4QYZJ

Crystal structure of a crispr rna-guided surveillance complex, cascade, bound to a ssdna target
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
195
Chain Sequence
MRSYLILRLAGPMQAWGQPTGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSESVQFAVRCDELILRRVSVTGLRDYHTVLIQTWREYLCDASFTVALWLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQPQKALLNYEPVGGDIYSEESVHLKFTARDEPMITLPRQFASREWYVIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/dna/rna
molecule keywords CRISPR system Cascade subunit CasA
total genus 38
structure length 195
sequence length 219
ec nomenclature
pdb deposition date 2014-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qyzJ00
4QYZJ 4N77A 5CD4H 4R0JA 4U7UK 4F3MA 5H9FJ 3VZIA 3KG4A 3VZHA 5H9EJ
chains in the Genus database with same CATH superfamily
4KO0A 5C25A 2KO1A 2B9EA 2KN4A 4J37A 3SDEA 1NHUA 1XIQA 3GZ7A 4EFAC 3M9MB 1TUVA 2AKWB 4ZVEA 2HK2A 4ZVSB 3NWRA 5JJBA 1W25A 1IBMJ 2I6WA 1JLFB 2DXFA 1RHRB 1TMMA 2HFUA 2GIRA 4NA3A 4FF1A 3OL7A 3AOCA 5MAOA 4YOEA 4NLXA 1P6TA 1RZMA 2C3OA 1KHWA 4RBUA 5J2PB 1J5EJ 1ZH5A 4H4KC 1SJ1A 2ZBPA 3T6JA 1H7XA 1LW2A 2VBXA 1GEHA 1OY8A 4LBHA 1IBLJ 3EGZA 2EFQA 1VIOA 4KHRA 4YR2A 2QFJA 4J9SA 4UOHA 1GK8A 3G82A 3JAMY 1YJRA 5EX0A 1CJTB 2HBYB 2FVQA 3HT3A 2B4UA 4JV5F 1HBMB 1SKUB 4ANCA 3KLHB 1W2BR 2RQMA 3DLBA 2VICA 4OHVA 3CD6S 2JHEA 1H0HB 4W90B 1YTYA 3MR7A 3GV5B 2R7RA 2LYVA 2MKJA 3UCUP 3LAMA 4RW9B 2ROGA 4C3KA 4RU9A 1RWXB 2MKHA 3IRWP 1FNOA 4KBIA 2P8IA 2ZJRQ 2X1FA 1YJNS 2B4PA 2K7JA 2YQ1A 1FWPA 5IM0B 3UR0A 5LOQA 5F8LA 4YMEA 1R8AA 2DNRA 2WK4A 1TKZB 1JLEB 2BKPA 3ITHA 2OTJS 3MCNA 3NGKA 2RRNA 2O5DA 1C0TB 3EDQB 3UCZP 2BW7A 1TU0B 1HWIA 2OEMA 3HCXA 4M5DA 4LFAJ 3RB3A 3MXHP 2DCUB 4LIRA 3SCLE 3H2VE 2QN6B 2RU3A 5GADI 2ZE2B 2UXCF 2HFZA 2H5EA 1RTJA 2JFKA 1Q79A 2CQ0A 2OFHX 3WC0A 1QUVA 3MM9B 4F67A 1UFLA 2V8GA 3BR9A 1N48A 4FP9A 1T3NA 2IA0A 1AUSL 2ZH8A 4K7QA 3QZ8A 4NCGB 3NS7B 1N5YA 3MEEB 1PAEX 1L3UA 4F4ZA 3R97A 2XMAA 4URQU 4ZOSA 3RBXA 1S72S 2DEIA 4PPDA 2YWWA 1VJWA 3HSDA 1SH0A 1KR4A 1PIEA 4MIAA 1WUUA 2W2PP 1S6QA 3PY8A 4ED4A 1Q1KA 2YNGB 5KFWA 2DR8A 2GVDB 2MZTA 2R2TA 2OLWA 2QIFA 1U1QA 2GQQA 4R5PA 5H9FJ 3K0JA 1RAFB 2V5HG 5M2PA 2H5IB 2CVIA 3CJ3A 3O44A 4YQWA 4DUZF 2YKMA 3I5AA 4I2PA 2HIYA 3ULHA 2VG7B 5KFFA 1VHIA 2B56A 2KKHA 2ASYA 2BYCA 4LT6A 5KFZA 3TX0A 4DV5J 4NLUA 1VI7A 1S6PA 5C2GA 1VQKS 4XAKA 3SI8A 3NGRA 3M8QB 3QFHA 3M2UB 4WTYA 3R7NB 3VAHA 4C8ZA 1Q53A 3DI6B 2MGZB 2I5JA 2EVZA 3OLAA 2BXJA 5DZ6A 2JEIA 1R6VA 1K1SA 3ZZTA 1T3OA 4WKRA 1HNWJ 2AJ2A 1MWZA 1RT5B 1S4EA 5AJ3F 1DTQA 2H51B 1L3KA 3AD8C 4JI7J 2PEBA 3SEOA 3H8YA 3Q89A 1JLCB 2XMTA 4YS2A 2AD9A 4LF7J 1WC4A 1D09B 1VRUA 3HFZB 1UA1A 3C46A 4X2BA 3BR8A 2RS8A 4LMZA 3W3SA 2E5GA 2LXIA 1EP4A 2UV8G 5K14A 4DOZA 4DX8H 3CCES 3N5BA 2LEAA 1Y3KA 2M4MA 1UFWA 4K4VA 2K7KA 2HHHF 2YY3A 2JVRA 3R6GB 2MY7A 2DHHA 2LP4A 3PX4A 1D8YA 3KOAA 4HACA 2CJKA 4DV2J 2XLKA 2EC0A 3DRPB 1HW8A 2FLNA 1PC5A 4UQTA 1U1NA 5KFAA 5F8MA 1VCTA 1CSJA 3T1YJ 3E8OA 2ZWPA 3LP0B 2ATLA 3I87A 5HL7Q 1F60B 3AQPA 3Q8YA 1IXKA 4ZVGA 2FJBB 4C0HA 1D8ZA 2XQCA 1RT1A 5F9LA 1N6QA 1X7VA 2W01A 2E9ZA 4WP3A 4YR0A 5AT1B 4KAIA 2CZ4A 3MUVP 4MYUA 4ZPAA 3OVSA 2Y8YA 4ZLLA 4K5RA 4O44A 4DFPA 2FZGB 3BGOP 5D6GA 4M94A 3EM1A 4URGA 1XTZA 3HXMA 1F9FA 2BA9A 5IT4A 3F44A 4FPRA 4ZDNA 4PR6A 2D9OA 3VAFA 1RWOB 3V4MA 1WOOA 4XIUA 1LK5A 3JSMA 2XI2A 4GKJJ 4W92B 2BEFA 2G0CA 3HKZD 2X1BA 4O4GB 1T0TV 5A6WA 1TV6B 3T19A 2MQPA 1SXLA 4YB1P 1ZTTA 1U1LA 1NMEB 3DRSA 2WOMA 4UQGA 2QC3A 3BN7A 5J2MB 2UXDF 3D68A 4QWAA 1EARA 3KHHA 3MFHA 5KFOA 4D3GA 2VJUA 1FEEA 3B6BA 4DV0J 3ENWA 3W64A 4Q0BA 4WYLA 4U8YA 2QL7B 4CLLA 2DNQA 5BJRA 3W5ZA 3X3UA 1BWVA 2X1GA 5D15A 2B0GA 2VU5A 2HNDB 2ADCA 1H98A 3KK2A 2LMIA 4TYAA 3GYNA 1LKZA 1UVKA 2HHUA 4OZ5A 4WF9Q 3D1HA 2M70A 2L9NA 3MMBB 4DL2A 3RW6A 2G2YA 2D69A 3K57A 1O51A 6AT1B 3IWNC 2ILYA 3BGRB 4USTA 2C22A 2CNKB 3QO9B 3I9V9 3NL0A 3P49B 2LECA 2KJWA 4DF8A 4IRDA 4QJVA 1VC0A 1WKJA 4JV5J 2BJDA 4CO1A 6FDRA 2IMWP 1WF2A 2YX7A 2H9ZA 3BBCA 3B82A 4OQJA 4DI6A 1YITS 1N5YB 2FZKB 3LP1B 4UOGA 1X4GA 2IVYA 2J9DE 3K7RA 3NS6A 3TVZA 3LUYA 2B51A 3CO9A 2EFGA 5ETPA 3H0PA 1EKRA 2V8DA 1RAJA 1EAYC 3ZFVA 2J6UA 1H72C 4X65F 2BJ9A 1FXLA 4BHQA 5I42B 4GVBB 2HHPA 1TKDA 3G9CA 1GNKA 1S6QB 4NYPA 1YBAA 2EFOA 1M90T 4YB7A 2NSBA 4RW6B 1AT1B 4LFCJ 1WG4A 3GFYA 2K1RA 4DR7J 3H25A 2DD8S 5B0GA 1EZZB 5F8NA 4UOCA 1M5VC 4JI5F 2RKIA 5HVGA 3H5SA 5ADZA 1UWBA 4RJVA 1LWCA 3G6ES 3PNIA 2APOA 4DCOB 4EUVA 1RWPB 3MMBA 3GFZA 3L9ZA 5DLFA 1J27A 1QUPA 3DLGA 5KFHA 3NRBA 1HNIA 2I1RA 1X5SA 4R0EA 2M2BA 4CT9A 1APSA 1UEUA 4B9UA 5CABA 2RD5C 2RJZA 3S6EA 1MMLA 1U0HA 1M5OC 3EE3A 5GMKa 5DS7A 1Y5IB 3KDNA 5KFRA 2R2UA 2GHWA 4JI2J 4CTAB 3GONA 1FRJA 3GIIA 5LL6d 2XGQA 5IOLA 2J9DA 2MKSA 2ZZTA 1RXOB 4TLRA 1UJ4A 4ZLJA 1RT3A 3CCTA 3E01B 4ZLPA 4KGVB 2W2OP 2OSRA 4W98A 2MB0B 4ES1A 3K8VA 1JB0C 2QO3A 1N0UA 2BJ8A 2FHJA 1YKWA 2YQ3A 4C98A 5RUBA 5D4PA 3W9IA 1IQTA 4WZMA 4LRAA 2RB7A 2DJWA 2MZSA 1RU1A 4J9UE 1Y5NB 2OUGA 3CCQS 3PR5B 3PW7A 1NPKA 1REGX 2Y1RI 1X9SA 1M0SA 3HVRA 3GSDA 2E66A 4Z7YA 5IQQA 1RABB 2WSCC 3K17A 1UWBB 2XG8A 1NHVA 2YKAA 4DX7A 2GMJA 3DOLB 5B0BA 1RAAB 3BKTA 1X0FA 2GHVC 2GS8A 4C3MA 4WFNQ 1BLUA 2B5JB 4WJBA 2UUAF 3A3PB 5HP1B 4DFKA 2AV5A 5KFYA 1S97A 2RQKA 4BWMA 3DGPB 1X4BA 3OFHA 2R8IA 1FK9B 4JI1F 1VQLS 2DR5A 1TMJA 4FF4A 1S0MA 4ECTA 5CD4A 1KRPA 2F9DA 3JSYA 1NKEA 2DKOB 5H1SV 4KFBB 5AXNA 4DFJA 4JI8F 1TK8A 4ERDA 4ZPTR 3I56S 1HQEB 1UZDA 3D28A 1SJQA 4O3QA 2L41A 4PXCA 1I94F 4A8KA 5KOWA 5IT0A 1M5HA 2HWIA 4JYAJ 4J9RA 4LF6F 4HL9A 4X62J 2LDIA 3N5FA 3DDNA 4CLSA 1VIXA 4TXSA 1VHFA 4LSLB 3G96A 4QIWD 1NNDA 4TU8A 1JJ4A 2CPYA 4K4UA 4J9VA 3ZZOA 3DKDA 2BMBA 4O4GA 5LSRA 4DJBA 5F3ZA 1FKOA 4AYBD 3SCIE 2RS2A 1U48A 4CP5A 2CJYB 4F4WA 1IUJA 1G4CA 2V4JB 3DCAA 1X9WA 1PYTA 1LNQA 2VG7A 2V8HA 4K5SA 1C4CA 4PPZA 3Q8SB 3KHRA 8AT1B 1N5SA 3BDEA 2J6SA 3M8YA 2NYIA 2RHQB 1GH8A 3S7RA 1WSRA 1HBOB 2NREA 3TARA 2J0SD 4ZIVA 5F8JA 1RJJA 5BXIA 1S9GA 1U2RA 3ET6B 3H59A 4URSA 2E9RX 1T02A 3V2UC 3VQSA 1WELA 5GAHU 3GJSB 5IWAF 2WTFA 3Q83A 4GC6A 4FS1A 1J5OB 4MK9A 4OHXA 2NYHA 2IBKA 2QMWA 5B09A 1T03B 1T8EA 2BM1A 1TL7A 1R89A 2YNFA 4LFAF 4B3TJ 2DRAA 4ZP8A 3FSYA 1ICEB 1UEKA 4HI1A 1YBUA 2VG5A 2Z2LA 4LR8A 1SV5B 1LW0B 4QIGA 3CVKA 4UW2A 3UD5A 4PWUA 2W9CB 2UVVA 4GKJF 3KK3B 3R6LB 2KM8C 3LWLA 3BH6B 3CJSA 4LSLA 4WK1A 4C11A 4OHYA 1NZAA 2QEXS 3MD3A 2J76E 4QR1A 5HI7A 2GCFA 3OTCA 3LP1A 2QLWA 4BBYA 4F4AA 4QWEA 2QL5B 4J9QA 3J7A1 3ISZA 1QTMA 4OHZA 2UXDJ 2KT3A 2XSJA 3SCJE 4I67A 1S1UB 2MQLA 2C2DA 2V2QA 1WNEA 1FRXA 2VDHA 1RAHB 3DLJA 3ZTRA 3RUBL 3DOMB 2BZ2A 3PG9A 1IQZA 2DGUA 2J5AA 2A18A 2WVCA 3FVYA 4N8NA 3FEYB 5C7PA 5J1EB 3PYGA 3FEZA 2R2RA 1IBKF 1NXIA 1D0EA 4PXEA 1ZM3A 1RHQB 3W7BA 2IY5B 2HMIB 2PD1A 3EVOA 4OFZA 2G13A 3B78A 4O0IA 3V6DA 4M8LA 1NJIT 3EX7B 4WE1B 4ZVQB 3OFEA 2HVDA 3TQ1A 2RDDA 3T41A 1A7GE 4I4BA 1V9OA 1WEXA 2A3JA 3JTNA 3VVTA 4X64F 2GNKA 1ZM9A 2FUG9 3JTPA 2ZDPA 1HNIB 3AD7C 4I7FA 5D3GB 1D9FA 3PO4A 4FYXB 1Q86T 2GA7A 1D1UA 4GKKJ 4ZKAA 3R1LA 4DL7A 3D0HE 3MZIA 1YZ6A 2L9WA 1VISA 2YWEA 3CIMA 4CLKA 2HLTA 8RUCA 3BO3A 1YDLA 4ITSA 2DR6A 2IMOA 4BDPA 1AFIA 1F2GA 1NSKL 2V8VA 3AD9C 1HL6A 1LWXA 2UVWA 4Y6IA 2RF2A 1LFWA 2GAHC 4OZJA 3KLFB 4KRWA 4B02A 2Z30B 4ZHRB 5B0AA 3JSMB 5CXTA 4ZJOA 5IT9U 5I3UB 1MMNA 3IWLA 4ZPVR 2G1DA 4BC7A 1WACA 3TANA 2AGOA 4JI3F 1ITPA 2WONB 1SJRA 1WF1A 3POTA 4IH7A 2LEPA 2JLFA 4LF2A 5K9FA 2V4RA 3EPGA 2E5LF 1K0TA 3WC2A 2QSFA 5EWGA 2EBGA 2FJVA 2CIMA 2CPIA 5B0DA 1NK6A 3H7HB 3F41A 2CG4A 2WB4A 3K8WA 3PFOA 4NOHA 3W2WB 5J1EA 4DV5F 3M30A 1N56A 4JI5J 1X60A 2XBPA 3CJ8A 4USHA 4OI1A 3RGIA 5C42A 1WORA 4P2FA 4X4VA 3A4TA 4X4QA 2YX4A 3D6HB 4DL4A 4K2JA 1TVRA 1W26A 5DJBA 3WHIA 1U4BA 1FTCA 3R2DJ 1RT4B 3M4XA 2JEGA 1UAWA 3IBFB 2PIIA 4ZN1A 3ZTPA 4Z7CA 1JLFA 1EX8A 1P1LA 3GU0A 3CXCR 2RIJA 2XULA 1IKYB 3CJ5A 4KGXB 2RAQA 2BE7D 3G86A 3MPYA 4EI2A 4ED2A 2YNHA 2DNZA 2DBBA 3OTOF 3C15B 3DLKA 1AZSA 3ZNJ1 2BW2A 1WEZA 1RWKB 5KG6A 3RB0A 3QAUA 4IQXA 4TY9A 4F8RA 3FGVA 1UVLA 2V69A 4BLGA 1URNA 4ECSA 2ZZNA 4L6V3 3U1LA 4L74A 4EYIB 2KU7A 1HQ2A 1K47A 5K8PA 1VBYA 1FXDA 2IHR1 2CRLA 4O3NA 2BQUA 5HO4A 1RT7A 1KC8T 4IR9A 4IOCQ 3MMCB 3OL9A 1I5OB 2G1HA 4P73A 3PX0A 3POTB 4FYVB 4NE9C 1U1MA 4WFZA 1B3TA 3A12A 4YUDA 2HBRB 2W24A 3EVWA 4PYDA 5E7OB 2ZBRA 4YR3A 3NOGA 1FDBA 2O67A 3NMAA 2B43A 1VQ4S 1SQEA 2K8GA 1N6QB 4QQBA 4DV3J 1B0VA 4DCPB 4UT4A 1NJWA 4I2QA 4KH0B 2A10A 2IYGA 3NGDA 1DTTA 4DF4A 1R8BA 3HT0A 4CO5A 3SV3A 3IO1A 4KKOA 3CSKA 4IH5A 4MMOA 5D0HA 2DGVA 5FLXU 5H9FK 1YJUA 2H54B 5HVFA 2GQCA 3TUZC 5E0OA 5LMUF 2HQFA 2HS3A 5H9EK 4JI1J 2E5IA 1KN6A 1YLXA 3JSBA 3T1HJ 1F5AA 2HFVA 5F3TA 4NA1A 5DQGA 3NGSA 1KQFB 1X4HA 1IR2A 1FCAA 1QJHA 3JQKA 3KWMA 1ZA1B 3FCHA 2XMVA 3N28A 2VDIA 4J9MA 4J9LA 4ECXA 2IRUA 4DV0F 5M2RA 4DSEA 3RZAA 1NK4A 3UFCX 1Q5VA 2KVQE 2D7SA 2OSQA 3HP6A 4U7CA 4NCGA 1FFGB 1PC4A 4FXWA 1LFPA 1S1TA 1OPIA 1OWXA 3RBDA 4JYAF 5J2MA 2U1AA 4ZN3A 4DL5A 3MPVA 1FNXH 1CPZA 5GMEA 1D3WA 2KVIA 4P2XA 1ACMB 2JX2A 3A8EA 4OX8A 1V6HA 3RBZA 1GXUA 1IN0A 5EX3A 5BR8J 4U8VA 1NKBA 2HNYB 4USVA 2V9KA 2Z2ZA 3UVJB 2O1PA 2CNLB 3G2XA 3KLGB 3Q24A 1ZETA 4E0DA 3HO1A 2XHWA 3S1TA 5L1IA 4PKDB 3KJVA 2QTWA 1KFDA 1EHWA 3N6MA 4KGZB 4F2SA 4RKUC 5DG9A 1WOSA 1OSCA 2JNJA 3BQ0A 3DGVA 2XNQA 2A0FB 4KKOB 4ZPDA 1HYSA 3D54A 4LSZB 4N8OA 1TK0A 2WSEC 4DX5A 5FLXY 4DPYA 4ZP9A 3BQ1A 4Z37A 2HRTA 4DV1F 2QYGA 2N7YA 4OV1A 1JLQA 2FJXA 3KHGA 2FPHX 4K59A 4P7VA 2OMLA 1UWAA 3LAKA 3OTDA 4NLQA 2R7WA 2NXNA 1B0PA 1Y7PA 4DUZJ 2RE1A 3V6DB 3EUNA 1VK8A 3LGHA 3VZHA 5L39A 4DR1J 1UW4A 4LRFA 3WX4A 2DPJA 3LANA 4JV2A 3MAQA 1NHKL 1TAUA 2W2QP 1B70B 1D9AA 4ECZA 1KHVA 3M1VA 4XDCA 4ZS6A 2LQBA 5ITHA 5EDWA 2GJFA 2A6OA 4B3TF 4C8LA 1PSDA 4OI3A 2BJ1A 1R8HA 3OSNA 5T7LB 2GIFA 2M52A 3UQSA 1HNZF 2LFVA 1AFJA 1Q5YA 4FN5A 2UUWA 2C2MB 1NH7A 3DMJB 4AL5A 1T94A 2F4VF 4DU7A 2XHCA 4G1PA 1Q7YT 2MSTA 3I32A 2AJ0A 3HSZA 2W4DA 2C2ZB 2HRYA 2M88A 3ITHB 5K14B 4PG6A 3PEJA 4QIVA 2VASA 2B3TB 3CJQA 2KYXA 4LF7F 1A9NB 4KPYA 3MR3A 4P74A 2VOOA 3KK2B 4FS2A 3CCWA 3NGTA 4CLFA 1NUEA 4U7UK 3R27A 2FD2A 2WSFC 1HQUA 2ZE2A 4OJ1A 5F41A 4RW4A 5F8IA 2IA6A 1KWMA 2F9JA 3F56A 2F4FA 1YRUA 2OJ3A 4JI7F 3BYRA 3DM2B 1WHXA 4HVZA 3SQGB 5DZ7A 4DZDA 5J2PA 3TRGA 3MCOA 5CAAA 3O1LA 5K20B 3PRBA 4C9DA 2IC3A 1F9HA 1MG7A 4WFYA 1HNWF 5HBMB 3J81U 5DM6Q 3N6NA 5ETMA 2ROPA 1KFSA 1WI8A 2M8DB 4LR7A 1X5TA 3TX8A 4B08A 1L3SA 2YWKA 1HI0P 2IJFA 2KYZA 4DV2F 2FB0A 2QMXA 1M5PC 4Y2CA 1T05A 2RQ4A 2FHOB 3SV4A 1HIYA 2V50A 4K50A 4BWJA 3C14A 1XNRF 4LSNB 3LOUA 2D9PA 4NASA 3A3OB 2JOQA 3B4DA 1FE4A 3BBFA 2HQCA 4DR5F 5AXMA 4RNNA 4N47A 1N0VC 5JMNA 2E7WA 3TO8A 3C19A 2Y3YA 3LO3A 4KB7A 2KJVA 4FDFA 4HDHA 1S1WB 1RA7A 2Z58B 3SCKE 5HSPA 5A76A 5KG5A 3K58A 1ZM4A 4XK8C 5I4MA 2OIHA 5T41A 3ILJA 3VGTA 5KT3A 5I3QA 1IKXB 3WZ0A 4B3SJ 3NLCA 1QM9A 1TZ0A 4MJKA 2ATCB 3CF5Q 3DRYA 5A0YA 2I5JB 2W4PA 5AE3A 4NXNJ 1SC3B 2NPIA 3R5JB 4H54A 3PM9A 3CC2S 2XY6A 2MJUA 4EBEA 4ENOA 2E7VA 4I2QB 3QRPA 3T5HA 4KSEB 4B17A 3TZYA 1SJFA 4A8YA 2P2CB 4IYQA 2IJRA 4P71A 2DR9A 4G3IA 3W2VA 5EWEA 1T05B 1VC5A 1ELOA 2YPYA 4G6VB 1C0UB 4TY8B 3R5BA 5C5JA 3MUMP 4PG5A 1RTDA 5HANA 4AFFA 1PILA 3QO9A 4JB8B 2NPFA 3TJAA 3N4WA 4NLTA 2KT2A 3CW2C 4KHPF 3A8IA 4M5HA 2YBVA 4DU8A 4A8OA 4IO1A 4J9PA 1HMVA 4PUOB 5KT2A 1KD1T 3LH2S 2BE2B 1S9FA 2Z8QA 3RBEA 3C3LA 1QAIA 3PRVA 2RF2B 2X3GA 2ZKTA 5C24B 4FYWB 2HFNA 4ZHRA 3PR4A 1IKVA 3TUPA 4DDFA 3I0RB 4MYTA 3PKMA 3NCPA 2D41A 3D0GE 4ECYA 4Y0FA 1JJHA 3QT7A 4P10A 2KZMA 2QLBB 3IBWA 3M9NB 2ZNZA 4ECVA 1Q16B 1V3SA 2C2NA 3LP0A 3HPOA 3Q23A 3V81A 1U8SA 1WG5A 2L9DA 5HJXA 1T95A 4Y34A 4CLTA 2KG0A 2BBEA 5GAHI 4I6YA 3JB9k 2AMCB 4CWBA 1UA0A 1REVA 3W66A 1V3ZA 1VQSA 4HT7A 3LTOA 2HVEA 3LWMA 4AQYF 3CD5A 1DTQB 2ZOMA 3MR2A 5KAKA 1YX2A 1OPZA 2W9BA 1S1VA 2XMKA 5IWAJ 1JLAA 1RCOB 3JYTB 2V2VA 1WC5A 1KVKA 1VQ8S 1BC6A 3DLGB 2IVFB 1SV5A 2D3UA 4YDDB 1N36F 5LXRA 4RW8A 1FWKA 1HBNB 2M5YA 5ETTA 1IBKJ 4Y28C 1A6LA 2CPDA 4G65A 4MFBA 3IBCB 3C2PA 1L3TA 2VPWB 2ZUGA 3PDNA 2VPYB 4PYAA 4A8XA 5DDPC 3C16B 3QLHB 5EHHA 3PYFA 1BQNB 2ZUAA 3KUGA 1Q7LB 3T5LA 1PG5B 1YZ7A 3H98A 4M5MA 4PEOA 4LF4F 1XMOJ 4MKVA 4QU6A 4CLZA 4CNZA 2VFTA 3I5BA 2DNLA 5LSLA 3NG8A 1FTRA 2HPUA 2JLGA 3R3TA 1RWWB 4QOTA 2XGPA 1Q82T 4HLBA 3PW2A 4FXVA 4RUAA 5HROA 2DGOA 1U26A 4C8YA 2VQFF 1OS5A 4JP8A 3BM7A 4I0WA 2K3IA 3GLJA 3I55S 4CZCA 1U24A 4FF3A 1F2HA 1HBUB 1TUGB 3SQOP 2AWZA 1PO6A 2ZEJA 1GAOA 1TUWA 1O5JA 2PA3A 3FBEA 3GIRA 4U6PA 3R5GA 5DDOC 4OX9F 1KP6A 2QJ3A 2V94A 1NM2A 3VAGA 1TL1B 4IG3B 2FQQB 4ZPBA 4M95A 2NQPA 1RAGB 2IPOB 3GP9A 2Y1JA 3AXMA 5T14A 1Q8LA 3M9OB 1XNQJ 3D1OA 2GVZB 2JZ5A 1OQ6A 4ELVA 2CA9A 3KJQB 4PWDA 1VMBA 1VJQA 2B9XA 3EZ5A 2X7IA 3PACA 4JI6J 2IAJA 1FRMA 2LXUA 1UVIA 2V9WA 3TYTA 3DOMA 4LBPA 4X66F 1L5UA 2PFFB 2VH7A 2VODA 4Q0BB 3M6UA 4PAAA 4MK8A 4USMA 4EZ9A 1PGZA 1J5OA 2BOAA 3LP2A 2JLEA 4DR4F 2UUCJ 2XY7A 1X4CA 4F4YA 2DITA 4DG1B 1IKYA 2A1BA 3EWGA 4LR9A 2MPUA 3QQCD 1CJVA 2CYYA 1KLMB 3M8PA 3PV8A 3RB6A 3DRRA 3R9LA 4CI0B 3V6JA 4FBTA 1QE1B 2M7SA 4NRUA 1RSCA 4WIQA 1NKCA 4CYUA 2GMHA 2XEXA 3MM5A 4RLEA 5SZTA 2PMWA 5KG4A 4OYPA 2HVHA 3EGNA 4C2MA 2W8KA 1HLWA 4IO9Q 4JI0J 3BS9A 4FZVA 1GFWB 3OTOJ 1AW0A 3MEEA 3JSRA 5AE1A 2QMUB 5DG8A 3Q8QB 2Z56B 5DGAA 3IN5A 3HSGA 5B0CA 1DAXA 2MKCA 3O6QA 5E41A 4XPCA 2ZM6F 5IC4B 2O66A 3OVBA 1NJXA 2XZDB 3QGPA 1RTHB 4OI2A 2ROEA 2YWFA 1WTBA 2KFYA 4B9NA 1B7FA 4YB6A 3RTVA 2EW9A 2OPRA 3LGMA 4ID8A 4M5LA 4NZ6A 5KFKA 3VAIA 5LMUJ 3FCVA 2YTCA 3UN5A 3OTBA 2OPQA 1LWEB 3DN9A 3A13A 4JOUA 4PUOA 1HA1A 2N7CA 3K5PA 4C11B 3BSNA 1KLNA 2NXUA 3OXLA 2SXLA 2RRAA 3KMQA 3MUTP 5KFSA 2ZH5A 4ES2A 4IFYA 2XI3A 3T1AA 1Y5LB 5KFDA 5HMZA 2YNIB 3MHYA 4RUBA 1S6PB 2VBZA 4GC7A 1T9XA 3QJJA 3NMRA 4CT8A 1URRA 4QR2A 5HP1A 1GTEA 1CULB 4H4MB 4LVOP 3QIPB 3TA0A 2F8EX 2V2ZA 3NAIA 1FT8A 2PE8A 3PEHA 5E3AA 2CQPA 3GG1A 3L09A 4OZ3A 2EBEA 2V4QA 4NI2A 2OP5A 4EO8A 2IVMA 3CCRS 4Q8FA 1YQHA 3JTOA 2Z2MA 4WP9A 3L3CA 2IFXA 1VQNS 1YGYA 4FYDA 4J90A 1KNZA 4ED6A 2KXHA 4CO0A 3NKYA 4X4SA 2AYMA 2WBRA 3MF5A 1SVDA 2FZCB 5E2QA 3IRXA 4EO6A 4DV1J 2M3DA 4WTOB 1J5EF 4AL6A 2QT7A 1N32J 2BJ7A 3D7SB 1FWLA 1P1TA 2CJAA 3T5JA 2Z2YB 4MH8A 3O8WA 4WFBQ 2RHSB 2FYXA 3CB4A 3K2YA 3QLHA 5KG3A 4B3RJ 4LFBF 3QT6A 3HZEA 3H4DA 1CS4A 3IXQA 1DLOA 2Q43A 3WX8A 2BRLA 2MMYA 3KXDA 3CDAA 3GFHA 3BO4A 1SL0A 4A47A 4Y3CA 1Y10A 4YB5A 4N7TA 3WIVA 1EJ7L 3VR1A 1AYEA 1SI9A 1SQGA 4OYAA 4ILMA 1U02A 4JBCA 1CQNA 1TR0A 2H3EB 2NS1B 3DI6A 3G82B 4MTPA 5HLFB 3NNAA 1IKWB 2BE9B 1YWXA 3M6WA 4KV8B 3DU5A 4J7CA 1UL3A 1F0XA 2VL1A 1C1CB 1NDPA 2Q79A 3DFEA 4NLYA 2E5LJ 2R2SA 5CZXA 2WRMA 1WKLA 3NP5A 2QV6A 2DNNA 4WXWA 5A8KB 5A6PA 2UU9F 4Q7AA 3CCSS 1M5KC 4ZVFA 1KOOA 5AXKA 1FJEB 2G2ZA 4HI2A 1NDLA 2VFRA 4KQZA 1RQ0A 2NSCA 2QL9B 2ZHOA 4G1QA 2JFDA 1DARA 2VKZG 2J7KA 4ICLB 2QLJB 1TKZA 3C6UB 3N0VA 1NDKA 4MK7A 4TQSA 2MQQA 4NLRA 5KT5A 2F4VJ 1X5PA 2F40A 1Q8BA 1T9UA 2YWHA 5HK4A 4ZJQA 1FO1A 2PA8D 4ZVOB 3OJSA 4R25A 1XMOF 5L1JA 1S5ZA 4AXJA 1KKHA 1C0TA 1JXVA 1R8CA 3F0NA 3DXSX 1RT6A 3A8KA 3I0SA 2DISA 2LDYA 3IM9A 5KTQA 3H40A 2CQIA 5HBMA 1XNRJ 3UE2A 1KQSR 1Z4UA 4DV7J 2LXFA 3P5BP 2RILA 3JQJA 1RA6A 2GC8A 3KKFA 5DRKA 2G0JA 5L38A 1XC9A 1VBXA 2R8GA 1HD1A 1WHVA 2CPEA 3G8QA 2XYPB 3PCOB 1Y3JA 2DGXA 2XMUA 1TKXB 4AT1B 1DQ9A 2Y0BB 1OJ4A 2Z0GA 1F5BA 3HLUA 4NLVA 5DQHA 4DQPA 3QSIA 3NAHA 1CQMA 4F0HA 4TU9A 2HZCA 2RQCA 5A8KA 1E6VB 1R7IA 1T9YA 1RT2B 3ZTOA 3R5DA 2GIQA 3GB0A 4ZA1A 3ILLA 4DPOA 3H4BA 4XPEA 2B9YA 1BQXA 3GCWP 1RK8A 2RT3A 4K4SA 4LRCA 4ZVRB 3KTQA 1WDDA 1H38A 2W9CA 3KFWX 3HSJA 3CMAS 2FVRA 2VG6B 1HI1A 1KQGB 2DNMA 4ZCLA 2WB1D 2H5JB 2ZC4A 4I2PB 3NOCA 3RAQA 2ZWOA 3RU0A 1QLNA 1FESA 1BY9A 2VUGA 1NSPA 3DHXA 4C6AA 2AZ1A 1DBDA 2YPZA 2HIQA 1PBUA 3O5TB 1PBAA 4Q44A 1VQMS 3M8QA 3W2WA 1R0AA 3TA2A 5FDLA 2B8PA 1O8BA 3T3FA 4OX6A 1G2EA 5GAEI 4V19X 1R0CB 3Q8PB 1FKPB 4AXIA 1S10A 3H5XA 2QLFB 3H2UB 2ACMA 3DGPA 2D74B 4KE5A 3PJWA 3PIPQ 2CNNB 1AUDA 5K8OA 2L3MA 3MM6A 3ZTQA 4M5DB 4WU3A 3IS9A 5HQ8A 4DSKA 1RT5A 2MZJA 1JNRB 2J8AA 2E5HA 2R42A 3D6TB 3EXYA 2GQ2A 3HHLD 3NCRA 4HHJA 3J7YU 3C15A 3CT9A 2FLOA 3DLKB 5BR8F 1HI8A 1NK8A 3G87A 1WHWA 2CZ9A 1NLKL 2YWGA 4LF1A 4JUZA 3CO0P 3G6YA 2HZVA 3GCXP 5E3QA 3BKUA 4LF9F 4DL3A 3T1HF 3OQ2A 1WEYA 1IR1A 2VC1A 5C24A 5A2QU 4KT0C 1IKVB 1KQKA 3GPAA 4C97A 3PW4A 5HQMA 1FHTA 2RMLA 2WVEA 1R8PA 2F8MA 2FJDB 4O0NA 2OPPA 1AB8A 1HBMA 4USJC 1YJTA 1N8RT 4X4NA 3W63A 2ILZA 4R8UA 5B0EA 3TR5A 2PT0A 3G6XA 1U1OA 1SPBP 5EUHA 3AB2B 3CIZA 1IBLF 3OJUA 3W62A 1HKAA 1S99A 2UVRA 3HMJG 1VQ6S 4DZ6A 3I4HX 3MAAB 3D2WA 4NXMF 2YKNA 2K1RB 1U1PA 3TQEA 2XCPA 3W61A 3K5LA 1G6BA 3HHNB 1IR0A 2E1PA 2MJNA 4C8MA 1MN7A 4EBCA 2AYEA 4OI4A 3WDOA 2MQ8A 3TWZA 4ECQA 3ET6A 3DYAA 3MPWA 2K2PA 3HD2A 4HT5A 4LF5F 2DNPA 2IJNA 3ONQA 1ULRA 2XC9A 1HFEL 4P2MA 4O44B 1IWAA 3DLLQ 4FVCA 1T03A 3VF0B 3S01A 2EI5A 4ED1A 3AFGA 3MM7A 1KVJA 1ZTWA 1QY7A 2HNZB 3QRQA 5CYQB 5DO2A 1NJZA 2M0GB 2H4YB 4TKTA 2VQEJ 2DXEA 2DVIA 3PHEA 3R7BB 3R5CA 4F04B 1NSQA 4H4KA 1RGVA 3DRSB 4Y2MA 2RDIA 5I3PA 4GO7X 1N52B 4RUHA 3MMAA 5GADU 1XJWB 2MXYA 4BCAA 1RTIA 1JJCB 3EZOA 1LOUA 1RWMB 2QX0A 3MFIA 5AXLA 4WK3A 5L1KA 1VYAA 2DH9A 2ZKUA 3L95X 4DPUA 1VLOA 3MURP 4LF4J 3OPKA 3ETOA 2JEJA 1T11A 2XO7A 2RNEA 1JLBB 3BPSP 4WKYA 1A0OB 2VHGA 3BF4A 2EKYA 4M1KA 4DV6J 2AW0A 3OR1A 2MZRA 4N76A 1NB7A 2DR7A 2MLYA 3A1YG 4P72A 2E1RA 3BGRA 3DYAB 3UD4P 2LQ5A 3TNVA 4OZLA 3JXOA 2MQOA 4HH1A 2DGSA 5B7WA 1ZBTA 2LA4A 4ANEA 1VRQC 2G4BA 1N5VA 1NJYA 3JQMA 1FFSB 3MM7B 4WIIA 1NDCA 3K5MA 4PQUB 1J2VA 3CPWR 4LFCF 3KLIB 4OYZA 2BJ3A 1NPRA 1Y00A 3AA9A 4CM2A 3KLEB 3KNGA 2MLXA 1U2FA 2EG2A 2XM3A 1CJUB 2GVZA 4RBTA 2IM0A 1S0VA 4RZRA 4B3OA 2HRUA 2EWHA 4OYIA 2LLZA 1G7CB 5GMDA 3CJKA 2D3O1 1JLCA 4KGKA 4RX6A 4RW9A 2ZJQQ 4NXNF 1SBRA 3FSXA 2MDAA 2PMHA 1FVSA 1KBRA 3MTKA 3J81j 1I51B 5ETNA 4JI6F 3GFXA 5KFJA 3MECA 3GILA 4RU2A 2R8KA 4X4UA 1U6FA 3T5KA 2IDEA 4DPTA 4Y2IA 3MR6A 3TVKA 2JVOA 1RTZA 3I4PA 4DN0A 4X84A 2GHPA 3KJVB 3BV8A 2VJVA 2C2OB 3CJ4A 2OD4A 5J1NA 3AXKA 2H1YA 5EWFA 2ZH9A 2AGQA 3THPA 1IBMF 2BQ3A 3AT1B 1H7WA 1NZ8A 1RB0A 1IJFB 4OMFG 4CNYA 4C48A 1N5QA 3RYLA 4QU7A 2CWXA 4EU0A 4DSFA 1FKPA 4OLPA 2YNHB 1UVJA 3FZBA 1TKTA 2C3MA 4GVLA 4WWSA 3DU6A 4QW8A 2QA4G 2FLPA 3CC4S 2VF3A 1Z1ZA 2OTLS 5KFMA 1IKWA 1PYOB 4KV8A 1FVQA 1RHMB 3KK1A 4B9TA 1BD6A 5KFVA 1Q78A 3BBBA 5CYMA 4IG0B 2XTJP 4JI0F 3J80U 2XS7A 3CCMS 1N33F 4P75A 2FY1A 2W2MP 3C14B 2EG1A 3QWUA 4K8RA 2W9BB 1FNMA 4IKAA 4KO0B 5C25B 4L72B 2DGTA 1Y11A 2DH8A 2Z57B 3HVAA 4I68A 3FFIB 1DQ8A 1R6YA 2KXFA 4B9VA 3FBCA 5LM7E 2ZFHA 2D3OR 2Q1LA 3IGVA 1U0SA 2JWNA 5K8MA 4AL7A 2WVBA 3ETMA 3FRZA 5I3UA 2FY8A 3CCUS 3LP2B 3MOJB 1RYSA 3K89A 3C16A 1UPMB 2P9GA 2D3ZA 3DHWC 4NLWA 3SMZA 1CULA 1S1UA 1WC0A 2DHXA 2O01C 2R3VA 1HQUB 3QPIA 4USUA 2CFXA 3W1YC 4RW6A 4CM0A 2RDJA 2R7TA 3M30B 3HVTB 1HD0A 4A8QA 4KC5A 2MHEA 2DY9A 3QYYA 4LQ3A 3CDEA 1TKTB 4NI2B 3SFGA 3M2UA 1V3RA 2YKOA 2AX0A 3HDSA 1FK9A 3HHLA 2O3DA 5GVQA 3RJMB 4CRJA 3OV7A 2HNDA 3I5CA 3P3DA 2CPXA 2EK6A 3ZC4A 4B3RF 4YY3F 3LF0A 5A2QY 3Q0AA 4IQMA 5BYSA 1TL5A 2C3UA 4RNHA 3ZZYA 1AZSB 1XBWA 1FD8A 4NYOA 4AD6A 3GIJA 1EP4B 1TQLA 1BUXA 3BPDA 4Q2MA 1WC1A 2A2CA 3CDUA 4ZCIA 2VIHA 2CQ2A 4WBFA 5K8NA 1F9EB 2FTRA 5K5MA 4EEYA 4DEZA 1S49A 3AA8A 3IAM9 3GIMA 2RVJA 2Y8WA 3NBPA 3I0RA 2ZH3A 3IGNA 5D0EA 1XK8A 1U25A 4FNHA 1KONA 1JNZB 3KG4A 4ZPCA 3LQVA 4FNIA 3UWTA 1GX5A 4HH0A 1QAYA 3DOKA 4QIFA 5KG7A 1PJ5A 4A48A 3BGFA 1KS2A 2P5VA 4F3OA 1SIZA 1GT8A 1R43A 4OX9J 1B7YB 4F25A 2C2RA 2AT1B 4IFVB 5F9NA 1U1KA 3D5MA 3L7PA 1DTTB 3LALA 2J8SA 5ETKA 1JWWA 1QAXA 1TVRB 2FHMA 1ZPWX 1VDHA 1VFJA 4IH6A 4Y2KA 5ETSA 2AJ4A 5L8RC 5B08A 1U09A 3KG0A 4L73A 3CTRA 4J9KA 2RU9A 1X4AA 4DR7F 1U8WA 1NSAA 4O23A 5D4LA 1HR0J 1TL3B 2YNGA 4DL6A 3CDBA 3TZZA 1FKAF 2JRSA 1VQYA 3EDRB 3G8SA 4Y65A 1CJKB 1T9WA 3E51A 2FJEB 2ZD1B 3KUEA 3HZGA 5KFGA 3FK4A 2P9EA 2DRDA 2AGPA 2Y1IA 4W4MA 1L3VA 1HNXF 3HJVA 4FVMA 3E01A 2U2FA 1RDRA 1RTHA 3DXBA 5KFLA 3PHTA 2W2NP 1HNVA 2F63A 3AOAA 2MHNA 3HULA 4PG4A 2XMMA 2AJFE 4A8MP 4CO4A 4JI4J 1MU2B 3FQLA 1RTJB 2HW3A 4DN9A 1NCLA 3SDEB 2B4OA 3HI9A 4HTIA 2YX1A 5D8HB 2HURA 2BQRA 3X1LB 1VS3A 4ILRA 1HWKA 3L7OA 3IR5B 3ICLA 1NU4A 4WCEQ 1SH2A 5F0WA 1RLCL 3DDIA 1JLAB 2CG8A 5A8WB 3MAHA 4ED5A 4PWWA 2FC8A 3BREA 4MIWA 4B3MF 2DGWA 4OX7A 1VQ9S 1S9EB 1NAQA 4OZNA 4C7QA 1P9YA 4JI2F 1M1GA 2AX1A 2HNZA 1DZ5A 1ZZFA 4HDGA 3KLFA 2A2DA 2NLWA 1XWLA 3FKBA 5FJ4A 3M1VB 1DRZA 5CYMB 1CC8A 2IYIA 2CVEA 5LSOA 2KG1A 4CLPA 4KPCA 3BSAA 1R0AB 1DFDA 2ADBA 1CVJA 1FDAA 2VFVA 2JL9A 2ZC3A 3E3XA 1LW0A 3ILIA 1KEKA 1X4DA 2PEHA 1MROA 2R7QA 3FFIA 3IG1B 1IKXA 2PO4A 2JJ4D 3Q22A 1H73A 4XDDA 2CJBA 1HWLA 2EKNA 2MQNA 3CWJA 3M6VA 4K0KF 3C6TB 2HNYA 3I82A 4F02A 2GJIA 3R2CJ 2E7XA 1FRLA 2ACYA 4OZ0A 5G4DA 2VBYA 2FGOA 3W5YA 2C2EA 4NLPA 2F65A 3IM8A 4RNFA 2PDAA 4NZ0A 2UUAJ 2FJAB 3CJRA 2B7CB 1UVMA 3DLEA 1RT2A 3CJ0A 1T7PA 3CCJS 3H5UA 1U0HB 4PG8A 2UV8A 1GQEA 2YKQA 2KH9A 4U7UD 3HKWA 3OVAA 2BACA 2MZ1A 1KTVA 1S9EA 1SKRA 3BSOA 1CLFA 2ABYA 2GFFA 5LJ5Y 3SYZA 2ZBCA 4H4OB 4WE1A 2BX6A 3HHLB 3VGUA 1SQFA 2H48B 2DHAA 1HMVB 2KL8A 2MZQA 3M7VA 5CHCB 3TUIC 3VCDA 2E5JA 4Y00A 2E29A 2OPSA 4PG7A 4TLQA 4V19J 3KLVA 3RRGA 3GWCA 2HBQB 1YHQS 1YIJS 4FXDA 3KG1A 4OYWA 2N4DA 2VV5A 1U45A 1UP1A 2UXCJ 1N5TA 1RKJA 1S77D 1RHKB 4ECRA 1TL7B 3PJXA 2DY1A 1SKWA 5GAGU 4NMLA 4X4RA 3MI7X 2KRRA 1MROB 3IG1A 3K5OA 3OR2B 4OYOA 4PQAA 2Q3PA 3NNHA 4B9LA 2AIRB 4AUKA 3AJDA 1UZHA 2J7UA 3CMQA 1C1BB 2CPJA 4I1TA 2PGCA 1Q95G 3VVUA 2UUBJ 4USWA 2XYGB 2CQ4A 4F36A 2MKKA 2W25A 4R5PB 3CDWA 2UU9J 2GV1A 2KRBA 1UEVA 2LCWA 3THVA 2VA2A 3VV2B 2F1FA 3QZ7A 4CO3A 3OUYA 2ZVSA 3DOKB 1JXLA 3UN2A 1BGXT 4CLUA 2DEJA 2DNYA 5HMXA 3TOQA 4N5SA 3P6YC 4LF5J 2J6TA 1FDDA 1PCAA 3ENAA 2R8HA 1Y9OA 2MEWA 1HWJA 2R7VA 2Q6BA 5MLCV 3R8YA 3J7ZT 4YY3J 4FKXA 4U96A 2HMIA 1DHMA 1GXTA 2CADA 4ID5A 3H5YA 3HK2A 3TEGA 1K44A 2F7VA 4DMZA 1S48A 3ENVA 4ES3A 3SFUA 4ZVTB 1WKKA 2VOPA 2C3PA 3TUJC 3ZTSA 4C8OA 1S4FA 1XMBA 2CUYA 3GG0A 4DV7F 4YN3B 1HQEA 3DC2A 3LA0A 1OYEA 2J0WA 1NB2A 3M6XA 5DQIA 5DM7Q 3WQPA 1BXNA 1SC4B 2R4FA 4E98A 3UDLA 1HW9A 2PFDA 3V5RA 1X4FA 4M5NA 1C1BA 1M5SA 2CQ3A 4EBDA 1RT7B 1ROFA 1U6BA 1BMQB 1OO0B 3W65A 3PIOQ 3KMSA 4LRBA 4NPOA 2ZVIA 3BN4A 5EGYA 4USKA 2UXBF 2EFVA 2CJ9A 2MY8A 3GQCA 2H65B 1RWNB 1JXEA 5G0RA 2Y1LB 3CD7A 5HQLA 5HAOA 1RBOB 3US5A 1HNZJ 5KFBA 1P27B 5HLFA 3PX6A 1S9GB 3AY0A 3GR1A 3I31A 2HHTA 3D6MB 4F26A 1P8GA 3J7AN 3Q8VA 2HHHJ 1T9VA 2WAQD 4JI3J 2KFZA 4DUTA 1JKHA 1WTFA 1GX6A 4TYBA 3TZWA 8ATCB 3PXGa 4X64J 4OI0A 3NNCA 4L3KA 3MPDA 1XR7A 4F4XA 3PZPA 4E2FB 2KM8B 3T6BA 4F0KA 2XLJA 5DG7A 2OEKA 1LV5A 1HARA 4YEAA 1U7LA 1X0PA 4OHWA 3SSSA 2ZJPQ 4C8NA 3B54A 2C2KB 2VKRA 2IAJB 4D3HA 2H4WB 4GVBA 3SSQA 4NL5A 1ZAWA 2BOPA 2M9KA 2RRBA 2OAUA 2VG5B 4ED8A 1WF0A 5HN0A 1NO8A 5LXYA 3CCZA 1VQPS 2Y9HA 3QAEA 2X3DA 3EYZA 5HJYA 1G1XA 3O3LA 2ZOGA 3M32A 5ETLA 3MCMA 4GO5X 4U9RA 4Q8EA 4KTQA 2GZOA 1DLOB 2UUTA 4E8UA 2ASLA 1JK9B 3MCSA 3JS9A 3UI3A 3PKYA 3OXGA 4JI8J 4LF9J 4DLGA 3RAXA 1I94J 1B99A 2MGZA 2ZH1A 4J9OA 1SB6A 2ZBIA 4A8SA 5HROB 3KLIA 5D4OA 1QDUB 1S6OA 1VR6A 3EGVA 5KFCA 1U47A 1R31A 2HGLA 2HWTA 1ZM2A 4IR1A 3EGWB 5THWA 1TAQA 4NLSA 2CQ1A 1MN9A 2LU2A 2OI2A 3IR7B 2EPIA 3RB4A 3TJ8A 3UD3P 3FJ2A 1N33J 2HKEA 3BYPA 4DV3F 4NLOA 2DIUA 3FSIA 4RW8B 2ALYB 1D9DA 1SC1B 2AP6A 2QFIA 4JV0A 2HAIA 2V8PA 3OHBA 3MR5A 3MECB 5L9NA 4X4PA 4I6WA 3CMES 2JC0A 2B6AB 3MEDB 4LIWA 4EK2A 1RAOA 2HS0A 7FD1A 3BDPA 1UPPA 2XWYA 3I96A 4MFBB 3UDEA 2CWKA 3AQOA 2MTLA 1SJ3P 2Q6CA 3HHKA 3U7JA 3VQTA 5JVHQ 2V68A 4B9SA 1B64A 4EZ6A 2PC6A 5T7LA 3CE8A 2V4JA 5IV3A 5KG0A 5IQ6A 3CC7S 2BKNA 2FVPA 3HF5A 4UTGA 3WIUA 1WWHA 1E6YB 1S12A 2YNIA 4EYHB 3RG6A 1H2UX 2E1MC 2UVUA 4RW7B 1XMQJ 1HHSA 2VQEF 2BANB 1UCNA 5F0UA 2L08A 1XEZA 2G0IA 4MKYA 4UY8T 1UJ5A 2R8JA 3B8HA 4LVNP 1ZS6A 3TJ9A 1KOHA 3OFGA 5KFXA 1ZZNA 2KXNB 5IT9Y 2QZ8A 4L76A 4ZVUB 3UW1A 3TP2A 5D78A 2LVWA 4KFBA 2G9OA 1ZOTA 4ZCMA 4F3MA 5GAGI 4YHHJ 2IM3A 3W9HA 3DLHA 3IFEA 5L46A 4TQRA 3SZ2A 2BM0A 4ER8A 2QRRA 2WZ1A 1CBKA 1O0PA 1FRKA 3D6FB 3V4IB 4GKKF 2CQCA 2ZOFA 3UPFA 3V81B 1GMWA 1VRTB 3D3CJ 3M2RA 1S6UA 3LGNA 4NZ7A 1BQMB 1PKUA 4IG3A 1EQ0A 1RWVB 3GIKA 3E2EA 1VBZA 3TVYA 2KZZA 3ADAC 2FDNA 4Z2XA 1VQ7S 1Q8IA 4AQYJ 3I6PA 1RISA 3H2LA 1E6YA 3MDFA 3MM8A 3QT5A 4NEZA 4MT1A 3C8YA 5DGBA 1TFYA 1UVNA 2DNGA 2KFNA 4CDIA 1WSVA 4FPIA 4OYXA 4DR1F 1HR0F 1WJ9A 2CJQA 1Q4RA 4WU2A 1EETB 3T9NA 4PRFA 5KOXA 3AJ1A 4NA2A 4LJMA 4DV6F 2HHSA 2GX8A 4WFXA 2B8QA 4HR2A 4CO2A 2VZ9A 3GTYX 3FEXB 2YH1A 2GGPB 2I8EA 3AOBA 4DXLA 2NXEA 2EEYA 3OW2R 4QPTA 3PW5A 2HSEB 3FBFA 2ZH2A 1GMVA 1KLMA 3LPEA 3M8PB 3H20A 3IC1A 5A0YB 3OSPA 3F73A 2R7SA 1YJVA 1YVFA 3MPUB 4Q45A 1RAIB 4Q43A 1RP5A 4WXOA 4QYRA 1LW2B 1XR6A 5KFEA 2B5JA 3RR8A 1JJ2R 4CLWA 3CJTA 4WPAA 2FGCA 2FHJD 1LXNA 4PXDA 3G6VA 4IRCA 4CLYA 1VRTA 3M2RB 5CCLA 1QVGR 2K06A 1RKIA 3KJNB 1N54B 3C6UA 4DR3J 1S7HA 1S0OA 4ETXA 2NZCA 1S76D 3PJ9A 2HHWA 3D67A 3S8SA 1RU2A 3OTEA 3AODA 2OPPB 1MNEA 1LQ9A 1TV6A 4LF8F 2C42A 5ETVA 5KG2A 5KT6A 2C28A 4PXBA 3UVJA 3J7Z5 2GAGC 1F3VA 1FERA 3VGSA 3Q2TC 4ANDA 1K73T 3FBBA 3FQKA 5C42B 3NGUA 3MAAA 2DCLA 4CIOA 4ECUA 4X4OA 3THTA 3EJMA 2P9CA 2ZH4A 1FKOB 1ZAVA 2ZITA 3IAS9 1CS4B 4J5OA 3EMTA 1W2IA 2X1AA 3GJQB 3T9ZA 3OHAA 2YKPA 2QE5A 3DRPA 4J91A 2BV3A 2ZBQA 3P96A 4I64A 5E5NA 2VBWA 2DPIA 4LF6J 2XNRA 5AE2A 2AJQA 2BUNA 2QSWA 3HHLC 1ZAXA 4GRSA 9RUBA 5HMWA 3VALA 4FYYB 4H4MA 2AU0A 1FXRA 4DQQA 1UW9A 3UDVA 1SH3A 5KFTA 2AQ4A 3QGGA 3UDCA 4M5JA 2ZDOA 4C4WA 1NEEA 2DXDA 2DNHA 2QA2A 1FX4A 1TK5A 1FJGF 4OLOA 3P5TL 1HBOA 1BHNA 3M8WA 1JMTA 4ID5B 4YFUA 4PWDB 1YRTA 1S1VB 4S0MA 3JYTA 3WBZA 1RWUA 2C3YA 3IMQJ 4K4YA 3FNNA 3BJYA 2PI4A 4UY85 1YJ9S 2WBMA 3GSIA 3ZZ0A 4NX9A 3DMJA 1GXLA 4KH1B 2KDOA 3D66A 5DDRC 4IDKB 3A3NB 3QGIA 7AT1B 2WVDA 2ZH6A 5I42A 3ZZZA 3L7UA 1Q8KA 4HEA9 4WZQA 1I1GA 2B6AA 2DK2A 1MU2A 3MEDA 3KYLA 5CCMA 3Q86A 4DG1A 3ELHA 3VAMA 2G2OA 4N56A 4CCHA 2LKZA 1TTHB 2PN6A 3D0IE 3D3BJ 2A6MA 2YH0A 3B4MA 1LK7A 2WOMB 3HX9A 1MMDA 2RKIB 1IJEB 1RT6B 4HHUA 2YVSA 4OJHA 4O3OA 2CAJA 1H2TZ 2CDRB 2GO9A 4MKAA 2ZM6J 2J7WA 2LU1A 5C2CA 4NCAA 1U49A 4HYKA 2LEBA 4ELUA 2OELA 3O2IA 4EMDA 5IS2A 4BS2A 4IFVA 3GE9A 3PVXA 2EK1A 3DRXA 1UTAA 3MWBA 3ZZRA 4KY3A 3KLEA 4F2RA 3GMGA 2CQBA 1S1TB 2QLXA 1JIHA 1RACB 1E6VA 4A46A 5LMNJ 4DS5A 2HQDA 1JLGB 2AEFA 3CUNA 4I6AA 1MW7A 4K4XA 1QSLA 3MEGA 4DHVA 3Q8UA 3PYDA 3R5AA 3KHLA 1JQGA 4AE5A 3U27A 1OY9A 1XN9A 4P52A 3G4SS 2E9TA 4RWXA 4LUBA 2VG6A 3MGJA 4DQRA 4FF2A 2IM2A 5J2NA 1DY3A 4I56A 1RAEB 1X5OA 4ATNA 2GVDA 4HHHA 3CCVS 1VBKA 5CH7B 3HM9A 2VPXB 4DUYF 2OMOA 3NCQA 3P8BB 4N77A 1YI2S 1YJ7A 2UUBF 2DHGA 4UF4A 3N6LA 1JX4A 4JV1A 3M2VA 5KFQA 4DV4J 3SSRA 2BVZA 3MEKA 1P9QC 1B0TA 1AROP 3PFEA 4DR2J 4B3SF 5A8RB 1I6JA 2V6AA 5KT4A 4DR6J 1QAJA 2J0QD 3ZNUA 3D1QA 5DDQC 5F8HA 3CJ2A 3BKFA 1C2PA 2I0XA 3JAMU 1HNXJ 5CYJA 2LQJA 3MOZA 3QIPA 4H4OA 4NMXA 2GGPA 4F50A 2FJWA 3G8TA 1FFWB 3RRKA 3W2VB 2VONA 2IBOA 1ZYQA 4LFBJ 2HGMA 2F3JA 2HHXA 1AXQA 1JLGA 3CD0A 2VFSA 1N36J 4CYUB 4DQSA 4OYBA 9ATCB 5H9EJ 1LWFA 3ZZUA 2CKWA 1RTIB 5A8WA 1PJ7A 1HBUA 2RUGA 1SKSA 3GYGA 5IZHA 2ASJA 1QSYA 2J9EA 4Q2LA 4RBVA 3HFVA 4WFAQ 2E1CA 1TL1A 2VQFJ 1QSSA 4M5GA 3I9ZA 1JLBA 3GYXB 3VWSA 4RUCA 3ZZPA 3FC9A 2XSJB 5F8GA 2XYHB 5JUMA 1B4SA 1K9MT 1KTQA 2FVSA 3BSCA 1TELA 1YBTA 2EFPA 2OPRB 3P45B 5CZVA 4O3PA 4V1Ak 5IM0A 4XTTA 4ZMMA 4IUFA 1HYSB 4LQ9A 1NH8A 2LQ9A 4O4RA 3R1HA 5B0FA 3UR3C 2CZVC 3UNYA 5ETOA 3V6HA 2AZ3A 3AAWB 3HVTA 3HHEA 4RW7A 4ZP7A 3NY0A 3J81Y 5SUHA 2UXBJ 2V0NA 4P9SA 3FRYA 2D1CA 5IC6B 5L9XA 1Y0HA 2JSXA 3QSYB 4PQUA 5J2QB 2HBZB 2V67A 5CQGA 1ZPVA 4OZ2A 2R7UA 1OYDA 2JDJA 3MM6B 1S0NA 1C1CA 2CQGA 1BWEA 3L4BC 2HQGA 1K8AT 5E3CA 4QWCA 1R0BG 1TL3A 2VB6A 3DLEB 3MTJA 6FD1A 1HBNA 1U6ZA 4WP8A 3GV8B 3Q8RB 3RR7A 4B3MJ 1YK9A 1LWFB 2FVCA 4DR3F 2HQIA 4M5IA 2DO0A 4A4JA 3OBIA 2ZHAA 2HGNA 1R3NA 1ZA2B 3VGVA 2XCAA 3M32B 1FA0A 2MLZA 2LA6A 4MAKA 2GW8A 5KFNA 2ERRA 3KNAA 2YKMB 2Y0SD 3UNGC 1KSPA 2QA1A 2XZWA 2I9SA 3BEGB 3IP0A 4C0OC 4QPXA 4RWWA 4YP3A 1H2VZ 1SUQB 3TAMB 2P6TA 5E3RA 4X66J 2MYFA 2C1EB 3IRXB 3VHQA 1VLYA 5DETA 1XR5A 2FC9A 5HATA 2BR0A 4DS4A 3I0SB 5BYRA 3NS5A 4J9NA 3FMWA 2XMWA 3NEKA 1N4LA 1OIAA 1I3OB 1N34J 3DM2A 3SQGA 4M5KA 4K4WA 1UJ6A 4K0KJ 2YKNB 3R7SB 4RNMA 1FDNA 4KHPJ 2V34A 2WW8A 3CCLS 2HVIA 1GMWD 1FX2A 4USIA 4DPWA 3W5XA 1JKHB 4OI6A 3V6KA 4OIXA 2R7XA 3KK1B 1PYSB 3ILOA 2NR0A 2KI2A 2JC1A 2NXJA 4NEYA 1OY6A 5L1LA 3P4UB 1RADB 2HWHA 4I7FB 4NYZA 5D3GA 1H3DA 4DX6A 1DURA 2N3OA 1Y4ZB 2JH3A 2NXCA 1XMQF 3CNQP 4UOFA 3OT9A 3T1YF 5E33A 3PW0A 3FDSA 5FIIA 1FJCA 1EIYB 2XO6A 2W4CA 4YDXA 2W9AA 2MKIA 3FCWA 2ZHBA 2NZ4A 4ZCKA 3CGIA 2EFNA 2KHCA 3MMCA 4ED3A 3OLBA 1KVIA 3W9JA 1S7IA 4G1QB 4ELTA 4ED0A 4KYZA 2N3LA 2DTJA 5CA5A 3TI0A 2WHOA 1FJ7A 2N4CA 3QGHA 2XWXA 2K3KA 3N01A 3ISND 4NWBA 2XMJA 1F1BB 3TAQA 2COLA 1N88A 2DNKA 2FLLA 2KHDA 5IXUA 2AEJA 1MWQA 4ETZA 4C8KA 3U1NA 3K5NA 3ZXWA 4F3QA 1U1RA 3OR1B 2E44A 4CH1A 1JLEA 1SJ4P 1OMSA 4QW9A 1FRIA 3QWPA 1WOPA 1S57A 3HJFA 3VZIA 1RCXB 3D9BA 4MIBA 2HLUA 2VD3A 5G0RB 4Q5VA 3RRHA 2F8HA 5KFPA 1MSWD 1Z2ZA 1BQMA 4LREA 4ECWA 2X51A 1RE1B 3AH6A 1TKXA 1GTHA 1FD2A 1HPZA 3EXCX 4IG0A 1DJ0A 4NXMJ 1IVZA 3UN3A 2XLIA 4OZ1A 4OJGA 4P6QA 1CEZA 4R8UB 2DIVA 2DGQA 4IOAQ 3HHDA 1QTNB 3SXLA 3QIDA 2ZNYA 4U67Q 4LSNA 2NUHA 3KUHA 1S1XB 1S59A 2RSQA 3QNWB 1VRUB 2V63A 4RR5A 2GJ2A 3OR2A 5FD1A 2DB1A 2XS5A 2I38A 1RHJB 2WW4A 3FMBA 4IDKA 1EETA 3QATA 2N82B 2V2KA 2IDLA 3AJ2A 2AYGA 4DUYJ 1Z2LA 2J9CA 1LXJA 4DSLA 4KR0B 1NK0A 2IRYA 1S1WA 1R27B 2BKOA 2B7BB 2OEJA 1NBEB 3BH7B 4IFYB 4FBUA 3M05A 4QR0A 2DT9A 5GAEU 2DO4A 2HYIB 2UUCF 4RPFA 2YXLA 7FDRA 4QCLA 4ZIWA 3PO5A 1UMJA 2VPZB 4PABA 4NCBA 4BC9A 1EQMA 1FF2A 3UCGA 4DR5J 3DOLA 2FIUA 2DNOA 5HMYA 1CG2A 4QZVB 3SBMA 4P7TA 3OL8A 1YRXA 1MWYA 3TA1A 3V4IA 3EZUA 5AJ3J 4OJ3A 1T9TA 3EICA 4C3LA 1QVFR 2Q66A 2KTQA 4G1IA 2HFOA 2HHVA 1CJTA 1FI4A 3GJTB 3IWXA 4F0MA 1AA1B 3RW7A 5IV4A 5D0GA 1C0UA 4TY8A 3M8RA 4ALZA 1RTDB 2W7OA 4KIAA 4HKQA 1HWUA 2YNFB 3UO0A 4F7VA 2VA3A 4NLGA 3FZ2A 3NXZA 4QIEA 1VQ5S 2YQ0A 2WCXA 1EB0A 1YSJA 3KK3A 3A8JA 2QA4S 2DH7A 3N79A 4ZLNA 5ETQA 5J2NB 2POKA 2BDPA 4OV6A 2QGFB 2QYCA 3QT8A 3BO2A 3KLGA 1SIWB 1FJGJ 1LWCB 4ZITA 1K1QA 5E3PA 1X31C 1K0VA 2XSFA 4UUXA 4QBUA 5JVGQ 4NLDA 4ZVPB 4LRDA 3M2VB 1WI6A 2XB2D 3U02A 2HK3A 4PCQA 1KDNA 2CNOB 3MM5B 5FDLB 2AF6A 2CQDA 1EKSA 5KFUA 1UKUA 5M2UA 1CJUA 4B3OB 1X9MA 2FHKA 2HQ3A 2GMLA 3RAMA 5ETRA 4A8FA 2BJEA 5LT5A 3ISNC 3W8PA 4CQ1A 4ZPWR 2PMZD 3QMQA 4DCJB 1W7WA 1FE0A 1OSDA 1REVB 3IS9B 3K59A 4RL1A 2JEFA 2R9LA 2RUSA 2UZAA 4OYMA 3BQ2A 1NRKA 1VOMA 3CJKB 3DNCA 4ICLA 2NCKL 2HS4A 1RHUB 3QFWA 4RO0A 4X62F 3G71S 2OH2A 3W8GA 1WG1A 2GO8A 4K4TA 5U47A 1N32F 1XQIA 2MKYA 4YHHF 3OXFA 1FRHA 1SC6A 2ZZMA 2CPFA 4DPXA 4ED7A 3QJPA 3OFFA 3M8SA 3EVMA 2HZAA 1TL4A 5LMNF 3GV7B 5KT7A 2CDQA 1O6XA 2ZH7A 3MM8B 3DRRB 3J7YI 2OD6A 3U1MA 1QE1A 2DYAA 5JXSA 1PAUB 3MMJA 4R0JA 1WC3A 2HG4A 2UP1A 2WVFA 1HHQA 2HAFA 1DQAA 4L3NA 4NRTA 2KT5A 4DLEA 1YG0A 4F4KA 4KJIA 2ALZA 5HVHA 4QYZJ 3CEDA 5KG1A 1V5IB 3D4JA 3IR6B 4CH7A 1F3FA 2HHQA 1OQ3A 1RT4A 3ZO7A 3MEGB 3GR0A 2AJ1A 2HEKA 4UUWA 5IFMA 4XO0A 4ZJLA 2RH3A 2PI5A 3KLHA 1GMUA 2NUUG 2F5GA 2IIHA 2EC2A 3IA0A 4FKYA 4DV4F 2OFGX 2MQMA 1YJWS 1TFWA 4OL8A 2IRXA 2CXEA 3TEHB 1VQOS 3LW5C 4DR6F 4UZBA 1RLDA 4WYWA 1NK9A 1FEHA 1HPZB 5BYQA 1MLAA 1TP7A 2L48A 5CD4H 4CTAA 2B4VA 2OPQB 1LWEA 2VFUA 4P2SA 1CJKA 5CYQA 5D4NA 1NK5A 2P6SA 3OL6A 4QYZK 4TN2A 4X65J 3KJFB 4ILLA 1G3OA 3HFKA 1IM4A 2HVZA 5EN1A 3H42A 1S1XA 1RYRA 3CULA 4QWDA 3OUYB 3OD2A 2BANA 1UFKA 1HNVB 2WONA 3C66A 3J80Y 3M8ZA 3MD1A 1X8DA 3N9UC 3BB5A 3HD1A 4Y2AA 3MM9A 4DR2F 1F5CA 2W7AA 4O3SA 1SL2A 4ZP6A 1WDTA 1XNQF 1RT1B 4ZK7M 2J0XA 4DFMA 2QG9B 5J1PA 3TZXA 4KHMA 3LPYA 4X4TA 1RBAA 4HTJA 1Q81T 3QRRA 2AEMA 1WC6A 4KGMA 4RW4B 4DSJA 1Q0NA 4LF8J 4EGLA 2E1AA 1F6TA 4A8WA 3TW0A 3H90A 2CJXB 1IBCB 4PZVA 4EWTA 2W7PA 1CJVB 3VAJA 4M63A 2OO4A 4B9MA 1RBLA 3TAPA 2OHDA 2IC3B 4DQIA 1QD1A 4TVAB 4C0BA 2XY5A 1VC6A 3AHPA 1C4AA 4CH0S 1VGYA 4I69A 2M8HA 3NBPB 3AB4B 1XERA 2LQ8A 2I2YA 3W60A 2EXUA 1V5VA 2AHOB 2XZTB 3BGUA 2PSZA 3DDKA 2BE2A 1BE4A 3PRDA 1RUSA 5D0RA 1IWGA 2CQHA 5D77A 2ASDA 1WHYA 1VK3A 1RT3B 1NK7A 3FUYA 3BZQA 4DL0C 4TU7A 2IM1A 2VC0A 2MSSA 5DLGA 2BABA 4RNOA 4QWBA 5A8RA 2R7OA 1N34F 4DR4J 1NPPA 1UETA 1M1HA 1H6KX 2AYBA 1PJ6A 5J2QA 3ENQA 1SCJB 3C6TA 3HVWA 3KDOA 2W8LA 4DBQA 2W1BA 2DRBA 3NWGA 1SL1A 1HHTP 2HFSA 4IRKA 1LEOA 2BRKA 1CC7A 1H74A 2OGUA 1WD6A 4UZCA 4ZVHA 2XS2A 3QBCA 4DSIA 4LBIA 3VTIA 4DWIA 2DHSA 3EPIA 1M1KT 2KB2A 1JLQB 1IM6A 3Q2SC 3PYEA 3GJRB 2ZD1A 4JI4F 1X4EA 2OKQA 3BGLA 2CPZA 4N41A 1RI7A 1S79A 2Z4PA 3SIPB 4O3RA 4K4ZA 3PTWA 4U95A 3MMAB 4TNOA 4K2XA 5KFIA 4GMKA 3VAKA 2OPSB 1U2CA 3TAMA 1SUQA 4MKBA 4IOBA 2B9WA 4L75A 5LJ3Y 3QJLA 4HACB 1BQNA 2CPHA
chains in the Genus database with same CATH topology
4KO0A 5C25A 2KO1A 4J37A 2KN4A 3SDEA 1NHUA 3GZ7A 4EFAC 3M9MB 1TUVA 4ZVEA 5JJBA 1W25A 1JLFB 2GIRA 4NA3A 4FF1A 3OL7A 5MAOA 4YOEA 4NLXA 1P6TA 2C3OA 4RBUA 1KHWA 5J2PB 1ZH5A 4H4KC 1SJ1A 3T6JA 1H7XA 1LW2A 2VBXA 3EGZA 2EFQA 1VIOA 4KHRA 4YR2A 2QFJA 4J9SA 3JAMY 1YJRA 5EX0A 2FVQA 3HT3A 2B4UA 4JV5F 1HBMB 3KLHB 1W2BR 2RQMA 3DLBA 4OHVA 3CD6S 2JHEA 1H0HB 4W90B 1YTYA 3GV5B 2R7RA 2LYVA 2MKJA 3UCUP 3LAMA 4RW9B 2ROGA 4C3KA 4RU9A 3IRWP 2MKHA 2ZJRQ 1FNOA 4KBIA 3THVA 2X1FA 1YJNS 2B4PA 2K7JA 3UR0A 5F8LA 4YMEA 1R8AA 2DNRA 2WK4A 1TKZB 1JLEB 3ITHA 3NGKA 2RRNA 2O5DA 1C0TB 3UCZP 1HWIA 4M5DA 3RB3A 3MXHP 2DCUB 4LIRA 3SCLE 3H2VE 2RU3A 5GADI 2ZE2B 2UXCF 2HFZA 2H5EA 1RTJA 2JFKA 1Q79A 2CQ0A 2OFHX 3WC0A 1QUVA 3MM9B 4F67A 1UFLA 2V8GA 3BR9A 1N48A 4FP9A 1T3NA 2IA0A 2ZH8A 3QZ8A 4NCGB 1N5YA 3MEEB 1L3UA 4F4ZA 4URQU 4ZOSA 1S72S 4PPDA 1VJWA 1SH0A 1KR4A 4MIAA 1S6QA 3PY8A 5KFWA 1Q1KA 2YNGB 2DR8A 2MZTA 2R2TA 2OLWA 2QIFA 1U1QA 2GQQA 4R5PA 5H9FJ 3K0JA 2V5HG 5M2PA 2CVIA 3CJ3A 3O44A 4YQWA 4DUZF 2YKMA 3I5AA 4I2PA 5KFFA 3ULHA 2VG7B 1VC6A 2B56A 2KKHA 4LT6A 2ASYA 2BYCA 5KFZA 2HW3A 4NLUA 1VI7A 1S6PA 1VQKS 4XAKA 3SI8A 3M8QB 3M2UB 4WTYA 4C8ZA 3VAHA 1Q53A 3DI6B 2MGZB 2I5JA 2EVZA 3OLAA 2BXJA 2JEIA 4WKRA 1K1SA 3ZZTA 1T3OA 1MWZA 1RT5B 5AJ3F 1DTQA 1L3KA 3SEOA 3H8YA 1JLCB 2XMTA 2AD9A 1VRUA 1UA1A 3C46A 4X2BA 3BR8A 2RS8A 4LMZA 3W3SA 2E5GA 2LXIA 1EP4A 2UV8G 5K14A 4DOZA 4DX8H 3CCES 3N5BA 2LEAA 1Y3KA 2M4MA 1UFWA 4K4VA 2K7KA 2HHHF 2YY3A 2JVRA 2MY7A 3PX4A 1D8YA 3KOAA 2CJKA 2XLKA 2EC0A 3DRPB 1HW8A 2FLNA 1PC5A 4UQTA 1U1NA 5KFAA 5F8MA 1CSJA 3E8OA 3LP0B 2ATLA 3I87A 5HL7Q 1F60B 3AQPA 1IXKA 4ZVGA 2FJBB 4C0HA 1D8ZA 1RT1A 5F9LA 1N6QA 1X7VA 2E9ZA 4YR0A 4KAIA 2CZ4A 3MUVP 4MYUA 4ZPAA 3OVSA 4DFPA 4K5RA 4O44A 4M94A 5D6GA 4URGA 1XTZA 3HXMA 1F9FA 2BA9A 5IT4A 3F44A 4FPRA 4ZDNA 4PR6A 2D9OA 3VAFA 3V4MA 4XIUA 1LK5A 3JSMA 2XI2A 4W92B 2G0CA 3HKZD 2X1BA 4O4GB 5A6WA 1TV6B 3T19A 2MQPA 1SXLA 4YB1P 1ZTTA 1U1LA 3DRSA 2WOMA 4UQGA 3BN7A 5J2MB 2UXDF 4QWAA 3KHHA 3MFHA 5KFOA 4D3GA 1FEEA 3ENWA 4Q0BA 4WYLA 5BJRA 2DNQA 3X3UA 2X1GA 2B0GA 2HNDB 2ADCA 1H98A 3KK2A 2LMIA 3GYNA 1LKZA 1UVKA 2HHUA 4OZ5A 4WF9Q 3D1HA 2M70A 2L9NA 3MMBB 4DL2A 3RW6A 3K57A 3IWNC 1O51A 2ILYA 3BGRB 2C22A 3QO9B 3I9V9 3NL0A 2LECA 2KJWA 4DF8A 4IRDA 4QJVA 1VC0A 2BJDA 4CO1A 6FDRA 2IMWP 1WF2A 2YX7A 2H9ZA 3B82A 4OQJA 1YITS 1N5YB 3LP1B 1X4GA 2IVYA 2J9DE 3K7RA 3NS6A 3TVZA 3LUYA 2B51A 3CO9A 2EFGA 4C9DA 3ZFVA 2V8DA 1RAJA 2J6UA 4X65F 1FXLA 4BHQA 5I42B 2HHPA 1TKDA 3G9CA 1GNKA 1S6QB 4NYPA 1YBAA 2EFOA 1M90T 4YB7A 2NSBA 4RW6B 1WG4A 3GFYA 2K1RA 3H25A 2DD8S 5B0GA 5F8NA 4UOCA 1M5VC 4JI5F 2RKIA 3H5SA 5ADZA 1UWBA 3G6ES 1LWCA 3PNIA 2APOA 4EUVA 3MMBA 3GFZA 5DLFA 1QUPA 5KFHA 3DLGA 3NRBA 1HNIA 2I1RA 1X5SA 4R0EA 2M2BA 4CT9A 1APSA 1UEUA 4B9UA 2RD5C 2RJZA 3S6EA 1MMLA 5GMKa 5DS7A 1Y5IB 2R2UA 5KFRA 2GHWA 4CTAB 1FRJA 3GIIA 5LL6d 2XGQA 2J9DA 2MKSA 4TLRA 1UJ4A 1RT3A 3CCTA 3E01B 4ZLPA 2MB0B 2OSRA 4ES1A 3K8VA 1JB0C 2QO3A 2YQ3A 1N0UA 2FHJA 4C98A 3OW2R 5D4PA 1IQTA 4WZMA 2RB7A 2DJWA 2MZSA 1Y5NB 3CCQS 3PR5B 3PW7A 2Y1RI 1X9SA 1M0SA 3HVRA 3GSDA 2E66A 5IQQA 2WSCC 1UWBB 2XG8A 1NHVA 2YKAA 2GMJA 3DOLB 5B0BA 1X0FA 2GHVC 2UUAF 4C3MA 4WFNQ 1BLUA 2B5JB 4WJBA 5HP1B 4DFKA 2AV5A 5KFYA 1S97A 2RQKA 4BWMA 1X4BA 3OFHA 2R8IA 1FK9B 4JI1F 1VQLS 2DR5A 4FF4A 1S0MA 4ECTA 1KRPA 2F9DA 3JSYA 1NKEA 5H1SV 4KFBB 5AXNA 4DFJA 4JI8F 1TK8A 4ERDA 4ZPTR 3I56S 1HQEB 3D28A 2L41A 1SJQA 4O3QA 4PXCA 1I94F 4A8KA 5KOWA 5IT0A 1M5HA 2HWIA 4J9RA 4LF6F 4HL9A 2LDIA 3N5FA 3DDNA 1VIXA 4TXSA 1VHFA 4LSLB 3G96A 4QIWD 1NNDA 4TU8A 1JJ4A 2CPYA 4K4UA 3ZZOA 4O4GA 5LSRA 4DJBA 5F3ZA 1FKOA 4AYBD 3SCIE 2RS2A 1U48A 4F4WA 1IUJA 2V4JB 3DCAA 1X9WA 2VG7A 4K5SA 2V8HA 1C4CA 4PPZA 3Q8SB 3KHRA 1N5SA 3BDEA 2J6SA 2NYIA 1GH8A 3S7RA 1HBOB 2NREA 3TARA 2J0SD 5F8JA 1RJJA 2R7UA 1S9GA 1U2RA 3H59A 4URSA 2E9RX 1T02A 3V2UC 3VQSA 1WELA 5GAHU 5IWAF 2WTFA 4GC6A 4FS1A 1J5OB 4MK9A 4OHXA 2IBKA 2QMWA 5B09A 1T03B 1T8EA 2BM1A 1R89A 2YNFA 4LFAF 2DRAA 4ZP8A 3FSYA 4HI1A 2VG5A 2Z2LA 2W9CB 4K4TA 1SV5B 1LW0B 4QIGA 3CVKA 4UW2A 2UVVA 4PWUA 4O3SA 4GKJF 3KK3B 2KM8C 3LWLA 4WK1A 4C11A 4LSLA 4OHYA 1NZAA 2QEXS 3MD3A 2J76E 4QR1A 5HI7A 2GCFA 3OTCA 3LP1A 2QLWA 4BBYA 4QWEA 4J9QA 3J7A1 3ISZA 1QTMA 4OHZA 2KT3A 2XSJA 3SCJE 4I67A 1S1UB 2MQLA 2C2DA 1WNEA 1FRXA 3DLJA 2BZ2A 1IQZA 2DGUA 2J5AA 2A18A 3FVYA 4N8NA 5J1EB 3FEYB 2R2RA 1IBKF 1D0EA 3FEZA 3P49B 4PXEA 1ZM3A 3W7BA 2HMIB 2PD1A 4OFZA 2G13A 3B78A 4O0IA 3V6DA 4M8LA 1NJIT 3EX7B 4WE1B 3OFEA 3TQ1A 1A7GE 4I4BA 1V9OA 1WEXA 2A3JA 3JTNA 4X64F 2GNKA 1ZM9A 2FUG9 3JTPA 2ZDPA 1HNIB 4I7FA 5D3GB 1D9FA 3PO4A 1Q86T 2GA7A 1D1UA 4ZKAA 3R1LA 4DL7A 3D0HE 3MZIA 2L9WA 2YWEA 3CIMA 3BO3A 2HLTA 4BDPA 4ITSA 2IMOA 1AFIA 1F2GA 2V8VA 1HL6A 2UVWA 4Y6IA 2RF2A 1LFWA 4OZJA 3KLFB 3JSMB 4KRWA 4B02A 4ZHRB 5CXTA 5B0AA 5I3UB 1MMNA 3IWLA 4ZPVR 2G1DA 4BC7A 1WACA 3TANA 2AGOA 4JI3F 2WONB 1SJRA 1WF1A 3POTA 4IH7A 2LEPA 2JLFA 5K9FA 3EPGA 2V4RA 2E5LF 1K0TA 3WC2A 2QSFA 5EWGA 2EBGA 2FJVA 2CIMA 2CPIA 5B0DA 1NK6A 3F41A 2CG4A 2WB4A 3K8WA 3PFOA 4NOHA 3W2WB 5J1EA 4DV5F 3M30A 1N56A 2XBPA 4OI1A 4USHA 5C42A 4X4VA 4X4QA 2YX4A 4DL4A 1TVRA 5DJBA 1U4BA 1FTCA 1RT4B 3M4XA 2JEGA 1UAWA 2PIIA 1JLFA 1P1LA 3CXCR 2RIJA 2XULA 1IKYB 3CJ5A 3G86A 3MPYA 4ED2A 2YNHA 2DNZA 2DBBA 3OTOF 3DLKA 2BW2A 1WEZA 5KG6A 3RB0A 3QAUA 4IQXA 4TY9A 4F8RA 3FGVA 1UVLA 1URNA 4ECSA 2ZZNA 4L6V3 3U1LA 4EYIB 2KU7A 5K8PA 1VBYA 1FXDA 2IHR1 2CRLA 4O3NA 2BQUA 5HO4A 1RT7A 1KC8T 4IR9A 4IOCQ 3MMCB 3OL9A 3PX0A 3POTB 1U1MA 4WFZA 4YUDA 2W24A 5E7OB 4YR3A 3NMAA 1FDBA 2O67A 2B43A 1VQ4S 1SQEA 2K8GA 1N6QB 4QQBA 1B0VA 1NJWA 4I2QA 2A10A 2IYGA 3NGDA 1DTTA 4DF4A 1R8BA 4CO5A 3SV3A 3IO1A 4KKOA 3CSKA 4IH5A 4MMOA 2DGVA 1YJUA 2GQCA 3TUZC 5E0OA 5LMUF 2HS3A 2E5IA 1KN6A 3JSBA 1F5AA 5DQGA 5F3TA 4NA1A 4TQSA 1KQFB 1NK4A 1X4HA 1FCAA 1QJHA 3KWMA 3N28A 4J9MA 3FCHA 2XMVA 4J9LA 4ECXA 2IRUA 4DV0F 5M2RA 4DSEA 3RZAA 3UFCX 2D7SA 2OSQA 3HP6A 4U7CA 4NCGA 1PC4A 4FXWA 1LFPA 1S1TA 1OPIA 1OWXA 3RBDA 4JYAF 5J2MA 2U1AA 4DL5A 3MPVA 1FNXH 1CPZA 2KVIA 1D3WA 2JX2A 3A8EA 4OX8A 1V6HA 1GXUA 1IN0A 5EX3A 1NKBA 2HNYB 2V9KA 3HO1A 2O1PA 4E0DA 3KLGB 3Q24A 1ZETA 2XHWA 3S1TA 5L1IA 4PKDB 3KJVA 1KFDA 3N6MA 4F2SA 4RKUC 5DG9A 1OSCA 3BQ0A 2XNQA 4KKOB 4ZPDA 1HYSA 3D54A 4N8OA 1TK0A 2WSEC 5FLXY 4ZP9A 3BQ1A 4Z37A 4DV1F 2N7YA 4OV1A 1JLQA 2FJXA 3KHGA 2FPHX 4K59A 4P7VA 2OMLA 3LAKA 3OTDA 4NLQA 2R7WA 1B0PA 1Y7PA 3V6DB 2RE1A 3EUNA 1VK8A 3VZHA 5L39A 2DPJA 1UW4A 3WX4A 4JV2A 3LANA 3MAQA 1TAUA 1D9AA 4ECZA 1M5OC 1KHVA 3M1VA 4XDCA 4ZS6A 2LQBA 5ITHA 5EDWA 4B3TF 4C8LA 1PSDA 4OI3A 1R8HA 3OSNA 5T7LB 2M52A 1AFJA 3UQSA 1HNZF 4FN5A 2UUWA 1NH7A 3DMJB 4AL5A 1T94A 2F4VF 4G1PA 1Q7YT 2MSTA 3I32A 2AJ0A 3ITHB 2W4DA 2HRYA 2M88A 5K14B 4PG6A 3PEJA 4QIVA 2VASA 2B3TB 2KYXA 4LF7F 1A9NB 4KPYA 3MR3A 2VOOA 3KK2B 4FS2A 3CCWA 4U7UK 3R27A 2FD2A 2WSFC 1HQUA 2ZE2A 4OJ1A 5F41A 4RW4A 5F8IA 2IA6A 2F9JA 3F56A 2OJ3A 1YRUA 3DM2B 1WHXA 4HVZA 3SQGB 5J2PA 3TRGA 3O1LA 3PRBA 2IC3A 4WFYA 1HNWF 5HBMB 5DM6Q 3N6NA 1KFSA 2ROPA 1WI8A 2M8DB 1X5TA 3TX8A 4B08A 1L3SA 2YWKA 1HI0P 2IJFA 2KYZA 4DV2F 2FB0A 2QMXA 1M5PC 4Y2CA 1T05A 2RQ4A 2FHOB 3SV4A 4K50A 4BWJA 1XNRF 4LSNB 3LOUA 2D9PA 2JOQA 3B4DA 1FE4A 4DR5F 5AXMA 4RNNA 4N47A 1N0VC 2E7WA 3TO8A 3LO3A 4KB7A 2KJVA 4HDHA 1S1WB 1RA7A 3SCKE 5KG5A 3K58A 1ZM4A 4XK8C 5I4MA 2OIHA 5T41A 5KT3A 5I3QA 1IKXB 3WZ0A 3NLCA 1QM9A 1TZ0A 4MJKA 3CF5Q 3DRYA 5A0YA 2I5JB 2W4PA 5AE3A 2NPIA 4H54A 3CC2S 3PM9A 2XY6A 2MJUA 4EBEA 4I2QB 3T5HA 4KSEB 4B17A 1SJFA 4A8YA 4IYQA 2DR9A 4G3IA 3W2VA 5EWEA 1T05B 1VC5A 1ELOA 4G6VB 1C0UB 4TY8B 3R5BA 5C5JA 3MUMP 4PG5A 1RTDA 3V81A 4AFFA 1PILA 3QO9A 2NPFA 3N4WA 4NLTA 2KT2A 4KHPF 4A8OA 4IO1A 4J9PA 1HMVA 4PUOB 5KT2A 1KD1T 3LH2S 2BE2B 1S9FA 2Z8QA 3RBEA 3C3LA 1QAIA 2RF2B 2X3GA 2ZKTA 5C24B 3PR4A 2HFNA 4ZHRA 1IKVA 4DDFA 3I0RB 4MYTA 3PKMA 3NCPA 2D41A 3D0GE 4ECYA 4Y0FA 1JJHA 2KZMA 3IBWA 3M9NB 2ZNZA 4ECVA 1Q16B 1V3SA 3LP0A 3Q23A 1U8SA 1WG5A 2L9DA 1T95A 4Y34A 2KG0A 2BBEA 5GAHI 4I6YA 3JB9k 1UA0A 1REVA 1V3ZA 1VQSA 4HT7A 3LWMA 4AQYF 3CD5A 1DTQB 2ZOMA 3MR2A 5KAKA 2W9BA 1OPZA 1S1VA 2XMKA 3JYTB 1JLAA 1VQ8S 1BC6A 3DLGB 2IVFB 1SV5A 2D3UA 4YDDB 1N36F 5LXRA 4RW8A 1HBNB 2M5YA 4Y28C 1A6LA 2CPDA 4MFBA 3C2PA 1L3TA 2VPWB 2ZUGA 3PDNA 2VPYB 5DDPC 4A8XA 3QLHB 5EHHA 1BQNB 1Q7LB 3T5LA 3H98A 4LF4F 4QU6A 4CNZA 2VFTA 3I5BA 2DNLA 5LSLA 3NG8A 1FTRA 2HPUA 2JLGA 3R3TA 4QOTA 2XGPA 1Q82T 4HLBA 3PW2A 4FXVA 4RUAA 5HROA 2DGOA 1U26A 4C8YA 2VQFF 1OS5A 3BM7A 4I0WA 2K3IA 3I55S 4CZCA 1U24A 4FF3A 1PO6A 1HBUB 2AWZA 1GAOA 4U6PA 1O5JA 2PA3A 5DDOC 4OX9F 2V94A 3VAGA 4M95A 1TL1B 4IG3B 4ZPBA 2NQPA 2Y1JA 5T14A 1Q8LA 3M9OB 3D1OA 2JZ5A 1OQ6A 4ELVA 4PWDA 1VMBA 2B9XA 3EZ5A 3PACA 2IAJA 1FRMA 2LXUA 2V9WA 3TYTA