J81U 1Q53A 2XC9A 2ALZA 1EX8A 2VPXB 4WZMA 4P75A 2CZ9A 4LIWA 1UVNA 1XMBA 1JMTA 3DU5A 1X4FA 4WFAQ 2A18A 4QR0A 4KGZB 4A47A 2MB0B 4MK9A 1SI9A 1ZM2A 3LWMA 1K1QA 2IAJA 1ZOTA 1RA6A 3MEDA 5ETMA 2R2RA 4TYBA 2DHAA 3PEJA 2RRAA 2HPUA 3AH6A 4DN9A 3JS9A 2B8QA 3AQPA 2VOPA 1CJUA 1KC8T 5A8KB 4P9SA 1DURA 1NDPA 3HSZA 4FYVB 2D41A 1RAJA 4OX8A 4KR0B 3MCNA 3FDSA 2ZNZA 3OXLA 2XB2D 2CYYA 3GFXA 4BCAA 2GO8A 2IVFB 4IG0A 4C97A 2BBEA 3SFUA 4QU6A 1S97A 3ZZZA 1K73T 4QWAA 1SV5B 3Q8PB 3KHRA 4ZPBA 3OL6A 4PUOA 5H9EJ 1R31A 1AW0A 3BQ0A 5HVFA 3JSMB 3CO9A 5I42B 3C2PA 2Y1JA 1N33J 1X60A 5CYQA 5KOXA 2LEPA 4G1QB 1GX6A 1WEYA 1TL3A 6AT1B 2FC8A 5DLGA 2E1PA 2Y0SD 1FCAA 2MTLA 5DG9A 4DV6F 2GQCA 2CQDA 2UV8A 1SKRA 1S6PB 2XULA 3DOMB 1J5OB 4FS1A 3HFVA 4DG1A 5GAEU 1KDNA 2N7YA 4B3OB 2DCUB 4NRUA 3HP6A 2LEAA 4RJVA 4NCBA 3CC2S 1M5PC 3KMQA 4DL4A 2WVBA 2VA3A 2WONA 1WHYA 3V81A 4M5GA 4ETZA 4G65A 3CJ4A 3I0SB 4JI1J 4CLKA 1IR1A 3HHLC 3G82A 3CJSA 2AU0A 1JXLA 1YJVA 4QWBA 1GX5A 1TMJA 2MKCA 4ECQA 4NYOA 3FRYA 2ZH2A 2IBOA 4IRDA 1REVB 1MMDA 2F7VA 3THVA 3AD9C 2EPIA 3HHLA 4FVMA 3KK1B 4A4JA 3MM7A 4PYDA 1QSYA 3M32B 1F3VA 3VR1A 4ZVGA 4L74A 1MU2A 3MR5A 4TLRA 4B9SA 2BACA 2LVWA 1NDCA 3MEDB 3G8QA 1WDDA 1QDUB 2YKAA 4OX9J 2GJIA 3KLVA 3HT0A 1SJ4P 4O0IA 3DHXA 4WPAA 3QT8A 2AT1B 2WBMA 3CW2C 4CYUA 2YX4A 2YXLA 5CXTA 3ZZRA 2BJ7A 2Z8QA 2NCKL 5HMWA 4IG0B 3GIRA 4ZP7A 1QLNA 2KXHA 4KBIA 2MQOA 2W7PA 5J1EA 3W9HA 3M8QB 4X4OA 4ED1A 4DL6A 1UWBA 4P52A 4KGMA 4NL5A 4OZ1A 4PQUA 2DR7A 2CQ4A 1RAEB 1N88A 2Z4PA 3FCVA 3LTOA 4J9PA 3TEHB 5GADU 4WFYA 5IQ6A 2JDJA 2LP4A 1JLFA 4BWJA 4WU3A 1H6KX 1GQEA 4I4BA 2CA9A 1X4GA 1T05A 1QAIA 3QAUA 1UEKA 1BY9A 3D3BJ 4IO1A 2KXNB 4YEAA 2R7TA 3T1YF 3KKFA 4ZVSB 4U6PA 2XLKA 4AQYF 4DG1B 2RILA 1ZAWA 4CZCA 2ROPA 1KVIA 3MPWA 4RNFA 1RT7B 4E8UA 2QC3A 3ENWA 1T03A 1VBYA 4J9UE 3GIKA 2XEXA 4TU9A 4DBQA 2XI2A 3H7HB 2HZCA 3V81B 4EYIB 2DRBA 5RUBA 3HFZB 1LWFA 5LT5A 5E41A 4J37A 2CQBA 2D3UA 3R5DA 2I0XA 3GR0A 5LXRA 4DR7J 1VHFA 3FNNA 1JLGA 1LEOA 8ATCB 4ILMA 2DITA 3LGNA 1L3SA 4DMZA 2VJUA 3DCAA 3TQEA 1HMVA 4ZCKA 5KT7A 1F60B 4OYBA 2LEBA 2F9DA 1QVFR 3KOAA 4DR2F 1S1VA 2W9BB 1U1QA 2ZHBA 4B08A 2HFUA 4L3KA 1RZMA 2EG1A 4N41A 5IC4B 3PEHA 2R8GA 3M2UA 4NA2A 1RTZA 2CPFA 1F2GA 1SC4B 1TELA 1UVJA 3AB4B 1TL1B 2OKQA 2B56A 5EWGA 5BR8J 3GZ7A 2RD5C 3G87A 1YLXA 3FFIB 4OYAA 2HHSA 4KGXB 4YDDB 1S7HA 2DH9A 4J9KA 2CJKA 4BS2A 5IWAF 3HCXA 2HAIA 1ZA2B 1CG2A 4DL7A 4PXCA 1YJNS 3M8PA 3NCRA 4UUXA 4WFBQ 4ZPVR 4YHHF 2YWKA 4M5NA 4R5PA 2AYBA 2Y0BB 4L6V3 1BMQB 2BXJA 2CPJA 3TANA 1N54B 4HEA9 3TJ9A 2OTLS 1QTMA 3C6TB 3CCLS 3KJNB 3IS9A 1FFGB 2VDIA 2HVIA 5ETNA 1U1RA 3QO9B 1IUJA 1RHRB 1G4CA 1Y5NB 5L1JA 1WG1A 2Z2YB 2UUBJ 1CJVB 1J2VA 3H25A 2B0GA 2HIQA 1FK9A 2HW3A 3TNVA 1VK3A 2UXBJ 2W24A 1GXUA 2AYGA 1HHSA 4EZ6A 2ZE2A 1B0PA 2O3DA 4YY3J 3QATA 1YG0A 3OVAA 2JLEA 2J7UA 2F4VJ 3C15B 2NXUA 2L9WA 2LKZA 2ZJRQ 3D68A 4CLZA 4MKBA 4P7TA 3G9CA 3AT1B 3OFHA 3H5XA 2V63A 4USHA 3ZTOA 3RJMB 4DFJA 1C2PA 1GFWB 2EW9A 2UP1A 2CNOB 2GHVC 1S10A 2QMUB 4A8FA 4JP8A 4V1Ak 1SXLA 4IR9A 1TFWA 2WB1D 3W2VA 2AZ1A 4NLYA 4QOTA 2VG7B 3SCKE 2YNIB 4EEYA 2OD6A 3SMZA 4P71A 4PWWA 4I0WA 1GNKA 2LXIA 3CVKA 4L73A 3CD6S 1RGVA 4W98A 5GAHU 2CNLB 3LOUA 3MI7X 4B9MA 2DK2A 3E01B 4IRCA 2CQIA 3MR7A 4UZCA 3KLIB 1JLAB 5C2GA 3KFWX 1S1WA 1Q5VA 5F8LA 3QT5A 4OZ0A 4DUTA 4F36A 4P2MA 2E1CA 2N4DA 4Q5VA 1G7CB 3QJJA 4R5PB 3K5LA 4X84A 3C66A 4HDGA 1B7YB 4DU8A 1TV6A 2VIHA 4I2QB 4O44A 2RRBA 3CIMA 4DQIA 5K8NA 4USWA 1M5VC 1C0UA 2FJXA 4WYWA 1SQEA 3D1HA 5LSLA 3QZ7A 2UV8G 1QE1A 4I67A 1FXRA 1TL7B 1FRIA 3POTB 3SEOA 4JI7F 2IRYA 4DR4F 1TQLA 1IBLF 4ER8A 2VA2A 4KHPF 1GH8A 3BN7A 4IDKA 1Y5LB 4M5JA 1GXTA 1K8AT 1RTDB 1RT6A 1FX4A 1H74A 1OO0B 2Q43A 2HVZA 2YKQA 5B0EA 1JLBB 3UN5A 1NK9A 2HS3A 4HH1A 2K7KA 3SI8A 2DHXA 2FQQB 3T1HJ 5C42A 1NBEB 1T94A 1FXDA 4AUKA 4OJ1A 4NMLA 1XWLA 3UD3P 3PXGa 4AXJA 1RP5A 4QIWD 4LR8A 2MZQA 4RPFA 4RW9A 3N5BA 1BQNB 2AQ4A 2LLZA 3HO1A 1CEZA 3CMES 2E9ZA 5DGBA 2NQPA 3M2VB 2ABYA 4WFNQ 2E5GA 1CBKA 1RBLA 2Y9HA 2HHWA 3T5JA 3CDWA 4OI0A 2HRYA 3B4MA 2DGTA 1PYOB 4BDPA 3KTQA 1K44A 2AGPA 1ZA1B 3PACA 1NXIA 3N28A 3ZO7A 4DWIA 5KG7A 3OT9A 2V67A 2GGPB 1EP4B 1RK8A 3R5BA 3KDOA 4ZLNA 3BH6B 1PBAA 3NGSA 3J7Z5 4AE5A 4ED7A 1TK8A 3CIZA 4PPDA 4GKKF 2Q79A 2VG5A 1LQ9A 3M6VA 3TWZA 4DV7F 4HTJA 2XWYA 2VFRA 3L95X 2RT3A 3TR5A 4NI2A 3P49B 1QAJA 2XNQA 7FDRA 2E9TA 1NU4A 1PC4A 2Z2MA 4ATNA 3HZGA 2W4PA 2HGLA 1CJTA 2EFNA 5EGYA 4LF7J 2IMOA 2DXFA 3QGHA 2YY3A 3IGVA 4KV8A 2A2CA 4WK1A 4OV6A 1QD1A 5KFJA 3M4XA 1NJXA 1FA0A 3QFHA 2ASYA 2IJRA 1EARA 2J5AA 4IDKB 1NJWA 1I1GA 4N77A 1VQNS 1E6VA 2AIRB 1NKCA 4YN3B 2B8PA 1HNZJ 4ZVQB 2VICA 1N8RT 2CVIA 1HW9A 4CO5A 1HR0F 4M5KA 1CC7A 2A0FB 2MKSA 4NWBA 4RW7B 1H98A 2IIHA 2VHGA 1AFIA 1UFLA 1T3NA 1SC1B 4AL5A 3W8PA 1N52B 4ITSA 4ED3A 4WF9Q 5IT9Y 1FFWB 2OPSB 1KEKA 4C3LA 2GA7A 2IHR1 4I56A 3PCOB 4ECYA 3TVZA 3HD2A 3NNCA 4CLPA 4DCOB 3W61A 3FC9A 3VGSA 4DV4F 5F8JA 2DO4A 5HJYA 3PX0A 2OSQA 3TAQA 3QBCA 2ATLA 1NRKA 4WTYA 4X4NA 1B70B 1S1TA 4HDHA 5D0RA 2ROEA 1BC6A 1N0UA 2F5GA 1NPKA 1MNEA 3CCES 4GC7A 1T9VA 3RBDA 3PYEA 3IR5B 1Q7YT 4I2PB 1U48A 5HLFB 3HM9A 2B5JA 3NY0A 4CLWA 2ERRA 1RLCL 1U24A 3K8VA 4EUVA 1XBWA 1N5TA 3OR2B 3PR4A 4CH1A 2OI2A 2VG5B 1DRZA 1M1HA 2JH3A 4RBUA 3GFYA 4WBFA 5H1SV 2FZKB 1QM9A 3FBCA 5AXMA 3I82A 4ILLA 4YUDA 2QGFB 1CC8A 1X0FA 1JWWA 2RQCA 2D3O1 3AXKA 4F0MA 1XK8A 3TYTA 3AHPA 4DL2A 4A8OA 2WZ1A 1WORA 2FVSA 1NK8A 2DNNA 3NS7B 1F0XA 2D9OA 4LFBF 2QO3A 5KG2A 3GV5B 4OZ2A 4LSZB 1VC5A 2DY1A 3NOCA 2H5JB 4LBHA 4M5HA 5K14B 1XNQF 3LA0A 1VBKA 1YRTA 2EFQA 3PJWA 2XQCA 4FP9A 4I7FB 5T7LA 1CPZA 2V8GA 2KXFA 3UI3A 2Y1IA 2K2PA 5JUMA 3QYYA 4NYPA 1O8BA 4ERDA 4DV2F 1U8SA 2OIHA 3D5MA 2RMLA 1RTHB 4GVBA 1D9AA 2HWTA 2HYIB 1VS3A 2WVEA 3JQMA 3DMJA 4ECXA 2C2NA 4U67Q 3PKYA 3MHYA 2MMYA 3M30A 3OHAA 3KJVA 4DS4A 2LMIA 5KFQA 4IG3A 4MYTA 3BGFA 3RAMA 1Q4RA 4BC9A 3MUVP 1H72C 1S7IA 1VK8A 1WOOA 4CRJA 2HHXA 3CCUS 1T9YA 2NPIA 1RJJA 3ETOA 1WWHA 1RYSA 3DOLA 4MK7A 1M5HA 1ZS6A 5ADZA 1BLUA 2XMWA 3I0RB 4DV0F 2H54B 1D8ZA 2M8DB 3J7ZT 2V94A 3AJ2A 1TR0A 3VAGA 1F1BB 2ZKTA 4Q0BA 1HI0P 2RRNA 5KG6A 3RRKA 2LDIA 4H4MB 3MAQA 2XSJA 3KNGA 3CDAA 8RUCA 3KLHA 1YK9A 2A2DA 3I87A 5IT0A 3HMJG 3MMCB 4DJBA 4DU7A 4YB7A 1MWQA 3LALA 3O5TB 4OYOA 1GTHA 4L75A 1U1KA 4P74A 4JI5J 1NK0A 3MPVA 4FKYA 2CQCA 2DNOA 3CJKA 4ED2A 5ETTA 3MFHA 2W8LA 1XERA 3IRXB 2Z2LA 2FIUA 2IC3A 1JLEA 3DI6A 3O8WA 4KHRA 4CNZA 2DNQA 4K5SA 5DM7Q 1BUXA 3TAMA 2M7SA 3OHBA 2J6TA 1VLYA 3MMBB 5T7LB 4WKRA 1Q78A 3C6UA 2DGXA 1DLOA 1ZPVA 3TAPA 2RH3A 2KJVA 2W25A 2ZWOA 1JJ4A 2BJ3A 5BYSA 2LQ5A 1YWXA 4B17A 4QZVB 3T5HA 1UVIA 4J9QA 2F8HA 2RDDA 5FJ4A 3QLHA 3QFWA 2BJ9A 3EGZA 1HYSA 3DOKA 3CJRA 4KO0A 3PO5A 1W2IA 1R0AB 3RAXA 2R2UA 2VG6A 4IG3B 3U1MA 4B3SF 3H98A 2KB2A 2NLWA 5E3CA 4ZLPA 2KM8B 2LCWA 3PYFA 2MZSA 2OAUA 4RW8B 4ICLA 1RU2A 3DOLB 2UXCJ 1PO6A 1GMWA 2LFVA 2EC0A 3UPFA 8AT1B 3C19A 1N36J 2YKMA 3HVTA 4TQSA 1HQEB 2VBXA 2HRUA 4LF8F 1R7IA 2KYXA 2I5JB 3ZZPA 1TP7A 3G6YA 1LK7A 1N5YA 2WAQD 2MKJA 3EDQB 3KG4A 2BW2A 5D0GA 4WFZA 2IM1A 2IDEA 4J7CA 2MQPA 1RWOB 4CTAB 3KLHB 4B02A 2AGQA 4NZ6A 2BKNA 5IM0B 2YPZA 2V2QA 2P6TA 1IN0A 4N7TA 4X66F 3DLLQ 3DFEA 1D9DA 2QIFA 3H40A 1JLCA 2G1HA 4LSNA 1OIAA 5LM7E 3NCQA 4Y0FA 3CJKB 4PXDA 2ZHAA 3W3SA 3Q89A 4B3MJ 2N3OA 3OTEA 1UVMA 2QRRA 2YBVA 3AAWB 3EX7B 1JLEB 2HBQB 2DNZA 3DI6B 2JEIA 2NUHA 4CLFA 2UVVA 4LFCF 2DR6A 2OO4A 3HI9A 3TAMB 5H9EK 1Q81T 3OFEA 4AL7A 3BV8A 4Y00A 5KAKA 4LF1A 2H3EB 1OYEA 2DCLA 2G13A 4ZJOA 1H7XA 4MK8A 3EVMA 5DETA 3WHIA 3IXQA 2WW4A 2DR8A 2CZ4A 3ITHB 4ZHRA 4ECZA 4LF5F 3D3CJ 4PABA 2FVCA 4O23A 4X62F 1RWWB 3HKWA 2DO0A 1R0CB 5E0OA 3OSNA 1HYSB 4WP9A 4HACB 1SUQA 3OLAA 2AZ3A 1WSVA 1GXLA 3BKFA 2CRLA 2ZZTA 2VG6B 3D0GE 3BO3A 1UVLA 1RE1B 2SXLA 1RHMB 3BBCA 3JAMY 3R2DJ 3SSSA 2YQ0A 1SIZA 4UOGA 4NXNF 3EMTA 1IKXB 2YNHA 2I1RA 5IQQA 4USKA 5A8WA 4Q7AA 1M0SA 5FDLA 2VQEF 2YKNB 5C25B 3HT3A 1Z2ZA 2OSRA 2FGOA 2VB6A 3SBMA 3O6QA 2I38A 4NLWA 5LL6d 2EG2A 5B7WA 2J0QD 2AF6A 5CD4A 5D4NA 3JQKA 4DF8A 4WTOB 1VQPS 2R8HA 4ZVHA 4JI2F 3HULA 2GVDB 2GHWA 4XPCA 4NLOA 4DOZA 2HFOA 1DTTB 5GMEA 3EZOA 2R7RA 2EWHA 3LP1B 3M7VA 3K5MA 2KFYA 1APSA 2GC8A 4K0KF 4PR6A 5A0YB 2E1RA 3CMQA 2DYAA 1NDLA 2YH1A 5D8HB 4ZVRB 1EETA 5G0RB 4CLYA 1LK5A 2DXDA 3L7OA 4LRAA 1H2VZ 4RU9A 2B9WA 1FKPA 4PG8A 2V8PA 5AJ3J 2DISA 3L09A 2CADA 2NS1B 1Q8IA 4U8VA 4GO5X 1KD1T 3K7RA 2V8HA 2HGNA 3WQPA 4XIUA 5GAGU 2UUAJ 3R6LB 2ZBQA 3GONA 3PW7A 2NZCA 2PGCA 1FEEA 7AT1B 2NPFA 1Q5YA 3VAJA 4JYAF 3EGWB 2YQ3A 4U9RA 1MG7A 2C42A 4Y3CA 3CNQP 5K5MA 1EQMA 1RT1A 3OFFA 2M2BA 2RU9A 1XN9A 2KH9A 4IFVB 2LA6A 1FX2A 4N8NA 2VONA 4C7QA 2F63A 1X9SA 5SUHA 4CT8A 2GMLA 3MWBA 2YNHB 3A12A 3W2WB 2F4FA 3GJSB 2CPIA 2BQUA 4OJHA 1BD6A 2ZNYA 4WXWA 5FDLB 4ZN1A 4FXWA 5F0WA 1ZTTA 1JX4A 4QIEA 1UZHA 4DR1F 3ZZOA 1N5SA 1U2RA 2DGSA 5HMYA 3TZZA 2N82B 1FRJA 5IT9U 4NZ0A 4DQPA 4H4KC 4TLQA 3W60A 3RBEA 3A4TA 1I6JA 3FCHA 1SQGA 2VUGA 3PTWA 3QQCD 3UDLA 3GV8B 3SDEB 4H4KA 3S01A 4RW6A 3QIPA 2ZH7A 4OLOA 3B4DA 2CJ9A 1TKZB 3T9NA 2QA2A 3H2UB 4P72A 2H5IB 2JRSA 2GW8A 2M88A 1YZ6A 2ZDPA 4LT6A 2V9WA 1UEVA 2XM3A 2QX0A 2OH2A 5HQLA 3ZXWA 3KLEA 3LH2S 1HNVB 1TKXB 5CCMA 1JK9B 4RNHA 2F40A 3NNAA 4Z37A 3AQOA 4Y65A 1WC0A 3MR2A 3OTOF 1X9WA 4WYLA 4MIAA 3MEGB 4JI8F 1X4BA 4JI3F 2FY8A 2Y8YA 2D9PA 2AYMA 4XDDA 3MMAB 4W90B 3K2YA 2XMMA 3DHWC 2H4YB 2MLYA 3PX4A 3QNWB 3DRXA 4OFZA 1RDRA 1O0PA 3Q8SB 4W4MA 3MM6B 2DGUA 2AJ1A 3BR9A 3OW2R 2QTWA 2VPYB 3DLKB 3LUYA 1RT1B 3P8BB 4BWMA 1KWMA 1PBUA 4M1KA 4C8MA 4KTQA 1SH3A 1F3FA 2QEXS 4ELTA 2ZM6F 3ILJA 4A8XA 3O2IA 1NZ8A 4C2MA 2Y1RI 3NLCA 4BBYA 4RL1A 1HNWF 1N4LA 2DGVA 3N6LA 3U27A 2HLUA 3IMQJ 4NLQA 4O0NA 4C8ZA 5B0CA 1RI7A 2L9DA 1DTQA 3DN9A 1P1TA 3OD2A 4NRTA 2F65A 5KFOA 2YVSA 1KQFB 1FEHA 4FYDA 1X4CA 4QWEA 3KLGA 3IG1B 3J7YU 1NHVA 1N6QA 1FRMA 1JJHA 1LWCB 1WHXA 2P9GA 5KFIA 3GR1A 3A13A 4EO8A 3JSRA 5I3UB 2YTCA 2C2ZB 3BBBA 2QSWA 1HBNB 3NWGA 3FVYA 2JC1A 3RB6A 3QIPB 1CULB 1VQLS 2ASDA 4ECWA 2DEIA 1R3NA 1GMUA 2HQFA 5HP1B 1UEUA 1Y00A 3D0HE 3MM8A 5K9FA 3EZ5A 4Q2MA 1HQUB 3TARA 5AE2A 2Q6CA 2RKIB 2U1AA 1NK4A 4MH8A 3FMWA 1RWMB 2BJEA 2YNFB 3WC0A 1RKJA 5KFBA 1VYAA 1MROA 5K20B 1FDBA 1FE4A 2AJ2A 2ZDOA 4DV6J 3SCJE 2RVJA 2QA4S 1LW2B 3OLBA 3M9MB 3Q8QB 2PC6A 2DD8S 3QWUA 5I3QA 3UN3A 1N34F 2OELA 1IBCB 1S9GA 2FB0A 3GYNA 3NBPB 4UQTA 3C16A 2VDHA 3T6JA 1RHQB 1YDLA 1UA1A 4OYXA 2P9CA 4WCEQ 3CC4S 4I6AA 4MYUA 4XK8C 3A8IA 2WSEC 3VVUA 2DHGA 1XMQF 2IM3A 1CSJA 4MKYA 3LP2B 3E2EA 1WOPA 4HI1A 4CIOA 1YTYA 2ZH9A 4DSIA 4V19X 2MJNA 4EBDA 2BEFA 3CDUA 1JJCB 3KK2B 4ZLLA 4DZDA 4Y2IA 2K7JA 2JEGA 3CUNA 1X9MA 3EXYA 2VOOA 1WF1A 4IUFA 1C4CA 2XZTB 4F3MA 1G2EA 3SFGA 5KFWA 3OUYA 1XEZA 5HVGA 1C0TB 5CYJA 1TAQA 5I4MA 2PMHA 2CG8A 2MSTA 2OPRB 3GFZA 3J80Y 4ES3A 1CJKA 2HBZB 2FJDB 3PZPA 3BSAA 2KRBA 3KLGB 3QRPA 1HD1A 3TO8A 4QIVA 4WFXA 3CCSS 4OHYA 2ZVIA 4DV3J 4AFFA 1QSLA 5GMKa 4JI4J 4C8NA 5KFRA 1Y11A 3DGVA 2ZVSA 3GLJA 1DJ0A 3HXMA 4TY9A 4TY8A 2MQLA 5G4DA 1NO8A 3G4SS 2VFVA 2CJAA 3DLEB 3MM8B 3IR7B 4ZP9A 1NHKL 2OP5A 1FO1A 3I96A 5ETVA 2KKHA 3HX9A 4F4AA 3R7BB 4WP3A 2RF2A 3HZEA 2X7IA 3HVRA 4ZK7M 1R8BA 4DUZF 3Q23A 2AYEA 3OL7A 3V4IA 3W9JA 1NSPA 2VBYA 4KH1B 3VWSA 2ZWPA 3W7BA 4Q2LA 4J90A 3T1YJ 3RUBL 1F5BA 4AQYJ 1F6TA 4KB7A 4ID5A 1BGXT 2RQKA 2JFKA 3NXZA 1YJWS 3C16B 4HKQA 3BR8A 2G2YA 4R8UB 3ILLA 3BQ1A 5CQGA 3VZIA 2AWZA 5L1KA 2ZH4A 1U1MA 4OHWA 2P2CB 2BKOA 2CNNB 3BREA 2J9EA 4TYAA 3L4BC 3OL8A 3M6WA 1S6QB 2B7CB 1RU1A 3N4WA 5EWEA 1V3ZA 2V34A 3W62A 3QJLA 3OSPA 1M5SA 2BJ8A 3SCIE 1IVZA 2JZ5A 1VQ9S 4DX6A 4RO0A 4IOBA 4Z7CA 4HTIA 2VKRA 4Y2KA 1PJ6A 2DNLA 2KFNA 5HBMA 4ZVUB 4O3QA 3RW6A 4MAKA 3V4MA 3UCGA 1K0VA 1XNRF 3QT6A 1NJZA 5D3GB 1SC6A 3OUYB 2HNYB 4MKVA 2UXBF 2R42A 5L9NA 2PN6A 3TP2A 3GMGA 4K5RA 1UMJA 3OJUA 5DLFA 4DV5F 3GYGA 3BGRA 4E2FB 3KUEA 3N0VA 4C3MA 3P45B 4CNYA 4OHVA 2CWXA 5D15A 2LXUA 2R9LA 4JBCA 3JAMU 4HLBA 2YWEA 4O3OA 3U7JA 1KHVA 3PRVA 2HBYB 3K8WA 5IWAJ 4PQAA 5KFDA 4URSA 2HZVA 4TKTA 5KFVA 2NXJA 2V4QA 5KFYA 4NXMF 4LUBA 4X64F 4KKOA 4IOAQ 2L08A 5D4PA 4CLUA 3QGPA 4DF4A 3SQOP 2Y3YA 2E9RX 1B99A 3MAAA 2KVIA 2DVIA 3BB5A 5J2PA 1IR2A 1VLOA 2APOA 3SQGB 4UQGA 3KYLA 2QSFA 2RE1A 4K50A 1ZTWA 3DDKA 1IWGA 3CPWR 2V4JA 1YJTA 2FVQA 4HHUA 1HBOA 1N56A 3I9ZA 2AEFA 1PG5B 1F2HA 4EMDA 3I5BA 3VAHA 1IKVA 2CZVC 1S72S 2P6SA 1WI8A 2PD1A 3HF5A 1WTFA 4ED0A 1P1LA 2JJ4D 1TVRA 1RHUB 3OTDA 1FXLA 2J76E 3LGMA 1E6YB 1VR6A 1NHUA 2BANB 4ZCIA 4CO4A 2FZCB 4WK3A 4YDXA 5ETSA 4ZJQA 4PCQA 1JXEA 3S1TA 2R8JA 2G0JA 3DXBA 3EPIA 3HSJA 4P7VA 2IA0A 5HQ8A 5GAEI 5L46A 3X1LB 2YNGB 3W5ZA 3LP0A 3BDEA 2VFSA 2VH7A 1AYEA 2AMCB 4NLPA 4CO0A 2V2KA 2PI5A 1T9WA 3KNAA 2AHOB 5K8OA 4USIA 2MQQA 1FKOB 5HANA 4J9LA 1R89A 3NGTA 4IOCQ 4FN5A 1FRLA 2XZDB 1J5EF 5IV4A 1WACA 1P9QC 1TUGB 4KFBB 1N48A 4QQBA 5HROB 1RACB 2AX0A 2IM0A 4J91A 4DFKA 1RAAB 3MUTP 5KT4A 4EWTA 5LOQA 4QYZJ 3K59A 1V5VA 2ZOGA 1CQNA 3IA0A 3U1LA 3T41A 1RAOA 1YKWA 1IBMF 1SJ1A 1NH7A 3CJ5A 3X3UA 4IH6A 3QIDA 3DC2A 3R7SB 3ZFVA 5CYMB 2A3JA 2MZTA 4DCPB 3PW4A 3CDEA 1O51A 1RT3A 3P5BP 2QLJB 4G1PA 5IV3A 5T41A 4IO9Q 1MN7A 4FNHA 3E8OA 3CJTA 1Y5IB 1LWXA 4B3TF 5D4OA 3MDFA 2X51A 4JI7J 3JYTA 5L1IA 1R6VA 5J2NB 3QSYB 3M8SA 2HK2A 1ZM3A 2C22A 3CTRA 4QPXA 1IBLJ 2B4OA 1UW9A 1EKRA 4EZ9A 4RLEA 3IAS9 4Y2CA 2YKOA 5GADI 1VRTA 3T6BA 4DSJA 4KHPJ 1WHVA 2XBPA 4Y2AA 4B9VA 4O3SA 1I51B 1RKIA 2CQPA 2OMLA 2NZ4A 2P9EA 3PG9A 4LBIA 1HBMB 5JJBA 3FUYA 2R7OA 4J9RA 5J2MB 1S79A 2B3TB 1DARA 4ECTA 1BHNA 1UP1A 2NYIA 3QRQA 1VQYA 1SB6A 3PKMA 4K4TA 4LF7F 3BGUA 2WHOA 3MTJA 4K4UA 2GIQA 2PT0A 3MEEB 2J0XA 2XO6A 1UTAA 4PEOA 1PYSB 2L3MA 1KVJA 3VAIA 2HSEB 1V6HA 2IVYA 2IJFA 3H8YA 1JLQA 3LGHA 3IR6B 2MZJA 1Q8LA 1TK0A 1S57A 1NJIT 1FERA 1IKYA 2C2DA 1N32F 2ZBIA 2XYGB 1RT2A 2HS0A 3QWPA 1KBRA 3KDNA 4X65F 3J7A1 2OFHX 1IBKF 4DQQA 4WU2A 4ED5A 5ETOA 3IAM9 1QSSA 5D77A 4OZNA 2AX1A 4IYQA 4EO6A 2Q1LA 4YOEA 1TKTA 1BE4A 3DYAA 2WRMA 2XWXA 4WZQA 2V2ZA 1U1PA 3MF5A 3GJTB 5AXNA 1RT4B 4GKKJ 3GQCA 2CAJA 4DV7J 1EKSA 2XY5A 3MD3A 2DJWA 5A76A 4M5IA 1OQ6A 2WSCC 4DFMA 1VCTA 3OJSA 1YJ9S 1HBUB 1R8CA 1RT3B 4RUAA 2HHVA 4KYZA 3M9OB 3VAKA 1WKJA 3HVWA 2Z2ZA 4KGKA 1WKLA 3BBFA 4QIFA 1S49A 1VISA 1KQGB 3FBBA 2BE2A 2HHPA 1KFDA 1DQAA 2WOMA 3TX0A 5AXLA 1RISA 1NCLA 2C2MB 2B43A 4PKDB 2YPYA 2MQNA 1HARA 3NP5A 3H59A 4NCGA 4QCLA 2E66A 1R27B 4UF4A 2XMJA 3GTYX 1HR0J 3OR1A 4YFUA 5EWFA 2B9EA 3CCWA 2GFFA 3MAHA 3ZNUA 1FWPA 4JI0F 3NWRA 5F8MA 4LRDA 1FWLA 2QA1A 3HSGA 1X4EA 2IAJB 3M1VA 5F9NA 3PR5B 3NS5A 4OI4A 4QWDA 3F73A 3QT7A 4NLTA 1HQ2A 1VQ6S 2GVZA 5D78A 1CJUB 2OJ3A 4DV4J 1ZAVA 2NUUG 2OPPA 4LF6F 2CJBA 3NGKA 4RZRA 5DQGA 4JI6F 4QBUA 1LV5A 1IQTA 3BO2A 3IGNA 3EM1A 3PHEA 2VU5A 2V68A 5DG7A 2HVDA 1YRUA 3GJRB 4DPWA 1VJWA 2IRXA 4MFBA 2W7AA 1JKHA 3FQKA 4PUOB 3GSDA 4I68A 2MPUA 4O4RA 4YP3A 4ZCLA 9RUBA 5F3ZA 5J2QA 1HPZA 3CE8A 1PKUA 3BN4A 3Q8VA 2VJVA 1U1LA 1LWEA 2AJ0A 1QUVA 4F4XA 5CYQB 1NKBA 3UVJA 3J80U 2F9JA 3D6HB 3DRRA 1TL3B 1PJ5A 3FSIA 2XS5A 4BHQA 4DCJB 2WVCA 2XCPA 2BUNA 3TQ1A 2KT3A 1D1UA 3MCSA 2BE7D 5GAHI 4I1TA 4DSEA 5HN0A 5HO4A 1U49A 1R0BG 2ZZMA 5KG4A 1OSCA 2QFIA 2R7XA 3MM5A 2I6WA 2ACYA 2UUCF 2BOPA 3ICLA 4DUYF 3Q24A 1RWXB 2CUYA 2WONB 5LMNF 3TUPA 5JMNA 3HK2A 5B0FA 2R2TA 1XNQJ 4OYZA 4F4YA 1YHQS 3QGIA 3G82B 2RQ4A 2W2NP 2ZH5A 4JV5F 3RBXA 3LAKA 4ZS6A 1YX2A 3BPSP 1VIOA 3ONQA 4M63A 1TL4A 2R8KA 3MPYA 2BA9A 3VQTA 2D3ZA 3HHLB 3RR7A 3MM7B 2DHHA 4UOFA 3FRZA 3DRPA 3PYDA 4DV2J 4H4OA 4TVAB 5DGAA 4XDCA 4KPYA 3P4UB 1P8GA 3A8JA 1MU2B 4ALZA 4ECUA 2WSFC 1NDKA 1SKUB 2ZD1A 1LFPA 1IKWA 3MURP 3KK3A 4DQSA 1RABB 5U47A 3RU0A 4HT7A 3O44A 4OL8A 3CD0A 5GMDA 3UR0A 4WIQA 2GAGC 3TZXA 3FZ2A 2E5HA 3KMSA 4QPTA 1Q8KA 4KQZA 3ETMA 2OPPB 5M2PA 4NE9C 3PY8A 3MR3A 3LF0A 4CYUB 2QT7A 4O4GA 1NKEA 4ELUA 4C11A 2WB4A 1W7WA 1FD2A 2CQ1A 5J1EB 1RCOB 1S1UA 4MFBB 5ETPA 3TA2A 2UXDJ 4K7QA 3WX4A 4Z2XA 1UWBB 3GYXB 4EK2A 4PQUB 1HPZB 3N9UC 3IWLA 2E1AA 1LWEB 2MGZA 1FRHA 3I4HX 3G8SA 1JLFB 3JTPA 3RRHA 1U0HA 2KVQE 3PFOA 2VODA 1NPPA 1D3WA 4QW8A 4FYYB 1T05B 1T0TV 5A8RA 4KAIA 5DQHA 3PDNA 1VRUA 1WC3A 5BYRA 2LYVA 2HMIA 3LWLA 4PZVA 2YWFA 5KFTA 4S0MA 2BR0A 4FBTA 1T03B 3G71S 4DLEA 5F3TA 4DX5A 3KWMA 5MAOA 2XMUA 3R9LA 4F50A 5E7OB 2DR9A 3TJ8A 3R1LA 3UDCA 2H48B 2YX7A 2D3OR 4I6YA 1FTRA 1RT5A 1LWFB 4TXSA 1KQKA 4PYAA 3G8TA 3BPDA 1JLGB 3CULA 5HI7A 3ENAA 4DL3A 1WUUA 3V6DA 3OL9A 1RB0A 4OV1A 4DR3F 3DM2A 1FE0A 1TZ0A 3QGGA 2QA4G 1HMVB 3EPGA 4DZ6A 2MKHA 1PIEA 2DNMA 2J9CA 1S1VB 1IJFB 4IH7A 2J9DE 5A6WA 1C1BA 3M6XA 3KK3B 3GP9A 3I9V9 2K06A 1UFKA 4B3MF 1KTQA 2LDYA 3M2UB 2AV5A 3A8EA 4RR5A 3H2LA 1GT8A 3MCMA 2P8IA 3RBZA 2LQ8A 1T9UA 5C24A 5LJ5Y 1WC5A 3EXCX 2CQHA 4PG4A 2W9CA 1S48A 3CMAS 1RSCA 3FZBA 1S1XA 5EDWA 4OJGA 4DR6J 2RQMA 3R7NB 3LQVA 4LF8J 1GMWD 3TEGA 1AT1B 2DNGA 1RQ0A 5HK4A 4EYHB 2UZAA 2ADBA 2XMAA 3K0JA 3L3CA 5ETRA 3M8PB 1UCNA 2MGZB 3MD1A 2EVZA 1HNXF 2QLBB 5DZ7A 2GAHC 3KLFA 3FEXB 3C46A 3C14A 1PSDA 1WC4A 4QYRA 3I32A 2NYHA 3ENVA 3AY0A 3DRYA 2CNKB 1X5SA 2MDAA 4B9TA 3IS9B 4X66J 3W64A 1OYDA 2H4WB 3E3XA 3R5CA 4C3KA 3DXSX 2MZ1A 2C3PA 5HJXA 2G2ZA 2HMIB 2B4UA 3D9BA 2E1MC 2HNDA 1S4FA 1F9EB 4OZ5A 4ZN3A 3VGTA 1FK9B 2E5LF 4OZ3A 4B9UA 3FCWA 2C3YA 2VPZB 4DL0C 2ZUGA 3Q8UA 2ZE2B 5H9FK 1JQGA 1MMNA 3B54A 4LFCJ 1U6ZA 1ZM4A 1L3UA 2KZMA 3GG0A 4D3HA 4ELVA 1RTJA 3I5AA 2DIVA 1X5OA 1Q79A 2Z56B 3P5TL 1RWUA 1U6BA 2HNZA 2PO4A 3DM2B 4B3RF 1VHIA 3MM9A 2M3DA 1IM4A 3W9IA 4X62J 2FTRA 2ZH3A 2W01A 1WG4A 3UQSA 3PFEA 4DL5A 3CF5Q 3AJDA 5D0HA 3GB0A 5L9XA 3I5CA 3VAFA 1NK6A 3EYZA 2N7CA 4FBUA 3W2VB 2XNRA 4LSLA 1AA1B 4CWBA 2J8AA 3PNIA 3MECA 4M5DA 1Q7LB 3N79A 4RW4A 3KXDA 4JV1A 1S9EA 2DIUA 4XTTA 4ANEA 4NXNJ 3P3DA 2C2KB 2UVUA 4IFYA 1W25A 2H65B 3SCLE 1YZ7A 4WE1A 3DLBA 3NAHA 3MOZA 1NSQA 2P5VA 5KT2A 1U7LA 4NLSA 3BGOP 4X4VA 1FJ7A 2KU7A 5BJRA 2QL7B 1S1WB 2IY5B 2KI2A 1Q0NA 2JVRA 3FSXA 1M1GA 1WI6A 2OEKA 4NLXA 3CCRS 1KTVA 1KSPA 1TV6B 2IMWP 4F7VA 1VFJA 4KH0B 4O44B 2WBRA 1DHMA 1NK7A 3D2WA 2D7SA 2UU9J 3HHKA 4NX9A 4PPZA 4HHJA 2XYHB 3BKTA 1C0UB 5F8GA 1VGYA 4K0KJ 2CJYB 4LRCA 4A8KA 1FJGF 4FNIA 2BV3A 3I56S 3PJ9A 1QE1B 3JTOA 2EKYA 2Y1LB 5DO2A 3ZC4A 4ETXA 1EB0A 4N8OA 1T7PA 1K0TA 1I94F 5A8KA 1L3KA 2MY7A 3Q83A 3OXGA 2COLA 4U96A 4I69A 5KG3A 3IO1A 3OQ2A 2HKEA 1RT6B 5A2QY 2JSXA 1ZH5A 2V69A 1U26A 2JL9A 1SV5A 1AB8A 3GIJA 3IFEA 2QMWA 3GCWP 5CH7B 5C42B 3JSMA 1UA0A 1JXVA 1KVKA 4CO2A 5I42A 1OQ3A 1HL6A 1HLWA 1Z1ZA 1X5TA 2BM1A 3OPKA 1SL1A 1HWLA 4RW9B 3I6PA 2QL5B 3CJQA 1GTEA 4FZVA 1R8HA 2L41A 1VRQC 4G1QA 3RR8A 2GJFA 2CFXA 2FGCA 5KFZA 2AJQA 2VQFJ 3U1NA 3VQSA 4ED8A 1OS5A 2YX1A 1YVFA 4IH5A 4OX6A 4ZKAA 1S6PA 4IFYB 4ECRA 1UJ5A 3M8WA 4P6QA 2CG4A 3DOMA 1J5OA 3NGRA 3IC1A 4PG7A 4MIWA 4B3OA 3BSOA 2WVDA 5LXYA 4O3PA 1YSJA 1KONA 4OLPA 4FF3A 2JNJA 5DM6Q 4FF1A 1VI7A 2DXEA 1B64A 3CO0P 4OZJA 1F9HA 1MW7A 2RDIA 3MXHP 3HD1A 3CJ8A 3I0SA 1UAWA 1B3TA 1AFJA 4MKAA 2VL1A 1UL3A 3Q8YA 2ZC3A 1QUPA 2MQMA 4UT4A 3W1YC 3S7RA 2R7SA 1REVA 3DU6A 1M90T 4G1IA 2UVWA 3KK1A 1VQSA 4USJC 3C3LA 4NI2B 3M32A 4LF4F 4ZJLA 1S6OA 2HQIA 2W9AA 5DJBA 4K4SA 1JIHA 3KHGA 3BDPA 4JV2A 1CJTB 3BO4A 1NPRA 3FEZA 3SSQA 4KPCA 2VPWB 1NK5A 4KV8B 2IPOB 1S6UA 4A8SA 1KN6A 1T9TA 4DX7A 1D0EA 2LQ9A 3M05A 2FLLA 4FDFA 4IQMA 1U6FA 2NSCA 3OTOJ 3AODA 4DQRA 2EEYA 3QZ8A 4JI8J 3UR3C 4Y6IA 2G2OA 1GAOA 4JI3J 2HK3A 4PWDA 1E6VB 5FD1A 3JB9k 4RNOA 1SQFA 4B9LA 2QJ3A 3M8QA 1X7VA 4URQU 3PRBA 4PXBA 3KHHA 3FBEA 3TJAA 4USVA 3PM9A 1TU0B 2PEBA 2JOQA 5M2UA 1KNZA 3SYZA 3VGVA 3RTVA 2GV1A 4U7UK 4DHVA 2VD3A 1D9FA 4UOHA 2XMTA 4DR5J 3NKYA 2PA3A 3A3NB 2R3VA 5E2QA 5LMUF 2BYCA 3TUZC 3CGIA 2Z57B 4ZIVA 1RBAA 2X3GA 2ZM6J 2UUWA 1WD6A 1XMOF 1SVDA 4DLGA 1RA7A 4MTPA 4C8LA 3CCZA 1DFDA 1S1TB 3F44A 2RIJA 1HNWJ 4M95A 4YR3A 4DV1F 1RT7A 4NLGA 2GQQA 1HWJA 2FJBB 3OTBA 2M4MA 1RYRA 2B5JB 4LQ9A 2K1RA 1Z4UA 2Z58B 3EVOA 1B7FA 5KFMA 2EFPA 3CC7S 2WVFA 1LXJA 2FHJD 4RNNA 1RCXB 2CPXA 3K5OA 3BQ2A 3CD5A 4RX6A 1G3OA 2KT2A 3MTKA 3RG6A 4EFAC 2W9BA 3MPUB 2RSQA 4F4KA 1KHWA 3M8ZA 1PYTA 4O3NA 1U09A 2XTJP 2XHWA 2ACMA 5KFLA 1FVQA 1KP6A 2CPYA 3TX8A 1H38A 1UJ6A 4CT9A 3FEYB 1RWVB 2X1GA 1TL1A 4C6AA 2V8VA 1N34J 1HI8A 2Q3PA 3TZYA 1TKDA 3TW0A 2VC1A 5KFKA 4ZIWA 2RJZA 3MGJA 4PWDB 4F3QA 4QYZK 2QN6B 1V3SA 4DV3F 1VQOS 5A6PA 3FFIA 5THWA 4JI4F 3G6XA 2CPEA 2L48A 1TL5A 4FXDA 2OPQA 1C4AA 1XMQJ 4Y2MA 5KFHA 5KOWA 2OGUA 4C0BA 2W7OA 1DBDA 1WHWA 2E44A 4GVBB 3GCXP 4DSKA 4Q44A 3DMJB 1S0VA 2FZGB 1NB7A 2B51A 2R7UA 3M30B 3KJVB 4F04B 3C6TA 5KTQA 4RUCA 5B0DA 3VAMA 3QO9A 4Q43A 2W4CA 4RUBA 1LFWA 1JNRB 4KC5A 1WC1A 1CJVA 3EICA 1T95A 1Z2LA 3CCTA 5F8HA 5GAGI 2B4PA 2DTJA 3ZTSA 4AT1B 4LF9F 1DQ8A 1GK8A 4R0JA 2K1RB 1VJQA 4Q0BB 2RS2A 3M6UA 2E7VA 4DPOA 1UJ4A 1RLDA 2KJWA 4YR0A 2R2SA 4HHHA 3C15A 2XSJB 2FHKA 1FJCA 2LA4A 4N47A 1VQMS 1LOUA 3RAQA 2GS8A 4F02A 2K3IA 5FIIA 2RU3A 3JTNA 4NZ7A 5L38A 4ANCA 2DNKA 2AW0A 3BEGB 2HFVA 2NXNA 1ZYQA 1OY6A 2X1FA 4CH0S 4CQ1A 4K2JA 5KFSA 2HFNA 4DUZJ 1Q86T 2IYIA 5EN1A 2VG7A 2YNIA 4KJIA 3ENQA 3PJXA 2IC3B 3HHDA 3ZNJ1 1S99A 3DLGA 4ZA1A 3HDSA 3C6UB 2CQ3A 1DLOB 4R25A 1EQ0A 5E5NA 3SZ2A 2I9SA 3E01A 1RUSA 2OPQB 5KT3A 2E7WA 3D1OA 2CXEA 2FVPA 3BJYA 1WSRA 1V5IB 3KLIA 1JLAA 3ULHA 5HMXA 4NLUA 2EFOA 4C9DA 4M8LA 3PW2A 2V2VA 3QLHB 4ZVEA 3DOKB 4NLRA 2XG8A 2HHHJ 1L3VA 4KO0B 4TN2A 3NOGA 3SV3A 3BH7B 4P10A 5IOLA 3UN2A 2RS8A 3B78A 4A8WA 5KFXA 4I2QA 1Y3KA 4ZLJA 2RDJA 1KR4A 2FPHX 1Y0HA 2KG0A 4PWUA 2HGMA 2IVMA 4ICLB 4HYKA 2XYPB 5CHCB 1KRPA 2G4BA 3K5PA 1GMVA 2IBKA 1OSDA 4NCAA 1XNRJ 1A9NB 1MMLA 4B9NA 5F9LA 4Y28C 3PX6A 1TL7A 4RKUC 2YKMB 3HVTB 5E3QA 3POTA 3T19A 3IWNC 1ITPA 1FDNA 2DRAA 4DSFA 1AUSL 4PAAA 2AEJA 2R7WA 3NAIA 1PGZA 1N5YB 4DV5J 3HLUA 2H5EA 2CJXB 1RTDA 4DFPA 2GMJA 4URGA 3GE9A 4CLTA 1JLBA 4UOCA 5LJ3Y 2CPDA 5EHHA 3D54A 1MWZA 4LFAJ 2C28A 4YS2A 3UCUP 2CVEA 5LSOA 2O67A 2MKYA 2M52A 3AFGA 1JLCB 5T14A 1VBZA 2RUSA 4NXMJ 4LSNB 4LJMA 1HA1A 1WEXA 3G6VA 4X64J 2IM2A 3KUHA 1NSAA 4KIAA 1UKUA 5M2RA 1BQNA 2FD2A 5KT5A 5AE1A 3CCMS 3PRDA 3F56A 3MMJA 3N6MA 3PHTA 4YB5A 2EK6A 2DR5A 3M2VA 3OV7A 3M8YA 3BSNA 1XR7A 3DLGB 3J7YI 2CIMA 4LRBA 3GIMA 1T11A 3BGLA 2FDNA 4OMFG 5ETQA 1ICEB 3R1HA 2HHQA 1TAUA 3FKBA 3D1QA 4ZHRB 5F0UA 2GGPA 4ID8A 2MYFA 1AXQA 4F0KA 1EP4A 2W8KA 4F2RA 4WXOA 1FNMA 1FNOA 5AXKA 3CD7A 4K4YA 4C8YA 3R5JB 1HNIA 1URRA 1SUQB 3IWXA 1KFSA 1LXNA 1QAYA 3SV4A 3DGPA 2OEJA 4IKAA 1HD0A 4ZPWR 1UWAA 5DDOC 4ENOA 5KFUA 5A2QU 3NGUA 4C98A 3PV8A 1YITS 5DQIA 4L76A 2BVZA 5A8WB 4PG6A 4HR2A 2JX2A 5CZVA 3ZTQA 4OZLA 4NPOA 2V5HG 4GKJF 2A1BA 9ATCB 1TUWA 3AA8A 3ZTPA 4ZP8A 4ILRA 4QR2A 5HMZA 4Q45A 3H42A 2HQ3A 3ISNC 3R5AA 3RYLA 3ILIA 1J5EJ 2YH0A 1TK5A 2JVOA 3CDBA 4L72B 3HHEA 2FYXA 3Q2TC 2NREA 3MEKA 2BOAA 4LR7A 1FKAF 4WIIA 4OJ3A 3AA9A 1A7GE 1U2CA 3MFIA 2KHCA 1VQKS 2W1BA 2Q66A 3H4BA 1SIWB 2QMXA 3OTCA 4DX8H 4RW7A 2XMKA 2W2MP 3I55S 3U02A 1B0VA 1IBMJ 3J81j 3UNGC 2CJQA 4A46A 3QPIA 1KLMA 4BC7A 2WCXA 2OPSA 4HL9A 2ZUAA 3MUMP 1EETB 4WKYA 2HFZA 4YR2A 4DPTA 4F26A 4ZVPB 4ZCMA 1ZZNA 4CM0A 2LU1A 2BJDA 1FKPB 5F41A 2E7XA 4B3TJ 2E29A 3LANA 4K4WA 2DRDA 4OX7A 5B0BA 4I2PA 5HLFA 3TUJC 1Y4ZB 5D6GA 2G1DA 4KGVB 4FPRA 2N4CA 2LQJA 3B8HA 3AB2B 3ZZYA 2RAQA 3WC2A 2VF3A 1FT8A 2KHDA 2J6SA 4FVCA 3OR2A 1OY8A 1Q8BA 1HNIB 1N33F 1DZ5A 2WTFA 2OFGX 3DGPB 4QIGA 4LVNP 4M5LA 1QY7A 3CEDA 2ZKUA 5BXIA 1WKKA 4U8YA 2WW8A 5K8MA 1I5OB 5KFGA 3UO0A 5KFFA 1ZAXA 1EJ7L 3LAMA 3V5RA 5E33A 1RAFB 1URNA 1HWKA 3H0PA 3RGIA 2XGPA 1KQSR 3UNYA 4NLDA 4OHXA 2XMVA 2PMWA 4FS2A 2BRLA 2A6MA 2ASLA 5IS2A 1U8WA 1I3OB 3GFHA 1U45A 4F8RA 2OUGA 4M94A 4M5MA 2DNYA 5K14A 2V0NA 2PMZD 4JI1F 5GVQA 4LF2A 1N32J 4I7FA 3GU0A 2ZEJA 3W5YA 2XGQA 5H9FJ 2VFUA 4X65J 1IBKJ 4RW6B 3KJQB 1KKHA 6FD1A 3M2RA 4C8OA 2O5DA 4XPEA 1WDTA 2C2OB 1QTNB 2EBEA 2I8EA 1M5KC 1IQZA 1RTHA 1WF2A 1WC6A 4Q8EA 1S12A 3KLEB 1KLMB 5KFEA 3WX8A 1N0VC 1R6YA 5L8RC 4OX9F 1RADB 1OPIA 1VQ4S 3NS6A 4AYBD 4ES1A 2CPZA 2FLNA 3S6EA 4YB6A 3MOJB 2GHPA 4Z7YA 3ELHA 5KG0A 3W66A 3VALA 4LRFA 3GWCA 3W63A 2ZJPQ 3W8GA 3QMQA 2ZBPA 4P2XA 2CDQA 5EUHA 5HATA 3N01A 3I0RA 2PFFB 7FD1A 2RB7A 3GIIA 5KG1A 1XTZA 1H0HB 1U0SA 4ZMMA 2OTJS 3EZUA 5CABA 4H4MA 4ZVOB 4ZP6A 1WOSA 4I64A 2HVHA 1FDAA 4GRSA 3O1LA 1ULRA 3MMCA 3VTIA 2JEJA 3O3LA 4ES2A 1R8PA 5KT6A 2QYCA 5DZ6A 4JI0J 2M8HA 3H20A 5B09A 4CCHA 3HHLD 1S0OA 2KDOA 3R6GB 2IRUA 2XS2A 5LSRA 3FSYA 4HT5A 2D74B 3IRXA 3WBZA 4A48A 1DTQB 2C3UA 4XO0A 1TFYA 1D09B 2XY6A 2FJAB 4LF6J 2LU2A 4JI6J 3NMRA 3EGNA 2H1YA 4U95A 2K8GA 3A3PB 2IA6A 2QG9B 3RB0A 4DPUA 3MMBA 1N6QB 3RB4A 5DDRC 4DR7F 4V19J 3LW5C 2E5JA 2VBZA 2H9ZA 2L9NA 3FK4A 4TNOA 4X4QA 3MR6A 2BX6A 2G0IA 3M2RB 4IQXA 2U2FA 5AT1B 4F4ZA 4UUWA 1Y9OA 4NEYA 1S9FA 3M8RA 4KHMA 3G96A 2DNPA 5DRKA 2VBWA 1OMSA 2KM8C 3T5KA 1R0AA 1MROB 1IXKA 4OI3A 4YB1P 1SL0A 2LECA 3THPA 4RW8A 4K4ZA 1VMBA 3VZHA 1T9XA 4K4XA 1S9GB 1S76D 3HJFA 1XJWB 5BR8F 1LKZA 3D6FB 1HQEA 3L7PA 2UXDF 2PDAA 4TQRA 3PIOQ 2UUCJ 4PRFA 2I5JA 2R7QA 4DUYJ 3HFKA 3LPYA 5LMNJ 2GNKA 5HQMA 2MSSA 4J9OA 1ZZFA 4JV5J 2CDRB 4FF4A 2B6AA 5AE3A 1F9FA 1SL2A 1SKSA 2O66A 4CTAA 3G2XA 1UFWA 4OYMA 4C4WA 3CWJA 2NXEA 5DDPC 3T5LA 1S4EA 2HWHA 5IM0A 3JXOA 1F5CA 1MSWD 1FFSB 3JQJA 4DR2J 3NG8A 1F5AA 2KZZA 3CCVS 1VDHA 1RBOB 1XC9A 2HAFA 2KYZA 2UUBF 4ZVTB 5MLCV 3OFGA 3QRRA 1LW0A 3E51A 3TVYA 3W65A 2V8DA 2FJEB 1FVSA 2QLWA 3F41A 2Y8WA 2XSFA 1CJKB 4A8QA 4YY3F 1OWXA 2EK1A 2XZWA 2ATCB 2PEHA 2F4VF 4MT1A 1O5JA 2CWKA 3BF4A 4RWXA 2Z30B 2YKPA 2GCFA 2AP6A 4MIBA 2DNHA 4X2BA 1NAQA 2DB1A 3ITHA 1J27A 4TY8B 4ED4A 1REGX 2FUG9 2B4VA 4WP8A 3P6YC 4RWWA 1U4BA 4YHHJ 2KG1A 4HACA 1ACMB 2RF2B 5B08A 2HRTA 5HSPA 3DLJA 1H2TZ 4JUZA 3V4IB 3PW0A 1Q95G 2LQBA 1T8EA 4NA1A 4LIRA 2GZOA 4U7CA 4X4RA 3MCOA 1IKXA 4ID5B 1WTBA 3D4JA 3GPAA 1HFEL 2YKNA 4DR6F 5C25A 1A0OB 1UPPA 2MHNA 1SBRA 3IN5A 3SXLA 1JB0C 3EE3A 1UPMB 3M9NB 2QE5A 1FI4A 4UTGA 1N5VA 1U02A 3AD8C 2MKKA 2ZH8A 2M5YA 1SCJB 4CLLA 2B6AB 4IRKA 4KRWA 4NOHA 3NNHA 2G0CA 3G86A 2GVDA 4D3GA 3S8SA 1YIJS 3TZWA 3ISZA 1MLAA 4DR3J 1Q1KA 2BDPA 3W5XA 4WWSA 2CQ2A 1DTTA 3B82A 2DH8A 3R97A 2HQGA 2HIYA 1W2BR 1H2UX 4CO3A 3LP1A 3WIUA 1FJEB 5HBMB 2F8EX 1SJ3P 4CP5A 2NR0A 5A0YA 2GO9A 1LW0B 4H54A 3A8KA 5KFNA 1R8AA 3KJFB 5G0RA 3JSYA 2ZC4A 3PIPQ 4QWCA 3K5NA 3OBIA 2EXUA 4USTA 2DH7A 2MZRA 3D66A 3RZAA 3ET6A 3BGRB 4EBCA 1VBXA 1X4HA 1TUVA 5JXSA 2ZHOA 1RAGB 5DG8A 2HBRB 2HURA 3IM9A 3D28A 3HKZD 1IR0A 4QW9A 1PCAA 4AD6A 2KN4A 1HHQA 2FHOB 3ZZUA 3WIVA 1HW8A 3T1HF 1YQHA 3K57A 1NH8A 1HNXJ 3SSRA 4KKOB 2ZZNA 2DKOB 2CKWA 2VASA 3CSKA 4DPYA 4RBVA 4IFVA 3UE2A 3MAAB 5L39A 2ZITA 4FYXB 3UWTA 5J2PB 2BW7A 3NRBA 2BZ2A 3IBWA 2N3LA 1QAXA 3H5YA 4L3NA 2BQ3A 3W2WA 2V4JB 5ITHA 1R43A 1T02A 3J7AN 1HBOB 2EFGA 1JNZB 3BYRA 2E5LJ 2MLXA 3L7UA 4DR4J 1PILA 2HZAA 1XR6A 4J9SA 1IKVB 5CD4H 2BMBA 3V6KA
chains in the Genus database with same CATH topology
1UL3A 2J0WA 4Y2IA 4N5SA 2ZC3A 1QUPA 1J2VA 2K7JA 2MQMA 3H25A 1ZETA 2B0GA 2JEGA 3CUNA 1X9MA 3S7RA 2R7SA 1REVA 2HIQA 3DU6A 1FK9A 1M90T 1TVRB 4G1IA 2HW3A 3TNVA 1VK3A 3EXYA 2UVWA 3KK1A 2XS7A 1VQSA 4USJC 2W24A 2VOOA 1GXUA 2AYGA 1HHSA 4EZ6A 1WF1A 3C3LA 3M32A 2ZE2A 3VCDA 4LF4F 1B0PA 2O3DA 3N5FA 4IUFA 1C4CA 1S6OA 4F3MA 2HQIA 2DGWA 3SDEA 1G2EA 2W9AA 2JLGA 1YG0A 3SFGA 5KFWA 3OUYA 1XEZA 5DJBA 2G9OA 3OVAA 4K4SA 1JIHA 4GO7X 2JLEA 1TKZA 1C0TB 5CYJA 3Q0AA 1TAQA 4CI0B 5I4MA 2PMHA 5EX3A 3KHGA 3BDPA 4JV2A 3BO4A 2J7UA 2MSTA 2OPRB 3FEZA 3GFZA 1Q16B 3SSQA 3J80Y 4ES3A 4DSLA 4OQJA 2VPWB 2NXUA 3R3TA 1NK5A 2UU9F 2FJDB 5FLXY 2L9WA 3BSAA 3PZPA 2LKZA 2KRBA 2QV6A 3H5UA 3KLGB 2ZJRQ 4KV8B 3JSBA 1HD1A 1S6UA 3UW1A 4A8SA 1WG5A 3LP0B 3ISND 3TO8A 4MKBA 1KN6A 4P7TA 3G9CA 4QIVA 4J9MA 4WFXA 2FLLA 1D0EA 2LQ9A 3M05A 3CCSS 4OHYA 4AFFA 3OFHA 1QSLA 1HNVA 1N5QA 5GMKa 1TKXA 4IQMA 2NSCA 1U6FA 2X1AA 3H5XA 4USHA 4DQRA 4C8NA 5KFRA 3QZ8A 3UR3C 4DFJA 5I3PA 1C2PA 4Y6IA 1GAOA 1L3TA 2ZVSA 4UW2A 3UD4P 2EW9A 2UP1A 1DJ0A 4KE5A 2GHVC 4PWDA 1E6VB 3HXMA 1S10A 4RNMA 4TY9A 5FD1A 4TY8A 3JB9k 2M70A 2MQLA 4A8FA 1TFWA 1SXLA 4IR9A 5G4DA 3QAEA 4RNOA 2WB1D 1NO8A 4OI6A 3G4SS 2VFVA 4B9LA 2CJAA 3W2VA 3DLEB 3MM8B 4N76A 4HI2A 3IR7B 3M8QA 4ZP9A 1X7VA 4NLYA 2CQGA 4QOTA 4HVZA 4URQU 2KFZA 3MEGA 2OP5A 3PRBA 4PXBA 1UETA 2VG7B 2VKZG 3SCKE 1FO1A 3KHHA 2YNIB 1VC0A 4EEYA 3I96A 2OD6A 3SMZA 4MMOA 2KKHA 3HX9A 1YJUA 4I0WA 3PM9A 1GNKA 4UY85 4EGLA 1UW4A 2DBBA 2LXIA 3MMAA 2RF2A 3HZEA 5IZHA 1XR5A 1HNZF 3HVRA 2JOQA 4B9SA 3CVKA 5M2UA 5KFCA 4ZK7M 4FF2A 3SYZA 1KNZA 1R8BA 4DUZF 2M0GB 3Q23A 2AYEA 3OL7A 5B0AA 3V4IA 3CD6S 1RGVA 3RTVA 5E3RA 2GV1A 4U7UK 4DHVA 2VBYA 3VWSA 2VD3A 1WEZA 1D9FA 5GAHU 2XMTA 1SH0A 3NKYA 3W7BA 4Q2LA 2PA3A 3LOUA 3MI7X 1F5BA 4B9MA 2DK2A 5E2QA 3MM6A 5LMUF 4KB7A 3E01B 1PC5A 4ID5A 1VC6A 2C3OA 1BGXT 4IRCA 2BYCA 2RQKA 3TUZC 3CGIA 2JFKA 2CQIA 3DLKA 1YJWS 2X3GA 1FRXA 2UUWA 1WD6A 4HKQA 1XMOF 4DLGA 1RA7A 1V9OA 1JLAB 3KLIB 4MTPA 4C8LA 2O01C 3BR8A 3KFWX 1S1WA 4R8UB 3NGDA 4RUHA 3CCZA 1Y7PA 5F8LA 3BQ1A 3I31A 1DFDA 3TA1A 5CQGA 4YQWA 3VZIA 1S1TB 4X4SA 1ROFA 2AWZA 5L1KA 2PE8A 4OZ0A 2ZH4A 1T3OA 1U1MA 4OHWA 3F44A 2RIJA 2ASJA 2VQFF 4M95A 4YR3A 2E1CA 2N4DA 2QZ8A 4Q5VA 1G7CB 1RT7A 4DV1F 3QJJA 4R5PB 3K5LA 4NLGA 1BWEA 2GQQA 4E98A 2NR0A 4X84A 3C66A 4HDGA 4OHZA 2DHSA 3BREA 2J9EA 1HWJA 2IYGA 4TYAA 4GMKA 1TV6A 2FJBB 4CO1A 3OTBA 3OL8A 4I2QB 4O44A 2M4MA 1WNEA 1FHTA 1FTCA 3M6WA 1RYRA 2RRBA 3CIMA 1S6QB 2B5JB 2B7CB 2QLXA 4LQ9A 4DQIA 2K1RA 3N4WA 4PXEA 5EWEA 1V3ZA 1Z4UA 5K8NA 4E0DA 1M5VC 3QJLA 2ILZA 1C0UA 3JYTB 1HWUA 2FJXA 1G1XA 4WYWA 1SQEA 3D1HA 3OSPA 1FRKA 1M5SA 5LSLA 1L5UA 3SCIE 1B7FA 2OLWA 3QZ7A 5KFMA 2EFPA 2UV8G 1QE1A 3CC7S 3FQLA 3ZZ0A 2JZ5A 4I67A 1FXRA 1VRTB 1VQ9S 4OI2A 1FRIA 4IOBA 3POTB 3SEOA 1LXJA 4HTIA 2KRRA 2VKRA 2IRYA 4Y2KA 4JI7F 1K1SA 3IG1A 4DR4F 2DNLA 2FHJD 1CLFA 4RNNA 1TQLA 2KFNA 3KOAA 5HBMA 3RW7A 4O3QA 2CPXA 3RW6A 5EX0A 4MAKA 3V4MA 2DPJA 4A8MP 3UCGA 3K5OA 3UFCX 1IBLF 1LWCA 3BQ2A 1K0VA 3CD5A 4RX6A 1G3OA 1XNRF 4ECSA 2KT2A 5I3UA 3R27A 2ZBCA 3MTKA 5D3GB 1NJZA 1HBNA 1SC6A 4EFAC 3OUYB 2W9BA 2VA2A 2HNYB 4KHPF 2RSQA 1GH8A 3WDOA 3BN7A 2BM0A 4IDKA 1Y5LB 2UXBF 4F4KA 1GXTA 1KHWA 1S0NA 1YGYA 1K8AT 5L9NA 1RTDB 1RT6A 2PN6A 3TP2A 5IFMA 3GMGA 1OO0B 4O3NA 1U09A 2Q43A 2HVZA 4J5OA 2YKQA 5B0EA 5HP1A 4K5RA 1JLBB 1UMJA 2XHWA 3OJUA 5KFLA 4GC6A 1FVQA 1HQUA 5DLFA 1NK9A 4DV5F 2HS3A 4HH1A 2CPYA 3TX8A 2AJFE 1H38A 1UJ6A 2RKIA 3BGRA 2DNRA 2K7KA 3SI8A 4CT9A 4C3MA 3N0VA 4G6VB 3FEYB 4CNYA 2DHXA 2X1GA 4OHVA 2YNFA 1TL1A 1P6TA 2LXUA 5C42A 2R9LA 4JBCA 1T94A 1FXDA 4AUKA 2V8VA 2YWEA 4HLBA 4NMLA 4OJ1A 4O3OA 1HI8A 3U7JA 1KHVA 1XWLA 3UD3P 2Q3PA 3PXGa 2MXYA 1TKDA 3TW0A 2VC1A 4AXJA 1RP5A 4QIWD 5KFKA 3J81Y 3RB3A 3K8WA 2RJZA 3MGJA 4PWDB 4DS5A 2MZQA 2VZ9A 1JLQB 4PQAA 4RW9A 4F3QA 1V3SA 3N5BA 4DV3F 1LW2A 1VQOS 3Q8RB 1BQNB 5KFDA 4URSA 5A6PA 3FFIA 2AQ4A 5THWA 4JI4F 3G6XA 2LLZA 2CPEA 3HO1A 4TKTA 3CMES 1CEZA 2L48A 2POKA 1TL5A 2E9ZA 4FXDA 5KFVA 5DGBA 2NQPA 2V4QA 3NBPA 2OPQA 5KFYA 1KOHA 2KT5A 4NXMF 1C4AA 4Y2MA 5KFHA 4LUBA 4X64F 4KKOA 2DGQA 5KOWA 3M2VB 1IKYB 4IOAQ 2L08A 5D4PA 4C0BA 4JOUA 1C1CA 1RT2B 2ABYA 3QGPA 2W7OA 4DF4A 1DBDA 4WFNQ 1VQ7S 1WHWA 2E5GA 2E44A 3THTA 3KHLA 2E9RX 3KG1A 2HHWA 4DSKA 2KVIA 3T5JA 4Q44A 3CDWA 4OI0A 2HRYA 1AUDA 3B4MA 2DVIA 3BB5A 1K9MT 4OI1A 5J2PA 2DGTA 2BQRA 3DMJB 3V2UC 1S0VA 2APOA 3SQGB 4UQGA 1NB7A 4BDPA 3LP2A 3KYLA 2QSFA 3KTQA 2RE1A 4K50A 2B51A 2R7UA 1BQMA 1TKTB 3M30B 1ZTWA 3DDKA 3DYAB 4F25A 3KJVB 2PSZA 3C6TA 3TRGA 2AGPA 2Z0GA 2V4JA 3CPWR 5KTQA 3PACA 3N28A 1YJTA 2OMOA 2R4FA 2FVQA 4RUCA 4DWIA 5KG7A 5B0DA 3VAMA 3CB4A 1HBOA 1N56A 3I9ZA 2GGPB 4DR5F 3QO9A 4ZVFA 1EP4B 4DDFA 1RK8A 3R5BA 4Q43A 3KK2A 3J7Z5 2W4CA 3I5BA 3VAHA 1LFWA 1JNRB 1IKVA 2CZVC 1S72S 4KC5A 2P6SA 1WI8A 4AE5A 2XLIA 1U1OA 3V6JA 4ED7A 1QVGR 1TK8A 4K4VA 3CIZA 4PPDA 2PD1A 3CT9A 4GKKF 3HF5A 1WTFA 2Q79A 3P96A 2XCAA 1T95A 1Z2LA 4ED0A 1P1LA 2VG5A 1SKWA 1LQ9A 2JJ4D 2VV5A 2EBGA 3M6VA 1TVRA 3CCTA 5F8HA 5GAGI 4DV7F 3OTDA 1FXLA 2J76E 4HTJA 3LGMA 2XWYA 2VFRA 1YI2S 2B4PA 2DTJA 3L95X 1CVJA 2RT3A 1E6YB 4LF9F 1NHUA 2HLTA 2ZOFA 3TR5A 2BANB 4ZCIA 4A8YA 4CO4A 1DQ8A 4R0JA 1H3DA 3P49B 1QAJA 4QU7A 4WK3A 2K1RB 4YDXA 2BE2B 2XNQA 7FDRA 2E9TA 4Q0BB 3BS9A 1NU4A 1PC4A 2ZFHA 2RS2A 2Z2MA 3M6UA 2M9KA 4ATNA 4PCQA 1JXEA 3HZGA 2XI3A 2W4PA 1C0TA 4DPOA 2HGLA 1UJ4A 2WOMB 2AGOA 2EFNA 5EGYA 3S1TA 2KJWA 4YR0A 2R2SA 2ADCA 2OPRA 2R8JA 4LMZA 3DXBA 4OIXA 2XSJB 2FHKA 3EPIA 2IMOA 4P7VA 1FJCA 2LA4A 3QGHA 4N47A 2IA0A 1LOUA 2YY3A 5GAEI 5HQ8A 1VQMS 3X1LB 2YNGB 3IGVA 4KV8A 2ROGA 2A2CA 3RAQA 4WK1A 4F02A 3LP0A 2FHJA 2K3IA 5FIIA 3MZIA 2RU3A 5KFJA 3JTNA 3BDEA 4NZ7A 2VFSA 2VH7A 4NCGB 5L38A 4NLPA 3M4XA 1NJXA 4CO0A 1ZPWX 2IJNA 2Q6BA 1FA0A 2V2KA 2PI5A 3KNAA 2DNKA 3DRSA 2ASYA 2AW0A 5K8OA 4USIA 2J5AA 2MQQA 1CQMA 3BEGB 4IDKB 1NJWA 1I1GA 1Y3JA 4N77A 3T3FA 1VQNS 2JFDA 3OR1B 1FKOB 1E6VA 1ZYQA 4J9LA 1R89A 1YBAA 1NKCA 4IOCQ 4X4TA 2X1FA 2F3JA 4FN5A 1FRLA 4CH0S 4LVOP 4CQ1A 3DLEA 5KFSA 3H5SA 2HFNA 4YMEA 1Q86T 2IYIA 1N8RT 2FJVA 2CVIA 2ILYA 5EN1A 2VG7A 4R0EA 1HW9A 4CO5A 1J5EF 4CH7A 2YNIA 1HR0F 3M1VB 4KJIA 3ENQA 3PJXA 3CCJS 2IC3B 4JI5F 1CC7A 1WACA 3CJ2A 1P9QC 4KFBB 3OVBA 2HG4A 2MKSA 3HHDA 4NWBA 4RW7B 1H98A 1AFIA 1S99A 1N48A 4NLVA 3DLGA 4Y34A 4QQBA 1UFLA 1T3NA 2GIRA 5HROB 2IM0A 2AX0A 4ZA1A 4AL5A 2ZOMA 3HDSA 4DFKA 1N52B 4ITSA 1ZBTA 4ED3A 3ZZTA 4WF9Q 5IT9Y 1KS2A 2PA8D 1H7WA 3MUTP 3C6UB 3PW5A 5KT4A 2CQ3A 2OPSB 1DLOB 4EWTA 4QYZJ 4R25A 1KEKA 5E5NA 4C3LA 3K59A 3SZ2A 1NEEA 2GA7A 2ZOGA 2IHR1 4I56A 4UY8T 2I9SA 1CQNA 3E01A 3IA0A 3U1LA 4ECYA 2OPQB 3TVZA 5KT3A 3Q2SC 2E7WA 1V3RA 3NNCA 1IBMF 1BQXA 1SJ1A 3D1OA 1NH7A 2FVPA 3CJ5A 2XLJA 3BJYA 3X3UA 4IH6A 4DV4F 1C1CB 3DC2A 3QIDA 5F8JA 2DO4A 1SJQA 3KLIA 1JLAA 3ULHA 2OSQA 5HMXA 3PX0A 3TAQA 3UCZP 2FLOA 3ZFVA 5CYMB 2UVRA 2A3JA 4R8UA 4NLUA 2EFOA 4F2SA 2ATLA 1NRKA 4WTYA 4C9DA 1VOMA 4M8LA 1JKHB 4X4NA 1S1TA 3PW2A 2MZTA 4HDHA 4HH0A 4ECVA 4FXVA 2ROEA 3RRGA 1IJEB 3QLHB 3PW4A 1MWYA 3CDEA 1O51A 3IRWP 1BC6A 1N0UA 3TI0A 1AROP 4ZVEA 3DOKB 4NLRA 1S77D 2R7VA 2XG8A 3HPOA 1MNEA 3CCES 4KO0B 4GC7A 4TN2A 1L3VA 5J2QB 1X4DA 3RBDA 3SV3A 1RT3A 3IR5B 4G1PA 2X1BA 1Q7YT 1BQMB 2RS8A 4I2PB 3B78A 5T41A 4A8WA 1U48A 5KFXA 4IO9Q 4MJKA 5HLFB 4FNHA 3E8OA 2JWNA 4I2QA 1Y3KA 1Y5IB 6FDRA 3HM9A 4B3TF 4K59A 1S6QA 2B5JA 2RDJA 5D4OA 3MDFA 1KR4A 2I2YA 2FPHX 1RTIA 3DRRB 2X51A 1Y0HA 3FMBA 2ERRA 2KG0A 2BRKA 2HGMA 2IVMA 4PWUA 3JYTA 4ICLB 5L1IA 4HYKA 5J2NB 2W4DA 1U24A 3M8SA 3K8VA 2HS4A 5CHCB 1KRPA 4EUVA 1ZM3A 2G4BA 3K5PA 2C22A 3CTRA 1XBWA 1N5TA 2F1FA 4QPXA 2B4OA 3OR2B 4RU2A 1OSDA 2IBKA 4EZ9A 4NCAA 1A9NB 4RLEA 1MMLA 3PR4A 3IAS9 4CH1A 4B9NA 5F9LA 2V4RA 4Y28C 4Y2CA 2VG5B 2YKOA 3PX6A 5GADI 1VRTA 3T6BA 1DRZA 4RKUC 2FC9A 2YKMB 3HVTB 5E3QA 4DSJA 3POTA 2JH3A 4RBUA 3GFYA 3T19A 3G6ES 3IWNC 1WHVA 3OXFA 1FDNA 4J9NA 2DRAA 2XBPA 5H1SV 4DSFA 4Y2AA 2UXCF 1QM9A 4B9VA 4XAKA 4O3SA 1RKIA 5AXMA 2R7WA 2PIIA 3I82A 3NAIA 2CQPA 4ILLA 2OMLA 4YUDA 5F8IA 2NZ4A 1CC8A 2P9EA 1PGZA 1X0FA 1N5YB 2RQCA 5D3GA 2PI4A 1JWWA 3EUNA 1N36F 2DGOA 2HNYA 3MM5B 3HLUA 3DDNA 1HBMB 2EFVA 2H5EA 5JJBA 1YRXA 3PVXA 2R7OA 1RTDA 4J9RA 5J2MB 2MKIA 1XK8A 4DFPA 2GMJA 3TYTA 2XY7A 4URGA 3AHPA 3PO4A 1S79A 1FD8A 4DL2A 3GE9A 4A8OA 1JLBA 4UOCA 2B3TB 1DARA 4LQ3A 5LJ3Y 2CPDA 4ECTA 1UP1A 2FVSA 5EHHA 2OD4A 2RUGA 3D54A 4ZPAA 5J1NA 1NK8A 2HHTA 1MWZA 2DNNA 2C28A 2IFXA 2NYIA 3UCUP 1F0XA 2D9OA 4LFBF 2QO3A 1VQYA 5KG2A 3GV5B 1SB6A 2CVEA 3BSCA 1VC5A 2D1CA 3PKMA 5LSOA 4F67A 4O3RA 4K4TA 2JC0A 3BGUA 2O67A 2WHOA 4LF7F 3MTJA 2M52A 3DRSB 1JLCB 3NCPA 4K4UA 5T14A 1VBZA 2GIQA 2J7KA 2PT0A 3MEEB 2J0XA 3C8YA 5K14B 4LSNB 1XNQF 4LJMA 1HA1A 1WEXA 3G6VA 2L3MA 1KVJA 3VAIA 1YRTA 2EFQA 3PJW<