4R0EA

Crystal structure of the poliovirus rna-dependent rna polymerase low-fidelity mutant 3dpol h273r
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHRLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dynamics as a Contributor to Error-prone Replication by an RNA-dependent RNA Polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase
total genus 141
structure length 461
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4r0eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r0eA02
2FJVA 3QIDA 1ZTWA 1RTIB 1REVA 4NLOA 4DG1B 5I42B 1ZTTA 4ZHRB 1LW2B 4F4YA 4I7FA 3T19A 4U6PA 4K50A 1HNIA 3CO9A 4ECTA 2ZE2B 2ALZA 1RA6A 2WONA 3I5AA 4KV8B 3KMSA 5KFUA 5CYMA 1BQNB 4KBIA 1HARA 5C5JA 5C25A 3DLEA 1TV6B 2WCXA 4XO0A 5KFXA 3GIIA 2B5JA 4IH7A 4YR2A 2ZD1B 4RNMA 4IG0A 1I6JA 3FFIA 3IN5A 2FVCA 2OPSB 4J9OA 4F50A 2YNFB 2DPJA 5DQHA 3E01A 4Q8EA 2BRKA 2VG7A 2C22A 3GIKA 1S1WB 3M9MB 5EWGA 4FBUA 2BRLA 4XPCA 1HYSA 4M94A 1RYRA 1QE1B 4KFBA 4NCGA 3MR3A 2W9BB 4EEYA 4WZQA 3ICLA 3DI6A 4TQSA 3EPGA 1RTJB 3H5XA 1SH2A 4MK9A 4O4RA 2GIRA 3DRSB 4Q44A 5KT5A 4DL4A 5KG3A 5C42A 5DG8A 2YNIA 3KLFA 2DPIA 2JEJA 3QO9B 4NYZA 1C1BA 3MECB 4MKAA 1JLAA 2HNYA 5C24B 2YKMB 4EBEA 2D41A 3CJ4A 1IM4A 1C1CA 2YNGB 3DMJA 3M8QA 1MMLA 1JLQB 2BE2A 4H54A 5KFQA 4K4TA 2XI2A 2FVSA 2O5DA 3V81A 1RYSA 2GIQA 5HROB 4O3SA 3PJXA 1LWCA 1D1UA 1KLMB 2IAJB 4URSA 3DM2A 5KFKA 4WXWA 5KG4A 1UWBA 3C6TB 1FKPA 1ZETA 2OPPA 4ID5A 5J2MA 4JV1A 3LP2A 5JXSA 2ASLA 1XR5A 1TL3A 2C2RA 1FK9A 3KHHA 3MEDB 4DL7A 1RT7A 2RKIB 4EBDA 3V4IB 4KAIA 5KG7A 4B3OA 1IKYA 4WXOA 2RKIA 2GC8A 2W7PA 4J9QA 4ED1A 4ZP8A 3MEDA 4QWDA 3N6LA 4IFVB 4IOBA 4ZPCA 3NGDA 4O4GB 1S1XA 2OH2A 2R8GA 1TQLA 2HNZB 4RW4A 1S6PA 1SH0A 2YNHA 1VRUB 3LP2B 5J2PA 2C28A 3MR2A 1FKPB 5HBMA 5HP1B 2FJWA 3N6NA 1HQUB 2IC3A 1T05A 1LW0A 5KFBA 4NRTA 3OLAA 2R8IA 4LQ3A 3RAXA 1LWCB 4JUZA 4KKOB 1IKWB 5KFFA 1S0OA 3DLGA 3TAMA 1YVFA 3OL6A 4ICLA 1VRTA 5KFNA 4Q43A 3BSOA 1JLQA 2BE2B 4ZPDA 1C1CB 3DMJB 1S97A 2AX0A 5DGBA 2YKMA 4RW7B 5HLFB 3MR5A 1JLBA 4RW8A 5KT2A 1RT2B 3CVKA 1IKVA 1DTQA 2IJNA 3JSMA 3PW7A 3KLFB 2IMWP 3DDKA 1SUQA 3DRSA 5F8JA 3KK1B 2OPQA 3IS9A 5KT3A 3KLEB 2HMIB 2IJFA 1T94A 4EO8A 3KLIB 3KJVB 3IGVA 4MH8A 3GILA 3UDLA 3GQCA 4YR0A 4WFYA 4RNOA 3NMAA 5KG5A 4J9LA 4JV2A 3BGRB 4IDKB 1T3NA 4LQ9A 4GC6A 3IGNA 3MEEA 3E01B 4NLDA 4R8UB 4RUCA 3PW0A 4H4MA 3IG1A 1RT4A 1JLFA 3T5KA 4M95A 2XGPA 5JUMA 1WNEA 2E9RX 5KG0A 4K4WA 2B5JB 2D3UA 1S10A 4WZMA 3H40A 3I0SA 4EBCA 1LWEB 4J9SA 5D3GB 1EP4B 4G1QA 5CYMB 4MIAA 4WYWA 4KV8A 4ZVGA 5KFYA 3V6HA 1EETA 3DYAB 3IG1B 2I1RA 4R5PA 1JXLA 2W9CB 1R0AA 2JLEA 1LW2A 4ZHRA 1C0TB 3BSNA 3QGGA 4DG1A 3CJ2A 3OLBA 2JC1A 4WE1B 3PW2A 3HVWA 3TQ1A 3SFUA 5K14B 4I2QB 4PUOA 2OPRA 1S1VA 3QLHA 1RT1A 3BSAA 4QWEA 3DLKB 4K4YA 3ITHA 4ZP6A 1HQEB 5DG9A 1N4LA 3KK1A 1SUQB 5DLGA 4NLVA 5KG1A 2J6UA 2B6AB 3D28A 4LSNB 2YKNB 1TKTA 3HHKA 3IRXA 3LALA 5F8NA 1VRTB 5KFTA 1RTDA 5KT6A 3TAMB 3QIPB 1DLOB 5KFEA 1IKWA 4JV0A 1SH3A 1BQMA 1RT3B 3KLVA 1JX4A 1JLEB 1Z4UA 4NLXA 4MK7A 5I3UB 4TXSA 4YQWA 1N6QB 1T05B 2D7SA 2ZKUA 3NKYA 4Y3CA 3PJWA 4Q45A 4ED0A 1NNDA 4LSLB 3DRRA 2JEIA 4J9RA 4KHRA 3PW5A 5I3UA 1HNVA 4WYLA 2IM1A 3UR0A 3HVTB 1T03A 3MF5A 1RT3A 2VA3A 3RB3A 4IRKA 3G86A 5CYQA 3TVKA 1RTDB 2BANA 2D3ZA 2CJQA 2BQ3A 4PWDA 2RDIA 4K4VA 1RT7B 2V4QA 3PW4A 5L1LA 4ZPAA 2YKNA 4LSNA 2XI3A 3GIJA 1S1TA 2FVRA 1S9EA 3CJ0A 3MFHA 2VA2A 3UPFA 1JKHB 2AGOA 4MKBA 4ID5B 1K1SA 4IRDA 4K4XA 2ASDA 4ZVEA 5KFRA 1HQEA 4HYKA 2CKWA 4FBTA 3I0RB 3QLHB 1S1UB 2WHOA 2OPRB 3DOLB 3E51A 5KFHA 1TVRB 5K14A 3H2LA 3OHBA 4NRUA 3FQLA 5F9NA 3G6XA 4ECWA 3T5HA 4WE1A 1TKXA 5KG2A 4YMEA 3KHLA 4QW9A 1FKOA 3C6UB 3Q8QB 4DEZA 2RDJA 2UVVA 1JIHA 1R0AB 2W9CA 2HNYB 2XCPA 4R5PB 2BQRA 3MECA 4F4WA 4O3RA 4EYIB 3MFIA 3M9NB 3V6DA 3EZUA 4KO0A 1EP4A 5D3GA 4H4OA 4ED6A 3I0SB 2UVWA 3FDSA 4ZVFA 2EC0A 1RDRA 4ECRA 3H4DA 1JLFB 4H4MB 4NLPA 3MEEB 1KHWA 4I2PA 2WK4A 1S1WA 1CSJA 5KFJA 2FVPA 2VG7B 3RBDA 2HAIA 3M8PA 2OPSA 4RNHA 4ZPBA 4IG0B 2ZD1A 4RNNA 2JEGA 4G3IA 3SFGA 5F8LA 4MK8A 3N6MA 5C25B 4H4OB 1QUVA 4IH5A 1C2PA 2OPQB 3IS9B 4KO0B 3KLEA 1BQNA 3V6DB 4IG3A 1MU2A 4RW6A 4HKQA 4QW8A 1S6QA 4O3NA 2R8KA 3QGHA 2WONB 2WOMB 1IKVB 1DTQB 5KFCA 3HKWA 3JSMB 1N48A 1JLBB 3LP0A 4O3OA 3BQ0A 4I7FB 5KFOA 1N56A 4X2BA 5I42A 3RB0A 4IH6A 1TKXB 2UUTA 4ICLB 3DLGB 5KFAA 2HWIA 4ZVHA 4ECUA 1S1UA 2R8HA 4OL8A 2V0NA 2I5JB 3I0RA 3RB4A 1LW0B 3LAMA 2E9TA 3NBPA 3EPIA 1VRUA 4NLUA 1RT6B 1S48A 4KE5A 5KFGA 2HNZA 3I5CA 1JKHA 4RW4B 5KFSA 1S1XB 4O4GA 5J2PB 1S49A 1S1TB 1S9FA 4NLTA 1XR6A 4IFVA 2C2EA 1LWFA 1D0EA 5KFPA 1S0NA 4ECVA 3VQSA 5KFDA 2W8LA 3KHRA 4O44B 3CWJA 3ISNC 4URGA 3PR5B 4F4ZA 4ECYA 3RAQA 1TKZB 4IFYA 3H59A 1DTTA 4XPEA 5CYQB 3V4IA 4K4SA 3PR4A 1RTHB 2WTFA 3HVTA 5KFLA 4FS2A 4ED7A 5KT7A 2R8JA 4MFBB 1S4FA 2HWHA 1FK9B 1IKXA 5F8HA 4RW9A 3Q8SB 5F8IA 2E9ZA 3I5BA 2J6SA 1HPZA 1RA7A 4QWAA 4QPXA 2AGQA 1UWBB 2ILYA 3C6TA 3CJ5A 4TLRA 3KLGA 3DM2B 4MIBA 3LP1B 4RZRA 2VG5B 3T1AA 5FDLA 1HMVB 5HROA 5DGAA 2F8EX 1DLOA 3KK3A 3SI8A 3H5YA 1NHVA 3KK3B 1JLGB 2IM2A 2UVRA 2B43A 1HMVA 5FDLB 1S0MA 1TKTB 1JLCB 2FVQA 4U7CA 5C24A 3PVXA 4J9NA 4IR1A 3CDWA 2B6AA 3QO9A 5DG7A 2UVUA 3MEGA 3FRZA 2YNIB 1HPZB 5EUHA 5J1EB 1QAJA 4ED8A 2IBKA 5L9XA 3H5SA 4NLWA 2AX1A 3HVAA 3ITHB 3DI6B 2R2TA 4F4XA 3DLKA 4MFBA 3FSIA 4KFBB 4NCGB 2W9BA 4TY8A 1QE1A 4PUOB 4TY9A 1DTTB 4RNFA 1OS5A 5KFZA 4NLSA 3BSCA 3V6KA 1C0TA 3BREA 2C2DA 2YNFA 3H5UA 1C0UB 1EETB 2AWZA 3DYAA 3QGIA 4KSEB 1TP7A 3T5LA 4O3PA 5DLFA 2ATLA 3NAIA 3GV7B 5EWEA 1K1QA 1TV6A 3NBPB 3UQSA 3LAKA 4G1QB 3Q8PB 3OSPA 2V9WA 5F8MA 1LWEA 5J2QB 3G6VA 3H4BA 3T5JA 1RAJA 2I5JA 2XWYA 3GIMA 2IM0A 4DL6A 3Q8RB 4EYHB 1RT4B 5KFWA 3NAHA 3KK2B 1J5OA 1HNIB 4R8UA 2XC9A 1SV5B 2AGPA 1NHUA 4Y2AA 3BGRA 1REVB 1RTIA 3CDEA 3LP0B 4IDKA 4QWBA 5L1KA 2WOMA 5J2NB 3V6JA 4URQU 5DQGA 3CDUA 1S6QB 4PQUB 4ECSA 1MU2B 4IG3B 4RW6B 3KLIA 3KJVA 1XR7A 4NLQA 2HMIA 3ISND 3OL8A 2XCAA 4RUAA 3NL0A 4YP3A 1RT5A 4K4UA 5J2NA 1RT2A 4RW8B 3DRPB 3M8PB 2V4RA 3BR9A 5HLFA 4RW7A 4ED2A 3GYNA 5KG6A 2IA6A 1GX5A 1SV5A 4NLYA 4GC7A 4I2PB 1GX6A 4Y2CA 3G6YA 4Q8FA 3KLHB 3KK2A 4KKOA 2ASJA 1J5OB 4R0EA 4O3QA 3DOKA 2W9AA 3MR6A 4IR9A 3KHGA 5J2QA 2IC3B 1HQUA 3JYTB 2RF2B 3BQ1A 3QZ7A 5HBMB 5HP1A 1TL1B 4QWCA 3RB6A 4NLGA 4ECXA 3LANA 3H98A 2XGQA 1S6PB 2YNHB 3MTKA 1S9GA 3PHEA 1C0UA 2HNDA 5KT4A 4Q0BA 4IKAA 2VG6A 2J6TA 4FS1A 3GV5B 5F9LA 3C6UA 1FKOB 1QAIA 4DL2A 2AQ4A 1IKYB 4ED3A 4B3OB 1N5YA 1TVRA 4J9PA 4TY8B 2JC0A 4TYBA 3DOLA 5T14A 4DL3A 2QV6A 2FJXA 3D5MA 2WB4A 4TQRA 3QZ8A 3GV8B 4J9KA 4ECQA 1TL3B 2FLNA 5J1EA 3RBEA 3KOAA 3MEGB 4IQXA 2OPPB 5J2MB 5KFMA 4WFZA 1S9EB 2QE5A 4YR3A 3OSNA 1JLCA 1KLMA 2IAJA 4ZMMA 2W8KA 2JEFA 4PWDB 3CIZA 2BANB 1N5YB 1JLGA 4TN2A 3V81B 3BQ2A 1W25A 3FQKA 2AU0A 1T03B 2VG5A 2YNGA 3LP1A 1HNVB 3M8QB 4NLRA 4Y34A 3OL7A 2VG6B 3KLGB 3CJ3A 1JLAB 4Q0BB 2HNDB 1C1BB 3DRRB 1S9GB 4KB7A 4IRCA 1U09A 4LSLA 5C42B 5EWFA 4ZP7A 2W7OA 1TL1A 2RF2A 3JYTA 1RTJA 1IKXB 4RW9B 2R2RA 2R2UA 1N6QA 5L1JA 2IM3A 3DOKB 1JLEA 4ECZA 1RTHA 1BQMB 2R2SA 4EO6A 4NZ0A 3QIPA 3KLHA 1TKZA 4IFYB 5KFIA 5DQIA 1HYSB 4O44A 3QYYA 3IRXB 2BR0A 2FLLA 4K4ZA 3KNAA 3KMQA 2BQUA 1LWFB 4ZP9A 3DRPA 5F8GA 2WRMA 3FFIB 1RT6A 1RT5B 2UUWA 3DLEB 4J9MA 1KHVA 2ILZA 4KHMA 5L1IA 4WFXA 5EDWA 3M9OB 1RT1B 2FLPA 3OL9A 4DL5A 3PZPA 1S1VB 4TYAA 4RU9A 5KFVA 3OHAA 3BJYA 4PQUA 4I2QA 2ZE2A
chains in the Genus database with same CATH superfamily
1UETA 2LLZA 4J7CA 1NK7A 1J2VA 3QIDA 1QY7A 3FCVA 4R0JA 1DHMA 1VQPS 2FJVA 4WWSA 3VAFA 1EQ0A 4PG5A 2WZ1A 4DG1B 2GJFA 3TJAA 1ZTTA 4F4YA 4I7FA 4WBFA 1Q5YA 4NZ7A 5A6WA 4U6PA 1HNIA 2QJ3A 3HKZD 1U0HB 1NSQA 2ZE2B 5G0RA 4DPWA 3I5AA 1M1GA 4FYVB 2QLXA 1YJNS 1R6VA 4B3MF 4NZ6A 3OFFA 3VGTA 4RBVA 2GQ2A 2XMJA 1K0VA 4ED5A 4R25A 5FLXY 2V34A 1TV6B 1FXDA 3GIIA 1YGYA 2WB1D 5DO2A 2DRDA 4RNMA 1NXIA 4PCQA 2F4VJ 2CVIA 4CCHA 2VOOA 2YNFB 3KG1A 2BJDA 2CPFA 2BJ3A 4X4PA 2ROGA 4C48A 1UJ4A 4WU2A 3HHLA 1XQIA 1S0VA 3EUNA 3DNCA 2M52A 4G65A 1HYSA 1T9VA 1QE1B 2A18A 3HP6A 4KFBA 4NCGA 3GCXP 2GVZB 5A8RA 2PO4A 2NYHA 2NYIA 3DI6A 3AX5A 1ELOA 2BW7A 4TQSA 3EPGA 4DPUA 2RDDA 4S0MA 3KG4A 4MK9A 3AY0A 2K7JA 3J7YU 5C42A 3KLFA 5ITHA 4X66F 2DNNA 4N56A 2XMMA 4NYZA 3MECB 1UVLA 1Y10A 2FJAB 2DGVA 5AT1B 4P72A 2EFPA 1HL6A 1Z2LA 4A4JA 1C1CA 2YNGB 4L76A 1RWMB 1M90T 1JLQB 2BE2A 2CPDA 1YRUA 3HLUA 3Q8YA 4LBPA 3RBXA 2RQMA 4YHHF 2GIQA 4F0MA 1D1UA 2HVDA 3FBEA 3CCLS 1GT8A 2Y8WA 4WXWA 5GAEI 3MAAA 3NMRA 3V4MA 2DHAA 2HZAA 1U2FA 3C6TB 4DX5A 3HO1A 2QZ8A 4N5SA 2PEBA 5A2QY 1P8GA 5E33A 1CEZA 4IYQA 3AX3A 2KU7A 2DXEA 4ZLPA 2MGZA 1RT7A 5LT5A 1VQ7S 4EBDA 5LMUJ 4QCLA 4FF4A 4M5MA 2C2ZB 3A8JA 4WP8A 4DR1J 1TFWA 1UCNA 4B3OA 3G2XA 4OYWA 4WKYA 2AYBA 2UUAJ 1NSPA 4DUZF 2HEKA 2J7KA 4U8YA 1S72S 3MEDA 3PRBA 1RBAA 3QRPA 1AW0A 4IOBA 2XG8A 3FJ2A 4RUHA 1TAUA 3RU0A 4O4GB 1S1XA 2DHXA 3HFVA 2R8GA 2DXDA 2HNZB 3CW2C 2CNKB 2NPIA 4RW4A 3OXLA 3MR2A 1FKPB 5DM6Q 4ECVA 2M0GB 3N6NA 2HFNA 2IC3A 4AL6A 4CYUB 1CJVB 1NJWA 2DGSA 3AQPA 4JI8F 3BH7B 4CLSA 2GV1A 4OI4A 1LEOA 1Y7PA 5E5NA 4JUZA 1TUVA 3L7PA 5KFFA 1S0OA 1BWEA 3Q2SC 2OD4A 5AXLA 4DR4J 2XZDB 3OL6A 3VVUA 4P7VA 1VRTA 1Q8BA 3M6UA 3BSOA 2OFGX 4Q43A 4ZPDA 3I4HX 1TU0B 1X31C 4Y2MA 2ZHBA 2AX0A 2YKMA 4FNIA 4ZPTR 4RW8A 5F3ZA 5KT2A 4TU7A 4XK8C 2V69A 5T7LA 1U6BA 1WG5A 1BXNA 2F4VF 4LFCJ 1RAFB 5E41A 2DY9A 5B0EA 5ETNA 3CT9A 2IJFA 3BGLA 3KJVB 4MH8A 2G2OA 2MEWA 1N36J 3UDLA 1RISA 3LH2S 2R7SA 1KRPA 2NZ4A 4F7VA 3I82A 1AB8A 2HSEB 2GIFA 2DNMA 4DR7J 1Q86T 4K5RA 2H51B 2MQLA 2UXBJ 2HHPA 3IGNA 3NLCA 4NLDA 1K0TA 2KDOA 3W7BA 1R8PA 2OP5A 3FMWA 2XNRA 1IN0A 1VGYA 2XS5A 4JYAJ 3MMBA 4YB5A 2YY3A 2E9RX 2QFIA 3CCWA 2B5JB 2MZSA 2YX4A 5KG0A 1AFJA 2IHR1 4WZMA 2PFDA 1WACA 4I64A 4OYAA 4ZK7M 2D74B 1FRIA 2HURA 3AJDA 5HMXA 2KM8B 4A8QA 5CYMB 4MIAA 5J1PA 2FHJA 1IM6A 4KV8A 1LFPA 5KFYA 4PYAA 3V6HA 3L95X 5IWAJ 1FVQA 3NS6A 1YJUA 3ENQA 1A6LA 1NDPA 1VQYA 2JC1A 4C3LA 4FYDA 4YB6A 1FD2A 1Q8KA 2HRYA 3F44A 3TANA 1IVZA 2BZ2A 2JVOA 4I2QB 1FNXH 4ZVPB 4Z2XA 1ZM3A 1NUEA 1S79A 1NDLA 4EK2A 4QWEA 3VGVA 1OO0B 2WSFC 2VFSA 1HWIA 2HBRB 2J7UA 3RUBL 1FRJA 1RWNB 4LREA 1BLUA 3QRQA 8ATCB 1SUQB 1MMNA 3P49B 1Z1ZA 1ZH5A 4ETXA 2K7KA 2KT2A 3EVWA 3LF0A 1HLWA 1X8DA 4LSNB 2YKNB 4OJ1A 5D4LA 1TKTA 1HNXF 2DY1A 1VQ9S 8AT1B 1V3ZA 4C8YA 1TL7B 3D67A 1VRTB 4F25A 4DUZJ 1RTDA 4OX9J 1OY8A 3W2VB 5KT6A 1DLOB 5KFEA 2J0SD 1JX4A 3CJKB 1JLEB 3D66A 5GAGU 5MAOA 3JQMA 2V2QA 2CQ4A 3MEKA 3HSDA 3PJWA 2GHWA 1FD8A 3A8KA 2MHEA 2A1BA 3EDQB 4AFFA 1NNDA 5BR8J 3OTOJ 2FLOA 4ZLLA 3MM8B 4W98A 1XNQJ 2H54B 5JVGQ 3T1YJ 1AXQA 3W5XA 2OJ3A 3D3CJ 3Q8UA 4KHRA 3O2IA 4I67A 4KRWA 3BGOP 3FRYA 1H2TZ 4L6V3 2IM1A 1WF2A 1MW7A 2W2MP 1NKBA 3RB3A 3J7A1 3TVKA 3HFKA 2DH7A 1HWUA 4A8OA 2BANA 2BQ3A 2CJQA 3M32B 1IXKA 2RDIA 1RT7B 3IBWA 4AQYF 2F9DA 3PW4A 4X65J 3TA1A 2YKNA 1B0VA 3UD4P 2V8VA 2N7YA 2HZCA 2VA2A 3MFHA 2J0QD 4MKBA 2CXEA 3GJTB 4P75A 4ID5B 1R8HA 3RJMB 3ULHA 2YWKA 2MLYA 4DCPB 5ETTA 4ZVEA 5IT0A 4HYKA 4IO9Q 2UP1A 1AFIA 2FJEB 4L3NA 1CVJA 2WHOA 2OPRB 3QNWB 2CJXB 5SZTA 4WP9A 3Q86A 3H2LA 1YJVA 3OHBA 4C3KA 4HT7A 1TMJA 1PC5A 5F9NA 3CD6S 3PX0A 4AD6A 4K5SA 4C9DA 2Z56B 3E8OA 3SCJE 4DR3F 3R5GA 1TK8A 1Q1KA 4C6AA 2GVDA 4QW9A 1X60A 2DBBA 1NK6A 1YI2S 2XSJB 2W9CA 1Y0HA 5KG3A 5BJRA 4F4WA 4C8KA 1SC6A 1HNXJ 3P6YC 2BV3A 3IM9A 2HG4A 4KO0A 3OFEA 4F67A 1G2EA 1HBNB 2VQEF 2UVWA 2B4OA 1F9FA 4B02A 3M6XA 1HA1A 2EC0A 3T41A 4DPXA 2AHOB 1UTAA 1YDLA 5JMNA 3VAHA 1T9XA 3DLJA 4H4MB 3WIVA 2FTRA 4I2PA 3MEEB 3DU6A 1S1WA 2DD8S 4BWJA 1ZM4A 1NK5A 3UN2A 2HAIA 2FQQB 4ELTA 3EMTA 3UN3A 4ALZA 3RRHA 1SKSA 1X9WA 1YHQS 2AYMA 5L38A 2ZD1A 1N33J 1H2VZ 4OI2A 1MMDA 1O5JA 2MSSA 4Y2IA 1OSDA 2NLWA 3IS9B 1T11A 4HKQA 2DITA 3ZZOA 3V6DB 2PIIA 2YWHA 1YBAA 3UN5A 2QMXA 4OZ3A 1S6QA 2QL9B 4RBTA 3HKWA 1G6BA 2QN6B 1F9EB 2GO8A 3VAIA 4I7FB 5KFOA 4BLGA 2Z57B 5I42A 5H9EJ 4IH6A 2CZVC 4USWA 2NUHA 1UKUA 2ZH5A 4KJIA 3DLGB 3CJRA 4DWIA 2VASA 2AF6A 3KDOA 2HWIA 1WTBA 1SJFA 3PYDA 1S1UA 4PYDA 4YEAA 2V0NA 4I6AA 5HJXA 4DV2F 3I0RA 4CYUA 3LAMA 4DV6J 3T5KA 5GMDA 3WC0A 4XTTA 3FK4A 2J9DE 4F4AA 5A76A 3TZZA 1KVKA 2E1AA 4LF2A 1VRUA 1RT6B 2RU9A 2M2BA 5CH7B 4LF6J 4M5GA 5J2PB 2FZKB 2IFXA 3IP0A 1M5VC 3PG9A 1FNMA 1LWFA 2DYAA 1CULA 4OYMA 3RG6A 5HVHA 1L3SA 3MPDA 2UU9F 1RGVA 1UEKA 5KFDA 1SL2A 1IBKF 3QMQA 4O44B 4DR4F 2CJBA 2U2FA 1SQEA 4OX6A 4F4ZA 1B0PA 4XPEA 3V4IA 4A8FA 5CYQB 3W64A 2ZH4A 4ZVUB 1GXUA 5CD4H 2DNYA 1AZSA 2MKKA 2HWHA 3U7JA 3M2UB 1JJHA 4YOEA 3K5OA 4UOHA 1S59A 2V2VA 3GE9A 3PO5A 2ZBPA 3TEGA 2UXCF 1HPZA 1KFDA 2Z2ZA 3MDFA 3PYEA 3UNYA 4QPXA 4QWAA 1IR1A 3C6TA 1WKJA 4TLRA 1WUUA 2H3EB 2KVQE 3MAAB 2W2NP 1U24A 2DGXA 1VISA 3DM2B 4GO5X 4J9VA 3KLGA 2IBOA 1TK0A 1HMVB 5BYSA 2DGUA 4JI5F 3AHPA 4UTGA 3ZZ0A 1FRLA 4UZCA 4AXJA 3KK3A 1NHVA 3QT8A 4C7QA 2GCFA 2BOAA 1S0MA 2XLJA 1ZZFA 1TKTB 4DV1J 1IQZA 1NHKL 1RAAB 4CI0B 4OZJA 4J9NA 3PVXA 1RUSA 2Z30B 5DM7Q 2PE8A 2GX8A 3W62A 2G4BA 2Y9HA 4B3RF 3SV3A 3MEGA 5EUHA 1KQKA 1HPZB 2C2KB 1RHRB 2BKPA 5L9XA 1KOOA 4NLWA 2I8EA 1U45A 3DI6B 2DT9A 4Z7YA 2Z8QA 2OEKA 2VD3A 2AZ3A 1YK9A 2OTJS 3HHLD 2Z2MA 3ENVA 1QE1A 2JFKA 3V5RA 1FTRA 2JJ4D 4K59A 3HF5A 3MURP 2C2NA 2DEJA 1VQKS 2F63A 3K17A 2CAJA 3SXLA 4CLFA 2YWEA 3PXGa 3D3BJ 3D0GE 2Z2LA 2N82B 1UA0A 1BE4A 2L9NA 1IR2A 4P73A 1KNZA 1VIXA 3T5LA 1EETB 1P6TA 3DYAA 1PYOB 3QGIA 1TP7A 3MCOA 4KSEB 2PMWA 4USTA 3NAIA 3PDNA 3MPUB 1SXLA 3HT3A 5EWEA 1T95A 1TV6A 1F60B 3B6BA 3QGPA 3Q8PB 2EW9A 1H98A 4DX7A 1FE4A 2YX7A 2HS4A 3JB9k 2VQFF 4V19J 2IM0A 4DL6A 4L75A 3DOMB 4CTAA 3Q8RB 4LRFA 1U0HA 2RMLA 4ZJQA 3BDEA 4R8UA 4OYPA 4MYTA 1FXLA 4YS2A 1CC8A 2AGPA 3K0JA 2BJ8A 3DHXA 4QWBA 2Y0SD 3LP0B 4M5LA 2KXNB 1HNZF 3N5BA 2FHMA 3GFYA 3NEKA 3R3TA 1UFLA 3V6JA 2XY7A 4PQUB 3H25A 4F0KA 4OI0A 4RW6B 1ZS6A 3AD9C 3KJVA 2YTCA 1XR7A 1FRXA 2ZOMA 3RRKA 3SIPB 5CXTA 5CQGA 1S7HA 3EX7B 2BOPA 3MMAB 3H2UB 2HMIA 3ZZRA 2LEAA 4OIXA 4RUAA 2C1EB 1RT5A 4CQ1A 2B9XA 2ZWPA 3G9CA 1RT2A 1RWXB 1LQ9A 2VBXA 3C19A 3DRPB 2V1TA 3CEDA 4KGZB 4P2XA 4RW7A 4CH0S 5GAHI 4ED2A 1NCLA 1WELA 4NA2A 5T41A 4AYBD 2KH9A 5D4NA 2IA6A 3TI0A 3M2VA 2D69A 3DDNA 4XDDA 3S6EA 4WIQA 1WDTA 5B0CA 3G6YA 3KLHB 3HJFA 4OJGA 3OQ2A 1J5OB 2HQIA 4R0EA 4CTAB 2MZTA 2P6SA 3DOKA 1DJ0A 2AYEA 2W24A 5B0AA 3MR6A 2IC3B 4V19X 2ZOGA 2MLZA 5LL6d 2ZH2A 2ERRA 1PGZA 4DR2F 2Y1LB 4ZVTB 1S6PB 2YNHB 3MTKA 4DX6A 3F0NA 1HD1A 3IM8A 1XIQA 3TNVA 3G96A 2HVHA 2RQKA 2YPYA 3CB4A 3O3LA 5F9LA 3OVAA 4FNHA 4NI2A 3WC2A 1XEZA 4FYWB 2RUSA 3NGRA 4I4BA 1TKDA 1BMQB 3H42A 3SCIE 3R5DA 5K8PA 3GJRB 1U6FA 1NDCA 4TY8B 2N4DA 3BO4A 4OZLA 3CDAA 3VAJA 3VAGA 2WB4A 5A8WB 1M0SA 4TQRA 3UD5A 2FJXA 2I6WA 3QZ8A 2UXCJ 1SKWA 4W92B 3H8YA 4WK1A 3RBEA 1PYSB 4LT6A 1HQ2A 3NXZA 5J2MB 1DRZA 2LQ9A 1UA1A 1UVKA 2BE7D 2NSBA 4YR3A 2KJWA 4O23A 3HK2A 1JLCA 1RWOB 3Q89A 2ATLA 2LDYA 2MKYA 3DRYA 4HH0A 5CD4A 1FJGJ 2N7CA 3TAPA 4ELVA 5HO4A 1N5YB 3V81B 2HHXA 4DV1F 5F3TA 1W25A 3FQKA 4DR3J 2CDQA 1R31A 2VBZA 5HQ8A 1U2RA 2J5AA 2YNGA 3LP1A 2XMKA 1VC6A 2Q3PA 2A10A 3KLGB 4F2SA 1F3VA 1JLAB 2L9WA 1KTVA 3QATA 4LSLA 1SL0A 4ZP7A 2RS2A 4PABA 3UFCX 2W7OA 1Q5VA 3D54A 4J90A 2RF2A 1KDNA 4NEYA 1IKXB 4RW9B 4ZOSA 2R2UA 3MOJB 3ZZYA 2DO4A 4P6QA 5CZVA 3R7NB 2CWKA 2IM3A 4PR6A 4OYZA 3Q23A 4X62J 4NZ0A 2XMAA 5IV3A 5DQIA 5ETVA 2E5IA 5GAEU 4U9RA 3FCHA 2RUGA 5EX3A 2FLLA 4K4ZA 2BM1A 2YX1A 1CULB 2OI2A 3OFHA 2DISA 2RILA 3HJVA 3DRPA 3WBZA 5F8GA 1XBWA 4M5IA 1KVJA 1GTHA 2UUWA 4LF4F 9ATCB 2ZKTA 3HZGA 3IA0A 4NA1A 4U8VA 2ILZA 3VR1A 1R0CB 4Q2MA 2VPYB 3WDOA 3WX4A 3VAMA 5EN1A 5EDWA 3GONA 3BYRA 4PXCA 4DL5A 1W26A 2PN6A 4RU9A 2Q79A 3OHAA 3G8SA 2HPUA 4IUFA 4PQUA 4RNNA 2J9CA 2ZE2A 3EGNA 5G0RB 3Q8VA 4JI7J 5AE3A 2P5VA 1ZTWA 1RTIB 1REVA 4DSKA 3JS9A 1VLYA 6FDRA 1L3KA 2D3OR 4Q7AA 1U1RA 1LW2B 1FJ7A 2DIVA 4UF4A 1UVIA 3T19A 3EXCX 3A12A 3CO9A 3GYGA 4ECTA 4GVLA 4B17A 2ALZA 5GVQA 3SCLE 2DNQA 3J81j 4DR7F 4KV8B 1TUWA 2V2ZA 2VPXB 3W3SA 3IO1A 5CYMA 4NMLA 1WHXA 4KBIA 1HARA 2ZH8A 1I94J 5C5JA 5C25A 4KHPF 3HSJA 3DLEA 4XO0A 3HM9A 1NO8A 4IH7A 3BPSP 2AJ4A 2AJQA 1JXEA 3NCPA 4P74A 4F50A 1WJ9A 3LO3A 3GTYX 2DPJA 3MAHA 1KS2A 3BN4A 1E6YB 3E01A 4EI2A 4LF1A 2EPIA 2DGTA 3W2WA 3GIKA 1VBXA 5EWGA 4XPCA 4LRCA 4PG4A 1IR0A 1WORA 1BUXA 4ES3A 2DTJA 2W9BB 3HX9A 5EX0A 1FDDA 4M5HA 3RR7A 4DV7F 4N8NA 3U1NA 2RSQA 2NSCA 1OPZA 3C2PA 4O4RA 4CO5A 4X64J 5KT5A 4KTQA 1OM2A 1MLAA 2CPIA 2M3DA 1RZMA 2YNIA 2C3YA 2KO1A 1P9YA 2PT0A 1KP6A 3QO9B 5IC4B 3CCJS 2DPIA 2XS7A 3GWCA 2HNYA 4EBEA 2YKMB 2UXDJ 1TTHB 3CJ4A 2HW3A 2BKOA 5D8HB 4A46A 3M8QA 3U02A 2MQOA 3GYXB 5KFQA 3BO2A 1NKCA 3NOGA 2RIJA 4K4TA 4M5KA 2XI2A 1FJCA 1YLXA 2FB0A 3HD2A 3MM9B 1SBRA 2XULA 3PJXA 1LWCA 5IC6B 1Q81T 2DR7A 5HQMA 4ZN3A 2KT3A 5K9FA 3P8BB 4OHZA 4RLEA 2YWGA 3SDEA 5KG4A 3CXCR 4UUWA 1UWBA 3EJMA 1K44A 4F26A 3HCXA 1R7IA 4YY3F 2PA3A 4DCOB 2X1AA 4UW2A 5JXSA 1CJTB 1TL5A 4HHUA 1L3UA 4DQPA 3R2CJ 2HFUA 1MWQA 2C2RA 2G9OA 2VC0A 5A8WA 4JI4F 3MEDB 2WVBA 3J80Y 1GH8A 4LF7F 4ID8A 3UD3P 1IKYA 5B0GA 4NWBA 4X4OA 4WXOA 4USUA 2RKIA 4BWMA 5HN0A 5L9NA 2W7PA 3MR7A 1HHQA 3NWRA 2DGQA 2J9DA 3L09A 1SJ3P 2OH2A 3F56A 3O6QA 1TQLA 5J2PA 9RUBA 1S6PA 1SH0A 2YNHA 4C2MA 4DSEA 2C28A 5LMNF 2KHDA 2MJNA 4OLPA 1M5PC 1H74A 2DNGA 1V3SA 1NZAA 4ZA1A 1G4CA 1HQUB 5C2GA 3KJQB 2FJWA 3MOZA 2H65B 4NRTA 2MKIA 3M8RA 4FP9A 4DPOA 4RL1A 5D0EA 3SQGB 3RAXA 4JI1F 7FDRA 1LWCB 3SMZA 5CCMA 5IFMA 4I6YA 1X5OA 2ZC4A 1IKWB 2JOQA 1XMQF 1KR4A 3DLGA 3B4MA 2ZEJA 4HL9A 1YVFA 1WHYA 3TAMA 5HQLA 3NY0A 2JHEA 5KFNA 1NBEB 4N76A 1KVIA 4OI6A 5D0RA 4RU2A 4LF8F 2YVSA 3DMJB 5AE1A 1VJQA 4LFBF 3TX8A 4I56A 4JI3J 3TQEA 4DQRA 5HLFB 3MR5A 1JLBA 3ET6A 2B3TB 1IKVA 2IJNA 3IXQA 2PA8D 3TUIC 1WC5A 2O01C 3IRWP 3JSMA 2IMWP 3N5FA 2FHKA 2KN4A 3FEZA 3KLEB 1FRMA 2F8MA 3IGVA 4AQYJ 1CJUA 3ETOA 1N5VA 1JJ2R 4WFYA 3NMAA 4F2RA 4A8SA 4JV2A 2RNEA 3THTA 1EQMA 2OEMA 2VFRA 3P45B 5LSOA 1M5OC 4PAAA 1X0FA 4A48A 1AROP 4ELUA 5F0WA 3MEEA 4USMA 4R8UB 4DV5F 2XQCA 2FY8A 1T8EA 2AJ2A 2CJKA 4FVMA 5JUMA 1X4BA 3K5LA 4K4WA 1S10A 3EGZA 3OFGA 1MSWD 1D9DA 3I0SA 4NOHA 1I3OB 1LWEB 4ETZA 4J9SA 1SVDA 1EP4B 2MSTA 4G1QA 4NPOA 4OX7A 5RUBA 5D3GB 4RPFA 1HNWJ 4ZVGA 3RZAA 1OQ3A 1P27B 4Y00A 2QT7A 4HTIA 4FXWA 5B09A 1HI8A 1MWYA 2A2DA 4PWWA 2XSJA 4W4MA 4CO0A 3C8YA 2JLEA 1RAGB 3MM5A 1LW2A 2W9CB 1C0TB 1HR0J 4JYAF 1NPRA 4DG1A 3OLBA 3PW2A 4WE1B 1IWGA 5K8MA 1UUJA 2RQCA 2ZOFA 1WG1A 3TQ1A 3AD8C 3SFUA 5K14B 3NCQA 1NH8A 2VBWA 5ETOA 3AAWB 1XMOJ 3J80U 4DV0J 1S1VA 3MCSA 1NK9A 1CJUB 3U1LA 3BSAA 2G2ZA 3DLKB 4ZCKA 2PEHA 2QA4G 4K4YA 3MXHP 1YITS 1NMEB 2XSFA 1U1LA 5DLGA 2LP4A 2KJVA 4QU6A 1Q0NA 5KG1A 2B6AB 3O8WA 5H9FJ 4DZDA 1U1OA 1ZAVA 4KGXB 2KVIA 2VPWB 3ILJA 4PG6A 3E3XA 4YFUA 5F8NA 3PV8A 1HKAA 1NSAA 3HT0A 3BS9A 5DRKA 3RAMA 3TAMB 3TO8A 6FD1A 1B7FA 4JV0A 3B4DA 1SH3A 3N4WA 2DNLA 4XDCA 2CZ9A 4WK3A 3SQGA 3PYGA 1CJVA 1PILA 2GMJA 3EICA 1MROB 3NKYA 4Y3CA 3H20A 4YN3B 2WVEA 2CVEA 4USJC 1DARA 2CQIA 2XYGB 1WOOA 3CIMA 3DRRA 2OFHX 3FBBA 3CE8A 4PZVA 2O3DA 1DQ8A 4RWWA 2Y1JA 1U1NA 1KD1T 5HANA 4F36A 1HNVA 3OTCA 1BWVA 1T03A 3HVTB 2VA3A 4HVZA 3LOUA 3G86A 3OTBA 2J8SA 3VALA 4NX9A 1N88A 1RTDB 1WDDA 4ZCIA 2OSRA 2V4QA 2HRUA 1M5HA 1LXNA 2J0XA 5L1LA 4ZPAA 3GMGA 2XI3A 3M8YA 1S1TA 4MAKA 3CJ0A 1R43A 4NXNF 3UPFA 1JKHB 1RWKB 5BR8F 3OTOF 1RBOB 3CJSA 3TARA 1QSLA 1FKAF 1N5SA 1K1SA 1HFEL 2WVCA 4K4XA 3BZQA 4OFZA 4FDFA 5JJBA 3HVRA 4DFJA 1VQLS 2CKWA 2CADA 2YKOA 3CNQP 3PTWA 4ATNA 1F5CA 3GFHA 2VPZB 3QLHB 1T9YA 1REGX 4I1TA 4J9UE 3DOLB 1U02A 2KT5A 3E51A 1SL1A 1B3TA 4W90B 2R42A 2W25A 2PMHA 4DN0A 2ADBA 4NRUA 3FQLA 4OX9F 1XNRJ 4WE1A 3VZHA 1SC3B 1ULRA 3D1OA 3C15A 3DLHA 2LDIA 3P5TL 1FKOA 3Q8QB 2RDJA 4DUYJ 1U1QA 2AP6A 3AD7C 1JWWA 2BQRA 2B7CB 2W01A 1ZAXA 1XWLA 2H9ZA 2RRNA 4HH1A 4EYIB 4D3GA 1RWWB 3OXGA 2Q66A 3DLBA 3MFIA 3M9NB 4JV5J 5D3GA 2DH8A 8RUCA 2BE9B 2CFXA 1I94F 4OYBA 3CCUS 2GVZA 2MLXA 3AA9A 3G4SS 1H0HB 3FEXB 3H4DA 2QG9B 2HFSA 2KKHA 5E3CA 1IBLJ 2JRSA 1W7WA 3JSRA 1YJ7A 4ANCA 4NLPA 4XIUA 1KHWA 5F41A 1VC0A 1L5UA 1M1KT 5LMUF 4EZ6A 1UVNA 2B51A 2BACA 4Y28C 2FVPA 2GJ2A 2OSQA 4CT8A 3RBDA 1YWXA 3I9V9 4FKYA 1H73A 2EFGA 3EWGA 1HHTP 4ZPBA 1VIOA 3IWXA 4IG0B 2DR5A 4G3IA 3W65A 1QD1A 4HI2A 1C4CA 3CSKA 3JTNA 5DDRC 1T9UA 2CQDA 1C2PA 1EB0A 3NCRA 4KO0B 4DCJB 1BQNA 3SV4A 4RW6A 3TJ8A 2HQFA 1PCAA 2EKNA 4USVA 4QW8A 5M2RA 4O3NA 5IV4A 2N3LA 1IKVB 3JSMB 2EBGA 3QAEA 2F8HA 3TYTA 4J91A 3PKYA 1WEYA 1UEVA 3BQ0A 5FLXU 1OQ6A 2NXCA 5AJ3J 4A8WA 2DNHA 3TRGA 4F3QA 4DFPA 4AL5A 2HGMA 2UUTA 4ICLB 2POKA 5KFAA 5HVFA 3BB5A 4U96A 1HWKA 3I55S 4JI7F 1N5TA 1LW0B 4OHXA 2LQBA 2E9TA 2OAUA 4RWXA 5KFGA 4HEA9 1DFDA 1JKHA 1S9FA 1S1XB 4O4GA 2LEBA 1YRXA 3M7VA 2QTWA 4HTJA 3S01A 1XR6A 4DQQA 3VGSA 2X51A 3AWRA 3PFEA 4TU9A 4USIA 3M2RA 1FE0A 3R27A 5E7OB 4HACB 3VQSA 3W61A 2B7BB 3WZ0A 2LU1A 3HSZA 3ISNC 4O0IA 3KHRA 3RAQA 1FJEB 1TKZB 3KXDA 4E0DA 1DTTA 2AZ1A 3KJNB 4NA3A 1Y5IB 4V1Ak 1QLNA 2R8JA 1RTHB 4UZBA 4FS2A 2QLFB 3THVA 2MGZB 1S6OA 3DLLQ 1FK9B 4LF6F 1IKXA 4RW9A 1M5SA 2E9ZA 2ZDPA 3QT5A 2J6SA 1XN9A 5KOWA 3K5MA 1VMBA 1UWBB 4M5JA 2CPZA 2IYGA 4JI0F 2PI4A 4TLQA 3GB0A 2EXUA 4MIBA 3LP1B 1PC4A 2PC6A 1APSA 2OHDA 4DUYF 1HD0A 3ILOA 3AOCA 2LKZA 1JJCB 3MM9A 3THPA 2F8EX 3BBCA 3KUEA 3TVZA 3H5YA 2OMLA 2XHCA 3VQTA 3W2VA 4LF7J 1UVJA 2IM2A 3R9LA 2P9EA 2B43A 1TL7A 5FDLB 4DI6A 2UVRA 2VDHA 3ISZA 3SYZA 2G13A 2FVQA 5LJ5Y 2W4DA 4U7CA 2NZCA 3BR8A 4C8MA 1FFSB 5C7PA 4L72B 3QO9A 1RHMB 5I4MA 1FJGF 3FRZA 4G6VB 3OR1A 5J1EB 1OYEA 2IBKA 1FO1A 2JX2A 3H5SA 3LW5C 4RKUC 5IM0B 4F4XA 4DFKA 1QTMA 2R2TA 2RAQA 3DLKA 1EX8A 2H5IB 2XNQA 3FBFA 5A8RB 3BDPA 2ZHAA 3RTVA 1RWVB 4G1IA 4TY8A 3J81U 1HIYA 2HLTA 1H3DA 1DTTB 4TY9A 3M05A 2E1RA 1UP1A 2N4CA 3AXKA 4BCAA 4M5NA 1ZPWX 3LWMA 4NLSA 1N8RT 4NI2B 1NB2A 1N32J 3P96A 4FYYB 3C3LA 1FHTA 2I9SA 2C3MA 2C2DA 5ETMA 2GMLA 1TUGB 3M30B 1VCTA 2RB7A 1HHSA 4DU7A 4DV3F 4KH1B 4C11B 2FC8A 3TA2A 1QDUB 2H1YA 2JH3A 4OJ3A 3LAKA 4G1QB 4LR9A 2ZVSA 5J2QB 2LVWA 2DHGA 2KFYA 3T5JA 1ROFA 2EFVA 2EI5A 3W1YC 1D8YA 4EYHB 1J5OA 3NAHA 4TVAB 1Y5NB 4X4RA 3HHNB 2ZZTA 4ZCMA 1A0OB 1YSJA 5HI7A 2XO6A 2MDAA 5HAOA 2WSCC 3BGRA 4IDKA 1REVB 1RTIA 3BH6B 5IWAF 1U0SA 2MZJA 1QM9A 2RS8A 3PIPQ 1IWAA 2CQ0A 1AYEA 2LQ8A 1KFSA 2NPFA 4DV4J 3LUYA 1CBKA 2DJWA 3HFZB 1S6QB 3ZTRA 2YWFA 3CJQA 3VF0B 1MU2B 1RCXB 2YBVA 4IG3B 3ZZUA 4ECSA 1IBMF 2WBMA 2BM0A 2IY5B 4UY8T 3OL8A 2C2MB 3I4PA 2HS0A 1JK9B 4I6WA 5H1SV 3DKDA 2XCAA 1NLKL 3W66A 1Q79A 4YHHJ 3D68A 4RW8B 3M8PB 4CT9A 3R7BB 5KG6A 1ZAWA 4CH1A 2K3IA 4NLYA 4GC7A 2F9JA 4PQAA 4I2PB 3ZTOA 1NKEA 2GA7A 4KKOA 3G82B 4E98A 4OI1A 3CF5Q 2L48A 2UUCF 2NXJA 1KQFB 2CPYA 2SXLA 1RHUB 2Z0GA 4E8UA 5J2QA 1HQUA 2CQ3A 2V67A 3BQ1A 5HP1A 1TL1B 3M6WA 4QWCA 4NLGA 5ETPA 3LANA 2QA1A 2QEXS 3H2VE 4DQIA 1X9SA 4DSIA 4IKAA 4Q0BA 3TUJC 3GV5B 1QAIA 3C6UA 4WF9Q 4FXVA 3UDEA 1VYAA 2CG8A 3C15B 4DL2A 3AJ2A 4P2MA 2IJRA 2AEMA 2KG1A 2IMOA 1TVRA 1YX2A 2MQNA 1R6YA 2JC0A 2NUUG 3WHIA 5CZXA 5T14A 4OMFG 4DL3A 2R7WA 1IBCB 1ITPA 2L08A 2J9EA 2Y0BB 3GV8B 4J9KA 1NRKA 1Z2ZA 3VZIA 3FNNA 3UDCA 1ZYQA 5J1EA 2CQPA 3IR6B 4WFBQ 2WAQD 3MGJA 4IQXA 1UMJA 1X4DA 2OPPB 5KFMA 4JV5F 2E7WA 3SDEB 3OSNA 3SBMA 2Q1LA 2HVIA 4D3HA 5LOQA 3M1VA 5K20B 1V9OA 3CIZA 2BANB 4GO7X 5C2CA 4KT0C 4ES1A 3BQ2A 2OIHA 1WWHA 1ZM2A 4UOFA 2AU0A 1T03B 1WKKA 1IQTA 1K47A 3M8QB 4LF9J 1YKWA 4NLRA 1EJ7L 3OBIA 1S76D 3IBCB 2EG2A 2E29A 1GEHA 2MJUA 1VBZA 1C1BB 1WHWA 1S9GB 2HAFA 3MM8A 1FI4A 1JNRB 1U09A 2YWWA 4NEZA 4WTOB 1UFWA 3T3FA 1TL1A 2KYXA 5DZ7A 4B3SF 2R2RA 2CJYB 2EC2A 3FCWA 3HHLC 2OKQA 2QFJA 1YJTA 1YQHA 1I51B 3DOKB 4ECZA 4DFMA 2A3JA 1UWAA 3PJ9A 5E3QA 2QSWA 1SQGA 2HHTA 2HHSA 2BABA 4OZ0A 4QYZJ 3QYYA 2BR0A 2V8PA 3AB4B 3KNAA 4U7UK 3UO0A 2IPOB 2COLA 2GFFA 2CYYA 2RE1A 1NM2A 4G1PA 5U47A 1PAEX 3DFEA 2ZVIA 1Y3KA 2WRMA 3FFIB 1N36F 2ABYA 5GADU 2QLBB 4U95A 1CJKA 1SIWB 2LQJA 1R89A 1KHVA 2V8GA 2ZBRA 4TKTA 4HT5A 3C16B 2PMZD 3VVTA 1ZZNA 3M9OB 4DF4A 3OL9A 3BJYA 2MB0B 1B7YB 3IBFB 3AA8A 4DV6F 3FGVA 3CO0P 2APOA 4NXMF 1IBLF 2DNKA 2UUCJ 2MQMA 3GSIA 3QBCA 6AT1B 2ZJQQ 1HBMB 2EEYA 1VQ4S 2NCKL 2WONA 1WEZA 3KMSA 1SPBP 4AE5A 5KFUA 3I32A 3DDIA 3UI3A 2HGLA 1X4GA 2DCUB 5A0YB 1NDKA 3BGFA 4DOZA 1YJ9S 1NK0A 4JBCA 2FPHX 5KFXA 1DBDA 1GMVA 3TJ9A 4EUVA 2ZH7A 2ZD1B 4WCEQ 4IG0A 1YIJS 4HR2A 3R2DJ 2VZ9A 4AXIA 2OPSB 3IN5A 5DQHA 4Q8EA 3UR3C 3EXYA 2VG7A 1GFWB 1S1WB 3M9MB 3GG1A 2XLIA 3GJQB 1Y00A 2BRLA 5B08A 3K57A 4FVCA 1Y5LB 2ZM6J 2HHHF 1EAYC 4EEYA 2YQ1A 4WZQA 4FPIA 3DU5A 3ICLA 4LUBA 3TR5A 3IC1A 1RTJB 2XMUA 3P3DA 3RW6A 1SH2A 2YKAA 2GIRA 3VTIA 3DRSB 2DIUA 1ACMB 2AJ1A 3EVMA 2ZH1A 5DG8A 2ZJPQ 4ITSA 4B9LA 4C8LA 1C1BA 2HK2A 4MKAA 1JLAA 3GR1A 5C24B 2WW4A 2D41A 2UV8A 3ZNJ1 1NU4A 1GQEA 3DMJA 4GKKF 1F0XA 3D6TB 3R5BA 2XMWA 3HZEA 3V2UC 1WEXA 4KGVB 1Q8IA 2CQCA 2O5DA 3LGMA 1T0TV 1VLOA 2BDPA 2CWXA 4O3SA 5DQGA 3MUTP 2YPZA 3KNGA 3DM2A 5KFKA 1FESA 1U1MA 2E5LF 4B3SJ 1OPIA 3OT9A 2WVDA 2DO0A 4YDXA 1UJ5A 2MKCA 1ZETA 2CJAA 5J2MA 4JV1A 3FBCA 3LP2A 1LOUA 1TELA 1FWLA 1NPPA 1OIAA 3ZTPA 2ASLA 2VJVA 1XR5A 2JVRA 3W8PA 3M2UA 2BVZA 2C3OA 2LECA 2DNPA 2F40A 3MCMA 4F0HA 5B7WA 4A8MP 1BGXT 2MZRA 2P6TA 3FZBA 1SJQA 3M32A 3KUHA 3MM6A 4FZVA 3T6JA 3V4IB 5KG7A 5B0DA 3CMQA 1JNZB 3R5JB 3NGTA 3OTDA 2I38A 4QR1A 2GC8A 4J9QA 2C3PA 3N6LA 4IFVB 2VQEJ 4CLTA 2FGOA 3GG0A 2XYHB 3NGDA 2ATCB 3ZZPA 2KXHA 3P4UB 5I3PA 1UAWA 3NG8A 1VRUB 3LP2B 3N01A 4KGMA 5HBMA 4Q5VA 3CMAS 2Y8YA 2A6MA 2ZNYA 5M2UA 1LW0A 1SJ4P 2OTLS 3T9NA 5KFBA 3PO4A 1A7GE 2VC1A 2MZ1A 2DH9A 2R8IA 4RR5A 1RHKB 1Y11A 3AOBA 3L7UA 1X4FA 2WVFA 3D4JA 4KKOB 3D2WA 1WOSA 5BYQA 2ZM6F 2RT3A 3GIRA 5L8RC 4QIFA 3DGPA 3OUYA 1TK5A 2BE2B 2CNNB 1JLQA 1F2HA 2GGPA 3I6PA 5DGBA 1R8CA 2M4MA 2VKZG 4RW7B 5FD1A 1Q95G 2P9GA 3MPVA 1RT2B 3ONQA 3CCRS 4ILLA 2ZWOA 2AV5A 2X3DA 3A4TA 3BGUA 4OJHA 3JAMU 1D3WA 3DDKA 1RQ0A 3KLFB 2VOPA 3BBBA 5F8JA 1H7XA 3DRSA 3MMAA 1M5KC 2OPQA 3D6FB 5KT3A 3NRBA 2R7XA 2ACMA 2ZH9A 2MZQA 2GO9A 2B9WA 2Z4PA 1AUSL 3GP9A 1GAOA 3N9UC 4OV1A 4GVBB 2XM3A 4OLOA 3B54A 4J9LA 1WHVA 3QAUA 2QX0A 3UCGA 1T3NA 2JWNA 2G2YA 4NL5A 1PIEA 4LQ9A 4P9SA 2W4PA 3ZNUA 2UXBF 1ZPVA 2X1BA 3MD3A 1HBOB 4H4MA 4GKJJ 2XTJP 3IG1A 1GMWA 2CQ1A 2FJBB 2GHPA 4OZNA 4ANEA 2KHCA 1WC6A 5A2QU 4LFAJ 1I5OB 2XGPA 4OHVA 3H40A 4M1KA 2VL1A 3LTOA 1HBNA 4EBCA 1KN6A 4USKA 2HHWA 3HPOA 4WYWA 1KBRA 2FHOB 4ZKAA 5CYJA 2DRAA 1JXLA 3IG1B 2A0FB 5M2PA 1WSVA 4ZHRA 4OV6A 2E5LJ 2X1FA 3HD1A 3QGGA 1HWJA 3CJ2A 3SZ2A 4LF8J 3A13A 2ZITA 4N41A 3JQKA 3SSRA 4C3MA 3L3CA 3ZZTA 2H5EA 3QLHA 1RT1A 4MTPA 2XWXA 3ZO7A 1LXJA 2G0JA 5IM0A 2DR6A 2DHSA 1HQEB 1RHQB 5DG9A 4C8ZA 1AA1B 2CG4A 1N4LA 3IFEA 5L46A 2ADCA 1NK8A 2UUBJ 3R5AA 3LQVA 2YKPA 1X4CA 4NLVA 2J6UA 4DLEA 5BXIA 2Z58B 3AQOA 3DCAA 3O1LA 1XMBA 2IDEA 3CJ8A 4MT1A 3QJJA 1N0UA 1UW9A 2VB6A 3JXOA 3DGPB 2QYGA 3EGWB 5KFTA 2MKJA 3EGVA 4RJVA 3QIPB 4LFBJ 2LMIA 2E66A 4RBUA 2V94A 1BQMA 3KLVA 1JQGA 2HQDA 4WJBA 1U7LA 4KYZA 4NLXA 3MTJA 4KPCA 4UUXA 1WI6A 2H5JB 4TXSA 5G4DA 5I3UB 2H48B 3QRRA 1T05B 1R3NA 2V9KA 3G87A 2DVIA 4Q45A 5GAGI 2IRXA 2C42A 2PI5A 1O51A 1CC7A 1P9QC 1QSSA 4KHPJ 4J9RA 2K1RB 1IJEB 4L3KA 3K58A 1GXLA 1U8WA 4N77A 3ZFVA 2ZDOA 1T9TA 5I3UA 4DXLA 4WYLA 4X4SA 3CCQS 2A2CA 2Z2YB 1RT3A 3MF5A 5ETKA 5CYQA 1BY9A 2AKWB 3CCMS 1NK4A 1TMMA 1SCJB 2BJ7A 1OJ4A 3PIOQ 4DR5J 3M1VB 4ZLNA 1RAHB 1ZBTA 3M2RB 4X62F 1WTFA 3MZIA 2UUBF 4DR1F 2KM8C 5AXNA 3GIJA 3PHTA 1BQXA 2K3KA 4WIIA 4AL7A 2AGOA 4E2FB 2DR8A 2FVRA 1UVMA 2MY7A 4C0BA 2VONA 4LR8A 3L7OA 2CZ4A 5KFRA 4FBTA 2HRTA 2NQPA 4DV7J 3UE2A 1KWMA 2FJDB 4QOTA 3B82A 1HR0F 1TVRB 5K14A 3LGNA 3IMQJ 4ZS6A 2QSFA 2E1MC 2XTEA 4YMEA 3W9HA 3EVOA 3KHLA 1YJRA 3M4XA 3T1HJ 3C6UB 1VRQC 3KJFB 4DEZA 4JI8J 1JIHA 3QJPA 2LXFA 4OYXA 2E44A 2HNYB 2XCPA 2RHSB 2BJ1A 3J7YI 3MECA 2HS3A 3CULA 2QC3A 3CC2S 2A6OA 1GNKA 1EP4A 2ZNZA 2CQ2A 3QPIA 4H4OA 1YZ7A 4K2JA 4HHHA 1FVSA 4P71A 2GHVC 1Q4RA 1Y4ZB 4OHWA 4ZVFA 5EGYA 4X64F 4DR5F 4ECRA 1XMQJ 2GW8A 3C14B 1O6XA 4NYOA 2QMWA 1WC4A 2WK4A 1VQ5S 3PM9A 4F3OA 3SEOA 2VG7B 2B9EA 4CLPA 1EIYB 1B99A 1FX4A 1RWPB 2B4UA 3W5YA 1CQNA 3PX4A 3JSYA 3BN7A 1VHFA 2JEGA 1RLCL 3DC2A 3J7AN 2BBEA 2QGFB 2CNLB 4H4OB 3ZC4A 5IZHA 2R4FA 3KLEA 1U49A 4IG3A 1MU2A 1JXVA 2KXFA 2D3O1 3QGHA 2WONB 4YY3J 5KFCA 1NAQA 3NP5A 5K8OA 2HLUA 3US5A 2V6AA 5ADZA 4ILMA 4ZVOB 3LP0A 4O3OA 3R7SB 4YB7A 2KL8A 1N56A 1R0BG 1N34F 4X2BA 2B4VA 3RB0A 2CPEA 2D9OA 1J5EJ 4JI1J 3IR7B 2G0IA 2UXDF 4DDFA 4IQMA 2CPXA 3MMJA 3PNIA 4ECUA 2DGOA 3OR2B 4KIAA 2R8HA 1XC9A 2I5JB 3JSBA 2WW8A 3A1YG 3AOAA 3NBPA 3FVYA 3EPIA 1PBAA 2D68A 5KFSA 1K9MT 2V2KA 4KE5A 3TX0A 1EHWA 3I5CA 1OYDA 1S49A 1S1TB 2BEFA 4NLTA 4J5OA 2C2EA 5IT9Y 2HQGA 2MXYA 3T1HF 1KONA 4QJVA 2GZOA 4CM0A 1S0NA 2W8LA 1F5BA 4LFCF 2V5HG 4HHJA 3CWJA 4DF8A 3GLJA 3PR5B 5ETRA 4ECYA 1URNA 1C4AA 3DXBA 3H59A 4IFYA 5CHCB 4CM2A 4DLGA 3PR4A 1VDHA 2ZUGA 2D1CA 1X5SA 5KFLA 1VK3A 4K0KF 4MFBB 1S4FA 1D8ZA 2HBZB 3POTB 3Q83A 1PYTA 3EE3A 1GTEA 3R5CA 4N7TA 4MYUA 5IQQA 4DL0C 4X4UA 3IWLA 1CJTA 1RLDA 2W2OP 3OR1B 1RA7A 4MMOA 4PG8A 3SCKE 4FKXA 3MMCB 4M5DB 3CJ5A 2ILYA 1I1GA 4LIRA 4X84A 2IA0A 3K5NA 1S5ZA 5AE2A 4RZRA 5IS2A 3T1AA 2AD9A 2K2PA 2GS8A 2V4JA 3ETMA 4EU0A 1UFKA 5DGAA 1JLGB 3CD7A 1FX2A 1G3OA 1WKLA 2QA4S 3PY8A 1RJJA 1VQSA 3I87A 3K5PA 5AXMA 3OV7A 5CABA 2VBYA 3UVJB 1X0PA 2HVEA 2ROEA 3TZYA 1SB6A 3MM7B 5DG7A 4WTYA 2UVUA 1VOMA 2YNIB 1WF1A 5E3RA 4ANDA 1QAJA 3NNAA 2JSXA 4ED8A 4DR6F 4FPRA 1RAOA 1E6VB 1RE1B 2F65A 3ITHB 2K8GA 3HVAA 3KYLA 3FSIA 1TR0A 4KFBB 4NCGB 2CDRB 2F3JA 4Y0FA 3TUPA 4QU7A 3W9JA 4OX8A 4HDGA 1OS5A 3VV2B 5CCLA 4HACA 3V6KA 1X5TA 3BSCA 2KYZA 3EZOA 1QAXA 3BREA 2HHVA 1QTNB 3R6GB 3PRVA 1W2BR 1DY3A 2YNFA 3H5UA 2LA6A 2AWZA 4OZ5A 5ETQA 4X66J 2RU3A 1X4AA 4PWUA 3PYFA 5DLFA 2Y1IA 4CO1A 2NR0A 1B70B 4RUBA 5E3AA 1VK8A 1FDAA 3D0IE 3UQSA 3NBPB 5LXYA 1VC5A 2V9WA 5F8MA 5D4OA 1RADB 2I5JA 2XWYA 3HSGA 3GIMA 3QSYB 4LF9F 3OR2A 2UUAF 3D0HE 2QYCA 2DB1A 1JB0C 1NZ8A 1RT4B 3OXFA 3CCTA 5A6PA 3AX2A 2XC9A 4YB1P 4TU8A 3PACA 3NNCA 2FHJD 2F7VA 4Y2AA 1B64A 3GFXA 2X7IA 2XB2D 2MKHA 5HLFA 1MWZA 3CDUA 3SSQA 3HMJG 3MPYA 4F4KA 3CCVS 2IVFB 4ES2A 3CPWR 4DJBA 4ZVRB 2AJ0A 2L9DA 3ISND 1CJKB 1XK8A 1JMTA 5GAHU 3NL0A 5GMKa 1MN9A 4YP3A 4EFAC 5J2NA 1ICEB 1OY6A 1HWLA 7AT1B 1S57A 3MI7X 1VJWA 4QPTA 4ZLJA 5CAAA 1PSDA 2IVYA 1N32F 4ENOA 3GZ7A 4Y2CA 4PXDA 4DMZA 3OVSA 3KK2A 2ASJA 1FRHA 1XNRF 3GSDA 3K8WA 4DR6J 3C66A 2W9AA 3TAQA 4NMXA 1X4HA 5E0OA 4IR9A 4M95A 3JYTB 2RF2B 5HATA 4C11A 1MG7A 4DUTA 3H98A 3G6ES 3PHEA 4DR2J 3BO3A 2E1CA 4USHA 1C0UA 4PG7A 2XMVA 2J76E 3K7RA 2JDJA 4RX6A 2VG6A 3BKTA 2J6TA 4ZPVR 1KOHA 2GVDB 1RP5A 4KGKA 2G0CA 1FEEA 1V5VA 2AQ4A 2VODA 2HWTA 4PPDA 3G71S 4C97A 2AW0A 1VS3A 3D1HA 4ED3A 4B3OB 4WP3A 3JTPA 4OI3A 1N5YA 4J9PA 4TYBA 5H9FK 3DOLA 4DSJA 7FD1A 4QYZK 1U6ZA 1YRTA 4ZITA 2NREA 2BJ9A 1VFJA 2RQ4A 1VQ6S 1TL3B 3MPWA 4DPYA 2I2YA 1BHNA 3O44A 2HQ3A 2LFVA 2FLNA 2LA4A 4P2SA 3KOAA 1RAIB 2RH3A 3MEGB 2DEIA 4MIWA 3TUZC 3MUVP 2R9LA 3UVJA 1VHIA 2R7RA 3DN9A 1T3OA 2CQBA 1KLMA 1FFWB 2IAJA 4ZMMA 2W8KA 4JI3F 4PWDB 2IIHA 2IRYA 3ENWA 1RCOB 3N28A 4TN2A 2YH1A 4OHYA 3M8SA 1NB7A 2J7WA 2OO4A 2PGCA 3OPKA 3WQPA 2BJEA 1HNVB 2GQCA 5HVGA 4CO4A 1V6HA 3HI9A 3CJ3A 3J7Z5 4JI5J 1GMUA 3M8WA 1KLNA 4Q0BB 4DS4A 3DRRB 3P5BP 3CDBA 2GQQA 5EWFA 1TL4A 4GRSA 1T02A 5KAKA 4OYOA 4PPZA 2HYIB 3CC7S 2DNZA 2CA9A 3UNGC 2HIYA 4AUKA 1RTJA 2ZBQA 5DDQC 3POTA 2HBYB 5L1JA 3NWGA 1AZSB 1U1KA 1JLEA 4ED4A 1BQMB 1O0PA 4EO6A 2CNOB 3N79A 1TZ0A 2CIMA 4GMKA 1TKZA 3RYLA 1N34J 1HYSB 1DURA 2VDIA 4DU8A 4O44A 3M2VB 3IRXB 3R1LA 1J5EF 3TW0A 3T6BA 5AJ3F 4IRDA 4QYRA 1LKZA 2DNRA 4NCBA 4CLYA 1IBKJ 1OSCA 1RT6A 1PBUA 3A3NB 4MJKA 3U27A 2AMCB 2KRRA 3EYZA 2E5JA 1LK7A 2E7VA 4KHMA 4Y2KA 1AUDA 1R27B 2BXJA 3TZWA 3PZPA 3PX6A 2DXFA 1PKUA 5KFVA 2GJIA 4LFAF 1ZA2B 2BQUA 2MTLA 2FGCA 2O67A 1N54B 5F0UA 4DV5J 4NLOA 3ZTSA 1VR6A 1BD6A 5I42B 1ZM9A 4ZHRB 1HI0P 2DCLA 2AYGA 4B9NA 4PKDB 3JAMY 1UZHA 5IOLA 2QMUB 4K50A 4QR2A 4IOCQ 3W5ZA 1FA0A 1RA6A 2QL5B 5MLCV 2OD6A 2ZZMA 2E1PA 2ASYA 3BYPA 1BQNB 4BC9A 3LWLA 4LRDA 3BKFA 2R7TA 3TA0A 3VGUA 4KC5A 3T1YF 2WCXA 3FEYB 2B5JA 4F04B 2F5GA 1KTQA 4YR2A 2QO3A 1WI8A 1SC1B 1QJHA 2BMBA 3FFIA 2FVCA 1GK8A 3FUYA 4J9OA 1I6JA 2MYFA 2ALYB 3FSYA 2VUGA 3AJ1A 3AFGA 2BRKA 3DHWC 2E5HA 3S1TA 4X4TA 2C22A 4KQZA 4BS2A 4FBUA 1KC8T 1U26A 2AEFA 2AJFE 3PFOA 3HDSA 4GVBA 4BHQA 3C46A 2U1AA 4M94A 1RYRA 2KFNA 4Z37A 3R8YA 2R3VA 1MN7A 5A8KB 3MR3A 1QUPA 1WG4A 4F02A 1DQ9A 2AIRB 2CJ9A 2O66A 3H5XA 3WX8A 1E6VA 4Q44A 4DV3J 1HBUB 4DL4A 3M8ZA 5K8NA 1V5IB 1FDNA 5T7LB 2JEJA 5DETA 4UY85 1NJYA 4B9SA 1F2GA 1U48A 3RBZA 4H4KA 3BKUA 2CQHA 1IM4A 4LF5J 2GGPB 2L41A 1MMLA 4H54A 4Y65A 3OJUA 2JLFA 2X1GA 3A3PB 3Q24A 3B78A 1YTYA 2FVSA 3FMBA 3V81A 1RYSA 2V4JB 4H4KC 1YBTA 5HROB 3HULA 4ZCLA 2VU5A 4JP8A 5E3PA 1KLMB 2IAJB 4URSA 4CO3A 2JEIA 1X7VA 1VBYA 3F41A 2EK6A 1FKPA 2BUNA 2CQGA 2GNKA 2OPPA 4ID5A 4JB8B 4PXBA 4QIEA 5CA5A 4DV4F 3CMES 3X1LB 1TL3A 1FK9A 4UOGA 3KHHA 4DL7A 1XERA 1RHJB 3NGKA 1S4EA 2RKIB 4UOCA 1TFYA 2Q6CA 5D0HA 3BEGB 4KR0B 4DSLA 4KAIA 1NSKL 1HW8A 1Y9OA 3MM6B 5IXUA 3PW7A 4EZ9A 2H4WB 3KG0A 5LSLA 3A8IA 4ED1A 1Q7LB 4ZP8A 4QWDA 3X3UA 4C0OC 2EKYA 4ZPCA 2HHUA 2KFZA 1IUJA 3K8VA 3S7RA 3AB2B 3SQOP 2CUYA 3Q22A 5LMNJ 5HP1B 5D77A 5GADI 4J37A 1T05A 2KB2A 2KZZA 1A9NB 3OLAA 4LQ3A 3NS5A 4B9VA 3NS7B 4ICLA 1X4EA 1RK8A 1XTZA 4QIWD 2OUGA 1C1CB 2HBQB 1S97A 1Q53A 2DKOB 1W2IA 2XBPA 3AH6A 4LBHA 1F3FA 1DTQA 3CVKA 3D6HB 1BC6A 1SUQA 2CPHA 1HBUA 2XZTB 3KK1B 5I3QA 1GMWD 3IS9A 1URRA 3ILIA 5DZ6A 1VQ8S 2HMIB 2CPJA 1T94A 4EO8A 3KLIB 4K8RA 1F9HA 3GILA 2VH7A 1FF2A 2Q6BA 4CZCA 5A8KA 3GQCA 4YR0A 4TNOA 4RNOA 2V68A 3I31A 4CIOA 5KG5A 3ADAC 1X5PA 3B8HA 3BGRB 3GJSB 4IDKB 3CCSS 4DQSA 1RTZA 3QT7A 2XY5A 1K73T 3H90A 3W2WB 5DDOC 2W2QP 2ZJRQ 3MM5B 2EFNA 5D0GA 3ZXWA 1EZZB 1E6YA 3E01B 5HJYA 2N3OA 4RUCA 4GC6A 3PW0A 3C14A 4EGLA 4JI0J 1H7WA 1JLFA 1RT4A 2ZBIA 1R8BA 4I0WA 3DOMA 2ACYA 1WNEA 1QAYA 3QFHA 3TEHB 5L39A 2D3UA 3NOCA 2KZMA 4ERDA 1KQSR 4JI2F 4QBUA 2EFQA 1HNWF 3CC4S 2HVZA 5J1NA 1F6TA 3MMBB 4CLZA 3UCUP 1EETA 3DYAB 3ZZZA 2I1RA 4A8XA 1FDBA 4R5PA 3UCZP 2FZCB 4WU3A 4P10A 1HNZJ 2J0WA 1R0AA 2R7UA 4OQJA 3R97A 2JFDA 2HFZA 3AODA 3BSNA 3FC9A 4ILRA 4F8RA 4JOUA 1UPMB 3RR8A 3HVWA 4DBQA 3L4BC 4PUOA 3IAM9 3A3OB 4NCAA 2OMOA 2OPRA 2YQ0A 1UPPA 2RD5C 1GXTA 3VWSA 5B0FA 2XO7A 3OVBA 4HI1A 3ITHA 4ZP6A 2NS1B 3ENAA 1RI7A 1LNQA 2QA2A 3D7SB 3KK1A 1WF0A 1RBLA 4LVOP 4YUDA 3D28A 3LPEA 4K0KJ 3OTEA 1KQGB 4B9UA 1M1HA 2C3UA 3HHKA 3J7ZT 4BC7A 3IRXA 3LALA 3D6MB 3VAKA 5HL7Q 1G1XA 2B4PA 1IKWA 1EKRA 2MHNA 3G8QA 1RT3B 5D6GA 3G8TA 1Z4UA 2QRRA 5HK4A 2P8IA 4MK7A 3VCDA 2EFOA 2VFVA 4YQWA 1N6QB 2YQ3A 2VQFJ 2ZUAA 2D7SA 2ZKUA 3MMCA 4M5DA 4ED0A 1P1TA 3NGUA 2BKNA 4LSLB 5D15A 3W8GA 2FC9A 4QQBA 3QSIA 2EBEA 3N0VA 3PW5A 2M5YA 3EDRB 1RB0A 1SJRA 3UR0A 2ZHOA 4DS5A 3TP2A 1FNOA 4MKVA 3R1HA 4IRKA 1S99A 4C0HA 2XY6A 4C8OA 1N52B 2ZH6A 2FZGB 4JI6F 1Q78A 2D3ZA 4PWDA 2LXIA 4K4VA 3BBFA 3MHYA 2GAHC 3GFZA 3GR0A 4C98A 4B08A 3OD2A 3O5TB 4LSNA 4YDDB 4NXMJ 1S9EA 1EARA 2KTQA 3W63A 1YZ6A 2VFUA 3S8SA 4CRJA 1PAUB 2ASDA 1HQEA 2XHWA 1H6KX 3I0RB 3I56S 2AT1B 2FY1A 1S1UB 4FYXB 3F73A 4QIVA 2WBRA 5KFHA 1NJXA 1H38A 1F1BB 5HMZA 3G6XA 4ECWA 3T5HA 4LRBA 1FRKA 2LXUA 1TKXA 5KG2A 1FERA 3A8EA 3BM7A 3H0PA 1TAQA 2UVVA 3Q2TC 3AXMA 2EVZA 3WIUA 3QWPA 1R0AB 1QSYA 2E5GA 4CP5A 4R5PB 4O3RA 1KSPA 1NEEA 1S6UA 2DHHA 1N0VC 4PXEA 4N47A 2MQPA 4LSZB 4DSFA 3V6DA 3EZUA 3IAS9 4LVNP 3CD0A 3EZ5A 4BDPA 4ED6A 3I0SB 1S7IA 3FDSA 1X9MA 1RDRA 1XJWB 2VFTA 2XZWA 3D9BA 3KUGA 1JLFB 5K5MA 1QVGR 1HBOA 1WSRA 2BYCA 4EWTA 2RRAA 4ZDNA 3UDVA 2HIQA 1CSJA 1G7CB 5KFJA 2R7VA 2GMHA 4OYIA 4CO2A 5EHHA 1VI7A 2HHQA 1U2CA 2KI2A 1HI1A 3K2YA 2DK2A 2LQ5A 2OPSA 2ROPA 3M8PA 4RNHA 4U7UD 2VKRA 4JI2J 3SFGA 5F8LA 3BF4A 4MK8A 2ZFHA 1D09B 3KWMA 3N6MA 5C25B 4UT4A 1QUVA 4IH5A 5A0YA 2OPQB 4EMDA 1LK5A 1UZDA 1LV5A 1NJIT 4XAKA 3BV8A 2V1SA 2R8KA 1H72C 2WOMB 1DTQB 1FCAA 1N48A 2M8HA 1JLBB 2OGUA 2JNJA 1CG2A 3H7HB 4OZ1A 1OWXA 2LU2A 2V8DA 1WC3A 3PEHA 4CLLA 3DRXA 4LF5F 3W60A 4LMZA 1TKXB 4LR7A 5D78A 4CWBA 2R7QA 2Y3YA 3D1QA 1MNEA 3J81Y 2ZC3A 2ZH3A 2B8PA 1SKUB 4ZVHA 3ZTQA 5FIIA 3AT1B 5IT9U 2L3MA 3RB4A 2DNOA 5KOXA 2G1HA 4ZIWA 3IR5B 4B9TA 1FT8A 4X4VA 1U4BA 2G1DA 3CD5A 1DAXA 3HHEA 4NLUA 4AT1B 1S48A 3L9ZA 5THWA 2HNZA 3M30A 4I68A 4PEOA 1PJ5A 4RW4B 1K8AT 4OL8A 1U25A 1YJWS 4LRAA 4IFVA 4ZIVA 5LXRA 1D0EA 4RO0A 5KFPA 2B0GA 1FWKA 2UZAA 1RABB 4IO1A 4URGA 1R8AA 4B9MA 2XMTA 2DR9A 2XEXA 4K4SA 5HMYA 2M8DB 3LGHA 3MWBA 2WTFA 2IYIA 3HVTA 3HHDA 2VICA 5KT7A 4ED7A 2XLKA 2W4CA 5HMWA 2AEJA 1SQFA 2FIUA 5LSRA 5F8HA 2K1RA 3Q8SB 2HGNA 1RSCA 5F8IA 3VHQA 3I5BA 4DN9A 2LYVA 1F5AA 1VQNS 3FSXA 1SJ1A 2IRUA 3MM7A 1MROA 1D9AA 1U8SA 2AGQA 4X65F 1ZA1B 2NXUA 3CJTA 4DV0F 1Q7YT 2E7XA 2EG1A 2VG5B 5FDLA 3CJKA 5HROA 1T7PA 3SI8A 1DLOA 1KKHA 1FTCA 3MUMP 3RGIA 3KK3B 1LWXA 2BX6A 2IDLA 2VV5A 4WFNQ 2OLWA 3R6LB 1HMVA 3M6VA 1RU2A 2W7AA 1JLCB 4FF2A 3JQJA 5C24A 1FFGB 4IR1A 3CDWA 2B6AA 2K06A 1UW4A 1KEKA 1SI9A 4N8OA 3FZ2A 4M8LA 1CPZA 4JI4J 2B9YA 2C2OB 1D9FA 2RJZA 3QFWA 1P1LA 2P9CA 3T9ZA 2AX1A 4A8YA 1IJFB 4DHVA 2YH0A 4MFBA 5E2QA 4NXNJ 4GKKJ 1WC1A 4DX8H 2W9BA 2GAGC 5GMEA 1VQOS 1CLFA 1FEHA 3KDNA 3LA0A 4PUOB 3I96A 1SIZA 2D9PA 2M70A 2MPUA 4LBIA 3KFWX 4C8NA 4RNFA 2MQ8A 3GPAA 2JL9A 4Y6IA 1Y3JA 3ELHA 4P52A 5KFZA 1C0TA 3TWZA 2VHGA 3GCWP 2NXEA 2DGWA 1C0UB 4O0NA 1YBUA 1FWPA 2HFVA 4QR0A 4O3PA 3OW2R 1S12A 3GV7B 2V50A 1IBMJ 2ZZNA 4ZJOA 3MD1A 1K1QA 3OSPA 1YG0A 2VF3A 5ETLA 3HXMA 1RKJA 1LWEA 3IWNC 3G6VA 2X3GA 3H4BA 1RAJA 2XS2A 4B3TF 4CLKA 2HHHJ 1Q16B 2MMYA 4HLBA 1N33F 2PSZA 5KFWA 3KK2B 1O8BA 2XYPB 1HNIB 1DQAA 1HBMA 4QIGA 1NPKA 2MY8A 4KY3A 4P7TA 1V3RA 2MQQA 4PRFA 1SV5B 1NHUA 2DRBA 5ETSA 2BW2A 3CDEA 4A47A 3GU0A 2HQCA 2Y1RI 3ILLA 2XTCA 4OZ2A 2R7OA 4QZVB 2WOMA 5J2NB 4ZVQB 5L1KA 4URQU 2FD2A 2V63A 2CRLA 3KTQA 2M9KA 3QJLA 4X4QA 3KLIA 4BBYA 1JJ4A 3C16A 4NLQA 2ZBCA 4KH0B 4WKRA 2QLWA 5DS7A 2M88A 3LPYA 4B3MJ 2VIHA 1RXOB 1NH7A 4K4UA 3ET6B 3K89A 4L73A 2V4RA 2BA9A 3BR9A 4ZN1A 3FKBA 3PRDA 3GYNA 1UL3A 2JZ5A 3SSSA 3CCZA 3CGIA 2H4YB 2QIFA 1GX5A 1SV5A 2FYXA 3BPDA 2F1FA 2RHQB 4P2FA 4CH7A 5IQ6A 3OUYB 1PO6A 1GX6A 4Q2LA 1J27A 1H2UX 3JTOA 4Q8FA 3RW7A 3E2EA 2W1BA 2RRBA 1WOPA 2RVJA 2JLGA 4O3QA 2QL7B 3DGVA 2UU9J 4A8KA 1QVFR 2EK1A 4LIWA 3KHGA 3RB6A 2W2PP 3I9ZA 3QZ7A 5HBMB 3CCES 2YKQA 2XTDA 3TVYA 4LF4J 4DPTA 4ECXA 1S77D 1PJ6A 4X4NA 1OY9A 2XGQA 1N5QA 1S9GA 2HK3A 2KRBA 2OELA 2HNDA 4ZPWR 5KT4A 3RRGA 1UEUA 1CS4B 4FS1A 1WC0A 2WSEC 1FKOB 4DZ6A 4IOAQ 3TZXA 4I69A 1VQMS 5DJBA 3EM1A 3U1MA 2QLJB 2M7SA 1IKYB 4JI6J 1RACB 4LJMA 5AXKA 4FF3A 4NASA 2HKEA 2PD1A 4K2XA 4ZVSB 4ZJLA 1ZOTA 2LEPA 2QV6A 3CTRA 3D5MA 1UJ6A 4ECQA 1FXRA 4CLUA 4CDIA 2FUG9 4WPAA 4FXDA 2HFOA 2B8QA 2F4FA 2FDNA 2B56A 1XNQF 2MKSA 1B0TA 2OEJA 2UV8G 3NNHA 2KG0A 4WFZA 1S9EB 2QE5A 3PEJA 4UQTA 5HSPA 2J8AA 2V8HA 3PCOB 1XMOF 1U1PA 1WD6A 1SKRA 4C4WA 2XZ2A 5LJ3Y 5KTQA 4U67Q 2JEFA 1PJ7A 2EWHA 1JLGA 1VBKA 4F3MA 1RU1A 3QWUA 4B3RJ 2O1PA 4CNYA 1CQMA 4NE9C 2PDAA 4M63A 1RWUA 4MKYA 2Q43A 2VG5A 5LM7E 1U47A 4Y34A 3OL7A 2VG6B 1CS4A 1OMSA 1B4SA 3Q0AA 3UW1A 2HNDB 5B0BA 4FN5A 4KB7A 3W9IA 3NGSA 4IRCA 2LCWA 5C42B 5IT4A 3DXSX 4ER8A 1NJZA 1HW9A 4B3TJ 3JYTA 3OJSA 1DZ5A 2I0XA 5D4PA 2IVMA 1AT1B 2P2CB 2VJUA 1N6QA 1SC4B 3PKMA 5H9EK 1Q8LA 3MCNA 1RTHA 3G82A 3UWTA 2R2SA 1L3VA 4GKJF 3KKFA 4KPYA 3QIPA 1EKSA 4NYPA 2NXNA 4IFYB 5KFIA 3KLHA 5FJ4A 5JVHQ 3QQCD 1L3TA 4HDHA 2HZVA 3HHLB 3QT6A 3KMQA 4CNZA 1LWFB 4FF1A 4CLWA 5DDPC 4ZP9A 3MAQA 4Z7CA 3K59A 4DV2J 4K7QA 1LFWA 1PG5B 1RT5B 4UQGA 1Q82T 3TOQA 4L74A 1RAEB 2YXLA 5BYRA 2PFFB 3DLEB 4J9MA 5L1IA 4WFAQ 4WFXA 2FLPA 1RT1B 5SUHA 1S1VB 4TYAA 3CUNA 1T9WA 4I2QA 1RKIA
chains in the Genus database with same CATH topology
1UETA 2LLZA 1NK7A 1J2VA 3QIDA 1QY7A 4R0JA 2FJVA 1DHMA 1VQPS 3VAFA 4PG5A 4DG1B 1ZTTA 4F4YA 4I7FA 5A6WA 4NZ7A 4U6PA 1HNIA 3HKZD 2ZE2B 5G0RA 3I5AA 2QLXA 1YJNS 4B3MF 4NZ6A 3OFFA 4RBVA 2GQ2A 2XMJA 1K0VA 4R25A 5FLXY 1TV6B 1FXDA 3GIIA 1YGYA 2WB1D 5DO2A 4RNMA 4PCQA 2VOOA 2CVIA 4CCHA 2YNFB 3KG1A 2BJDA 2CPFA 4X4PA 2ROGA 1UJ4A 4WU2A 3HHLA 1S0VA 3EUNA 3DNCA 2M52A 1HYSA 1QE1B 2A18A 3HP6A 4KFBA 4NCGA 5A8RA 2PO4A 2NYIA 3DI6A 4TQSA 1ELOA 3EPGA 3KG4A 4MK9A 3AY0A 2K7JA 3J7YU 5C42A 3KLFA 5ITHA 4X66F 2DNNA 4N56A 2XMMA 4NYZA 3MECB 1UVLA 2FJAB 2DGVA 2EFPA 1HL6A 1Z2LA 4A4JA 1C1CA 2YNGB 1M90T 1JLQB 2BE2A 2CPDA 1YRUA 3HLUA 2RQMA 4YHHF 2GIQA 1D1UA 3CCLS 1GT8A 3NMRA 4WXWA 5GAEI 3V4MA 2DHAA 3HO1A 1U2FA 3C6TB 2QZ8A 4N5SA 5A2QY 1P8GA 5E33A 1CEZA 4IYQA 2KU7A 4ZLPA 2MGZA 1VQ7S 1RT7A 5LT5A 4EBDA 4QCLA 4FF4A 1TFWA 4B3OA 2AYBA 4WKYA 4DUZF 1S72S 2J7KA 1AW0A 3MEDA 3PRBA 4IOBA 2XG8A 3FJ2A 4RUHA 3RU0A 4O4GB 1S1XA 2DHXA 2R8GA 2HNZB 4RW4A 2NPIA 3OXLA 3MR2A 1FKPB 5DM6Q 4ECVA 2M0GB 3N6NA 2HFNA 2IC3A 4AL6A 1NJWA 2DGSA 3AQPA 4JI8F 2GV1A 4OI4A 5E5NA 1Y7PA 4JUZA 1BWEA 1TUVA 3L7PA 5KFFA 1S0OA 3Q2SC 2OD4A 5AXLA 3OL6A 4P7VA 1VRTA 1Q8BA 3M6UA 3BSOA 2OFGX 4Q43A 4ZPDA 3I4HX 4Y2MA 2ZHBA 2AX0A 2YKMA 4FNIA 4ZPTR 4RW8A 5F3ZA 5KT2A 4TU7A 4XK8C 1U6BA 5T7LA 1WG5A 2F4VF 5E41A 5B0EA 3CT9A 2IJFA 3BGLA 3KJVB 4MH8A 3UDLA 1RISA 3LH2S 2R7SA 1KRPA 3I82A 2DNMA 1Q86T 4K5RA 2MQLA 2HHPA 3IGNA 3NLCA 4NLDA 1K0TA 2KDOA 3W7BA 1R8PA 2OP5A 3FMWA 2XNRA 1IN0A 1VGYA 2XS5A 3MMBA 4YB5A 2YY3A 2E9RX 3CCWA 5KG0A 2B5JB 2MZSA 2YX4A 1AFJA 2IHR1 4WZMA 4ZK7M 1WACA 4I64A 2D74B 1FRIA 5HMXA 2KM8B 4A8QA 5CYMB 4MIAA 5J1PA 2FHJA 4KV8A 1LFPA 5KFYA 3V6HA 3L95X 1FVQA 3NS6A 1YJUA 3ENQA 1A6LA 1VQYA 2JC1A 4C3LA 4FYDA 4YB6A 1FD2A 2HRYA 3F44A 3TANA 2BZ2A 2JVOA 4I2QB 1FNXH 4Z2XA 1ZM3A 1S79A 4QWEA 1OO0B 2WSFC 2VFSA 1HWIA 2J7UA 1FRJA 1BLUA