4QYZJ

Crystal structure of a crispr rna-guided surveillance complex, cascade, bound to a ssdna target
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
195
Chain Sequence
b'MRSYLILRLAGPMQAWGQPTGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSESVQFAVRCDELILRRVSVTGLRDYHTVLIQTWREYLCDASFTVALWLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQPQKALLNYEPVGGDIYSEESVHLKFTARDEPMITLPRQFASREWYVIKGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/dna/rna
total genus 38
structure length 195
sequence length 219
ec nomenclature
pdb deposition date 2014-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qyzJ00
4QYZJ 3VZIA 4U7UK 5H9FJ 3VZHA 3KG4A 5CD4H 5H9EJ 4R0JA 4N77A 4F3MA
chains in the Genus database with same CATH superfamily
2ZBQA 1S9GA 4DG1A 2W2OP 2I5JA 3VV2B 3R27A 1N34F 1U1KA 3NRBA 3FBCA 4YR3A 2DIVA 2CZ9A 4X65F 3BO3A 4W98A 1OPZA 2WSFC 2AJQA 4FKYA 9RUBA 5FLXU 3NGKA 5A2QY 4L74A 1Z2ZA 3QGHA 3BQ0A 3I9ZA 5HK4A 2J0SD 3NAHA 4KGKA 3A1YG 2MQ8A 3KK2B 3FCHA 5B0AA 1N34J 5I3UA 3DDNA 4ZCLA 1N5YA 3G8TA 2NREA 1RTZA 1RTHB 3MM6B 2F1FA 1MMLA 1N5TA 3CCRS 4X65J 4QR2A 3FQLA 4USKA 1WEZA 3EPIA 3ILIA 1S59A 4UQTA 4PUOB 2JJ4D 5EX3A 3TJAA 3PIOQ 5J2MB 3OL6A 3W61A 1B7FA 5CD4A 3UD3P 1FVQA 4WE1A 3PKMA 1TV6B 3V6DB 2Y1RI 1RT2B 1Y5LB 2QL9B 4DOZA 4ZN3A 4YP3A 4LRBA 1OQ3A 1RAIB 1WWHA 4RNFA 1V3RA 2M3DA 3KMQA 3CGIA 2R7WA 2R2SA 3QT8A 1NKBA 1WC1A 3OXLA 2D7SA 2WAQD 1FWPA 3DXBA 1SC4B 3FJ2A 1HL6A 5DS7A 2LQ8A 3LP0A 1T05A 1CJKA 3R3TA 3GJTB 2DGQA 1KC8T 3PXGa 4C8ZA 3K5PA 4URGA 1TK8A 2DITA 5E3CA 3FEZA 3M9OB 1VDHA 1X4GA 2FVCA 2YH0A 5D4PA 3TAQA 1UEVA 4QZVB 3T1YF 3DM2B 3BB5A 4ECXA 6FD1A 4ZP7A 5C25A 4RLEA 2GS8A 2KXHA 1UVIA 1VC5A 2RKIA 3TUIC 4FBTA 1JXLA 4KT0C 2HZAA 3H20A 2PIIA 2VFSA 1MWQA 3IR7B 1DTTB 1RBOB 4C8MA 3H5XA 2R7RA 3T1YJ 4BCAA 1HW9A 5B0GA 2G9OA 1EKSA 1VI7A 4TYAA 4A8QA 3N5FA 1YZ7A 2QMUB 3TZXA 2WOMA 4YS2A 4BWJA 1FNXH 1CG2A 4KIAA 1FJEB 1G7CB 3PYGA 3M2RB 1L3VA 3P5TL 4CO2A 2IYGA 4PWDB 4TQSA 1Y5IB 2W7OA 1S6PB 3CCQS 2RS8A 2PGCA 2NPFA 2IMWP 5H1SV 4NMXA 3TX0A 4CT9A 2K7JA 4EUVA 1AB8A 1BWVA 2IC3B 3DLEA 4F2SA 5IXUA 3UCUP 5HP1B 2HSEB 1SI9A 4NMLA 4KC5A 5JVGQ 4G1IA 3W2VA 2ZDOA 4LFCF 1UMJA 1Q1KA 4LQ3A 2D69A 3ZZUA 4DV5F 2XY6A 1FK9B 3BPDA 1SQEA 4NWBA 2KG0A 4J9NA 3MHYA 3CD5A 3EYZA 1UPMB 1XERA 4R0JA 1YBUA 1WKLA 3MM8A 2JEIA 5BR8F 4DUZJ 2DKOB 2OEMA 2FLLA 1LW2B 4FP9A 3MWBA 4ZVTB 3PYDA 1RBLA 1T9UA 3RYLA 2W9AA 4LFCJ 2EC0A 2MQPA 3VR1A 2PA8D 4DZDA 1RHRB 4DV5J 1HWKA 1NU4A 2ZC4A 4GC7A 2RDDA 1C2PA 2C2KB 4ID5A 4ZA1A 2VQFJ 4DR4F 5F41A 3HI9A 4CLWA 1R8CA 2XG8A 5BR8J 2HVDA 4IH7A 1RQ0A 4PQAA 1ZA1B 1R8BA 2FC9A 4DF8A 3EZUA 1NK0A 4TU9A 4O0IA 2UP1A 2PSZA 2J0QD 4PZVA 1F5BA 4N8OA 1RHMB 2UVWA 4B3SF 2ALYB 5HQLA 2XLJA 4XO0A 1PJ7A 4LRCA 4F4YA 4DEZA 5LOQA 3QZ7A 1BQNB 4FVCA 4DPUA 1DTQA 3ILOA 4R8UB 2FZGB 4QOTA 5HLFB 4JI7F 1WJ9A 4DR4J 2QA1A 4UOGA 5JMNA 3NCPA 3PW7A 2G2OA 2J8AA 3CJTA 4KE5A 3DOKB 4UF4A 2HNZB 3I4PA 2LDIA 3JTPA 1LWEB 4B3SJ 3I9V9 4ECQA 2AEJA 2VPWB 1FKPA 3SQOP 2A6OA 4RW4A 3CO9A 5LXRA 4CCHA 1JX4A 4JI7J 1N54B 1K1QA 3G2XA 4EO8A 3BEGB 1VRTB 3R5AA 4DV1F 4ZVSB 3D6HB 3VWSA 4ITSA 3GG0A 2K3KA 4A4JA 2BMBA 4CDIA 4MKYA 2MZSA 2E5IA 4LF7J 4QU7A 4DF4A 3M4XA 1WC4A 5LMUF 1J5OB 1FXDA 4I2QA 3KK1A 2CXEA 3TWZA 2VH7A 1YJVA 4DV1J 2HBZB 4C8OA 2OGUA 2PFFB 2CQPA 3PTWA 2OPQA 2ZITA 4MFBA 3KUGA 4ED2A 4EBEA 1ICEB 2N7YA 1Q16B 2P9EA 3GYXB 3QT5A 4Q44A 2G0IA 3TYTA 5HL7Q 3OVBA 2QL7B 5LMUJ 3ISND 3I82A 1PC4A 4DFKA 3A8KA 3I5BA 1GX6A 1DHMA 3C19A 1KN6A 4OX8A 1SH3A 3TUJC 2VJVA 2B4UA 2GAGC 1GK8A 1UCNA 5GAEU 2H3EB 2AP6A 2OEJA 1CQMA 3TUZC 5HVFA 2M9KA 3D68A 2C2MB 2BW2A 1JJCB 1FEEA 2VHGA 1TFWA 3A8EA 3FVYA 4URQU 1FX4A 2JX2A 4I7FB 4Q5VA 2XEXA 4U8YA 3PACA 1FA0A 1VQKS 3N4WA 3NGUA 2IDLA 1C4AA 3H5SA 4KGMA 1FF2A 5KG4A 2DHHA 2QLWA 1DBDA 4KTQA 1GFWB 1J27A 1Z4UA 3TUPA 2HG4A 2GVDA 5IS2A 1RT7A 4IG0B 5IFMA 2BOAA 4L6V3 2XWYA 4OI4A 2CZ4A 5HROB 2N7CA 2BV3A 1TKTA 2D9PA 3A8IA 4NLRA 3PJWA 4DLEA 5H9EK 3HO1A 3R7SB 5C2GA 1SH2A 4ZDNA 1IBCB 2M4MA 5FLXY 3PVXA 4DG1B 2FVQA 2I5JB 3H7HB 1KDNA 1VK8A 4DX5A 4LJMA 1VYAA 3HSZA 4HH1A 4UY8T 3M6VA 5AXMA 5KG5A 4KYZA 4KHRA 4DPYA 4KPYA 2ZVIA 1T9WA 1U2CA 4IH6A 2CJBA 1XR6A 5D0EA 1X4EA 2G13A 2L3MA 1Y4ZB 3DRYA 2HPUA 2J0WA 2B4OA 4NA2A 2QA2A 5I3UB 2QFJA 1N5YB 4JYAF 4ETZA 3V4MA 2CQ2A 2KVQE 4QPXA 4FYWB 1U8WA 2JVOA 3RW7A 2KXNB 5KFOA 4F2RA 3BZQA 3SCIE 4OV6A 5B09A 3WIUA 2DEIA 1PJ5A 2AYBA 4H4OB 3WIVA 1NH7A 3NL0A 1Q7LB 2C2DA 3F41A 3GMGA 1SCJB 2YKOA 5F8JA 5IV3A 4LSLB 2MB0B 3K5OA 3A3NB 4JYAJ 2MZ1A 2CJAA 5L46A 1SKWA 3MEEB 2CQ0A 2MGZA 3HJVA 2LXUA 1RWOB 3RZAA 1T11A 2FGOA 3PX0A 2ROPA 2DH8A 4M8LA 4PKDB 4A8XA 2X1FA 3DGVA 1UA1A 3R8YA 2ZHBA 3NNCA 4HTJA 1FTRA 5D3GA 2P2CB 2BDPA 3M7VA 1T05B 4OZNA 4P74A 1CJKB 2DB1A 5E3RA 2MQOA 2GQ2A 2HGNA 1WTFA 1QVGR 3OUYB 1HI1A 4JI6J 5KOWA 4NOHA 5DLFA 1VHIA 2MHEA 3FBBA 2V2QA 3HJFA 5C25B 1E6VB 3HCXA 2DO4A 4DX8H 4K5RA 4OI6A 4ZP6A 2RKIB 3MCSA 4C3MA 3CJ0A 5F9NA 3K57A 5J2PA 1Q8IA 4OX7A 1R3NA 1UWAA 3PFEA 5J1PA 1SL2A 2ABYA 2DH9A 1RWNB 4NZ7A 1F3FA 1FFWB 2Y1IA 2A2CA 1KQFB 2AJFE 4DL3A 1HHTP 5A8KA 4GMKA 3BS9A 1M0SA 4R25A 2P8IA 2KVIA 3LUYA 2WOMB 4QWEA 4DL2A 5KT4A 1N88A 1U7LA 1VRQC 3T9ZA 2R7SA 3CDUA 1U6FA 3RR8A 3T41A 4YMEA 1OIAA 3PO5A 5D78A 2COLA 1NZAA 1RAAB 1K9MT 3JSYA 1UFWA 2B56A 1XR5A 2HS4A 1XC9A 4DL0C 2M7SA 1V3SA 2QC3A 5ADZA 2E1CA 2BKPA 2WVFA 4OZ5A 4F02A 3CPWR 2EI5A 2ASJA 2EKYA 4ALZA 1T0TV 1ZTWA 1KLNA 4Y65A 4ZPCA 5IWAF 3OJSA 5DG7A 3UNGC 2MSTA 1A7GE 1L3KA 1RWMB 2DNQA 5H9EJ 3QJLA 2BJ7A 3CD7A 1TR0A 4DR5F 1LOUA 2ATLA 4O23A 3B4DA 1BC6A 1UTAA 4ID5B 2AD9A 3R5DA 4PABA 5IWAJ 3AY0A 1RJJA 1HBUA 2DGVA 1KTQA 1E6YA 4EU0A 3GCXP 1PO6A 3KLHA 4ZP8A 4CLYA 3RBDA 1JB0C 2NYIA 1X5TA 2FJWA 3GJQB 3PJ9A 1NSPA 5ETTA 3CB4A 1UVLA 2XCPA 3RTVA 3RRHA 4ZPVR 2OPRA 4EWTA 4C9DA 3R97A 4F0MA 1WSVA 3D7SB 2LA6A 4YFUA 2IJRA 2UVVA 3CW2C 2IM0A 4HI1A 1RWWB 3BH6B 4OYXA 2IBKA 4NL5A 1URNA 4FPIA 3BYRA 1QDUB 2WBMA 1KTVA 1LQ9A 1U4BA 1CQNA 1FKPB 1U8SA 2V8GA 4RW4B 4RW9A 3KG1A 1YJWS 2LA4A 1FI4A 4PXCA 2J0XA 2GQQA 2R8KA 5SZTA 3OL9A 1JNRB 1SQFA 1X4FA 2K2PA 1HLWA 4ED0A 1QJHA 3I87A 2V50A 4X4NA 3ETMA 2LQ5A 3OLBA 4F3OA 4RU9A 2XYGB 4UTGA 2DBBA 3HHLD 3RRKA 3BSAA 1HWLA 2W2NP 1RT4B 4OJGA 2W4PA 3LGHA 2Q6CA 3PYEA 3OPKA 4EYHB 2I9SA 3T3FA 1UEUA 3KK1B 3NNAA 4DS5A 3O3LA 3VGTA 1YKWA 3EICA 5B0FA 3M8QA 4ZLNA 2KO1A 3OL7A 1AUSL 2HHPA 3A13A 2OPQB 4YHHF 2YWFA 3GE9A 4MFBB 3IG1A 3J7YU 2AZ3A 2VUGA 4X4TA 2HLUA 2ZHAA 3E8OA 5LT5A 3TAPA 2Q1LA 3ZO7A 4FBUA 1YJUA 1VQMS 4K5SA 3G6ES 4RBTA 1YWXA 5EUHA 2W4CA 2CA9A 3LW5C 3DLBA 1LV5A 3BH7B 4C8YA 1DFDA 5HAOA 5M2RA 2ZUGA 2BJ1A 3EGZA 2WB4A 4YUDA 1LW0A 1EHWA 1HNZF 1X8DA 1VCTA 3S6EA 1N0VC 1AW0A 4G65A 3O1LA 2DGSA 1AXQA 3FBEA 5LSOA 3G86A 1IM4A 4KAIA 4U6PA 3DXSX 3N9UC 3U02A 2XMUA 3QJJA 3CDEA 4TY9A 1VGYA 3T5HA 5CXTA 5DGBA 1T9YA 1B0VA 1HNZJ 4DBQA 4O3OA 1HQ2A 1PBUA 3T6JA 2W7AA 3D54A 5HI7A 4JB8B 4OMFG 5KT7A 1NZ8A 5JXSA 1PSDA 2GVDB 3CMAS 1RT7B 5EX0A 3CUNA 3MPVA 2P9GA 1O5JA 4USTA 2BM0A 5DQIA 3TI0A 1I6JA 1ULRA 1TKTB 3SCKE 1PKUA 4RKUC 3CCSS 1U02A 5IC4B 1XTZA 2XS2A 2RQKA 2DJWA 3EDQB 5K14A 2DISA 4K8RA 3WC0A 2JNJA 1TL4A 1G1XA 5CQGA 1WOPA 1R8HA 2MKKA 2MQMA 3W5YA 4ED3A 4OX6A 1FRMA 1RAOA 4PG5A 4RR5A 1YITS 3RRGA 3JSMA 1HNXF 5LSLA 3G71S 1HFEL 4IG3A 4ZVQB 3BN7A 3GIIA 4ECRA 4ZKAA 4ECYA 3DRSA 3UDCA 2ZHOA 3D2WA 5EGYA 5FIIA 3CJ5A 3AH6A 4J9UE 2RD5C 1FDBA 2HRTA 3EXYA 5KFMA 3CTRA 1FERA 2ZH2A 1CPZA 1HNXJ 2D3OR 2R3VA 1REVB 2ZH1A 4YN3B 3MPUB 1W2IA 3WDOA 2Z2MA 3PW4A 1EQ0A 3BJYA 4J9QA 4GO7X 2MQLA 1Q4RA 2KYZA 5I4MA 4Z2XA 1H73A 4NYZA 1JLFA 2EEYA 2HGLA 1BHNA 5IC6B 5BYQA 2MGZB 3WHIA 3IM9A 4K0KF 1EQMA 2RSQA 3AB4B 2VDIA 9ATCB 1V6HA 2H48B 2JDJA 3FEXB 4RO0A 2DR9A 1PJ6A 2OJ3A 7AT1B 2DTJA 4UT4A 2HEKA 1FDNA 5D3GB 1FX2A 4RL1A 3ISNC 2G2YA 2AJ0A 2KFZA 3G4SS 4K0KJ 2MKIA 2ZFHA 2LCWA 1HBMA 3NY0A 2KRBA 1UETA 5IT9Y 4PEOA 5E5NA 3M8ZA 3MUMP 1VFJA 3QO9A 3OTEA 4AFFA 1JJ4A 4WFBQ 4LQ9A 3FBFA 4J9VA 4MKAA 4HTIA 3A3PB 2DY9A 4D3GA 3BM7A 3M9MB 4CO5A 1WC0A 5J2PB 1DQ8A 2Y8WA 2RS2A 3HLUA 1HBOA 1X4BA 2CVEA 3MCOA 4YR0A 1F5AA 3OTDA 2CQBA 2K3IA 1TL7B 1SH0A 2EG1A 4J9RA 4LR8A 4LSNB 3W9IA 2MMYA 5A8KB 1GMVA 2Z56B 2AIRB 1T03A 2HWTA 2HBYB 2DNHA 2XMMA 3MAAB 1OMSA 1CULA 2UUWA 1LK7A 4K4VA 5ETVA 2WB1D 3CSKA 4K4WA 4MMOA 4HYKA 2IDEA 5CYMA 4ZPTR 5D4NA 4QYZK 1U09A 2HQ3A 2VPZB 1HNIA 3H42A 1F5CA 3AQOA 1VOMA 1TKZA 2CJXB 2E5HA 2ROGA 2G2ZA 2GC8A 1N32F 4YDDB 1PYTA 1IR0A 2ZVSA 3G87A 4HH0A 3VAHA 4C98A 4DSJA 1AZSA 4OYAA 3Q24A 4A47A 3VZIA 2POKA 2DNRA 1H38A 2XLIA 1WDTA 3UNYA 3R5BA 1N32J 3EWGA 3VQTA 3NP5A 1S5ZA 2A18A 2P9CA 3B8HA 2YH1A 2FJDB 3OT9A 2WONA 2CIMA 2W2QP 4JI1F 3ZZYA 4USWA 4Y6IA 1O6XA 4OYIA 2V34A 2ZE2A 1XMOF 2GCFA 3ZC4A 4PG7A 1HBUB 5KG0A 2B9YA 3KJQB 1E6YB 2XTJP 2GNKA 3FMBA 3KLHB 2V8HA 3U1NA 3BQ2A 1M5SA 4AXJA 2HZCA 1N0UA 1RHQB 3V81A 5GADI 1HMVA 3BR9A 4A8KA 3ZNUA 2HMIA 2HFUA 4JI1J 4J7CA 3RAXA 4FVMA 1Z2LA 5JJBA 2LMIA 2OPRB 2GMLA 2YXLA 2H4YB 1WF0A 1XMOJ 4DSEA 2AT1B 1QAIA 2V2ZA 4DR1J 1T9VA 1VQ4S 2EC2A 2FC8A 3CCMS 2QN6B 2E9TA 4ICLA 3NCQA 3OLAA 3PO4A 4ZJOA 4ZMMA 1JXEA 3T9NA 4B9UA 2IMOA 3BKFA 2FLOA 2CVIA 1S4FA 1HHSA 1S72S 2CRLA 4G1QB 3ZNJ1 3GSDA 4KGZB 3MECA 3EVWA 2XY7A 4ZP9A 4ZVHA 5LL6d 1X9WA 4XDCA 1SJ3P 2BKNA 4DR3F 1DJ0A 3CCZA 2L48A 2DGWA 2P6SA 5HBMA 3DNCA 2BQUA 3NS7B 3DLGA 3VVTA 5D4OA 1SL0A 2EW9A 1OQ6A 2ZNYA 3B54A 3QATA 3KK3B 4F36A 8ATCB 2BR0A 2QT7A 2HVZA 2BQ3A 1CVJA 3BKTA 1HNVA 1RYRA 2Z57B 1U2RA 4OZLA 4DR3J 3GFYA 3I0RA 5IOLA 2OIHA 5E7OB 5M2PA 1NK7A 2EFGA 2J6UA 4OL8A 3PR4A 4UW2A 3UW1A 2FZCB 2GX8A 4ELTA 3RBEA 1Q5YA 1PC5A 1KR4A 1LW0B 5CD4H 3HFVA 3AOBA 4WF9Q 3NMRA 2CJQA 1R8AA 2RMLA 1Q53A 1FJGF 4QW8A 4OIXA 4TY8B 4DMZA 4CLPA 2AU0A 2CWXA 1SVDA 3D6TB 3OTBA 4OLPA 2AQ4A 3CCWA 1EP4A 1R0AA 4KH0B 2GIQA 1UFLA 2FTRA 3RB3A 3M30A 3QIPA 1GMWD 1WHYA 2GFFA 3DN9A 3EX7B 1HQEA 3GWCA 2K06A 5G0RA 1FJGJ 4KFBA 3SXLA 1MMNA 2EVZA 3EZ5A 2GJ2A 2RHSB 2DGOA 3NBPA 3AHPA 3IWNC 1M1KT 5KFWA 2XHWA 1U1QA 4CLFA 4QBUA 3A3OB 5K14B 2VF3A 3I96A 3HD1A 5F8IA 3B4MA 4ILRA 3MD3A 2B9EA 4ZITA 1U1PA 1JQGA 2RQCA 1QSYA 4UOHA 3MPWA 1TQLA 4OI2A 3TOQA 5IZHA 2V68A 1KONA 3R2DJ 4Y2IA 1HD0A 4I2PA 4OHXA 1LXJA 1U47A 3VAIA 2CFXA 2OELA 3JSMB 1B7YB 3IC1A 4ID8A 2Z2LA 4OZ3A 5GMEA 3KNAA 5F8GA 5KFKA 3DRSB 5DGAA 2PI4A 4QIWD 2YVSA 3JB9k 4I6WA 2YWEA 1FWKA 2AGOA 3HK2A 4BC9A 3G6VA 2MZTA 2YNHA 4ZOSA 1I3OB 5F8HA 2W7PA 2IRUA 1XEZA 4TQRA 2VL1A 2V8DA 2AEFA 4DWIA 1MWYA 3C14A 4YDXA 1JLQB 2EBEA 4QQBA 1W7WA 2CDRB 4DQPA 3HHEA 3MMCA 1JLFB 5KG1A 3UVJA 3KLEA 2Z2YB 1YJRA 2CQ4A 1SXLA 2QLXA 1TFYA 4NX9A 1Q81T 3M32A 2NQPA 3UDEA 1UKUA 2DNOA 2PT0A 4ERDA 2DPIA 3QGPA 1H3DA 1IKYA 1RAHB 4KRWA 4KO0A 4Q2LA 3KLFA 3Q22A 3MGJA 2H65B 1NJYA 2J9CA 1HBMB 4LF9F 3CCES 3G9CA 3PG9A 2DVIA 2CNNB 5KT2A 2YWHA 1S49A 3QO9B 3J80U 3PW2A 4J5OA 3MEDB 3IR5B 4ZPBA 2CADA 8RUCA 5ITHA 3EE3A 1R7IA 4YY3F 3DFEA 2R8IA 4V19J 1HBOB 2GO9A 2CQ3A 5KT6A 3L3CA 2CPJA 2FPHX 4LF9J 2M8DB 3RGIA 3M6WA 1REGX 1TL5A 1AUDA 2UXBF 1DQ9A 3JSRA 1NO8A 2QLJB 2NXJA 2GJIA 1OY8A 1Y5NB 3DCAA 2F65A 4DPXA 4J9SA 5D77A 4RU2A 2W01A 3OHAA 2XZTB 4YY3J 2M88A 2LXFA 3BBFA 4LMZA 1CULB 3GR0A 4RNOA 1WC3A 3RBZA 4AXIA 2QX0A 4DSKA 3HULA 2UXBJ 5J2NA 1HWUA 4YB6A 2IJNA 4YB7A 4B3MF 2J7WA 1U1RA 1HNIB 3ENWA 4RW6A 3NGDA 2QG9B 1U2FA 1TKZB 1FD8A 4KSEB 1KP6A 3FC9A 2B8QA 1NEEA 2LDYA 2HQFA 1UVNA 1LWFA 3CNQP 1D8ZA 1WNEA 3J7ZT 4DUYF 2HKEA 2RDJA 3J7AN 4RX6A 2W9CA 1QUPA 3SZ2A 4B3MJ 3TARA 1ZAVA 3BV8A 2Y0BB 3IRXA 4OZJA 1RTDA 1NRKA 1Y10A 3MM6A 2UUBF 1Q82T 3SMZA 4IR1A 2HFVA 5A2QU 2VKRA 3E01A 4U96A 4A8FA 4V1Ak 4DUTA 2XMVA 1FVSA 3OBIA 1PYSB 4MIBA 1TKXA 2U1AA 5CH7B 5J2MA 1X0FA 4DUYJ 2XGQA 2VZ9A 1S12A 2LFVA 2KHDA 1JKHB 4U8VA 4TXSA 4CTAA 3MM5A 5E0OA 4C0OC 1TV6A 2ZE2B 4WYLA 2PO4A 2UUBJ 2HHTA 1NK6A 2WK4A 4WFAQ 2F8HA 4F26A 3KUEA 2G1DA 4MYUA 1S1VA 2PD1A 2GHWA 3V81B 1HMVB 4DPOA 5I3PA 2IYIA 4OYPA 8AT1B 3BQ1A 2ZKUA 4ECUA 2GIFA 1M90T 3IO1A 3HKWA 3MTKA 3V4IA 2ZEJA 2V6AA 2MLZA 4CI0B 3US5A 3C15B 2QA4S 2YWWA 3PRBA 1JLCB 2IVFB 3LAKA 2W8KA 2DNLA 4GKJF 4DV6F 1HR0F 2CNOB 2HIQA 4OYOA 3H0PA 4RUAA 3MI7X 4CLUA 4N77A 3M2VA 3CJ8A 3C6TB 2KRRA 1P6TA 2DY1A 4AE5A 2R7VA 4F4ZA 5DQHA 3CULA 1H7WA 2E66A 3SQGB 1PBAA 1ZAWA 2RQ4A 4FKXA 2WTFA 3SFUA 3EGNA 3S1TA 4GKJJ 4DV6J 1HR0J 2UZAA 3CT9A 3OXFA 1DTTA 2WSCC 2W24A 5HBMB 3IBWA 4LSZB 1YRUA 3FNNA 4U67Q 3DC2A 4QWAA 4H54A 3G96A 2BANB 4DFMA 2H5IB 1WDDA 4ES2A 3M8WA 4QIEA 3SBMA 1HNVB 5FJ4A 1X5OA 2A2DA 3MOZA 4DU7A 3P4UB 1K44A 5T14A 2I1RA 1S6PA 2HLTA 3M8SA 3NOCA 4DPTA 4R5PB 2PA3A 3VGUA 4YQWA 4KB7A 4UY85 1YSJA 4BC7A 2BJ9A 3UR3C 3ONQA 2X7IA 2ZWOA 4ECSA 3ZZRA 2IY5B 1FT8A 2WVEA 3JQJA 1FNMA 1S9FA 3LPYA 2PDAA 2FIUA 2ZBIA 3Q2SC 2FVPA 1Q5VA 2CWKA 4DV0F 5KFAA 3GV5B 2R2UA 5DDPC 1NHUA 2MXYA 4IO9Q 1SUQB 2ZH6A 4MIWA 2UUAF 3ZZTA 4RW8B 2ZDPA 5HMXA 4Y2KA 4N76A 2OTLS 3VQSA 5B0BA 4OX9F 4K4ZA 5IM0A 2XMKA 2DRDA 1LW2A 1YJ9S 4ZPAA 4WTOB 3TZYA 3H40A 2H4WB 3I5CA 3SIPB 3N6MA 3M30B 2DO0A 3QIPB 3TVZA 5L8RC 4ECVA 3NEKA 4DV0J 4Q7AA 2YKNA 3GP9A 1HQEB 4F7VA 2UUAJ 5G0RB 1K8AT 2IHR1 1YBAA 2OKQA 4KFBB 4RWXA 2ADBA 4M5HA 2Y3YA 4U95A 3SSQA 3GIJA 2ZD1A 2O66A 2MKCA 2L41A 4OX9J 3NBPB 1GTHA 2D1CA 1B64A 4IDKA 3PRDA 1VQ5S 1VIXA 3RR7A 4GKKF 5B0DA 1UW4A 2EK1A 4OHYA 2NZ4A 3AA9A 3LP1A 1T8EA 1F3VA 2GMHA 2YBVA 3O5TB 3IWXA 5GAHI 1S48A 2ZJQQ 4DFJA 4LFAF 2OPPB 1IUJA 4MK8A 4M5MA 2F4VF 3NGSA 3K5LA 2VA3A 4K4TA 4GKKJ 4KGXB 3ZTOA 5A6PA 4JOUA 4LRAA 3BGRB 4ED8A 3OTOJ 1LFWA 2BA9A 1IKWA 4LFAJ 4F0KA 2M8HA 1B0PA 2MJUA 2F4VJ 4CO1A 1Q0NA 3EZOA 2BJ3A 1TELA 1CS4B 2C2EA 1RSCA 3D0HE 2YNHB 3HX9A 1Z1ZA 4QR0A 2JEJA 1V9OA 4CLSA 1QVFR 1IR2A 1WF1A 2Q6BA 3C14B 2R42A 3TANA 3R1HA 2IJFA 1VS3A 3DRPA 5KOXA 1LKZA 2FHOB 4DI6A 1HNWF 4EBDA 2I2YA 3KLEB 2FUG9 4CQ1A 2M52A 4C8LA 3G8SA 2MDAA 5ETRA 3CXCR 1VQPS 3TO8A 2VG6A 1H6KX 1N6QA 1RXOB 3M32B 1ZPWX 2VOOA 3M8YA 4OYZA 4UZCA 4CIOA 3D67A 2BW7A 2XYPB 4YEAA 4DR7F 2E1PA 2GQCA 2NYHA 1WG1A 1IKYB 3QYYA 4KO0B 1HNWJ 1LK5A 4DR2F 3ET6A 3KLFB 2AX0A 3QGIA 2XZWA 2CPZA 3H90A 2R9LA 7FD1A 1J2VA 5JVHQ 2QYCA 3MFIA 4TU8A 1CBKA 4WFNQ 2QL5B 5C5JA 4M5JA 2MLXA 3L95X 1M5PC 1NJXA 1KNZA 1FRKA 3I4HX 1R0CB 3PHTA 4DR7J 2ZC3A 3AODA 3I56S 4ES1A 4XAKA 5LSRA 4DR2J 4QU6A 4O4RA 3NNHA 1PYOB 2FY8A 3Q86A 4URSA 1F6TA 1OY9A 1NDCA 5MAOA 3DHXA 4P52A 4IG0A 4P7VA 2LQ9A 3P49B 2MY7A 1B99A 1RA7A 3JQKA 2B43A 3QRQA 3QGGA 3FFIA 1O0PA 2GV1A 1HWIA 2XI3A 4WFYA 3NWRA 1RAEB 4B3RF 4UZBA 1WHVA 1TMJA 4RBUA 4ZS6A 1CC7A 5J1EA 4ED5A 4OQJA 1UJ5A 2EFOA 2B9WA 1CJTB 3POTA 3EJMA 4RW6B 1Y00A 1H7XA 4WPAA 1KOOA 1JLEA 3JQMA 4DQQA 4OJ1A 1FHTA 1LWFB 4WXOA 2JEGA 4B3RJ 4PWUA 4USIA 1F2GA 1N48A 2IIHA 4UOCA 2VBYA 1RB0A 1WOOA 2W9CB 4BDPA 4NCBA 3MAQA 2AEMA 1NM2A 3IRXB 1RTDB 1M5HA 1JWWA 3UN3A 3FSXA 2HHSA 3E01B 4Y00A 4U9RA 2RDIA 5KFDA 3DRRA 1RAJA 4DN0A 3SCJE 1CLFA 4F4WA 5B0EA 2P6TA 4UQGA 1TKXB 2V4RA 4WBFA 1XQIA 4H4OA 2HHQA 1AFJA 4KV8A 4LSLA 5KFPA 4CTAB 3MM5B 1NMEB 2HHHF 1XNQF 3GZ7A 3C8YA 4A46A 4X64J 3P6YC 3MEEA 3QQCD 2GGPA 4FNIA 3E51A 5D0RA 1YGYA 1S1VB 2CPFA 2X1GA 1RAGB 3UN2A 4NE9C 1H74A 1XMBA 1U1NA 4YB5A 2C2OB 2DCUB 1HQUA 2HHHJ 1XNQJ 1KKHA 1YJTA 5E41A 3KOAA 4M1KA 3V4IB 2OD6A 3IAS9 1N5QA 3BO4A 2XYHB 3R5GA 4DSLA 1SJ1A 3KHLA 4ILLA 1NJWA 4ZJLA 2C1EB 3OUYA 3F44A 2VG5B 1QM9A 3R5CA 2N82B 2PEBA 1QAYA 1XMQJ 2PE8A 1UVMA 4WP8A 2HHUA 3M2VB 4WJBA 2BVZA 1E6VA 3PZPA 3DYAA 1RWUA 5KG2A 1X5SA 3CC7S 4MYTA 5J2QB 4CLZA 1SC6A 4DSIA 3ETOA 5A0YA 3GSIA 4JI0F 1UZHA 3RG6A 3KHHA 2DH7A 3GFZA 3AFGA 2CNLB 2JC1A 1TUWA 5ETSA 5KAKA 1K1SA 3LP2B 3PX4A 2KU7A 3L4BC 3FRYA 2KI2A 1IJEB 1KBRA 1V5IB 1WI8A 2H5JB 4JI0J 5KFZA 1X4CA 1F9HA 2HNDB 1DURA 4QR1A 2AMCB 1VQ9S 1VQ8S 4KKOA 3MR7A 4NXNF 3JTOA 4G1PA 2FJBB 4DUZF 4DN9A 4LREA 4NYOA 3SI8A 1ZH5A 2IRXA 2FD2A 3FUYA 2JL9A 3WX4A 4K7QA 3G8QA 4NLDA 1Y9OA 2HFSA 3CJKB 3PRVA 2QRRA 3CD0A 1RISA 1VISA 5HANA 3MR2A 4KQZA 2VQFF 3MPYA 1UAWA 4ZN1A 4NXNJ 4ZVRB 1SJ4P 2R2TA 1BLUA 4ZIVA 4L3NA 3W65A 3WZ0A 4AL6A 2V67A 2RUSA 2HW3A 3OFGA 5IM0B 3GFHA 1UZDA 1VQOS 4N47A 2BBEA 5KFYA 2XZDB 3T1HF 3BBBA 4TVAB 2OTJS 1OSDA 4H4MA 2YKNB 2ZH7A 4NA3A 2BQRA 4F25A 3FDSA 2W25A 3AT1B 2ZD1B 2E44A 3MM9A 5B0CA 2VFTA 1N8RT 2UVRA 4EMDA 3B82A 4DCJB 3T1HJ 4IDKB 3S01A 2I8EA 2AW0A 2J8SA 2C2ZB 2RT3A 2DIUA 3LP1B 2JHEA 3I55S 1FRHA 1C0TA 3OD2A 2X1AA 1M1GA 1S77D 4FDFA 1LWXA 4F3MA 1XWLA 4I64A 4DL4A 5E3AA 1TAQA 4JI4F 1CSJA 4RNNA 4LF7F 2E1MC 2OFGX 3GQCA 1JLBA 1RHKB 3CDAA 1OS5A 1S9EA 3TVYA 1ITPA 3DLJA 4CT8A 4P71A 5CAAA 1SKRA 3ZTQA 1WD6A 4JP8A 1Q8KA 3QFHA 4EO6A 1KHWA 1IKWB 3HP6A 2D3UA 2MQNA 3MTJA 5L38A 3PYFA 4GVBA 4JI4J 5LXYA 3CJRA 5GAHU 1RT4A 2BXJA 3L9ZA 3O44A 4CP5A 4MT1A 1AYEA 4ED6A 3AXKA 2ZOFA 2KKHA 3BREA 2CG4A 2C3YA 2AYGA 5DDOC 4KPCA 2ILZA 1RT6A 3DRPB 5ETKA 3I32A 2QSWA 1S57A 1V3ZA 4UUXA 1BXNA 4ES3A 5T7LA 1K0TA 3I0SB 4LF2A 3HHKA 2DGUA 2FHMA 2Q43A 1RDRA 2VG6B 3TAMA 1TZ0A 2JC0A 1N6QB 3THVA 4CH1A 1WORA 4X66F 1R6YA 2R7OA 3MPDA 3HD2A 3TNVA 3I31A 2FJAB 3ET6B 2JFDA 1S79A 1YK9A 1VJWA 1NK8A 1SIZA 6FDRA 5T41A 5CCLA 2O01C 1X5PA 3DU5A 3NGRA 1R27B 2M2BA 1OYEA 1HBNA 2E5GA 4YB1P 2PC6A 4X66J 3OSPA 1MU2A 3VF0B 2VBXA 4UUWA 4C48A 1RA6A 2E7VA 1C1CA 3HF5A 4QW9A 1TAUA 1NXIA 1SKUB 4QYRA 2E5LF 5F8MA 2WVBA 3KDOA 4USHA 2JLEA 4LT6A 3EVOA 1C0UA 1X9MA 2H5EA 2F9DA 4LRDA 4I1TA 1JLAB 3FFIB 1W2BR 2LLZA 4W90B 2OO4A 2JSXA 5J1EB 4ATNA 3BGLA 2E5LJ 1FDDA 5LJ5Y 3GCWP 2J5AA 3G82A 4WIQA 3M2UA 3POTB 1RBAA 1VQ7S 2XM3A 3U7JA 4QIFA 3ULHA 2ZZNA 2NCKL 3RB4A 4Y2CA 3VAGA 1JLEB 2OPSA 2J7UA 2BJDA 4A8SA 2KM8C 2NXNA 2ATCB 3CIZA 1S4EA 5A6WA 2DK2A 1LNQA 4PXBA 2OSRA 2FYXA 4QWCA 3SEOA 2HAIA 4NA1A 3NAIA 1NKEA 1FEHA 1JMTA 2IFXA 2QYGA 3AOCA 1NB2A 3TJ9A 3MURP 5C2CA 1JIHA 3FZBA 3DRRB 1ZYQA 4XTTA 3MXHP 4HACB 3V6KA 1QTMA 4NLQA 2VBWA 5CYJA 3CD6S 4NEZA 1S6OA 5EWFA 3OFEA 3MR3A 1FDAA 1SIWB 1REVA 4KV8B 2SXLA 2CAJA 4O3RA 4ER8A 3K58A 4M5LA 1HIYA 2VFUA 1YX2A 2QFIA 5KT3A 1EAYC 3TP2A 3K5NA 3BGOP 1T95A 1UPPA 2DXEA 5F0WA 2V94A 2GGPB 3EMTA 4JI6F 1VC6A 1FE4A 3TA0A 3GPAA 3D1OA 3W63A 3W9JA 2JOQA 2CJ9A 2HFOA 1WEYA 1HQUB 1HWJA 4Y34A 4DQIA 1F2HA 1U48A 3OVAA 1FRJA 1S99A 3NGTA 2H9ZA 4CZCA 5ETQA 1VBZA 4Y0FA 3LH2S 4FYDA 4NLTA 2RH3A 2QA4G 1WACA 5GMKa 2RILA 4XPEA 1NNDA 1UA0A 2MJNA 1A9NB 3VGSA 3D5MA 4NI2A 4CO3A 4HHJA 2EFNA 3DYAB 3M05A 3HXMA 1IN0A 2NSCA 3W8PA 2GZOA 3IWLA 4HLBA 2ALZA 2DHXA 1I51B 5IT9U 2J9DA 1PG5B 1UVJA 5ETMA 1BGXT 3S8SA 2RIJA 4LIWA 4OV1A 4N5SA 3QLHA 3VAFA 3TQ1A 4NCAA 5A0YB 5D15A 1FRIA 1NAQA 1TL7A 1YRXA 1ELOA 3W3SA 2Q3PA 3GFXA 4LSNA 4IFVA 4FYYB 5K20B 3W64A 2UXDF 2HS0A 4FF4A 4ZIWA 4DZ6A 3H5UA 2A0FB 1RCOB 5K8PA 4CYUA 4LFBF 1RABB 4P6QA 3MAAA 3PV8A 1NUEA 4NLVA 4ECZA 1S76D 2ZBRA 3IR6B 1OSCA 1R31A 1VQ6S 3QNWB 4DX7A 3ZZZA 3IGNA 1KQKA 1TKDA 1G2EA 1YJ7A 4K4UA 3CWJA 2ZOGA 2LXIA 2J9EA 4KKOB 2ACMA 3D4JA 3C46A 2UXDJ 1GTEA 4UOFA 4JV5F 1EJ7L 3AD7C 4LFBJ 4DU8A 2XWXA 4DCOB 1RWPB 2E7WA 2YKMB 3J81Y 3AJ1A 4ECTA 2OSQA 1BE4A 4DV3F 4I6YA 3CCTA 4I67A 5C24A 5AE2A 1WUUA 3V6HA 2KTQA 3KNGA 5GAEI 2DD8S 2E5JA 3TEGA 3B78A 4JV5J 3T5LA 4U7UK 1KD1T 2A3JA 3KLIA 1RKJA 3IP0A 4DV3J 4F4KA 3D0IE 1M1HA 1WTBA 4H4MB 2DNYA 2VICA 2WBRA 2V9WA 2O5DA 1ZOTA 1SC1B 5D6GA 5G4DA 3P5BP 3CJQA 1KHVA 1GMWA 3IA0A 2XNRA 2HVHA 5IQ6A 2CQCA 2WW4A 3MM9B 2J76E 2CZVC 1NH8A 4IRDA 1KQSR 1VQSA 3JS9A 4HHHA 4F8RA 1O51A 3M6XA 1VBYA 2VIHA 1VQNS 3P45B 4F50A 4HI2A 1F0XA 1K0VA 4M5KA 4ELVA 1C0TB 3K17A 4ZHRB 2IPOB 1YHQS 1S1TA 3K59A 1V5VA 2AX1A 2A1BA 3CC4S 3ZTSA 5AXKA 2H54B 3W5ZA 1PIEA 1ZPVA 1VBKA 2N4CA 1C1BA 2LKZA 3SDEA 4I0WA 1S1WA 2YTCA 5HVHA 2VC0A 1NJZA 2HHVA 2BE2B 4TKTA 1JLBB 5L9NA 4KH1B 1L3UA 2FJVA 1S9EB 3ICLA 3IXQA 4G1QA 2WSEC 2NXCA 1U0HA 1NPKA 3PHEA 3V5RA 2NXUA 2OD4A 2VG7A 4P75A 2DR8A 1L3SA 2DNKA 3HZEA 2XBPA 2C42A 3DLLQ 4N8NA 4GVBB 1Q86T 5KFTA 1R8PA 2N3LA 2B4PA 3CE8A 1U1LA 3SYZA 3KK3A 1RT6B 1IM6A 2V4JB 1YJNS 2ZOMA 3UWTA 4HDGA 2XO6A 2V9KA 2AF6A 5T7LB 1HARA 4LUBA 3GR1A 3P96A 5RUBA 1NSQA 3TAMB 3CF5Q 4FF1A 2MZJA 5L1LA 2NSBA 5KFQA 1SJQA 4YR2A 3PIPQ 3CIMA 3BDPA 3W62A 4OZ1A 1FCAA 2LVWA 3OJUA 2EBGA 1KVKA 1IJFB 1OO0B 2N4DA 3RUBL 3OR2A 3J7Z5 1RWKB 3GONA 2XMAA 3HMJG 4Y2AA 5KG6A 2JVRA 5HATA 4IKAA 3MM7B 1HBNB 4HKQA 2YPYA 3ENVA 4RUHA 3BDEA 3H2VE 3RAQA 1MU2B 1WELA 4TY8A 1X4AA 3R6LB 5A8WA 4C97A 7FDRA 3JXOA 1WKKA 3TW0A 1N52B 2LQJA 4MAKA 5L1KA 1C1CB 3M8PA 1XIQA 4LBIA 4WZQA 1OWXA 4IQXA 3HVWA 4G3IA 4OJHA 5D8HB 2RRNA 4V19X 2CPYA 2R7UA 3M9NB 1C0UB 3QWPA 2HIYA 3AD8C 4FS1A 3BF4A 4IRCA 5A8RA 2BOPA 3FKBA 5IQQA 1GX5A 4WU2A 2J9DE 1LEOA 3UCZP 2B9XA 4OHZA 3G82B 1YG0A 1FXRA 3M2UB 3BGFA 1RWVB 1I5OB 3H8YA 2B8PA 2ROEA 3CVKA 1YBTA 4NLOA 2OPSB 2EPIA 3D3CJ 1FFSB 3WX8A 3IBCB 3T5KA 3OFFA 4I69A 3HVTA 4DR6F 3FGVA 2RQMA 1SL1A 4BS2A 3JSBA 3DLKA 2R7XA 3C66A 3VVUA 5AE1A 3N6NA 3GIRA 1UJ4A 2AV5A 2GVZB 2VDHA 4TLRA 4QPTA 1S6QA 4Y28C 2FJXA 2VKZG 3BKUA 1G3OA 2F4FA 4TU7A 5DZ6A 3OHBA 5BXIA 4IOAQ 1R43A 4JV1A 4X4RA 4DR6J 4P10A 4ZVEA 3QAEA 2Y0SD 3AQPA 3BPSP 5ETLA 2WRMA 2KH9A 1RLCL 1S1UA 1JLQA 2HFNA 3CMQA 1VIOA 5K8OA 1RYSA 4AT1B 5HN0A 1T9TA 3QT7A 2OH2A 2MHNA 1VBXA 4NLYA 3HT0A 3RAMA 1D3WA 3GIKA 1RGVA 3EDRB 2DR5A 4Z37A 2CQDA 4L3KA 4K59A 4PWWA 2N3OA 1DARA 4MIAA 1MW7A 3EUNA 1KVJA 3LPEA 2ZKTA 4Z7CA 1TK0A 2IM3A 2VOPA 3AB2B 3V2UC 5MLCV 2VODA 1RTJA 1S0MA 1UJ6A 4NI2B 3U1MA 1WI6A 3MEDA 5JUMA 1C4CA 1P9QC 3MEGA 2CNKB 2B5JB 2KHCA 5FD1A 3HSDA 2PEHA 3K0JA 4ZPWR 4Y3CA 5F3TA 4C4WA 2X3DA 1ZS6A 4CNYA 3QLHB 2YQ3A 3GG1A 4N41A 4O0NA 4U7CA 2AGPA 4DL6A 2FHJD 3H25A 5HQ8A 3G6XA 1NPPA 3C6UA 4DQSA 4IFVB 2J7KA 1UVKA 3I5AA 2HNYA 1DLOB 1X7VA 4KGVB 2GMJA 4CYUB 2YNIA 4L75A 5AT1B 1T3NA 1RADB 3KKFA 1KQGB 2VU5A 4MK7A 3Q8UA 3CO0P 4JV0A 3IGVA 3TR5A 1Q8LA 3DKDA 4K4SA 5AJ3F 3J7YI 1QUVA 4NCGA 4WK3A 4C0HA 1DZ5A 1UEKA 3HDSA 1Y3JA 3KWMA 5HVGA 4BWMA 4OJ3A 4LF8F 2B6AB 2DEJA 4K2JA 4LBPA 3D9BA 5K8MA 1WF2A 5C24B 2YQ0A 2QMWA 5AJ3J 2CG8A 4NLGA 1KRPA 2D74B 2Z30B 4B9NA 3F0NA 4HR2A 2C28A 5KFRA 2BJ8A 3KJNB 3DU6A 4FNHA 2MZQA 1R0BG 4WCEQ 4LF8J 2JFKA 3KLIB 3GJRB 2CKWA 3A4TA 3R9LA 1QTNB 1RK8A 3MFHA 1JKHA 4X4OA 3BBCA 4WK1A 2DRAA 3TZZA 5EWEA 2FY1A 3NWGA 4DR1F 3RW6A 2UUTA 4ANDA 2AKWB 1L5UA 4F67A 4FPRA 4PXEA 2F63A 3LGNA 2U2FA 4MTPA 3OSNA 1X9SA 3LA0A 4B3TF 3N6LA 3EGVA 1P1LA 2ZNZA 2XO7A 4WP3A 1YDLA 2MPUA 2IBOA 5H9FK 1S1TB 3EM1A 4P9SA 1TTHB 1T3OA 4CO4A 5CCMA 3C15A 2DNGA 2FDNA 1JLCA 3DOMB 3N28A 1C1BB 3SDEB 2KZZA 4I56A 1S1WB 1EX8A 1JXVA 1IBMF 1N33F 1IKXB 4B3TJ 4O4GB 1D1UA 3ZTRA 2YNGB 2OEKA 3DOLB 3C6TA 4K50A 4M94A 1EARA 4LF6F 2EWHA 2B51A 2HK2A 1RHUB 4NZ0A 4DDFA 4EEYA 3ZZPA 1U0HB 4Q8FA 4D3HA 2Y1LB 3SQGA 4NLSA 1JJHA 2QV6A 3K7RA 1KEKA 2LU2A 2VG7B 4LF5F 2F9JA 2WHOA 1PGZA 3HT3A 2DCLA 1VMBA 4RPFA 5K5MA 1EZZB 3H4BA 4WZMA 5GMDA 1MMDA 1IBMJ 1N33J 2XC9A 4Q0BA 3IBFB 2KFYA 2HVIA 1S9GB 4LF6J 2DXDA 4LBHA 5FDLA 1HYSA 2BANA 4I68A 3MOJB 4C2MA 2C3PA 4J37A 3DDKA 4DS4A 3TEHB 1QSSA 3CJ4A 2PMZD 4LF5J 2HRYA 3C16A 4NXMF 4C3KA 3SFGA 1FO1A 4PG6A 3QFWA 4EZ9A 2CPDA 3W7BA 4RUBA 4QWBA 4R5PA 2IVYA 4B3OA 1YVFA 2O3DA 3MR6A 5IV4A 3X1LB 3FCVA 4NXMJ 2CUYA 2EK6A 3OR2B 4IRKA 3KYLA 2WVDA 4A8WA 2FGCA 3SSRA 2RF2A 3IS9A 2CQIA 2ZBPA 2HK3A 1A6LA 5ETPA 4F0HA 4WE1B 3CCJS 4X62F 3AD9C 1RT5A 1SUQA 5DM7Q 4RW8A 4A8OA 2EXUA 2RUGA 1WC6A 4NLUA 2IAJA 5A8WB 4DSFA 1YTYA 2UVUA 4M5IA 3MMJA 5GAGI 5KFNA 2WCXA 3LWMA 4CM2A 2OI2A 4Q45A 3M8PB 1WSRA 5D4LA 1ZZNA 3CJ2A 4X62J 4PAAA 3AA8A 1MG7A 1H0HB 4C8KA 3WC2A 3D66A 2EFQA 3LP0B 4ECWA 3HVAA 2HQCA 3W5XA 2C3OA 5A8RB 1RZMA 4ED7A 1D0EA 1KWMA 4L72B 2GHPA 4IFYA 1G4CA 2DR6A 1ROFA 2PI5A 1BY9A 1GQEA 4B17A 3ZFVA 3UDVA 2ASDA 4AUKA 2EFPA 4QJVA 4CRJA 2E7XA 1EB0A 4IH5A 2XGPA 3H2UB 2OPPA 3AJ2A 4KJIA 3D28A 3PM9A 4MK9A 2E29A 3CDBA 2XY5A 2B4VA 3HVTB 3F73A 3BGRA 3SCLE 2BABA 3DLKB 4USJC 1M5KC 1TUVA 3H5YA 1QAXA 1S6QB 5KFGA 5L1IA 3GYNA 4RUCA 2VASA 1Q95G 1LXNA 1CS4A 3KTQA 4ZCKA 4Y2MA 5DDQC 4W4MA 2ILYA 1XR7A 4NYPA 4M5NA 1TMMA 2PFDA 2Q79A 3HHLC 5H9FJ 1APSA 5EDWA 3T6BA 1JNZB 1H98A 1OY6A 1S1UB 1IQTA 1SJFA 5EHHA 4NPOA 4OI3A 3DLEB 1VC0A 4S0MA 4I4BA 5ETNA 4O44A 3GIMA 1VQLS 3IM8A 3TRGA 3W2VB 2MSSA 3U1LA 4CM0A 2DNMA 3FSYA 4O3NA 5KFUA 6AT1B 4Q8EA 2VFRA 2ZH8A 1KLMA 3PKYA 2XB2D 3MM8B 4HEA9 1R89A 5KFJA 3JYTA 2I38A 4FZVA 2CQ1A 1KSPA 1FESA 3D1HA 4PXDA 4X4SA 3QBCA 1JLGA 3J81j 1RTJB 3KHGA 4GVLA 3D6MB 2RB7A 3SV4A 1GXUA 3EVMA 3CEDA 3MEGB 4XIUA 1FKOA 1Y11A 4USVA 2LEAA 2BKOA 2W9BA 4WTYA 2XCAA 2V2VA 1P8GA 5DRKA 2MKJA 1VR6A 3QMQA 2UV8A 2AZ1A 1NK9A 4DR5J 2LQBA 2CJYB 3MR5A 4G6VB 1NHVA 1DTQB 3GLJA 2KZMA 2V63A 3C6UB 3BYPA 1BWEA 2R8HA 2E9RX 2HNYB 3IMQJ 3T19A 1A0OB 1U1OA 1H2UX 1CJVA 5THWA 4J9MA 4P7TA 2YNIB 3O2IA 5K8NA 1AFIA 1CEZA 3P3DA 2CQHA 4PQUA 1RU1A 4PRFA 2AHOB 5BJRA 3BSCA 1IKVA 4JUZA 3M1VA 5AXNA 1GT8A 4CLTA 2DNPA 2RU9A 1HI8A 1CJTA 4NCGB 5LM7E 2IA0A 3NS6A 3QZ8A 4I6AA 4CH0S 3UI3A 1TL3A 2QGFB 3KUHA 3GJSB 1ZAXA 4LVNP 2LP4A 4NLXA 4FXDA 5L1JA 2UV8G 1Y7PA 2Q66A 2ZBCA 3L7OA 4PPDA 4P2XA 5KFFA 2CPXA 4I2QB 2WVCA 1RLDA 3T1AA 1L3TA 1RWXB 2MQQA 2VBZA 1NCLA 3NKYA 1IWAA 1RTIA 3VZHA 4DFPA 2YKQA 2KG1A 3CCLS 3BO2A 4MH8A 1U6BA 1NLKL 4CNZA 4ZLLA 3MCMA 3N0VA 2UU9F 1BQMA 1XNRF 3UD4P 3Q2TC 2ACYA 2W2MP 4A48A 3GB0A 2DRBA 3TVKA 1RP5A 4A8YA 4YHHJ 5BYRA 4WXWA 2JRSA 3DLHA 3RJMB 3EPGA 2LEBA 2ZJRQ 2CPIA 4JBCA 2UU9J 3TJ8A 1XNRJ 1Q7YT 5LJ3Y 3QIDA 2GHVC 3OQ2A 5L9XA 1U1MA 4P2SA 2VG5A 1IR1A 2H1YA 2KM8B 2HBRB 1Y0HA 1S6UA 2LYVA 1ZM4A 3HZGA 2V4QA 4IOBA 2I0XA 4H4KC 2YKAA 2BX6A 3GU0A 4IR9A 4N56A 1T7PA 3W9HA 3PJXA 4DV7F 3OXGA 3H98A 5I3QA 5GADU 3RB0A 5BYSA 2BYCA 4ZVGA 2V8VA 1QAJA 3NLCA 5J2QA 1TL1A 1GXLA 4ED1A 3FEYB 3BR8A 1G6BA 4OYWA 3FRZA 4OI0A 2JLGA 2ZJPQ 4ILMA 1ACMB 4Q0BB 2J6SA 1HPZA 5EWGA 3P8BB 2L9NA 2JLFA 5HSPA 1YZ6A 4IO1A 5FDLB 1HYSB 3CJSA 5LMNF 2XHCA 3LP2A 4DV7J 5HO4A 1UWBA 3K8VA 3W60A 1S0VA 4RNHA 2Z4PA 3A8JA 3C16B 5DZ7A 2F40A 4ZVFA 4NRTA 1D9FA 1WEXA 1NDPA 2VB6A 5KFHA 1T94A 1N56A 2HNDA 1TVRA 1WG5A 1ZETA 3ADAC 4Q43A 5F8LA 5LMNJ 4B3OB 1N5SA 1HHQA 1XBWA 4HVZA 2Y1JA 3HM9A 3ELHA 3OV7A 1F1BB 4O3SA 2JEFA 1RACB 4AL7A 3IFEA 1WG4A 4F4XA 3KG4A 1NDLA 4CLKA 3VAKA 4B9TA 2RJZA 4ZVUB 4R0EA 5E33A 1YIJS 1FNOA 2RF2B 3IS9B 3HFZB 3CJKA 3MAHA 1RT5B 3PW5A 4C8NA 3N79A 3ILJA 2DGTA 2CYYA 2IAJB 5IT4A 2NZCA 5KT5A 4GC6A 3THTA 2W1BA 3DI6A 1IXKA 3GTYX 2XSJA 2O67A 4M5GA 3SSSA 4FYXB 4E8UA 1DQAA 2R8JA 1SKSA 4FXWA 2D41A 2R4FA 2D9OA 3LO3A 3CC2S 4WKRA 1S97A 2XSFA 3THPA 2NR0A 3MUTP 1K47A 4DL7A 4C6AA 1BUXA 3UN5A 3UDLA 2K7KA 2MYFA 3PEHA 2EKNA 3AAWB 2HVEA 1T9XA 4DHVA 2FVRA 2A6MA 4K4XA 4FYVB 4M95A 3NCRA 5EN1A 4IFYB 5AE3A 3HHNB 3A12A 2V5HG 2G0CA 2O1PA 4C11A 5GAGU 4L76A 3OTOF 1JJ2R 5DLGA 1MNEA 3HPOA 2BE9B 1NSAA 1KFDA 3W8GA 2L08A 4ZCMA 4QIVA 1YLXA 2B7BB 5HMWA 4ZLPA 3U27A 5F8NA 1R6VA 4E98A 3TQEA 4LR7A 3MMBA 3NOGA 2G1HA 2F8MA 2M5YA 2MZRA 1LFPA 4C0BA 5ETOA 5DDRC 2XI2A 3KJVA 5E3QA 1JK9B 3VAJA 3LANA 5A76A 4K4YA 2YPZA 4DV2F 2GIRA 4P73A 2UXCF 3ILLA 2D3ZA 2OP5A 3L7UA 1VRUA 1CJUA 1ZTTA 1S10A 5M2UA 2NXEA 3HSGA 4AQYF 5DM6Q 3IRWP 2HBQB 2B7CB 1Q8BA 5DQGA 2BZ2A 2JWNA 3QAUA 2YWKA 2H51B 4DCPB 4DV2J 2KFNA 1SV5A 2UXCJ 3Q83A 1UP1A 4PG4A 1UL3A 4O44B 3DMJA 3I0SA 3CMES 4YOEA 2OLWA 1VQYA 3UD5A 1KOHA 2RE1A 2QLBB 5AXLA 4ELUA 4AQYJ 1SQGA 4ZK7M 3R1LA 4FN5A 3WQPA 4OLOA 5C7PA 1KLMB 4DQRA 3MEKA 1IWGA 3JYTB 5DO2A 1I1GA 1WKJA 3NG8A 1JLGB 1D9AA 1FTCA 2RVJA 1S7HA 1W26A 2HGMA 2E1AA 2JH3A 1P27B 3OFHA 2J6TA 4OHVA 4PYAA 5KFEA 3NXZA 4B02A 2W4DA 2GO8A 3QRPA 1U25A 3W1YC 1FE0A 3N01A 1MROA 4WYWA 2FLNA 2KT5A 4E0DA 1FKOB 2VFVA 1NB7A 1S0NA 2W9BB 2YNFA 1VLYA 3PFOA 1Q79A 3R6GB 2V8PA 2OFHX 1FD2A 3M6UA 1MLAA 3PNIA 4XK8C 2FQQB 1FXLA 4X4UA 1HI0P 1HA1A 1DY3A 1CJVB 5SUHA 4HL9A 2VC1A 3O6QA 1T02A 3N5BA 4OZ0A 4PQUB 1JLAA 4X2BA 4JV2A 5GVQA 1UW9A 1IKVB 4OYMA 3M1VB 3LALA 2FJEB 4RW9B 2Z2ZA 4DL5A 2KJWA 4KBIA 1EKRA 2WW8A 1TL3B 4B08A 4X4PA 1S1XA 3TX8A 1DAXA 1PAUB 1YQHA 2FLPA 4JI3F 4KHPF 4TYBA 3DGPA 4F3QA 3UO0A 3LTOA 3D0GE 1RT1A 3UQSA 1M5VC 1HW8A 4MJKA 4NLWA 2L9WA 4J91A 2DHGA 3M8QB 3PX6A 4ZVOB 4FXVA 4X64F 4M5DA 3PY8A 1EIYB 4AD6A 3TZWA 2ZH3A 2QZ8A 3Q23A 2RU3A 3IG1B 2FZKB 3VHQA 4JI3J 3FK4A 2R8GA 1RTIB 1LWCA 4KHPJ 3ENAA 4HACA 1PCAA 5C42A 1U24A 1NDKA 4OHWA 1NKCA 3QPIA 3H4DA 2Y8YA 1BQMB 4ENOA 4W92B 2HYIB 3LF0A 1OYDA 2C22A 3D6FB 3FZ2A 3JTNA 4EGLA 4F4AA 4NZ6A 2AYMA 5J1NA 2LECA 1XMQF 4NASA 1NSKL 2RHQB 3OL8A 3PW0A 4RWWA 2BACA 1WC5A 4X84A 1X4DA 2B0GA 4LF4F 3MDFA 2YWGA 1KFSA 1U49A 2QIFA 2LEPA 2V2KA 1RT3A 2AWZA 3Q8SB 2AYEA 1U0SA 4WKYA 3AOAA 4NLPA 3KLGA 5I42A 2HQIA 3VGVA 1I94F 4QYZJ 2DHSA 2KL8A 4NRUA 3X3UA 5DETA 4J9OA 2XNQA 4J9LA 4PR6A 1H2TZ 2ZWPA 2DHAA 4LF4J 2OHDA 5CZVA 5KFIA 4ANCA 2L9DA 3V6JA 2HWIA 3OR1A 1BQXA 3LGMA 1N5VA 1TL1B 2M70A 1I94J 2DR7A 1XK8A 2KT3A 2QTWA 4RZRA 1VHFA 1HPZB 1ZZFA 2VJUA 3HHLA 2A10A 4RBVA 2X1BA 3TA1A 1MWZA 3Q8VA 1QE1A 4RNMA 1UWBB 2HWHA 4WU3A 2F3JA 3E3XA 5CYQA 2I6WA 4E2FB 3OW2R 4RJVA 3KLVA 2HFZA 2KXFA 4AYBD 5D0HA 3W2WA 2YX7A 1H2VZ 5DG9A 2ADCA 1RUSA 3L09A 4B9MA 4BLGA 4IG3B 5D0GA 2R7TA 1TVRB 2AJ2A 3O8WA 5HJYA 1FWLA 3K5MA 5HJXA 1J5EF 3KFWX 4LF1A 2MKHA 2YKMA 4JI5F 5KFXA 3CCUS 2X3GA 2ASYA 2PMHA 1Y3KA 1QY7A 4CLLA 4OFZA 1CC8A 2IRYA 4FF2A 1RHJB 3J81U 4O3PA 1J5EJ 2MLYA 1YI2S 3SV3A 4RW7A 4JI5J 1F9FA 2CQGA 3FQKA 3K2YA 4IYQA 1YRTA 3DI6B 3IAM9 1WHXA 2XSJB 2HZVA 1TU0B 3HSJA 3FSIA 2DPJA 2YY3A 2CJKA 4C7QA 1SJRA 1RE1B 4ETXA 2YX4A 1UFKA 2RNEA 4BHQA 3S7RA 3MMAA 4QWDA 3H59A 1ZM9A 2CPHA 4Z7YA 2P5VA 4QCLA 3RBXA 4P2MA 2VD3A 4ZLJA 1FJ7A 4EFAC 2K8GA 3K8WA 2ZH4A 2K1RA 1RCXB 2XQCA 1X0PA 3ENQA 4ZHRA 4C11B 1VLOA 5B08A 2B3TB 1QLNA 1X60A 1P9YA 2KN4A 4EBCA 1URRA 1B4SA 2DNNA 3LAMA 4C3LA 2E1RA 4KY3A 2XMWA 1U6ZA 2GW8A 2AJ4A 1IBLF 2QJ3A 3D3BJ 3DRXA 4OYBA 3RU0A 4JI2F 3MMBB 2BE2A 2R7QA 4M63A 4CO0A 3NMAA 2W2PP 3EGWB 3K89A 3VCDA 3W66A 1U45A 5DJBA 3KJVB 2DXFA 1TUGB 3ITHA 2BRKA 1EETA 4WFXA 1T03B 4DPWA 2VA2A 3KXDA 4TLQA 3ZTPA 3JAMU 4N7TA 1ZA2B 1IBLJ 1VRUB 1CJUB 2YKPA 2OMOA 4JI2J 1NHKL 3QSIA 5CYMB 4MKBA 1IVZA 3E2EA 1WOSA 2NUUG 2VONA 5KFSA 4TNOA 2QEXS 1RKIA 2OUGA 4BBYA 3UR0A 1PILA 2V4JA 1SV5B 2D3O1 3DMJB 2GJFA 2XMJA 2BRLA 2C3UA 2RAQA 1GAOA 5CZXA 1GH8A 1GEHA 1W25A 2RRAA 3KK2A 3C3LA 5F0UA 3Q89A 4KR0B 1AZSB 1RTHA 1NK5A 3QWUA 4DJBA 3UPFA 2KYXA 2AGQA 2HQGA 2QE5A 4PG8A 2BUNA 3BSOA 4PUOA 1X4HA 2PMWA 3MD1A 2MY8A 4IUFA 2WONB 5U47A 1NJIT 1N36F 4USMA 2ZM6F 1O8BA 2QLFB 1RI7A 4H4KA 4B9VA 3PCOB 5KFVA 1F9EB 3MM7A 4J90A 3V6DA 3R5JB 1RT2A 3CDWA 1B0TA 1MROB 3KHRA 2XLKA 2C2NA 4K2XA 5CA5A 2XS7A 2YNFB 4X4QA 2KB2A 1SC3B 2F5GA 2HMIB 4O3QA 3QJPA 2VPYB 1N36J 2ZM6J 3ZZOA 3EXCX 2CPEA 2FHJA 4IQMA 3RB6A 1GMUA 2FHKA 4ICLB 2KDOA 3FCWA 2C3MA 1OPIA 2NPIA 2ZH9A 3QRRA 3LQVA 1NBEB 3VALA 4LR9A 3DM2A 3MZIA 2GAHC 1F60B 1GNKA 3R7BB 2HURA 3MECB 3ZXWA 4EK2A 3GILA 4USUA 1S1XB 4FS2A 1SB6A 2BM1A 2NS1B 2HHWA 2HQDA 1NK4A 4HT5A 2F7VA 3DGPB 4WFZA 1TK5A 1RT1B 3J7A1 2F8EX 3BN4A 3QT6A 2Y9HA 3HHDA 3DLGB 2IM1A 2GVZA 5IT0A 4M5DB 2MKYA 2HS3A 2VPXB 2YX1A 3B6BA 3UE2A 4ED4A 3HFKA 3M2RA 1LWCB 4XPCA 4PWDA 1AROP 2YQ1A 3I0RB 4U7UD 5C42B 1HD1A 3OVSA 3DHWC 1NPRA 5HMZA 3C2PA 1MSWD 1VK3A 1HKAA 1DRZA 2IC3A 4KHMA 4OI1A 4PYDA 1KS2A 3H2LA 3Q8QB 5HP1A 2BEFA 3LOUA 5E3PA 3CCVS 4EZ6A 2VV5A 1MN7A 2HHXA 3BSNA 3D1QA 3GV7B 1FK9A 5DG8A 3VTIA 2PN6A 1OJ4A 4HT7A 1B3TA 1AT1B 2Z8QA 4L73A 4WP9A 1K73T 1RT3B 1GXTA 3MCNA 4HHUA 5B7WA 4ZJQA 1EP4B 2FB0A 1R0AB 3KLGB 4J9KA 2HRUA 5F3ZA 3PR5B 2XMTA 4IOCQ 5I42B 3CJ3A 3WBZA 2G0JA 3VAMA 2E9ZA 5L39A 1QD1A 3HKZD 4XDDA 4P2FA 1N4LA 5KG3A 3T5JA 3ZZ0A 4EI2A 2APOA 5E2QA 3AXMA 2X51A 3M8RA 1VJQA 1D8YA 4AL5A 1WHWA 2B5JA 1AA1B 5CABA 3F56A 2OAUA 3OR1B 1SPBP 5KG7A 3OTCA 3IN5A 2ERRA 4B9LA 1Q78A 4ZVPB 2V0NA 4NEYA 1BQNA 4R8UA 3HHLB 5HLFA 3TA2A 2Z58B 5K9FA 4FF3A 1DLOA 1U26A 2RRBA 3MF5A 4J9PA 1BD6A 1FFGB 1QE1B 2DT9A 1BMQB 2EFVA 1H72C 2C2RA 5CYQB 1SBRA 3DDIA 3DOKA 5KFCA 4GRSA 2HNZA 4I2PB 1LWEA 1IQZA 4DLGA 3W2WB 2EG2A 5KTQA 1B70B 1IBKF 3Q8YA 3Q0AA 4CWBA 1S7IA 4ZPDA 2ZH5A 1VRTA 4PCQA 2G4BA 4Q2MA 2LU1A 3ISZA 3KG0A 3KJFB 2B6AA 1KVIA 5F9LA 2Z0GA 3R7NB 2NLWA 3L7PA 1IBKJ 4LVOP 4LIRA 1J5OA 4PPZA 1FRLA 1PAEX 4A8MP 4P72A 3G6YA 4ANEA 2WZ1A 3KDNA 3MMCB 4HDHA 3UVJB 4RW7B 2IVMA 1D9DA 3GYGA 2IM2A 2BJEA 2R2RA 2ZUAA 2ZZMA 1TP7A 2ASLA 2IA6A 1QSLA 2XULA 4DX6A 4WWSA 4X4VA 2JZ5A 1S0OA 2OMLA 1ZM2A 2DGXA 2M0GB 4F04B 3PEJA 2QMXA 3PDNA 4LRFA 4DXLA 1X31C 5HQMA 4CH7A 2KJVA 3MMAB 1M5OC 3J80Y 3UFCX 4QIGA 4TN2A 1D09B 5CHCB 2AJ1A 1ZBTA 2DNZA 2XS5A 3Q8RB 3R2CJ 4JI8F 3MUVP 2K1RB 1FRXA 4GO5X 1XJWB 4EYIB 2CDQA 3FMWA 2DYAA 4ZCIA 4I7FA 1P1TA 3DOMA 2MKSA 4MKVA 3AJDA 2UUCF 3Q8PB 1IKXA 1RAFB 5HMYA 2HAFA 3I6PA 4O4GA 1FJCA 3HVRA 2VQEF 2YNGA 3JAMY 4DV4F 4B9SA 5KFLA 3DOLA 4JI8J 2NUHA 3GV8B 2QO3A 3KMSA 1FKAF 2MEWA 3QSYB 1MN9A 2QSFA 3ITHB 2BE7D 1EETB 4WIIA 2FVSA 3UCGA 5HROA 4OZ2A 1XN9A 3NS5A 1RU2A 3BGUA 3LWLA 2UUCJ 1ZM3A 2KT2A 2ZZTA 5KFBA 2GA7A 2VQEJ 5J2NB 2W8LA 4DV4J 2MTLA 2V69A
chains in the Genus database with same CATH topology
3CCMS 4DG1A 1S9GA 3DU5A 2E9TA 4ICLA 2I5JA 1R27B 2M2BA 3NKYA 3R27A 1N34F 1U1KA 1HBNA 1RTIA 2E5GA 3NCQA 4YB1P 3OLAA 3PO4A 3NRBA 2PC6A 3OSPA 4YR3A 3VZHA 4ZMMA 1JXEA 3T9NA 4DFPA 1MU2A 2DIVA 4B9UA 2YKQA 4X65F 3VF0B 2IMOA 2KG1A 3BO3A 2FLOA 1OPZA 2VBXA 2CVIA 4UUWA 3CCLS 3BO2A 2WSFC 1S4FA 2AJQA 1HHSA 4MH8A 1S72S 1RA6A 1U6BA 2CRLA 4G1QB 4CNZA 1C1CA 3GSDA 3NGKA 3MECA 5A2QY 3HF5A 1Z2ZA 3N0VA 3QGHA 3BQ0A 2UU9F 2XY7A 3I9ZA 1BQMA 4ZP9A 1XNRF 4QW9A 2J0SD 3UD4P 4ZVHA 1TAUA 3Q2TC 2ACYA 4A48A 3GB0A 2DRBA 3NAHA 4QYRA 5LL6d 2E5LF 4KGKA 3TVKA 1RP5A 5F8MA 3A1YG 4A8YA 1X9WA 3KK2B 4XDCA 5BYRA 4WXWA 4USHA 3FCHA 5B0AA 2JLEA 5I3UA 3DDNA 4ZCLA 1SJ3P 3G8TA 1N5YA 2NREA 4DR3F 2JRSA 1DJ0A 1RTHB 3MM6B 4LT6A 3CCZA 2L48A 2F1FA 1MMLA 1N5TA 1C0UA 3CCRS 1X9MA 2H5EA 4QR2A 3DLHA 2DGWA 2P6SA 3FQLA 5HBMA 3DNCA 2BQUA 1WEZA 2F9DA 3EPIA 4UQTA 4PUOB 2JJ4D 3DLGA 4I1TA 1JLAB 5EX3A 3EPGA 2ZJRQ 2LEBA 5D4OA 3FFIB 1SL0A 2EW9A 1OQ6A 3PIOQ 1W2BR 2ZNYA 5J2MB 3OL6A 2CPIA 2LLZA 4JBCA 4W90B 2OO4A 3KK3B 1Q7YT 1B7FA 2JSXA 5J1EB 2BR0A 2QT7A 2HVZA 3QIDA 4ATNA 2GHVC 3BGLA 5LJ3Y 2BQ3A 1CVJA 1FDDA 5LJ5Y 3OQ2A 3UD3P 1FVQA 2J5AA 1HNVA 1RYRA 4WE1A 5L9XA 1U1MA 4P2SA 2VG5A 3PKMA 1TV6B 1U2RA 4OZLA 3M2UA 3POTB 3V6DB 2Y1RI 1RT2B 2KM8B 1VQ7S 1Y5LB 3U7JA 3GFYA 1Y0HA 4QIFA 1S6UA 2LYVA 1ZM4A 3HZGA 3I0RA 3ULHA 2V4QA 2ZZNA 4IOBA 4DOZA 4YP3A 3RB4A 2OIHA 2I0XA 4H4KC 4Y2CA 1OQ3A 1WWHA 5E7OB 4RNFA 1V3RA 3VAGA 5M2PA 2M3DA 2YKAA 1JLEB 2OPSA 4IR9A 2J7UA 3KMQA 4N56A 2BJDA 4A8SA 3CGIA 2KM8C 2R7WA 1T7PA 2R2SA 1NK7A 2EFGA 2J6UA 3PJXA 4OL8A 4DV7F 3PR4A 3CIZA 3OXGA 3H98A 5I3QA 5A6WA 5GADU 4UW2A 3RB0A 1NKBA 2DK2A 3UW1A 3OXLA 2D7SA 2BYCA 5BYSA 4ZVGA 2GX8A 2WAQD 2V8VA 3RBEA 4ELTA 1QAJA 3NLCA 4PXBA 5J2QA 2OSRA 3DXBA 1TL1A 1GXLA 1PC5A 3FJ2A 4ED1A 1KR4A 3FEYB 1LW0B 3BR8A 3SEOA 5CD4H 4QWCA 1G6BA 1HL6A 2HAIA 3FRZA 4NA1A 5DS7A 4WF9Q 3NAIA 2JLGA 1NKEA 4OI0A 2ZJPQ 3LP0A 1FEHA 1JMTA 2IFXA 1T05A 4ILMA 3NMRA 3R3TA 4Q0BB 3MURP 2DGQA 2J6SA 1KC8T 1JIHA 3FZBA 3DRRB 1HPZA 3PXGa 4C8ZA 1ZYQA 5EWGA 3K5PA 4URGA 1TK8A 2DITA 2L9NA 2CJQA 2JLFA 5E3CA 1R8AA 4IO1A 3FEZA 2RMLA 5FDLB 1Q53A 1HYSB 3MXHP 1FJGF 3M9OB 5LMNF 3V6KA 1X4GA 4QW8A 4NLQA 3LP2A 2FVCA 2VBWA 2YH0A 4OIXA 4TY8B 4DMZA 5CYJA 5D4PA 3CD6S 5HO4A 1S6OA 5EWFA 3TAQA 1UWBA 1UEVA 3K8VA 2AU0A 3OFEA 4QZVB 3MR3A 1FDAA 3DM2B 3T1YF 1S0VA 1SIWB 3BB5A 1REVA 4KV8B 4RNHA 4ECXA 2Z4PA 3OTBA 2SXLA 4OLPA 4ZP7A 6FD1A 3CCWA 5C25A 2AQ4A 4O3RA 4RLEA 3K58A 1EP4A 2F40A 1R0AA 2KXHA 4ZVFA 2GIQA 1UVIA 4NRTA 1VC5A 2VFUA 1UFLA 2RKIA 3TUIC 1D9FA 2FTRA 3RB3A 3M30A 1WEXA 5KT3A 2VB6A 3QIPA 4FBTA 5KFHA 1JXLA 3TP2A 3K5NA 1T94A 1T95A 1WHYA 2GFFA 1N56A 2HNDA 3DN9A 4KT0C 3H20A 2PIIA 1TVRA 1WG5A 2V94A 5F0WA 3EX7B 2GGPB 1ZETA 1HQEA 3GWCA 2VFSA 4JI6F 5G0RA 4Q43A 1VC6A 5F8LA 3IR7B 1FE4A 3TA0A 4KFBA 4B3OB 1N5SA 3SXLA 1DTTB 1MMNA 2EVZA 4C8MA 3H5XA 3EZ5A 2GJ2A 3D1OA 2R7RA 4BCAA 1XBWA 2JOQA 2CJ9A 2HFOA 4HVZA 2DGOA 2Y1JA 1WEYA 3HM9A 1HQUB 1HW9A 3NBPA 3OV7A 1HWJA 4O3SA 2JEFA 3AHPA 4Y34A 5B0GA 4DQIA 4AL7A 3IWNC 2G9OA 3IFEA 1WG4A 4F4XA 3KG4A 1U48A 1VI7A 3OVAA 1FRJA 1M1KT 3VAKA 4B9TA 1S99A 4TYAA 4A8QA 2RJZA 5KFWA 3N5FA 2XHWA 1U1QA 4R0EA 5E33A 2H9ZA 1YIJS 1FNOA 2RF2B 2WOMA 3IS9B 4QBUA 4CZCA 1VBZA 4BWJA 3CJKA 4Y0FA 3LH2S 5K14B 1FNXH 1CG2A 3I96A 4KIAA 4FYDA 5F8IA 1FJEB 3MAHA 3B4MA 4ILRA 4NLTA 2RH3A 1G7CB 3MD3A 1RT5B 2QA4G 3PW5A 3M2RB 1WACA 4C8NA 1L3VA 3P5TL 4CO2A 5GMKa 2RILA 2IYGA 1U1PA 4PWDB 4TQSA 1Y5IB 2RQCA 4XPEA 1QSYA 3N79A 2W7OA 1NNDA 1S6PB 1UA0A 3CCQS 2DGTA 3MPWA 2MJNA 1A9NB 1TQLA 2RS8A 2CYYA 4OI2A 2IAJB 5IT4A 2PGCA 3TOQA 5KT5A 5IZHA 3D5MA 4CO3A 2NPFA 4HHJA 2IMWP 1KONA 4GC6A 2EFNA 3DYAB 3M05A 5H1SV 3HXMA 3THTA 4Y2IA 1HD0A 4I2PA 1IN0A 2NSCA 4OHXA 1LXJA 3DI6A 3IWLA 1IXKA 4CT9A 4HLBA 2K7JA 2XSJA 1U47A 3VAIA 2CFXA 2ALZA 4EUVA 2O67A 2DHXA 3SSSA 3JSMB 4E8UA 2IC3B 3DLEA 2J9DA 1UVJA 1BGXT 1DQAA 2R8JA 3IC1A 4ID8A 4F2SA 2Z2LA 5IXUA 3UCUP 3KNAA 5F8GA 1SKSA 3S8SA 5HP1B 2RIJA 4NMLA 1SI9A 4LIWA 5KFKA 4FXWA 4KC5A 3DRSB 5DGAA 2D41A 5JVGQ 4OV1A 4G1IA 3W2VA 2R4FA 2D9OA 4N5SA 2ZDOA 3QLHA 1UMJA 3LO3A 3VAFA 2PI4A 3CC2S 4LFCF 4WKRA 3TQ1A 1Q1KA 1S97A 2XSFA 4LQ3A 4NCAA 3THPA 2NR0A 5A0YB 3ZZUA 3MUTP 4QIWD 4DV5F 2XY6A 1FRIA 1NAQA 1YRXA 1FK9B 4DL7A 1SQEA 2YVSA 1ELOA 4NWBA 2KG0A 4J9NA 3W3SA 3UDLA 2K7KA 2MYFA 3JB9k 2Q3PA 3MHYA 3GFXA 3PEHA 4LSNA 3AAWB 4IFVA 3CD5A 4I6WA 2YWEA 3EYZA 2AGOA 1XERA 4R0JA 3HK2A 4BC9A 4DHVA 2FVRA 2UXDF 2HS0A 3G6VA 4FF4A 2MZTA 4K4XA 2YNHA 3MM8A 3H5UA 2JEIA 4M95A 5K8PA 3NCRA 4ZOSA 5EN1A 4LFBF 4IFYB 5BR8F 5AE3A 3HHNB 5F8HA 2W7PA 2IRUA 4P6QA 1XEZA 4TQRA 2VL1A 2V5HG 2G0CA 2V8DA 3PV8A 2FLLA 4DWIA 1LW2B 1MWYA 4FP9A 4NLVA 2O1PA 4ECZA 4C11A 1S76D 3MWBA 5GAGU 3IR6B 1OSCA 1R31A 4YDXA 3OTOF 1JLQB 1JJ2R 2EBEA 1MNEA 4QQBA 3RYLA 5DLGA 2W9AA 2EC0A 1VQ6S 3ZZZA 2MQPA 3IGNA 1KQKA 3VR1A 3HPOA 2PA8D 1TKDA 4DQPA 1G2EA 3HHEA 4K4UA 3CWJA 2ZOGA 3MMCA 1JLFB 1HWKA 1KFDA 2L08A 4ZCMA 5KG1A 2LXIA 1NU4A 2ZC4A 3KLEA 4QIVA 4GC7A 4ID5A 1C2PA 4ZA1A 2B7BB 1YJRA 2J9EA 5HMWA 4ZLPA 2CQ4A 3U27A 4KKOB 1SXLA 5F8NA 3C46A 5F41A 4DR4F 4E98A 1GTEA 4JV5F 3MMBA 3HI9A 2XG8A 1R8CA 2F8MA 2M5YA 2XWXA 2QLXA 2MZRA 1RQ0A 4IH7A 4PQAA 1TFYA 1R8BA 1LFPA 2FC9A 4NX9A 4C0BA 2E7WA 2YKMB 5DDRC 2XI2A 4DF8A 1Q81T 3M32A 3J81Y 3EZUA 1NK0A 3AJ1A 4TU9A 4O0IA 3KJVA 2NQPA 2UP1A 5E3QA 2PSZA 1UKUA 2J0QD 4ECTA 1F5BA 2OSQA 4N8OA 1JK9B 4DV3F 3VAJA 2DNOA 3LANA 4I6YA 2UVWA 4B3SF 2PT0A 3CCTA 2XLJA 4XO0A 2DPIA 4ERDA 3QGPA 4K4YA 4I67A 1H3DA 4DV2F 5C24A 5AE2A 3V6HA 2GIRA 4F4YA 4DEZA 3QZ7A 2KTQA 1IKYA 2UXCF 3KNGA 1BQNB 4KRWA 4KO0A 4FVCA 2D3ZA 1DTQA 4Q2LA 3KLFA 4R8UB 3MGJA 3Q22A 2OP5A 5GAEI 4QOTA 5HLFB 4JI7F 2DD8S 1NJYA 2J9CA 1HBMB 1VRUA 2E5JA 4LF9F 3CCES 3B78A 1ZTTA 1S10A 2QA1A 3G9CA 3NCPA 5M2UA 3T5LA 3PW7A 2DVIA 4U7UK 1KD1T 4AQYF 2J8AA 5KT2A 5DM6Q 3IRWP 2YWHA 1S49A 3QO9B 4KE5A 2A3JA 3PW2A 4J5OA 2B7CB 3MEDB 1Q8BA 3DOKB 5DQGA 2BZ2A 3IR5B 3KLIA 2HNZB 4ZPBA 3I4PA 2LDIA 3JTPA 1RKJA 1LWEB 2JWNA 3QAUA 4F4KA 2YWKA 3D0IE 5ITHA 3I9V9 4ECQA 1R7IA 1WTBA 2VPWB 4H4MB 2DNYA 1FKPA 4YY3F 2KFNA 3DFEA 1SV5A 1UP1A 4RW4A 2WBRA 3CO9A 4PG4A 1UL3A 2O5DA 1ZOTA 5LXRA 2R8IA 4O44B 2V9WA 4CCHA 3DMJA 5D6GA 3I0SA 1HBOB 2GO9A 4V19J 1JX4A 5G4DA 2CQ3A 5KT6A 3CMES 1N54B 4YOEA 3L3CA 2CPJA 1K1QA 2FPHX 1KHVA 2OLWA 2M8DB 3M6WA 3IA0A 2XNRA 2HVHA 4EO8A 3BEGB 1TL5A 1VRTB 5IQ6A 1VQYA 1AUDA 3R5AA 2CQCA 4DV1F 2UXBF 1KOHA 1DQ9A 3JSRA 1NO8A 2RE1A 4ELUA 5AXLA 3VWSA 2GJIA 4ITSA 3MM9B 4ZK7M 3GG0A 2J76E 2K3KA 2CZVC 1NH8A 4IRDA 4A4JA 3R1LA 4FN5A 1KQSR 4OLOA 1Y5NB 1VQSA 3DCAA 4J9SA 4MKYA 1KLMB 2MZSA 2E5IA 5D77A 4QU7A 4DQRA 4DF4A 4F8RA 4RU2A 1O51A 3M4XA 3M6XA 1VBYA 3OHAA 1VQNS 3MEKA 2M88A 4F50A 5LMUF 2LXFA 1F0XA 4HI2A 3JYTB 1K0VA 4LMZA 1J5OB 5DO2A 1C0TB 4ELVA 1FXDA 4I2QA 3KK1A 3GR0A 4ZHRB 4RNOA 1I1GA 1YHQS 1S1TA 3K59A 2AX1A 3NG8A 2A1BA 3CC4S 4AXIA 2VH7A 1JLGB 5AXKA 1D9AA 1YJVA 1FTCA 2RVJA 4C8OA 4DSKA 1S7HA 5J2NA 1HWUA 1ZPVA 2HGMA 4YB6A 2PFFB 2IJNA 2N4CA 2E1AA 2CQPA 4YB7A 2OPQA 2JH3A 1P27B 2ZITA 4B3MF 2J7WA 3OFHA 4MFBA 2J6TA 1C1BA 4OHVA 4ED2A 2LKZA 1HNIB 1U1RA 5KFEA 4B02A 3SDEA 4I0WA 4EBEA 2W4DA 2N7YA 1Q16B 2GO8A 2P9EA 3ENWA 1S1WA 4RW6A 2YTCA 3GYXB 3NGDA 1U25A 1FE0A 2VC0A 4Q44A 3N01A 1U2FA 1NJZA 1MROA 2HHVA 2BE2B 4TKTA 4WYWA 1JLBB 1TKZB 1FD8A 2FLNA 3TYTA 2KT5A 5HL7Q 4E0DA 5L9NA 1FKOB 4KSEB 3OVBA 2VFVA 1NEEA 1NB7A 1S0NA 1L3UA 2LDYA 2FJVA 1S9EB 3ICLA 3ISND 3I82A 3IXQA 2W9BB 2YNFA 1UVNA 4G1QA 1PC4A 1LWFA 4DFKA 1VLYA 2WSEC 1D8ZA 3PFOA 1WNEA 3J7ZT 4DUYF 1Q79A 3PHEA 3V5RA 2OFHX 1FD2A 3I5BA 3M6UA 2RDJA 2NXUA 2OD4A 1GX6A 1DHMA 4RX6A 2W9CA 1KN6A 1QUPA 4OX8A 2VG7A 3SZ2A 2DR8A 1SH3A 3PNIA 3TUJC 3TARA 4XK8C 1L3SA 1ZAVA 2B4UA 2DNKA 1FXLA 4X4UA 3HZEA 3IRXA 4OZJA 2XBPA 5GAEU 1RTDA 2C42A 3DLLQ 1NRKA 3MM6A 4N8NA 1HI0P 2UUBF 1Q82T 1HA1A 2AP6A 1CQMA 5KFTA 1Q86T 3TUZC 1R8PA 3SMZA 4IR1A 5SUHA 2N3LA 2VKRA 3E01A 4HL9A 2VC1A 2M9KA 3O6QA 1T02A 2B4PA 3N5BA 4A8FA 3CE8A 4OZ0A 4PQUB 1JLAA 2XMVA 1FVSA 3OBIA 1U1LA 2BW2A 4MIBA 1FEEA 1TKXA 4X2BA 2U1AA 3SYZA 1TFWA 5CH7B 5GVQA 4JV2A 5J2MA 1IKVB 1X0FA 3A8EA 3FVYA 4URQU 2XGQA 3KK3A 2VZ9A 3M1VB 2JX2A 1RT6B 4I7FB 3LALA 4Q5VA 2V4JB 2XEXA 2FJEB 1YJNS 2ZOMA 3UWTA 4RW9B 4DL5A 3PACA 4HDGA 2KHDA 1JKHB 1FA0A 4TXSA 4CTAA 3MM5A 1VQKS 2V9KA 3N4WA 2AF6A 5T7LB 5E0OA 1C4AA 4C0OC 1HARA 1TV6A 2ZE2B 4WYLA 4LUBA 2KJWA 3H5SA 4KBIA 3GR1A 2PO4A 4KGMA 2HHTA 2WW8A 1TL3B 4B08A 1FF2A 4X4PA 1S1XA 5KG4A 3TX8A 3P96A 1NK6A 1DAXA 2WK4A 2QLWA 4WFAQ 1DBDA 4KTQA 1YQHA 3TAMB 1Z4UA 3CF5Q 2F8HA 4FF1A 2MZJA 2FLPA 4F26A 2NSBA 5L1LA 5KFQA 1SJQA 2G1DA 4YR2A 4MYUA 3PIPQ 4JI3F 3CIMA 3BDPA 4KHPF 2HG4A 4TYBA 1S1VA 2PD1A 3DGPA 4OZ1A 2GHWA 4F3QA 3V81B 5IS2A 1RT7A 4IG0B 5IFMA 1HMVB 1FCAA 4L6V3 3D0GE 2XWYA