4R0EA

Crystal structure of the poliovirus rna-dependent rna polymerase low-fidelity mutant 3dpol h273r
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHRLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
publication title Structural Dynamics as a Contributor to Error-prone Replication by an RNA-dependent RNA Polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
total genus 141
structure length 461
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4r0eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r0eA02
4IFVA 1HARA 1TKTB 2C2RA 1C0UB 3IG1A 3C6UA 2FJXA 2E9ZA 2YKNA 4EYIB 5D3GA 1QE1B 1XR5A 3HHKA 1S6PA 1S9EB 1SH0A 2UUTA 2AWZA 5T14A 1T03A 2W9BA 3KK1A 3NKYA 3KMQA 3HKWA 3KK2A 1CSJA 3FRZA 3KJVA 5KFQA 3OL6A 3QIPB 1HYSA 2BQRA 3LANA 4Q0BB 3MR2A 5KFWA 2J6UA 5J2NA 2IJFA 2GIQA 4R8UB 1IKWA 1RTDA 4ECTA 3I0RB 1RT2A 5C5JA 5J2PB 1DTQB 4RW8B 3MTKA 4URQU 4GC6A 2QV6A 3IGVA 3OLAA 1S6QA 4RW9B 3DI6A 3BQ2A 2YNGB 3H5YA 2XI2A 4DL7A 2XWYA 4H54A 4RW6B 2UVWA 1TKTA 1J5OB 5KG2A 2ZE2A 4DL3A 3Q8QB 1JLCA 2R8IA 1RT1B 5C25B 5J1EA 1QE1A 4NLQA 5DG9A 2XCPA 4ZPBA 4ECSA 1S9EA 1SH2A 4Q43A 3H40A 4J9RA 1S1UA 1RYSA 3DDKA 3RB6A 3QLHB 3PR5B 5DGBA 4MIBA 1S49A 4O44A 4WE1B 2HMIB 2FLPA 4PWDB 2WTFA 3QIPA 4Q0BA 4YP3A 2RDIA 4H4OA 4I7FA 1RT7A 2WB4A 3KLHA 4HYKA 4ECQA 1XR7A 1C0TB 2HNYA 5KFOA 2JEIA 4R8UA 4ZVEA 2BRLA 4B3OB 4TLRA 5J2QB 4RU9A 5J2PA 4RW8A 1JIHA 4DEZA 1S0OA 1S4FA 4RW9A 4RZRA 3BJYA 2UVVA 1TL1A 2B5JB 3T5JA 4K4YA 2OPRB 3CJ5A 4RW6A 3QO9A 5J2MA 3DRPB 4Y34A 3M9NB 5KG7A 1S0MA 4LQ3A 4I2QB 4LSNB 2ASLA 3OHAA 3DRSB 3T5LA 3NL0A 5F8HA 5KFKA 4K4UA 2J6TA 1RT1A 4U6PA 3KLVA 5KFFA 2GIRA 4TY8B 2FVRA 3BQ1A 3MR6A 3DOLB 4IH7A 2HWIA 5KFGA 2IAJA 2ALZA 2W9AA 5KFJA 3QLHA 3FFIB 2W8LA 2RKIA 2IJNA 1N5YB 1LWCB 1JX4A 4YR3A 4ED3A 2YNIA 1S48A 2VG6B 3PW5A 2R2RA 4NLSA 5DQGA 3OHBA 5J2QA 3EPIA 3DMJA 1QUVA 3KHHA 3TAMB 3BQ0A 4ICLB 3I5BA 4LSLA 4ECXA 4ECYA 3BSOA 3PVXA 5L1KA 3CWJA 5KG1A 3V4IA 3G6XA 4J9NA 2OPRA 4O3QA 1S9FA 4WYWA 4NLPA 3QGGA 3Q8SB 4LSNA 1RT3A 5I42B 4Y3CA 3UPFA 1KLMB 3NBPB 5JUMA 3OSNA 2W8KA 3TQ1A 5EWEA 3KHGA 4NCGB 3BREA 3RBEA 1JLGB 4TY8A 1HPZA 3GIMA 2V4RA 2WOMB 4Q45A 3H5XA 3DOLA 3OLBA 3DLGA 3QZ8A 2QE5A 4KBIA 4J9SA 4F4XA 3FFIA 2RF2B 1RTIA 1KHVA 4KO0B 3UQSA 3HVWA 4KKOB 1N48A 1N5YA 3N6MA 4J9KA 1D1UA 1LWCA 5KFEA 3IG1B 3C6UB 3IGNA 4Y2CA 3QIDA 4PQUA 4ZP9A 5KT6A 1RA6A 4YR2A 5D3GB 3E01A 2YNHA 5KFLA 4ICLA 3TAMA 2YNFB 4H4MB 3KHLA 2R8KA 3OL9A 3KLIB 2IM3A 2W9BB 3KK1B 4O3OA 3KK2B 4K4WA 2XGPA 2RDJA 4MKAA 4MKBA 5CYQA 1JLAB 5I42A 1LWEB 2IM2A 2IA6A 2VG5A 3GYNA 3DLEB 5J2NB 5KFUA 4EYHB 2OPSB 1IKWB 1RTDB 1LW0A 5I3UA 2F8EX 1RT2B 4NCGA 3CO9A 1C1BA 1JLGA 3V6HA 4IR9A 2R8HA 2WOMA 1S6QB 2YKMA 3DI6B 3G86A 5KFPA 2HAIA 2WRMA 4O3NA 5KFXA 1N6QA 4NLXA 4IG3A 1S0NA 4NLTA 4WZMA 3FQKA 2V4QA 1RAJA 1U09A 4NYZA 1K1SA 2ZE2B 4YR0A 3V6KA 5HBMB 1JLCB 4ZPAA 2WONA 5J1EB 1T05B 5KG5A 4MK9A 2YNFA 3ITHB 4H4MA 5KFTA 4OL8A 1DLOA 1S1UB 3KLIA 4Q44A 4YQWA 5KFAA 4HKQA 1SUQB 4O44B 3PW7A 3PW4A 3QZ7A 5DLFA 4ZPDA 1OS5A 4H4OB 2VG7B 2OPQA 1JLAA 1RT7B 1UWBA 3CJ2A 1LWEA 4I7FB 4MH8A 5FDLA 3KLHB 1C2PA 2HNYB 3DLEA 3T5KA 2OPSA 3PHEA 2CJQA 4TQRA 3EZUA 4O4RA 3DM2A 3JYTA 1TL1B 4ECRA 1ZTWA 2E9TA 1LWFA 1ZETA 2IM1A 2J6SA 2D7SA 3QO9B 5J2MB 4IQXA 3CDEA 3I0SB 2BQUA 4IG0A 5KG3A 5HBMA 2W9CB 4ZP8A 1I6JA 4TYBA 4I2PA 3N6LA 2R2TA 1GX6A 2BANA 1T05A 1QAIA 4M95A 1T3NA 5EUHA 3ITHA 2IAJB 4MK7A 3G6YA 3CDWA 5DQIA 1SUQA 1EP4B 2AGPA 3RAQA 1C1CB 2RKIB 3BR9A 4PUOA 2VG7A 3FDSA 2YNIB 2W7PA 1HQEA 4ED8A 4IKAA 1S1WB 4RW4B 2FJWA 5KFMA 4KFBB 3KNAA 3IRXB 1TL3B 3DMJB 4FBUA 2FVCA 4IRCA 4LSLB 4KSEB 4F50A 1FK9A 1RT4B 5EDWA 3V4IB 4IFYA 1GX5A 1KHWA 2OPPA 4XPCA 1NNDA 5C42B 1Z4UA 3RB4A 3CJ0A 3I0SA 1RT3B 4ZVGA 4EBEA 5CYMB 3KK3A 1S10A 2B6AB 4NLDA 2W9CA 2VA2A 5KFCA 4KV8B 3T5HA 5KFDA 1IKYA 1HPZB 5L1IA 3T1AA 5DG8A 3DLGB 1S9GA 4J9OA 1TP7A 1TQLA 4RNOA 2C28A 4Q8FA 1HNIB 5L1JA 1RTIB 1EP4A 1C1CA 3H5UA 1N4LA 4ZPCA 5KFIA 4O3SA 3SFGA 2FVSA 3QYYA 1S1WA 4RW4A 1SV5B 4WXOA 5KT4A 4F4ZA 4NLGA 4KFBA 1S1XB 4PQUB 3IRXA 1HQUA 3MF5A 5HROA 4Y2AA 1TL3A 3E01B 2YNHB 3NAIA 1REVB 4U7CA 4MIAA 3KLEA 2AX0A 1RT4A 1IKXB 1FKOB 4M94A 3MEGA 1S97A 3IN5A 3I5CA 5L9XA 3NAHA 4MK8A 3MEEA 4K50A 1TKZA 5CYQB 1W25A 5C42A 2UVUA 4URGA 2AQ4A 2I5JB 5CYMA 2VG5B 2OH2A 2B6AA 2V0NA 3MECA 4K4VA 1VRTB 4KV8A 1LW0B 4KAIA 5I3UB 4TQSA 1C1BB 1JKHB 4O4GB 2FJVA 1LW2B 1IKVA 4WFXA 2YKMB 4NRTA 3I5AA 1JLFB 3D5MA 1HNIA 3OL7A 2ATLA 4ZHRB 1N6QB 4IG3B 1NHUA 4EO6A 5JXSA 3GV7B 3UDLA 4F4WA 2FLLA 1XR6A 4ED0A 2C2DA 4TYAA 4KB7A 1SV5A 3RBDA 3NGDA 1S1XA 2WONB 4WYLA 5KFVA 2R2UA 5HLFA 2EC0A 3GQCA 1REVA 2R8JA 2D3ZA 5KFHA 1DLOB 2VA3A 1IKXA 1FKOA 5KT2A 1MMLA 3T19A 3ISND 2BR0A 2OPQB 2UUWA 1UWBB 2I5JA 5FDLB 1D0EA 4R5PA 3Q8PB 3MFIA 3LALA 4URSA 3RB0A 1VRTA 4QWDA 2JEJA 4G3IA 3H2LA 3H4BA 3LP2A 4RUCA 3KHRA 1RA7A 3LP0B 1JKHA 3DM2B 4K4XA 4O4GA 3JYTB 4KHMA 1LW2A 5KT3A 1NHVA 3KOAA 4QW8A 3DOKA 4IH6A 3PR4A 3SI8A 1JLFA 2BRKA 4GC7A 2JEFA 3KLGB 2WK4A 1LWFB 3VQSA 4ZHRA 4IRDA 1DTTB 4WZQA 1RT5A 5K14B 3JSMA 4JV0A 3RAXA 4LQ9A 4ZMMA 4IG0B 2UVRA 2IBKA 2E9RX 1MU2A 4I2PB 2BANB 3GILA 3V6JA 4G1QA 4TN2A 4KHRA 3FQLA 4ED2A 1RTJA 1TKXA 4J9QA 4K4ZA 3MFHA 3TVKA 3H4DA 1RTHA 2HWHA 4PUOB 3KMSA 1T94A 3SFUA 4QPXA 3LP1A 1RDRA 4TY9A 5EWGA 2ILZA 3M8PB 1HQEB 5C24B 3OL8A 3PZPA 4NLUA 2AGQA 2DPIA 4Q8EA 3H98A 3G6VA 2FVQA 3LP0A 3GIJA 2BQ3A 3NMAA 1FKPB 1TVRA 3HVAA 4RW7B 1FK9B 5KG0A 3M9MB 4IFYB 3UR0A 4NLWA 5F8GA 1S1VB 2HNDA 2OPPB 3KLGA 3GV5B 3DLKB 4EBCA 1SH3A 1DTTA 4DL5A 3PW0A 5K14A 2D3UA 2JLEA 3BGRB 2O5DA 3HVTB 5KFBA 5F9NA 3GIIA 4DL2A 2CKWA 3DYAA 3KK3B 1EETA 4F4YA 4FS2A 2XI3A 5F8NA 4XPEA 1JLBA 4J9MA 1ZTTA 3N6NA 1IKYB 2DPJA 2ZD1A 5HP1B 3C6TA 4RNHA 5DQHA 1S9GB 1IM4A 4QW9A 3KLFB 2WHOA 4K4SA 1RT6B 4ZVFA 2XCAA 4QWBA 1YVFA 2IC3B 3DRRA 3M8PA 1BQNB 5KFZA 4MFBA 5C24A 3MR5A 1HQUB 5HROB 4J9PA 3V81B 4NZ0A 3KLEB 4TXSA 1FKPA 1C0UA 1QAJA 4RW7A 4IR1A 2JEGA 4ECZA 3MEGB 1S1VA 3DLKA 2JC1A 3MEEB 4EO8A 1TKZB 3BGRA 3HVTA 3IS9B 2AU0A 4ECUA 3M8QB 3MECB 4IOBA 2FLNA 4ZVHA 4JV2A 3BSCA 4FS1A 3V6DB 1N56A 4ECVA 2XC9A 5HP1A 1IKVB 3E51A 1R0AB 1JLQB 3QGIA 5KT5A 3KLFA 2R8GA 4ZP6A 5KFRA 1HMVB 1RT6A 4DG1B 3I0RA 2C22A 4RNFA 1DTQA 2IC3A 3CDUA 1BQMB 4WFZA 1BQNA 4K4TA 5KFSA 2YNGA 2W7OA 4DL6A 4WXWA 5HLFB 3V81A 2ASJA 5F8IA 1J5OA 3H5SA 3D28A 4ED7A 3Q8RB 4IDKB 3ISNC 5C25A 4NLYA 3IS9A 2BE2B 3M8QA 4R5PB 4JV1A 2HMIA 4KE5A 2AX1A 4WE1A 2GC8A 4PWDA 3LP2B 3V6DA 5L1LA 5EWFA 1S1TB 2AGOA 1R0AA 1JLQA 3DOKB 1C0TA 3H59A 4O3RA 3PW2A 1HMVA 1VRUB 4DG1A 5KT7A 4RNNA 4B3OA 1JXLA 1RT5B 3JSMB 4QWCA 2B43A 4NLOA 4J9LA 1BQMA 3RB3A 1HNVB 2B5JA 5KFYA 3CIZA 1JLEB 1MU2B 2WCXA 5F9LA 3DRPA 3LAMA 1TV6B 4G1QB 4I2QA 1RTJB 1TKXB 4XO0A 2IMWP 4JUZA 4FBTA 3OSPA 3DRSA 4YMEA 4IDKA 1RTHB 4ED6A 4R0EA 3PJXA 3LP1B 3MEDB 2HNZB 4O3PA 2BE2A 4RUAA 4ECWA 5KG4A 4ID5B 1K1QA 5F8LA 2R2SA 4DL4A 4EEYA 2D41A 2FVPA 5F8JA 4IFVB 5DGAA 1S1TA 1TVRB 2I1RA 4ED1A 2C2EA 2IM0A 2VG6A 5DLGA 1VRUA 5F8MA 2HNDB 2YKNB 3CJ3A 5KFNA 2ZKUA 4IH5A 3LAKA 3M9OB 4WFYA 3QGHA 4NRUA 1S6PB 2V9WA 1T03B 2JC0A 3DYAB 1EETB 1HNVA 3ICLA 2XGQA 3BSAA 1JLEA 3KJVB 1JLBB 1RYRA 4RNMA 2ASDA 5KG6A 2ZD1B 1HYSB 3CVKA 1TV6A 3GIKA 3C6TB 2ILYA 4NLVA 3NBPA 1KLMA 1WNEA 4NLRA 5DG7A 4IRKA 4X2BA 3BSNA 3FSIA 3DRRB 3MEDA 2HNZA 3MR3A 3PJWA 4QWEA 4QWAA 4ID5A 3EPGA 4MFBB 4ZP7A 3GV8B 2RF2A 4KO0A 3CJ4A 4EBDA 4KKOA
chains in the Genus database with same CATH superfamily
1E6VB 2GVZB 4LFCJ 1QE1B 5IOLA 1S9EB 1LV5A 3PIOQ 4G6VB 1Q8IA 2BQRA 4S0MA 2QRRA 4ILRA 4C0OC 2E5LF 5J2PB 2CZ9A 3VVTA 4MYUA 5J1EA 3SCLE 2MLYA 3BYPA 2DTJA 4I4BA 5DGBA 3JTOA 2IBOA 4DV6F 1OIAA 4EFAC 4FDFA 4E8UA 1PCAA 2EFNA 4DV3F 3T6JA 2B5JB 2FY8A 5AE3A 3TJAA 2G0IA 1LK5A 3OHAA 2OD6A 5KFKA 4MTPA 4TY8B 4GKKF 4CCHA 3CCVS 4WKRA 1NK7A 3GR1A 4C48A 4C6AA 1YWXA 1V3ZA 3MD3A 2PO4A 3OSNA 3KUEA 4C97A 2CPYA 2Q66A 3LA0A 4UW2A 2A1BA 1UMJA 2AJ0A 1R7IA 2G9OA 3C6UB 2VPZB 1ZM3A 4H4MB 2CWXA 3MEKA 3CCSS 5K9FA 3E3XA 5A8KB 2IA6A 5D8HB 3KG0A 1RT2B 1JWWA 3CO9A 1K0VA 1C1BA 1H6KX 3HM9A 3CJ8A 1JNZB 4OHYA 4USKA 1NB7A 3GPAA 4OI0A 2J0XA 2KZZA 2VBXA 3CSKA 4FF2A 1HBNB 4OLOA 2Y8WA 3PV8A 2XS2A 1JLAA 2IHR1 2W1BA 4ECRA 1ZTWA 1QVGR 4PPDA 4DPUA 2RHSB 4LR8A 4FPRA 2R2TA 3AAWB 3HD1A 3W8GA 3BR9A 1U6FA 2FJWA 3IRXB 1N36F 1ZH5A 1GX5A 1I94J 4WWSA 2GAGC 4IOCQ 3BEGB 4NLDA 5L9NA 3FCWA 4Y00A 2GAHC 2UV8G 5IQQA 2H5IB 3CXCR 2XYHB 5L1JA 4ZPCA 2DVIA 1DHMA 1S1XB 2UUBJ 3NAIA 3KLEA 1RT4A 1F60B 3H0PA 2BM0A 4F7VA 4EI2A 4M5LA 1J5EF 5D15A 5CYMA 2UZAA 2V0NA 4OI6A 1T9UA 3SQOP 1O0PA 3V2UC 4FXWA 3I5AA 4DX5A 4ZHRB 3D0HE 2VBYA 3NNHA 2V8HA 4C3LA 4O0NA 2AZ3A 3B82A 1F6TA 3JB9k 4WYLA 5KFHA 3BBFA 1CJVA 3IBFB 4Q7AA 5KT2A 2RSQA 2HQFA 1VQ8S 1KVJA 4B17A 4CO0A 3ZTSA 1T9XA 4N8NA 4BC7A 4ZMMA 2UUCJ 4ZCLA 1FESA 4WK1A 3BDEA 4ED2A 1V3SA 1F5BA 1RXOB 4DXLA 5H9EJ 3C15B 3OL8A 1XTZA 1NSAA 1R6YA 3R2DJ 5K14A 3NS5A 1R6VA 1EETA 4XPEA 3I9ZA 2ZJQQ 5DQHA 4NXMJ 3KLFB 2NSBA 3TNVA 1KEKA 5E3RA 1MMDA 4YB7A 3IRWP 2RS8A 1ZYQA 1U24A 2CZVC 3MEEB 2WBRA 3BGRA 3IS9B 2K1RA 2CPEA 1SPBP 3O3LA 4CTAA 1R0AB 1WOSA 2FJDB 5KFRA 4F0MA 2MKHA 5L8RC 1XMQF 5I4MA 1NZAA 2YNGA 5E33A 3MPVA 3PKMA 3D54A 1UZHA 4F3QA 2IMOA 4NZ7A 2NYIA 3GR0A 4ZJOA 2OTJS 2B4OA 1JLQA 2OTLS 2F4VJ 3A3PB 1H7XA 1KONA 4DJBA 2Z0GA 5EN1A 2HAFA 1CC8A 1WG4A 1DQAA 3ADAC 4ID5B 2KFNA 4DL4A 2I1RA 3MM5B 4PAAA 2ZD1B 2DISA 1WWHA 3EZOA 1WNEA 2ALYB 4N8OA 4B3TJ 3CULA 1JNRB 4QWAA 4MFBB 2MSTA 2FJXA 1WELA 2E9ZA 1HW8A 5A8RB 4Y2MA 1HNXJ 1CSJA 5DDRC 1HYSA 2E7VA 5KFWA 5IWAF 3QRRA 2XZTB 2OI2A 4JI0F 3KXDA 4ED4A 1J5OB 2B0GA 4LJMA 1S6OA 2ZE2A 3W2WA 5C25B 3HXMA 3NWRA 3H40A 3BZQA 1HBUB 1S49A 4ES2A 3E2EA 2RB7A 3DGPA 4ELUA 2KRBA 2XG8A 2RAQA 4DV2F 2ASLA 1ZM9A 3U02A 2QL7B 2KM8C 1CJTA 2DRDA 3ILOA 3PX6A 1Q8BA 3DLBA 2DHXA 3FBFA 2ZZTA 4ECXA 2D3OR 4NYPA 3OJUA 4C2MA 1E6YB 3BREA 1JLGB 2V69A 4XIUA 1JJCB 1FRXA 3QZ8A 4F4XA 5BJRA 3UQSA 5B0CA 1N5YA 2D9PA 2P9CA 3UWTA 2K8GA 1EIYB 4ICLA 3RRGA 2IM3A 5A76A 2VFRA 2B51A 3CPWR 1GXLA 4NL5A 2WRMA 1S0NA 1CJUB 3N5BA 4NYZA 2Y0SD 1MG7A 2WONA 1IBKJ 2NYHA 2CQCA 2DNZA 3FUYA 2B9WA 4UZCA 4G1PA 2CJQA 5G0RB 3CJKB 4DSIA 2JL9A 4DS5A 2BJ1A 5J2MB 2ATCB 4EMDA 5DQIA 4WU2A 2EBGA 1K9MT 4FP9A 1Y00A 4IKAA 1KQSR 4LF5J 2ZBCA 2AIRB 1M1KT 2LXFA 4UTGA 3FMWA 2CQGA 2HS4A 1KNZA 3H5UA 4WXOA 4F4ZA 4KFBA 3W5ZA 1N32F 1FI4A 1W25A 1X4EA 4JI4F 1VJQA 1HHTP 1S5ZA 4O4GB 4WFXA 3LGHA 4BHQA 4IG3B 1X9WA 4F3MA 2V50A 3M8RA 1VQ9S 3F56A 3T19A 1DBDA 4LBIA 4ZS6A 4HI1A 2HLUA 4UUXA 4AL7A 3LP2A 4RUCA 1K0TA 3EGNA 2MKCA 1NHVA 3SI8A 2DK2A 4USJC 1IQTA 4EWTA 1RTHA 3H90A 4ELVA 4ETXA 5C24B 3GYGA 1N88A 2RDDA 4YOEA 4IQMA 3M9MB 4FZVA 3DLKB 4DL5A 3EVOA 5F9NA 3N28A 3PIPQ 1IBMF 2P9GA 1I51B 1S9GB 2PDAA 4ZVFA 4DV1F 4WFBQ 4OJGA 5A2QU 1Y7PA 1QM9A 3M8WA 1BQNB 5KFZA 4U96A 4X64F 2V8PA 2CJAA 2R3VA 2ZWOA 4DUYJ 1Z2ZA 1OQ6A 3M8QB 4BDPA 3BSCA 2G1DA 3V6DB 1NJXA 1VHIA 1IKVB 2NPIA 3M2RB 1RT6A 2IC3A 3OR2A 3R97A 3TX8A 1UJ4A 1BQMB 3KKFA 2RJZA 5T41A 3OTBA 1RAEB 1RSCA 3H5SA 2AYMA 4ED7A 5BR8J 1FFWB 4B9UA 4R5PB 3DLLQ 3MM6A 1Y11A 2X1GA 3L95X 1A0OB 1RAIB 3ENWA 1C0TA 3PW2A 1SC4B 4OYAA 2BYCA 2J9CA 4DHVA 1Y5IB 2A0FB 2HGNA 4JUZA 2HHQA 1RCXB 4JI8F 3HZGA 2CPXA 2CWKA 4CYUA 5ETTA 3AA9A 1M5SA 3HT3A 4LREA 2NLWA 2VKRA 2DY9A 3BGLA 3UDVA 2DIVA 5DLGA 3R9LA 5KFNA 2CPHA 4EUVA 1QTMA 5IV3A 5GAGU 2FUG9 5JVHQ 1TV6A 3UE2A 4A46A 1RWOB 2QMXA 3LPEA 1GMUA 2LEAA 3QJLA 3ENQA 1PC4A 3OV7A 7FDRA 2C2ZB 1KC8T 2FZGB 2W9BA 3HKZD 3TQEA 3N0VA 1Y0HA 3KJVA 1U2RA 3QSYB 4NI2A 2GIQA 3HHLB 3SSRA 4BWJA 1TU0B 5ETVA 4F04B 1YJUA 3M4XA 3KG1A 3H5YA 2WVBA 2XI2A 4DOZA 1XIQA 3D67A 5KG2A 4DL3A 4C8MA 3KG4A 5GAHI 2FC8A 3TZXA 3RB6A 4ZLPA 2WTFA 5ETKA 3CJQA 4ECQA 1LXNA 2HNYA 2D9OA 3MD1A 1APSA 1SL1A 4K4YA 3CJ5A 4LF9J 3QO9A 1IN0A 2HLTA 4U6PA 2CZ4A 2V4JA 2FVRA 3JSBA 4BC9A 2G4BA 2RRNA 4YB6A 4NWBA 2NXCA 4DBQA 2FD2A 2VONA 2Z2YB 1B7YB 1VK3A 4B3MJ 1N34J 3VAHA 3Q89A 4DFKA 3MHYA 4NEYA 1HPZA 1RU1A 2QMUB 2WB1D 1OY8A 2HBQB 3FFIA 1H2VZ 4L73A 5DJBA 3A1YG 1URNA 5GADU 5C2GA 5LMNF 4HDGA 1JLAB 2ZZMA 1IKWB 3V6HA 1H98A 1UW9A 1OYEA 2QLBB 1V6HA 2KI2A 4OZ2A 2RILA 4PCQA 3PYDA 1FJEB 4DR1J 2OFHX 3PW7A 3AODA 3AXKA 1WI6A 4MH8A 1RBAA 3DLEA 3ZTRA 3PFEA 2DCUB 4O4RA 2HQDA 1X4BA 1TL1B 4RWWA 1LWFA 1Q8KA 2EEYA 4HH1A 4ZP8A 2Z56B 2MB0B 1W26A 3N6LA 3QFWA 2RKIB 1Z2LA 3FCHA 1T95A 3P45B 3GE9A 3R6GB 2XULA 4X4RA 1D9DA 1RT4B 2D74B 1LOUA 1RT3B 1TELA 5CYMB 2OSQA 3GFZA 1P1LA 3MM7A 1SIWB 3BO4A 4CO3A 4ZOSA 3PCOB 2VQEF 2HHPA 2WVDA 1XMOJ 3QYYA 1Y3KA 5FD1A 4HACA 5HROA 4U7CA 3A3NB 2LXUA 1IJFB 4OIXA 4V1Ak 2Y1JA 2V67A 3CCES 4C0HA 3Q23A 2VBZA 4FKXA 2LXIA 4LSZB 2OAUA 3D5MA 4D3GA 2ATLA 2A18A 2DR6A 1UCNA 3GJRB 3NGDA 2U2FA 1FE0A 2IRUA 3JTPA 1DLOB 2VA3A 1IKXA 4G65A 2IYGA 3C16A 2DKOB 4I69A 5FDLB 3UW1A 4URSA 3BBBA 2VC0A 4GC7A 3VQSA 1X4GA 2WZ1A 5K14B 4CIOA 4KIAA 1O6XA 5CYJA 5ETRA 1TAQA 4DPTA 1HWUA 4WP3A 4ZPTR 4P75A 1T94A 3SFUA 3MXHP 1V9OA 2JHEA 4RBTA 2VJVA 3UDCA 4GVLA 1HI1A 5F8GA 2C2NA 1H73A 3BGRB 2K1RB 2HVDA 5F8NA 3L7OA 3C6TA 4CTAB 1RCOB 1X9MA 3RRHA 2LMIA 1QSSA 4QOTA 2PE8A 1RP5A 3ZNJ1 5HL7Q 1SL2A 3MECB 3OTEA 2CJ9A 2EC2A 1JLQB 3J7YU 2C22A 5LSRA 2VKZG 4P6QA 2UXBJ 4WFZA 3W3SA 4OZNA 1VC0A 1UVLA 1H2UX 4M5HA 5CH7B 3OPKA 1ZAVA 2DNQA 3PG9A 2AX1A 2RUGA 4LFBF 2IVMA 4JP8A 2WCXA 4IUFA 1XNQJ 4DDFA 2YH0A 1NDLA 2CDQA 1RWXB 1K1QA 1WOOA 1HBMA 4X66F 5DGAA 4QR1A 2VG6A 4TU7A 5F8MA 2BV3A 2JC0A 1HNVA 3BSAA 1JLBB 3TUZC 1HYSB 2NCKL 4K2XA 2QO3A 3R27A 3ZTOA 5EGYA 4HH0A 3MR3A 4KO0A 4EBDA 1HBOB 3HD2A 3W2WB 3MAHA 4CLKA 2YWKA 5AJ3J 5KOXA 4LIWA 2UP1A 3CMQA 3DGPB 2V5HG 3IGVA 1S6QA 1U1NA 3NCRA 1WC1A 3Q8QB 2DHHA 1CJTB 3HJFA 1SH2A 2HFOA 3D6HB 3DDKA 1OSCA 2HHHJ 4Q0BA 2KB2A 2RRBA 4JI7J 1SC1B 1U26A 2QA4S 2YX4A 4KGXB 3DRPB 2P9EA 3M9NB 5E3QA 3TANA 2M7SA 2YVSA 1OPIA 1N5YB 2KZMA 4I67A 1X5SA 3K17A 3P96A 4Z7CA 4OHVA 5J2QA 3DMJA 3W8PA 4ICLB 3PVXA 5KG1A 3G6XA 4P52A 3W2VB 4NLPA 2HS3A 2BJ7A 4OYXA 5CCMA 2Y3YA 2ZBPA 5H9FJ 4KKOB 2MGZB 3N6MA 1VIXA 3FBBA 2O66A 3IGNA 4Y2CA 3OD2A 4DSKA 5J1PA 2R8KA 3K7RA 3RBXA 3I4PA 3W62A 4ZVRB 3SQGB 2V2ZA 1VLYA 3BH7B 1RADB 2DH7A 3K8VA 3R6LB 2DHGA 2ZHBA 1NK8A 2YNFA 1YIJS 5KFAA 2B9XA 4I7FB 1KQGB 2QJ3A 3T1HF 1QDUB 1SQGA 1FXRA 1SQEA 4ZITA 5D4OA 1Q95G 3Q2SC 2IM1A 4USMA 2OMLA 2PMWA 4WFAQ 2J7KA 3BF4A 2AJ2A 1U1MA 3KWMA 5DO2A 4UT4A 2L9DA 2JFDA 1WHYA 4LFCF 5IC6B 3PHTA 4PUOA 5IT0A 4X4QA 2FPHX 2HVZA 2JLGA 1U7LA 2RRAA 3D0IE 5KFMA 4KFBB 3KNAA 4QPTA 2UU9F 2HK3A 3LO3A 4XTTA 2ZH1A 3QNWB 3AJ2A 2FTRA 3KK3A 4B9MA 3T5HA 4LRDA 3MI7X 4DSFA 2EPIA 4RNOA 3HO1A 1IJEB 4A8MP 2IRYA 3DC2A 3NAHA 1TKZA 3M2UB 2V1TA 4EO6A 3FKBA 1U1KA 2BUNA 3TRGA 4QU7A 8AT1B 2R8JA 2D3ZA 2IYIA 4W92B 4YDDB 2ZDOA 4L3KA 2F65A 1CQMA 2C3MA 3F73A 4PPZA 3VGUA 1WACA 1L5UA 4IRDA 2N3OA 2IBKA 1Y10A 1AXQA 1N8RT 3KMSA 3M6VA 2BJDA 3K5NA 4QYZK 3GIJA 3TAPA 2OPPB 2ZVSA 1MMNA 2LLZA 4DL2A 3RR8A 1AROP 4ZPVR 3G71S 1ZTTA 1U1QA 1RLCL 1RT6B 2IC3B 4QJVA 3VAJA 2L48A 2AP6A 3MR5A 1HQUB 1PGZA 3CEDA 1B99A 3A8EA 5E2QA 3AX3A 2A10A 4JV2A 4USUA 4KYZA 1HR0J 1I1GA 5KFSA 4JI5J 4CDIA 2BVZA 1EB0A 1T3OA 4CYUB 2JVOA 3AX5A 3M1VB 1RBOB 1X31C 4YY3F 4LFAJ 4U7UK 3TUPA 4B3OA 3JSMB 4QWCA 2B43A 3EGVA 2FHJA 3LF0A 1TV6B 3VQTA 5D0HA 3DRSA 2UUBF 1FERA 4N56A 4ECWA 5KG4A 2WSCC 8RUCA 3LOUA 3ENVA 2BJ8A 4LF2A 3TVZA 3IR6B 3HF5A 3N4WA 3KJVB 4NI2B 1FD2A 3IWLA 3VHQA 2W4PA 3DRRB 3ET6B 2GHWA 4B9TA 3GV8B 5B0GA 1BY9A 1UL3A 2YKNA 3TZWA 4QIFA 2H65B 4F67A 3A4TA 2WW8A 5B0BA 5E7OB 2AJ4A 2HZCA 1PO6A 3MR2A 2UUCF 3OT9A 4M1KA 2O67A 1BQXA 3NCQA 4PR6A 1GXUA 3HSZA 3MTKA 5D0RA 2F9JA 3JS9A 2HHSA 2M9KA 3HI9A 1TKTA 4CNZA 2QC3A 1OMSA 5H9EK 1FF2A 2CADA 2V4JB 5DG9A 4TU8A 4DV0F 2R42A 2HFVA 2VL1A 4WE1B 1RHKB 1FT8A 4NXMF 3BJYA 2D68A 3G82A 1UP1A 3MM9A 5ITHA 1YJNS 4DX6A 4ZVSB 3CC7S 3MTJA 2CAJA 2HFSA 2PEBA 4ILMA 5KFGA 2FY1A 3FFIB 2IJNA 1HFEL 1EQMA 3DLHA 1FRIA 2E5JA 5DQGA 1QUVA 3I5BA 4LSLA 4ZCIA 3IAS9 1EX8A 4WYWA 2CQPA 3LQVA 3AOCA 4UZBA 2FZCB 2BM1A 2RT3A 2W2NP 5D78A 4KBIA 1FNXH 5CZXA 2DH9A 2JZ5A 4IYQA 5KFLA 3QGPA 3OL9A 3KK2B 2R9LA 1VDHA 3CCTA 3AXMA 2VF3A 3DLEB 3HULA 3DI6B 2NXEA 1KVKA 3M30B 1N6QA 3MCNA 2E5GA 3CD5A 5HAOA 3DNCA 3VAMA 3D4JA 1NSPA 1OS5A 2Y1IA 2UUAJ 1RT7B 2HHVA 1Q79A 1WC5A 4RX6A 1W7WA 1WKJA 3H42A 4BWMA 1VCTA 4B3TF 3Q8UA 1X0PA 4ZN3A 1GX6A 1T05A 1QAIA 1T9WA 1T3NA 1UUJA 1HNXF 2YNIB 4ED8A 1KOOA 4M5DA 5CABA 4DUTA 3CDAA 4Z37A 4O23A 2AJ1A 4B3SJ 2EWHA 2XTCA 1UEKA 1OYDA 5KFCA 1RU2A 1TP7A 6FDRA 3L3CA 3CCJS 2ZC4A 1IR1A 1JXVA 2VV5A 3SDEA 2J9EA 4Y2AA 4PG7A 2QZ8A 1IKXB 3C16B 2GCFA 3PRBA 3HPOA 3BN4A 2VG5B 4W4MA 2EW9A 4L74A 4X65J 4CLSA 1CLFA 3BV8A 3UDLA 2FLLA 4NCAA 1Q7LB 2LU2A 4HTJA 3RBDA 5A8WA 2NPFA 1NJWA 4F36A 1UFWA 3OFGA 1AW0A 2OPQB 2I5JA 4DL0C 1D0EA 4EZ6A 3MFIA 2B56A 2ZOFA 4PXDA 5GMDA 1NAQA 2MLXA 3JYTB 3OUYA 4QW8A 4IH6A 1GK8A 4KT0C 2Y0BB 1F9HA 1RTJA 2HG4A 2PMHA 3QT5A 3MFHA 4YN3B 4CLPA 3ELHA 2QL9B 3O6QA 5LOQA 3QWPA 4B9VA 3R5CA 4ENOA 3N6NA 4Y2KA 3G96A 1DAXA 3J80Y 1IBKF 1SKSA 1RHQB 3M7VA 2MJNA 4J9PA 1E6VA 2F8MA 4AL5A 3MEGB 4FYDA 1HLWA 4MJKA 4IOBA 2J8SA 3M8ZA 4UOGA 1HNWJ 4ECVA 5KT5A 4CLFA 2EK1A 1FJ7A 3UI3A 1HI0P 2XZDB 2PI5A 2FYXA 4ES3A 4LF5F 3DDNA 4C0BA 1EAYC 1S99A 3ISNC 4NLYA 4U95A 1YDLA 2AT1B 2R7UA 1S7IA 4OI4A 5ETMA 2RD5C 1SJQA 1HNVB 2B5JA 4E0DA 1N52B 1M5VC 1O5JA 4OQJA 2W2PP 1HA1A 1IBCB 3GFXA 2KKHA 2J9DE 2PN6A 2RVJA 2Q43A 1BD6A 1REGX 1TVRB 4ITSA 3W9IA 2DD8S 3DYAB 3ICLA 4PG8A 2HFZA 1V3RA 3ISZA 2R7QA 3MR7A 7AT1B 3LUYA 1VQMS 2RU9A 3BSNA 3RW6A 2YPYA 1YGYA 1G2EA 3C6UA 3WZ0A 3LW5C 1S6PA 2AWZA 1F0XA 4OYBA 2ROGA 4QU6A 4Q0BB 5LL6d 2L9NA 5A8KA 2IJFA 1RT2A 4GC6A 3OLAA 1GNKA 1PJ7A 5IQ6A 3BQ2A 2V8GA 2XWYA 3Q86A 1QLNA 1NK5A 3IWNC 2R8IA 3D1HA 3W63A 2XCPA 4A8YA 4ECSA 3TEGA 4F0KA 1HBNA 2FLPA 2LDYA 2Y9HA 2XMKA 1XR7A 2JFKA 2OUGA 3SSQA 5J2QB 5SUHA 2RMLA 2K06A 3UR3C 4I2QB 4RBVA 2X3DA 3T5LA 4XDDA 1DY3A 4RU2A 4LF8J 4IH7A 1VQLS 4DX7A 4DUYF 4RPFA 4YR3A 4ED3A 1P1TA 3U1MA 4DQSA 1T7PA 2MQQA 3JTNA 1RAHB 2OPRA 4JV5J 1M1GA 3Q8SB 4Y3CA 2XSFA 1YQHA 5BR8F 3Q22A 2XO7A 2VFVA 4ZDNA 1U0HB 2LEBA 3VGTA 1HIYA 2YNFB 2C2KB 1U48A 1OJ4A 2A6OA 3GYNA 5J2NB 4USTA 1D3WA 2NUUG 3ILJA 3NGKA 4O3NA 2I6WA 1QTNB 3J81U 3V6KA 4FXVA 4HT7A 3AQOA 2POKA 3NCPA 1CC7A 4DQQA 1GFWB 4LR7A 5D0GA 3ZZ0A 3MWBA 1OO0B 1WKKA 3PM9A 3AJDA 3UN5A 2OELA 4FNIA 4QIEA 2E1AA 2BKPA 5EX3A 2LQBA 1SUQA 5B09A 3TZZA 1T9YA 2OEKA 3D68A 3BYRA 5A2QY 1KFDA 2EG1A 3FDSA 3C15A 1SL0A 1ZPWX 1X4FA 2FIUA 5D4NA 3R3TA 4ILLA 1YLXA 4DCJB 2HHWA 3RR7A 1S10A 5DDOC 5K5MA 1ZS6A 3AQPA 3T1AA 4JB8B 1C1CA 1X0FA 3SFGA 5KT4A 1FHTA 1PAEX 4OMFG 3OXGA 1G6BA 3T1YJ 3MEEA 4K8RA 3ETMA 2OH2A 4LF9F 1HNIA 4HHUA 1NUEA 1IR0A 2CQIA 3WDOA 2C2DA 5KFVA 1MWQA 4ZN1A 4OI3A 2BW7A 1FKOA 3MMBA 1VQPS 4LVNP 4WKYA 4B3MF 1UWBB 4W98A 2QIFA 1N34F 3I6PA 3EZ5A 2I8EA 2CG4A 3TP2A 4DV4F 3EJMA 1U1OA 1DQ9A 3P8BB 3ZXWA 3LWMA 2A2CA 4KGZB 1HQEB 2CA9A 2E7WA 2EG2A 1U02A 3UVJB 5M2PA 3K2YA 2CKWA 3MM5A 2XZWA 2XI3A 4DR3J 2ZD1A 2GVDA 2E1PA 3BPDA 1Q16B 3IBWA 4MFBA 1FX2A 2Z30B 2W2MP 3KDOA 2JC1A 5A8RA 4EO8A 2AEJA 1PIEA 2ERRA 2RUSA 4E98A 1QY7A 5AE2A 3NY0A 5IXUA 4M5IA 3CD0A 2OMOA 3K58A 1J5OA 2YPZA 4P2FA 5C25A 2XLJA 2R7VA 4C7QA 4BLGA 2ZOGA 1HBUA 4KE5A 5L1LA 4LF6J 3H2UB 3DOKB 1RT5B 4N5SA 2CYYA 2CIMA 3CIZA 1WJ9A 5F9LA 2DEJA 2C1EB 2HQCA 1XMOF 1RABB 2GQQA 2ABYA 3CNQP 4IDKA 3I32A 5LJ3Y 4ZLJA 3D6TB 2PEHA 1R8PA 5F8LA 2D41A 1NKBA 1VRUA 2YKNB 3CJ3A 1Q5YA 4IH5A 3TX0A 3M9OB 3KJNB 1ZA1B 2FHJD 2ASDA 4CO2A 2XNRA 1QAYA 1ROFA 2LP4A 3C14B 5AXKA 3ZC4A 4IFVA 1TKTB 2FZKB 3LH2S 3THVA 2E5IA 3WHIA 2UUTA 2QFJA 1H38A 4DQIA 2G13A 3LANA 3CCZA 4DV3J 3I96A 1UPPA 5D4LA 1WC6A 1XN9A 3DRXA 4P73A 2DGXA 3OFEA 2UVWA 3KYLA 2VICA 3MM9B 2FHMA 1F5AA 3U27A 4V19X 1X8DA 3W64A 2RDIA 3U1LA 2J9DA 2DY1A 1DFDA 3AB2B 2Q6BA 4P7TA 1AYEA 1SJRA 5J2MA 3BKFA 1ULRA 1S12A 2VFUA 2F7VA 5KFJA 2KHDA 2E1RA 1NB2A 1UKUA 1JX4A 1YBAA 1Z1ZA 2R2RA 2DNHA 4NA2A 1S9FA 2UXBF 2GX8A 1KLMB 1U1LA 3JSYA 3GIMA 1JJ2R 2BX6A 3QT8A 1R8CA 1KHVA 3P3DA 3IG1B 3HJVA 3Q24A 1NCLA 4NA3A 3HSGA 3UD4P 2WVCA 2KG0A 3TA1A 1XNQF 3OVBA 4IG3A 3FQKA 2GJ2A 3LGMA 3QPIA 4L76A 4WP9A 1T05B 1NSQA 5K8PA 3WIUA 1VBYA 4O44B 3DLJA 3MMCB 2LECA 1T8EA 1NK9A 4OI1A 4H4OB 3CJ2A 5GVQA 4M5DB 1HD1A 3NGSA 2W7AA 2GFFA 2KYXA 3CDEA 4QCLA 3O5TB 3FJ2A 2GO8A 2DNOA 3OTDA 3R5BA 3SDEB 5AJ3F 1S77D 5ETLA 4F50A 1GQEA 3RUBL 3GSIA 1FJCA 3TUJC 1Z4UA 3ZZRA 3PRDA 4WP8A 1TK5A 2ZJPQ 2VA2A 3TUIC 5L1IA 1S9GA 5ETPA 4Q8FA 4EK2A 1R89A 2HHHF 2FGCA 2BABA 5A8WB 2O01C 1Q5VA 1PAUB 4ZJQA 4JI7F 2XS7A 3BKUA 5L9XA 2KL8A 1NKEA 5IT9Y 4URGA 2I5JB 3C3LA 1TUWA 1IKVA 4HDHA 2YKMB 4NRTA 3OL7A 2CPIA 5E3AA 5K8MA 2OEMA 4ED0A 1UZDA 1FTRA 2ZKTA 1LKZA 3BB5A 3EGWB 4RWXA 5B0DA 3HCXA 2B4UA 4R5PA 3Q8PB 1VRTA 2N82B 1GH8A 4KRWA 1RACB 1JLFA 3SZ2A 1BE4A 2LKZA 5BYRA 4HHJA 2CPJA 1UFKA 2HBZB 5H9FK 2XQCA 2BANB 2HW3A 4R25A 1RHJB 4D3HA 4DZ6A 4NMXA 3PX0A 3MPYA 2APOA 1OY6A 1SXLA 4MYTA 5IV4A 4J37A 2FVQA 1FWPA 3FEYB 4IFYB 4NLWA 3KLGA 1PJ5A 3GIIA 1C4CA 4LF1A 1IKYB 2LQ5A 3KNGA 3ZZPA 4WCEQ 5K20B 2ZEJA 3PXGa 4C8LA 1WTFA 1WC4A 1XJWB 4Y65A 3I87A 3RU0A 1VQ4S 3A8IA 4NZ0A 4RW7A 5AXNA 4ECZA 1DZ5A 2B7BB 1UEVA 5DM6Q 4WFNQ 4J90A 1GTHA 3ENAA 3HHLA 2XLKA 3NS7B 1XBWA 4J7CA 3CDUA 4MT1A 1CG2A 4MAKA 1AZSB 5F8IA 3Q8RB 4X4TA 1UTAA 1VISA 3W5XA 1Y5LB 4JV1A 1FE4A 2GIFA 2GC8A 1UAWA 1OWXA 1VFJA 2GS8A 4CM2A 2D3O1 1HI8A 1OPZA 2C2OB 3HHDA 1HHQA 4RR5A 2KH9A 4C8OA 3QBCA 3CTRA 2HHTA 4X4OA 1TKXB 4YMEA 2NXJA 2NS1B 1DURA 1FTCA 2BXJA 1T9TA 4X4VA 4A8WA 1SJ1A 2UV8A 1S1TA 4ED1A 2B7CB 1GEHA 6AT1B 1S6PB 1MNEA 1MLAA 2XGQA 5HMYA 4RNMA 2DIUA 2HRUA 5D0EA 2M3DA 2GGPA 2GJFA 4IRKA 1UPMB 2HNZA 1CPZA 5CD4A 1PSDA 4I6AA 1C0UB 1SJ4P 4EYIB 5T14A 1HWJA 5J1NA 1QSLA 1FJGJ 4U67Q 3CO0P 3RJMB 4L72B 1IKWA 4DV2J 3CD7A 2HS0A 2L9WA 2M8DB 1VQOS 4P74A 3UD5A 4PYAA 3VZIA 4PWDB 4YP3A 3IR7B 3UCUP 4RU9A 4L3NA 4RW8A 1JIHA 3D3CJ 2IVFB 1S0OA 2ZBRA 1TL1A 4A8KA 2OPRB 2XTJP 3DU6A 4M5GA 4JBCA 1RT1A 4KH0B 1FDDA 2RKIA 2F1FA 2QEXS 2BOAA 4DPWA 4CH1A 3PW5A 3BQ0A 1TL7B 1RLDA 3L09A 2Z2MA 4RJVA 1HR0F 2RQCA 3RTVA 4ZLLA 2OP5A 1RT3A 2CVEA 3NBPB 5CHCB 3HSJA 4JI5F 4TU9A 5CZVA 4LRFA 3DOLA 4KY3A 2QE5A 2R7WA 2RF2B 2H5EA 2F9DA 2V63A 1N48A 4ZIVA 5KFEA 2MZQA 5KT6A 2QLXA 4LFAF 3KHLA 4AE5A 1WHXA 1NU4A 3J7Z5 5I42A 4OHXA 3NWGA 3GJSB 4B9NA 1F2HA 4NCGA 3IC1A 3MCMA 4KHPJ 1L3SA 2GO9A 2AJQA 3PKYA 2ZFHA 3MMAA 3GMGA 3NGRA 1DLOA 1S1UB 3KLIA 3W9JA 5B08A 2MZRA 1SUQB 1UA0A 3K5PA 1H72C 5FDLA 3KFWX 3EZUA 2BE7D 3X1LB 2D7SA 2BQUA 1WDDA 2MKSA 3HMJG 4ZK7M 2ZUGA 3EYZA 2QA4G 2WVFA 1C1CB 1DJ0A 2VZ9A 2DCLA 4CLYA 5L38A 2LCWA 2P5VA 2IRXA 3V4IB 3NNAA 2X3GA 4F25A 1IQZA 2YX7A 3RB4A 4EZ9A 4Z7YA 1HHSA 1MROA 2E66A 3CDBA 4JI3J 4J9OA 3DDIA 1HNIB 2XMVA 3QSIA 2MY8A 3PDNA 5LJ5Y 4M63A 2YNHB 4MIAA 4KR0B 1FKOB 3MMBB 1VQ5S 4YFUA 4MK8A 5CYQB 3B8HA 2KG1A 1VC6A 3MECA 2KYZA 3ONQA 2XO6A 5I3UB 1U6ZA 4QBUA 3R1HA 3GIRA 3DU5A 2MQOA 1KS2A 3AD9C 3GTYX 3GQCA 3JSRA 2YY3A 2RQMA 2KTQA 4YB5A 3R5GA 2YX1A 2JVRA 2DR5A 1FRKA 1UVKA 5KT3A 3PR4A 3KOAA 2R7TA 4ZJLA 3Q8VA 2ZITA 1ZBTA 1IBMJ 3G87A 4P2MA 4IG0B 2E9RX 3UO0A 4L6V3 3OW2R 4KHRA 3FQLA 2GVDB 1U1RA 4ZPWR 4OFZA 1IBLJ 2KFYA 4PABA 1FK9B 2IDLA 4EBCA 1NO8A 1RUSA 2XNQA 3L9ZA 3I55S 1FKAF 1X9SA 1YRXA 1JLBA 2DPJA 2DH8A 1RK8A 2BA9A 4CO5A 4H4KC 3VAGA 1N5TA 3H7HB 2EFPA 1HQ2A 2UUAF 1HBOA 4IR1A 2J0SD 4GO5X 3ZZUA 4OYWA 1VBKA 3MUMP 3L7PA 1KQKA 4K7QA 2XC9A 5LMUJ 4ZVUB 2R8GA 4M5NA 1YSJA 1M5PC 4J9VA 2FB0A 3I9V9 3QQCD 2W7OA 2KT3A 4PZVA 3M2VA 4IDKB 4CM0A 1UJ6A 4B3SF 1VRUB 2A6MA 4DG1A 4RNNA 2G2ZA 1T9VA 3DRPA 4TVAB 3J7AN 3EVWA 1FRHA 2DGUA 2ZVIA 2KU7A 2V1SA 4IFVB 2C2EA 5CQGA 3NP5A 3KJQB 2ZKUA 2HBYB 4WFYA 5DETA 4X65F 5GAEI 3W2VA 2DB1A 4ES1A 1EKRA 4NLRA 3PACA 1RQ0A 4KKOA 2MGZA 3VR1A 2GMJA 4C11A 2QA2A 4K0KJ 3HX9A 3ZNUA 4CLZA 2DXFA 4QZVB 1LNQA 3SQGA 1URRA 2ZH8A 4DLEA 4JI6J 2DYAA 5B0FA 1B0PA 3RW7A 4UQTA 4NLQA 4ZPBA 3ZZZA 4AXJA 1N5SA 2HMIB 1ZZNA 4USHA 4I7FA 4LMZA 4FVMA 3MZIA 3R7BB 3L4BC 1JJ4A 4WTOB 4DEZA 2KJVA 3P4UB 4FYXB 5GAHU 2AMCB 5KG7A 2EK6A 3LTOA 5ADZA 4K4UA 1WG1A 2PFFB 2HWIA 1X4AA 4YUDA 3CB4A 4KC5A 4E2FB 1VQNS 4L75A 5HQMA 4NLSA 1HNWF 1KDNA 1MWZA 4ECYA 2R4FA 5F3ZA 5BYSA 1W2IA 4J9SA 2XMAA 3R7NB 1WC0A 1HNZJ 2ACYA 4U7UD 4ATNA 2FJEB 2H48B 1TFYA 3MOZA 4DPYA 3CCUS 4N76A 4ANDA 2VDIA 2XWXA 2IM2A 2AJFE 1RTDB 2KXFA 4QQBA 3M2UA 4HVZA 4HEA9 4AXIA 1K47A 4DLGA 1SKWA 5DM7Q 3X3UA 3P49B 3PW4A 1BWEA 5GMKa 4FN5A 3CF5Q 1Q8LA 1LWEA 3M6XA 4JI1F 1N54B 3HK2A 1DRZA 4K59A 2CJYB 1DQ8A 2V2QA 2PIIA 3BH6B 2JOQA 2MJUA 4AYBD 1S59A 2IAJB 4MK7A 2VD3A 1AUDA 3RAQA 1QSYA 1XMBA 2VG7A 3KUGA 3DCAA 2OPPA 2XHWA 3OR1A 4B02A 1O51A 2NSCA 2W9CA 1PILA 4HL9A 2P2CB 1RTIB 3MCSA 3R8YA 5KFIA 4F26A 4GRSA 4RW4A 1TTHB 1HQUA 2JJ4D 1L3KA 1IUJA 3EDQB 4PEOA 5DS7A 5C2CA 3ZO7A 1F5CA 3UDEA 2EBEA 2CNKB 1VRTB 2VJUA 2V34A 1UFLA 3PYFA 1JLFB 1YRUA 1KQFB 1NH8A 1NHUA 4LF8F 3TOQA 1WF2A 4YHHJ 1BGXT 5HI7A 1R27B 5HVFA 4B9LA 2HGLA 4Y6IA 2F8HA 4PRFA 3GG1A 3CGIA 1FEEA 3M1VA 4LBHA 1WUUA 3LALA 2JEJA 4JV5F 2VPWB 3CIMA 2YH1A 2F4FA 2HURA 2JEFA 3KLGB 3BR8A 4WZQA 3JSMA 1UVNA 4JV0A 3CJRA 3V6JA 4UY85 4PYDA 2MQMA 2J8AA 1TL5A 3ZFVA 3G6ES 4Q8EA 3NMAA 4RW7B 1RKIA 2VFTA 3GV5B 2Z2LA 2D3UA 2JLEA 1TKDA 1KLNA 1R43A 3FZ2A 2KDOA 1TK8A 3DRRA 3ET6A 2BDPA 2XHCA 3G9CA 2BJ3A 2BJEA 4LFBJ 2H54B 3C2PA 2MKKA 2LFVA 5ETQA 2MQLA 3D28A 4OYPA 3F0NA 2FLOA 2XZ2A 2M8HA 1OQ3A 1NEEA 4WE1A 4K5SA 2MQNA 1B0TA 1S1TB 1TMJA 3H59A 3HHLD 1YJ9S 2AZ1A 1VOMA 3DN9A 2HVIA 5KOWA 2MLZA 5HJXA 1Q1KA 4C9DA 2GGPB 3CMAS 2HNZB 3VGVA 3AOBA 3T1YF 3WX8A 5HO4A 5F8JA 1N33J 1D8YA 2HNDB 4ZCMA 1NZ8A 4PG6A 2JH3A 2GJIA 2CQ4A 4OJ1A 1PYSB 1TAUA 3QJPA 3D6FB 2EXUA 3MEDA 1XNRF 1B3TA 3CJ4A 2CQDA 3MM8B 5CAAA 2RQKA 2ZHOA 4BBYA 2PT0A 3A8JA 4CO1A 4DSEA 3K0JA 3KMQA 3KK2A 2IDEA 2XSJB 2HRTA 4ANEA 5JJBA 2B8PA 2E5HA 3JAMY 1FWKA 2HQIA 3FRYA 4RW8B 4DR4J 3DI6A 4DFJA 3M30A 3PFOA 4H54A 2OSRA 2G0JA 4A8QA 2ZM6J 2ZH4A 4KTQA 4UOCA 1RT1B 1L3UA 4DSJA 3VALA 1RT7A 3AFGA 4JI2J 4HYKA 1RHMB 1ELOA 4OZLA 4DR3F 3A12A 4ZVTB 2HK2A 4C8KA 2GIRA 3B54A 3DOLB 3G8TA 4X62J 3HT0A 3CMES 2YNIA 3CJTA 1R0CB 3S7RA 3CWJA 3NGTA 4FPIA 3FCVA 5I42B 1ZAWA 3UPFA 1XC9A 1GT8A 1GAOA 4U8VA 5EWEA 2EI5A 1RAGB 1VLOA 4NCGB 1KKHA 3OLBA 3AWRA 1UEUA 1JQGA 1LWCA 3MMAB 5EX0A 3QIDA 2XY5A 5D3GB 3DXSX 3KLIB 3KK1B 4MKBA 2VG5A 1P8GA 2F8EX 2C2MB 2WOMA 2DBBA 3BPSP 2DHSA 5LT5A 5HQ8A 4OYOA 3W9HA 4NLTA 4WZMA 3BN7A 2OEJA 5DLFA 2UU9J 1XWLA 2VUGA 1YX2A 2OPQA 3KLHB 2PSZA 4FYVB 5IS2A 1S72S 3SCKE 3JYTA 4IO1A 1XQIA 1RHRB 4OZ3A 2KHCA 1JK9B 2IFXA 2DNYA 2YWFA 1MROB 2V8DA 1AUSL 3G6YA 3NLCA 1EZZB 3BM7A 4UOHA 2QL5B 2W7PA 3MOJB 3Q83A 1CS4A 2NQPA 4N47A 1NNDA 2L41A 3I0SA 4A48A 2JSXA 2MKYA 3TW0A 3H2VE 2O1PA 3DLGB 1TQLA 1EP4A 1K73T 4F4KA 1AFIA 3MF5A 3PX4A 2AX0A 3MEGA 2H9ZA 3SEOA 3W60A 4NCBA 1ACMB 1G4CA 4KV8A 1F9EB 4KAIA 1FDNA 4X4UA 1BMQB 1G7CB 4HHHA 4I64A 3ZZYA 3THPA 3M8SA 5JXSA 4X4PA 4V19J 1SV5A 2M52A 2CXEA 2WSFC 4QYZJ 2EC0A 2MHNA 2ZUAA 2IIHA 1MMLA 3SCIE 4DR6J 2I38A 2YTCA 4G3IA 4DR5J 3H4BA 3KHRA 1RA7A 2MZTA 1U45A 3P5TL 2XY6A 3GSDA 4CO4A 2HSEB 1KN6A 1SCJB 5HANA 4TN2A 3VWSA 6FD1A 1X4CA 2EFQA 4QPXA 4QR0A 4NLUA 2DPIA 3LP0A 2BQ3A 1NH7A 1TVRA 3ZZOA 4AD6A 3DYAA 1F3FA 3HZEA 1Y3JA 2WHOA 4K4SA 4H4KA 4HI2A 1YVFA 2P8IA 4N77A 3O2IA 4NOHA 1I3OB 3M2VB 1ZM4A 4BCAA 5CA5A 4YY3J 2ZZNA 4JOUA 3U1NA 2DNLA 1PC5A 2I9SA 3FVYA 4ZVHA 2NZ4A 5DZ6A 4DG1B 2EFGA 5T7LA 1Y9OA 2HEKA 2F40A 4DL6A 5HLFB 3UNYA 2AKWB 2C3OA 3IO1A 2Q1LA 1FFSB 1FXLA 2QLWA 2OFGX 2CQBA 4LF7J 4KGVB 1IWGA 2ADBA 1BWVA 4TNOA 2MYFA 5LXRA 2GQCA 1MU2B 3GG0A 4OZ0A 3T41A 4I2QA 2DGSA 1VI7A 2R7XA 2V94A 3LP1B 5B0AA 1Q82T 4C11B 4UOFA 1WC3A 3Q2TC 1M1HA 2VPYB 5A0YB 2C3UA 4DR7F 2A3JA 3FSIA 1U2FA 1WKLA 3NOCA 4P2SA 4DV0J 1U0HA 1XR5A 2VQFJ 4X4NA 4OZ5A 5J2NA 3K5OA 5HMXA 3I0RB 4ZVOB 4URQU 2CNNB 2QV6A 2NR0A 4AQYF 2HRYA 1MW7A 4Q43A 2H4YB 4ALZA 4KPCA 2GV1A 2R7SA 4ED5A 5HK4A 2AEMA 2JEIA 2BRLA 2ZBQA 1NLKL 3QT6A 3A3OB 5ETNA 3L7UA 3LWLA 2B3TB 4AL6A 1W2BR 3BQ1A 1RI7A 1HD0A 3TA2A 2W8LA 4UUWA 1U1PA 1B7FA 3QWUA 1KVIA 1IVZA 5L1KA 4UF4A 4O3QA 3CCMS 3W1YC 1YJVA 4LSNA 5JUMA 1YRTA 1OY9A 1SC3B 2V4RA 3H5XA 4CH0S 3W5YA 3T9NA 1PBUA 3CCQS 2PGCA 1D1UA 2B8QA 2PC6A 4ZP9A 3B4DA 2CQ3A 2CPFA 4YEAA 4KJIA 4O3OA 5CD4H 1VHFA 2XGPA 5MLCV 1R8AA 3EM1A 1LWEB 5KFUA 3U7JA 1NK0A 4IR9A 3IAM9 5I3PA 3G86A 1D9AA 1Q78A 2OLWA 1S4EA 4YR0A 1CEZA 1JLCB 4JYAJ 3RG6A 2QLJB 1Q7YT 4Q44A 4KH1B 2VG7B 1UWBA 4ZLNA 1C2PA 2DITA 3PHEA 3J80U 2MSSA 2XS5A 2LVWA 3OR1B 1YBTA 2W9CB 1WDTA 4LRBA 1Y4ZB 1NPRA 3I82A 1P27B 5BXIA 2NXNA 1HQEA 4RW4B 4DN9A 1FJGF 2ZOMA 5K8OA 1SC6A 4IRCA 5HN0A 1WG5A 3UVJA 1Q4RA 1CVJA 4EBEA 3M32B 4LT6A 4RL1A 2XMWA 5KFDA 2AHOB 3S1TA 2C28A 3K57A 2CUYA 4C3KA 3OXFA 4YDXA 2FVSA 2ZC3A 2BMBA 4PQUB 1YITS 3E01B 1S57A 5SZTA 4C98A 4M94A 3WIVA 3D6MB 1S97A 2V9KA 2QTWA 5E3PA 1I5OB 1I94F 1LW0B 3TARA 5RUBA 3K89A 4KQZA 4K5RA 3POTB 5LXYA 3NNCA 5IC4B 1MN7A 4QWDA 2K7KA 2KO1A 3DM2B 1OSDA 4AUKA 1LW2A 3DOKA 3MCOA 2E29A 1RT5A 1YJRA 5U47A 4I2PB 1O8BA 1N0VC 3D2WA 1OM2A 3EXCX 2ILZA 4DN0A 2FGOA 4A4JA 2CJBA 3UR0A 2QYCA 3MPUB 3NXZA 4KHPF 1JB0C 1BLUA 3VV2B 1N5QA 4RNHA 4A8FA 2HHUA 3C14A 2VODA 3W66A 4DQRA 4XK8C 3BDPA 3GCWP 4P71A 4TXSA 1QAJA 5IZHA 3HVTA 4ECUA 1N5VA 3ZZTA 2FLNA 2CFXA 1T0TV 3D1QA 3QGIA 2J7UA 2Y1LB 4RNFA 2CVIA 3GJTB 5CXTA 4K4TA 3RGIA 4FNHA 1PJ6A 3OVAA 4DX8H 1KBRA 3F41A 4LRCA 4I68A 1J27A 2R7OA 4Q2MA 3VVUA 2AW0A 5E3CA 4DV7J 4JI3F 3NOGA 5HSPA 1YZ6A 4NLOA 2QG9B 3ILLA 2WVEA 4G1QB 4XO0A 2Z58B 4Q2LA 3MAAB 1NRKA 2WW4A 3DOMA 3EWGA 4O3PA 3MEDB 4RUAA 1X4DA 5B7WA 5IM0A 1X5OA 1QJHA 3V5RA 1AB8A 4YS2A 2LA4A 4I6YA 2DRBA 4NRUA 1RYRA 2F4VF 3WC2A 1KLMA 2LQ9A 4P7VA 3HP6A 1CQNA 2K2PA 3PJWA 4Z2XA 3MPDA 2GHVC 2HQ3A 1HARA 3IG1A 4Q5VA 1RZMA 1J2VA 3HHKA 3O8WA 1TK0A 4M5MA 1MSWD 2XM3A 4CP5A 3AJ1A 3D66A 2KT2A 1DTQB 2VPXB 2GMHA 4GMKA 1YBUA 1H2TZ 1NJYA 2DNKA 3FBCA 2EVZA 2ZHAA 1R3NA 1IBLF 3GWCA 4J9RA 3PR5B 4O44A 2ZH6A 3MMCA 4H4OA 5KFOA 1S4FA 4RW9A 2Z8QA 1EQ0A 1S0MA 4PXEA 5FLXU 1M0SA 1IWAA 2J6TA 1ZAXA 5E41A 3KLVA 2MZSA 2XYGB 2CPZA 1NXIA 1VRQC 3T3FA 1LWCB 1YJ7A 1S48A 1YK9A 3EPIA 2G0CA 1H74A 2MZJA 5LMUF 2RU3A 4J91A 1UJ5A 1NKCA 2AF6A 3DKDA 3RBEA 3RZAA 2WOMB 1Y5NB 3C46A 2F5GA 3M05A 4OX7A 2QT7A 3OBIA 3RBZA 4MKAA 1QVFR 2M0GB 1ZOTA 4ID8A 2R8HA 2J5AA 3GP9A 1RBLA 2V6AA 2ASYA 2YKMA 2M5YA 8ATCB 4FF3A 5LM7E 2V4QA 4NMLA 2PA3A 3AH6A 1NDKA 5J1EB 1C4AA 4YQWA 1S76D 1NPKA 4TQRA 1K8AT 3IWXA 3EGZA 2E9TA 1CS4B 4OX9J 1YG0A 3QFHA 3AY0A 4IQXA 3I0SB 2LU1A 1I6JA 5HBMA 2LQJA 2BANA 4KGMA 4M95A 4K0KF 5IFMA 1EP4B 2AGPA 4M5KA 4NX9A 5HJYA 1DARA 1RHUB 4NXNJ 1M90T 3P6YC 1U25A 4FKYA 4IFYA 4MKVA 1KHWA 1EARA 2PI4A 2J0QD 4ZVGA 1LK7A 4JI6F 4GKJJ 4KV8B 1IKYA 5DG8A 2H1YA 3FC9A 2MTLA 1N4LA 2K3IA 4OYZA 1S1WA 2D1CA 1SV5B 2M2BA 4F0HA 1N0UA 4USIA 2UXCJ 1V5VA 3AT1B 1FNOA 3FGVA 3IN5A 3I5CA 1U2CA 2LQ8A 5C42A 3D7SB 2UVUA 1M5OC 2B6AA 1RWKB 1C1BB 5F0UA 4DV4J 1X4HA 4R0JA 3QAUA 1R8HA 2YWEA 1XR6A 4M5JA 5HQLA 4M8LA 2JX2A 1AZSA 2R2UA 1R8BA 2MKJA 1BHNA 2BE9B 1TMMA 3LP0B 1JKHA 3R5DA 4K4XA 5AXMA 2BRKA 3RAXA 5A6PA 1HNZF 2YKAA 2A2DA 3GILA 1TKXA 3G2XA 1BUXA 1QAXA 5EWGA 3AD8C 3NGUA 2HPUA 1S7HA 5K8NA 2AGQA 5L46A 2K7JA 2BKNA 4C4WA 2DXDA 2AD9A 1FO1A 3DHWC 4TLQA 3SXLA 5T7LB 4A47A 1TUGB 3AX2A 1SB6A 4I56A 3T9ZA 3IXQA 3KLEB 2B4PA 1FKPA 1C0UA 3DRYA 2KM8B 4XAKA 1Q0NA 1YJWS 3CUNA 1TL4A 4FS1A 1KD1T 1NBEB 3TAQA 2XTEA 4LF4J 2IY5B 1XEZA 5HVHA 2YKPA 2HFNA 2YWHA 3V81A 4B3RJ 2LYVA 1CJVB 3QT7A 2CJXB 3NS6A 2DNGA 4PWDA 2XMTA 4F2SA 2Z4PA 4J9LA 5KFYA 5C7PA 4DWIA 1HWLA 5FIIA 5BYQA 4OX6A 2OHDA 2V2VA 5GAGI 1A9NB 2K3KA 3IR5B 2YKOA 2R2SA 2ZH5A 4USVA 3VAIA 1TL7A 2VOPA 1EETB 2EFOA 4HT5A 3NBPA 4YHHF 3GYXB 5DG7A 1TZ0A 2H51B 3IMQJ 1WSRA 2PFDA 2RF2A 4DZDA 3G8QA 1A6LA 2L3MA 3HLUA 1M5KC 1SH0A 3OTOJ 3SSSA 2YKQA 5C5JA 4NZ6A 1VIOA 1GMWA 1RWWB 2YNGB 4CT9A 1WORA 2OO4A 1S1UA 1RYSA 2V2KA 4CLLA 5DZ7A 2KJWA 1U49A 2MEWA 4R8UA 1P6TA 1SIZA 4RZRA 4RW6A 2JWNA 3HHNB 1WF1A 4LSNB 1GXTA 5F8HA 3GCXP 5IT9U 3VGSA 2VBWA 2W9AA 2RQ4A 2NZCA 4WPAA 1ICEB 3OHBA 2YBVA 3V4IA 4J9NA 5GADI 4PWWA 3SCJE 1X7VA 2MKIA 2W8KA 3QRPA 1KTQA 3EVMA 1UA1A 4NYOA 4DR2J 2D69A 4F3OA 5B0EA 4N7TA 3PEHA 4OHZA 1JXEA 2YNHA 3PJ9A 1VQ7S 4K4WA 4WK3A 4DU7A 5CYQA 1TUVA 3ULHA 2WBMA 5I3UA 3AD7C 4O0IA 2JDJA 4LIRA 3PRVA 2HAIA 2XY7A 4NLXA 4X4SA 1RAJA 1U09A 2H5JB 4WTYA 2ZE2B 3EDRB 2FHOB 4ZPAA 5G4DA 4PXBA 1N33F 3PYEA 4MK9A 5A6WA 5KG5A 4DV5J 2P6SA 2IJRA 3KTQA 4C8ZA 1VBXA 2RS2A 2UXDJ 5ETSA 2FJAB 4QR2A 3KUHA 4P72A 2Q3PA 4RBUA 4IG0A 4RLEA 5KG3A 4TYBA 4P9SA 5EUHA 2J76E 1RWPB 4F4AA 4DR1F 1U8SA 3HVRA 2FVCA 2F63A 1FK9A 4DR4F 3FSYA 1FRMA 3TA0A 4ZA1A 2ZM6F 2PA8D 2SXLA 3CCLS 2N7CA 4DUZJ 1F9FA 1TL3A 4JI2F 4OI2A 1U6BA 4K2JA 3VF0B 2GZOA 2ZJRQ 4TQSA 2BJ9A 2Z57B 1LW2B 4QIGA 4DFMA 4TYAA 4X62F 2FQQB 2DT9A 2WONB 2BKOA 4OJHA 1REVA 2COLA 2N4DA 2HVHA 2AEFA 3PYGA 5E5NA 1HKAA 1ZPVA 1NJZA 2DO4A 2WK4A 2GNKA 3IM8A 1CULA 4F02A 3IP0A 2QSWA 4GVBA 2E5LJ 3O44A 2M4MA 3H4DA 2DR8A 2DNRA 2C42A 2U1AA 3HVAA 3NG8A 1DTTA 3HVTB 4ZCKA 4DV6J 3QJJA 4F4YA 4OV6A 3TVYA 3N01A 2VOOA 3VTIA 2XCAA 3FZBA 3OXLA 1GMVA 3M8PA 3J7YI 5H1SV 2CQHA 1YTYA 4QYRA 4ERDA 2QYGA 4GKKJ 3TWZA 2N7YA 4EU0A 3CC4S 1IXKA 1N56A 3PEJA 3VAKA 3MURP 2AYGA 3E51A 1WF0A 2OIHA 5AT1B 3HSDA 4ZIWA 1NDCA 4WXWA 2XTDA 2ASJA 1HW9A 1VGYA 3DOMB 2VH7A 5I3QA 5IM0B 3IFEA 3C8YA 2HMIA 3PNIA 3LP2B 3ETOA 1YJTA 3QRQA 2VFSA 1HMVA 5LSOA 1PKUA 2X7IA 2YQ1A 3LAMA 1RTHB 3PJXA 2BE2A 4CZCA 2CJKA 1BC6A 3CCWA 1AA1B 1RAOA 2V9WA 4DQPA 3O1LA 1JLEA 1D9FA 3CE8A 3RAMA 1WHVA 2W01A 3CVKA 2ILYA 2G2YA 3A13A 3EPGA 4DR6F 2C2RA 2AYEA 3DFEA 2HWTA 4DR5F 3UD3P 3H25A 2M70A 1JMTA 3NKYA 2QMWA 2PMZD 3FEZA 1N36J 4LBPA 2J6UA 1RTDA 1UWAA 3OR2B 4RW9B 2XLIA 4DL7A 1FX4A 4UQGA 3HFVA 1IM6A 3G8SA 2DNNA 3OJSA 3N79A 4DPOA 4MIBA 3VCDA 3QIPA 3MM6B 4DSLA 1L3VA 4C8YA 2WB4A 2ZNZA 1C0TB 4PKDB 1L3TA 5HATA 2UVVA 1J5EJ 4Y34A 2VU5A 2LDIA 3NL0A 1TR0A 5KFFA 2ALZA 3FNNA 2IAJA 2MPUA 4OLPA 1VS3A 3QLHA 4MMOA 5E0OA 2VHGA 2JLFA 4MIWA 3KHHA 1KSPA 2HKEA 3H20A 3KHGA 1AT1B 1VQ6S 4WF9Q 2MQPA 4CH7A 1CJKA 4Y0FA 1RTIA 3HVWA 2I0XA 3M6WA 2N3LA 1NK6A 5D6GA 4DU8A 4YR2A 3TAMA 2X51A 2W9BB 4LF7F 4RO0A 2V68A 3CW2C 2XMUA 4C8NA 3BBCA 3DGVA 3KJFB 3WBZA 3PY8A 2MQ8A 3FSXA 3F44A 3RRKA 5HBMB 1UVMA 4HKQA 3AHPA 3UN2A 3QZ7A 2ROPA 1B4SA 2HNYB 2OPSA 2MXYA 2Q79A 4U8YA 1Q53A 2AV5A 3UNGC 1ZETA 2J6SA 3MUVP 3QO9B 3PO5A 1V5IB 2ZH3A 2G1HA 2JNJA 3ITHA 1XMQJ 3UN3A 1P9QC 1EHWA 2E1CA 2VQFF 4ER8A 1S1WB 3A8KA 2DXEA 4RUHA 4FBUA 2KN4A 5HMZA 1X60A 4XPCA 3MMJA 5C42B 3CJ0A 2ZH2A 2B6AB 1HPZB 2ACMA 5F3TA 2H4WB 3C19A 1RWNB 3W61A 2CRLA 3M6UA 4HLBA 1Q86T 1KOHA 1NM2A 4PG5A 4PQAA 4RUBA 3MPWA 4PWUA 1LXJA 4K4VA 3MDFA 1JKHB 2FJVA 2M88A 2F3JA 3GV7B 4F4WA 1NPPA 3PTWA 2MDAA 5GMEA 1K44A 3MUTP 3WX4A 2DNPA 1HWIA 3MGJA 2DGQA 4KHMA 4DCOB 3GFYA 2XB2D 1LWFB 3TYTA 4CLUA 3D0GE 3N5FA 5IWAJ 2V8VA 3R2CJ 2DGOA 2NREA 4K4ZA 4JI0J 5HMWA 1S6UA 2P6TA 1WEZA 4AFFA 2QGFB 2KVIA 2QFIA 3TJ9A 1WI8A 3H98A 4P2XA 4LUBA 1VC5A 2QN6B 1FKPB 1PG5B 1SJFA 1GTEA 2VC1A 2HNDA 2RE1A 3VAFA 1SH3A 3I4HX 5KFBA 3SBMA 4DPXA 4FS2A 4NEZA 2HIQA 3MM7B 2N4CA 4QW9A 1RGVA 4JYAF 4Y28C 4NASA 1FWLA 4ELTA 3MM8A 4HACB 5HROB 3V81B 1TFWA 3I56S 3K59A 2JEGA 1S1VA 1NMEB 3SYZA 5KAKA 2YWWA 4FYWB 4QIWD 2XSJA 1PYOB 5HP1A 4B08A 3IA0A 2W4DA 2FJBB 3GZ7A 3NEKA 2OGUA 4LR9A 3UFCX 3JQJA 1SQFA 3BS9A 5IT4A 2EKYA 3BGFA 3GFHA 3B6BA 1ZM2A 4FVCA 1D09B 3K5LA 3TI0A 2AGOA 3W7BA 4O3RA 3R5AA 3EE3A 2R7RA 4PXCA 3LGNA 2B4VA 1BXNA 3V4MA 4FBTA 3GONA 1WOPA 2DEIA 2BBEA 4EEYA 3TEHB 4YB1P 1RKJA 1XERA 2IM0A 3LAKA 2XMMA 2W2OP 3EICA 2X1AA 1D8ZA 3C6TB 1LFPA 2LEPA 2DGWA 4X2BA 4CWBA 2ADCA 5GAEU 3S8SA 5D3GA 4WBFA 1T03A 3KK1A 3HKWA 3FK4A 3OL6A 3PO4A 4R8UB 4ECTA 1B64A 2HIYA 4RW6B 5DDPC 3AOAA 2GVZA 1QE1A 1VBZA 1RTZA 1S9EA 1QD1A 2E44A 3HHLC 3KLHA 5AE1A 2CQ2A 4TLRA 1NK4A 5J2PA 1N32J 4ZVQB 2AYBA 4FXDA 3BO2A 3E8OA 1GMWD 2FHKA 3SV4A 1T11A 4JI4J 4LQ3A 1PYTA 4OHWA 1EJ7L 3J7ZT 3RYLA 3MR6A 2QSFA 4CI0B 4CLWA 1HBMB 4DI6A 1CBKA 5FJ4A 2W2QP 2VG6B 2E7XA 3TZYA 3BSOA 2ZWPA 3EX7B 3WQPA 4NPOA 2HZVA 3QGGA 1UETA 3UCGA 3TQ1A 4TY8A 4Q45A 2G2OA 3DLGA 4KO0B 1T02A 2KXNB 2NXUA 4J9KA 4CLTA 4A8SA 1RA6A 1LFWA 3OFFA 5D4PA 2VASA 4JI1J 3D9BA 4DV7F 2ZBIA 2XEXA 3IM9A 1X5PA 4WIQA 3H8YA 1VR6A 1S6QB 2LA6A 2FC9A 1K1SA 1IR2A 1Q81T 2CG8A 4DV1J 3S01A 2MZ1A 3CD6S 4H4MA 2O3DA 4X64J 3THTA 1S0VA 1B0VA 2HQGA 1VQSA 3B78A 3DXBA 2RHQB 4P10A 1FVQA 3Q0AA 5D77A 2L08A 2DR7A 5JMNA 2ZH7A 4IO9Q 2NUHA 4FYYB 2YXLA 1TL3B 3DMJB 4NE9C 3R7SB 1RJJA 1YKWA 7FD1A 5EDWA 1FFGB 9RUBA 5DRKA 1HWKA 1FDBA 1YI2S 1SKUB 2EFVA 2KRRA 4WIIA 2ROEA 1ZZFA 4DF4A 4J9UE 1X5TA 2E1MC 3I31A 4NLGA 4GO7X 4JI8J 3IRXA 1AFJA 1REVB 3JQKA 4G1IA 2KFZA 1JJHA 5KTQA 1H0HB 1U0SA 1UW4A 3FEXB 3CC2S 3CJSA 1CULB 4KB7A 3CT9A 3LPYA 1S1XA 4GVBB 5HLFA 3C66A 2HYIB 2UUWA 1KWMA 4BS2A 3RB0A 4Y2IA 1SI9A 5LSLA 2VB6A 3TJ8A 4U9RA 4ZHRA 1DTTB 2OKQA 2UVRA 3KDNA 3US5A 1MU2A 3R5JB 1RWUA 2XYPB 3IBCB 4J9QA 2CQ0A 4LRAA 3N9UC 4PUOB 3T6BA 3LP1A 1RDRA 3M8PB 3JAMU 5M2RA 4I6WA 1YHQS 3G6VA 5KG0A 3EUNA 1H7WA 3PW0A 1M5HA 4F2RA 2O5DA 3VZHA 3KK3B 1XK8A 3QATA 2ZDPA 4KGKA 2BOPA 1IM4A 5A0YA 3SV3A 2DO0A 1RAFB 4ZKAA 2I2YA 3D3BJ 2WAQD 4OJ3A 2AU0A 1TKZB 4OX9F 3S6EA 2GHPA 4KPYA 4AT1B 3KLFA 1VJWA 1HMVB 4J5OA 3I0RA 4XDCA 3EXYA 5ETOA 5FLXY 4NXNF 4OX8A 3JXOA 3IS9A 1FVSA 2BE2B 1R0AA 4GKJF 1KR4A 2QX0A 5LMNJ 1G1XA 1JLEB 2IVYA 2DHAA 2IMWP 1FRJA 1XNRJ 1QUPA 2UXCF 4R0EA 1S79A 1MN9A 2FVPA 4W90B 2X1BA 2OD4A 3QGHA 2CDRB 1U4BA 4X84A 3HHEA 1VQYA 3J81j 1EKSA 1LEOA 4QWEA 1FD8A 4ID5A 1FA0A 2DGVA 4A8OA 2B9YA 1FXDA 3ZTPA 3TO8A 3FRZA 1WSVA 5KFQA 3QIPB 3UCZP 2DR9A 1B70B 1H3DA 4N41A 3FBEA 3QMQA 4I1TA 1JLCA 5JVGQ 4DS4A 1YZ7A 2VQEJ 3QLHB 5DDQC 4ZVEA 4B3OB 1G3OA 4CT8A 1KTVA 3T5JA 1F1BB 3W65A 1P9YA 1NSKL 1NDPA 3DRSB 2JRSA 1CJKB 2KVQE 4DMZA 2W4CA 1KRPA 2EKNA 5F41A 3TAMB 3J7A1 4LF4F 3P5BP 3M32A 1WD6A 2HHXA 2J0WA 4B3RF 3Q8YA 1F3VA 4ETZA 2XMJA 4RKUC 3OFHA 5L39A 1VMBA 1WHWA 4PQUA 3E01A 2ZNYA 2RDJA 1U47A 4EYHB 2OPSB 1LW0A 1E6YA 1JLGA 4QIVA 5KFPA 5KFXA 3SMZA 1RAAB 3BKTA 2VDHA 2Y1RI 3POTA 2OJ3A 3TR5A 5M2UA 2GQ2A 3ITHB 4OL8A 5KFTA 1LWXA 2MY7A 3FMBA 3ILIA 3NMRA 4ZPDA 3G4SS 3QAEA 3BGUA 3T5KA 3DM2A 3G82B 1CJUA 2IPOB 2VIHA 1SVDA 4IOAQ 3JQMA 4I2PA 5AXLA 4ZVPB 2CQ1A 3CDWA 3OTOF 2KT5A 3BGOP 3NRBA 1FNMA 1WEYA 4C3MA 3R1LA 5G0RA 2CNOB 3CJKA 4LSLB 4KSEB 5CCLA 3HFZB 2CNLB 2X1FA 2W25A 4HTIA 2MHEA 2RNEA 1RB0A 4F8RA 2B9EA 2C3PA 2DNMA 3M8YA 4OV1A 2QA1A 2RH3A 2YQ3A 1RWVB 4MKYA 2IA0A 2Y8YA 4OZJA 3AA8A 2PD1A 4USWA 1WTBA 3CCRS 4CQ1A 4X66J 4K50A 2AQ4A 4UY8T 4TKTA 2BZ2A 1N6QB 4FF1A 3D1OA 3HDSA 4CNYA 4DCPB 1R0BG 1UVJA 1SJ3P 1ZA2B 2BW2A 1UVIA 2HGMA 3WC0A 1SBRA 2J7WA 2ZH9A 3ISND 2BR0A 4HR2A 2BACA 3H2LA 1R31A 1VK8A 4O4GA 1RISA 2XBPA 1FCAA 3EMTA 1U8WA 4LQ9A 4DR2F 4WU3A 1VYAA 4G1QA 2GMLA 3MAAA 3TVKA 3SIPB 2HWHA 4TY9A 1NHKL 2QLFB 4FF4A 4OYMA 3PZPA 4NA1A 5THWA 9ATCB 3J81Y 1S1VB 4EGLA 4DF8A 3K5MA 1KFSA 1ITPA 1FDAA 5EHHA 4J9MA 1KP6A 1NJIT 2HVEA 5HP1B 4PG4A 1RWMB 3OTCA 3GLJA 4QWBA 4DV5F 4OZ1A 4OYIA 5C24A 2FDNA 1WEXA 2YQ0A 3B4MA 2CPDA 2UXDF 4B9SA 1SKRA 1FRLA 3DLKA 2Q6CA 1VQKS 3ZTQA 1F2GA 2MMYA 4ANCA 4ZP6A 5MAOA 3AB4B 1MWYA 4A8XA 1DTQA 3OVSA 2YWGA 1BQNA 3MAQA 2HFUA 2RIJA 2GW8A 3OQ2A 2HZAA 4CRJA 5HVGA 3BO3A 3GU0A 5F0WA 1HL6A 4WJBA 3M8QA 1PBAA 3HFKA 3DHXA 3V6DA 5EWFA 2DRAA 3OUYB 1A7GE 3M2RA 5KT7A 4DFPA 1JXLA 3GB0A 3RB3A 1BQMA 1LQ9A 1RE1B 2DJWA 2KXHA 4DUZF 4DR7J 1RTJB 2H3EB 3OSPA 4ED6A 3GJQB 3K8WA 2WSEC 2DGTA 4LF6F 1FEHA 1T03B 2W24A 3T1HJ 2HBRB 2BEFA 5KG6A 3GIKA 4NLVA 2C3YA 4LVOP 2Z2ZA 4AQYJ 4ZP7A 4I0WA 2GA7A 4O3SA
chains in the Genus database with same CATH topology
1E6VB 3VR1A 1BY9A 2GMJA 1A6LA 2L3MA 2QA2A 3HLUA 4C11A 1UL3A 2YKNA 1QE1B 3HX9A 1M5KC 4QIFA 1S9EB 1SH0A 4F67A 2WW8A 1LV5A 5B0BA 3PIOQ 4G6VB 1Q8IA 4QZVB 2BQRA 2QRRA 2AJ4A 2HZCA 4ILRA 5E7OB 3SSSA 3MR2A 3SQGA 4M1KA 4C0OC 1PO6A 2UUCF 2O67A 1URRA 1BQXA 3NCQA 2ZH8A 2YKQA 2E5LF 4PR6A 5C5JA 1GXUA 5J2PB 4NZ6A 3MTKA 4DLEA 2F9JA 1VIOA 2HHSA 2YNGB 4CT9A 2M9KA 3HI9A 1TKTA 4CNZA 4MYUA 5B0FA 1B0PA 3RW7A 1FF2A 2OO4A 5J1EA 2V4JB 4NLQA 4UQTA 3SCLE 4ZPBA 5DG9A 4TU8A 2DTJA 4DV0F 1S1UA 1RYSA 4I4BA 3ZZZA 4AXJA 1N5SA 5DGBA 2VL1A 3JTOA 2V2KA 4WE1B 2HMIB 2IBOA 1ZZNA 4USHA 1FT8A 4DV6F 1OIAA 4EFAC 2KJWA 4I7FA 4LMZA 1U49A 4FVMA 3MZIA 4R8UA 4E8UA 2EFNA 1JJ4A 4DV3F 1P6TA 3T6JA 4DEZA 4NXMF 2KJVA 1SIZA 4RZRA 3BJYA 2B5JB 5AE3A 5GAHU 4RW6A 2D68A 2JWNA 3HHNB 1WF1A 1UP1A 5KG7A 3MM9A 2EK6A 4LSNB 5ITHA 1LK5A 3OHAA 1GXTA 2OD6A 1YJNS 5F8HA 5ADZA 4K4UA 5KFKA 1WG1A 3CC7S 4MTPA 4TY8B 3MTJA 2VBWA 2PFFB 4ILMA 2HWIA 5KFGA 4GKKF 4CCHA 3CCVS 1X4AA 4YUDA 2W9AA 2FY1A 3FFIB 4WKRA 2RQ4A 3CB4A 1NK7A 3GR1A 2IJNA 1HFEL 4KC5A 3DLHA 1VQNS 1FRIA 4NLSA 2E5JA 5DQGA 3OHBA 1HNWF 1YWXA 1QUVA 1MWZA 4ECYA 3I5BA 4LSLA 1V3ZA 4ZCIA 3MD3A 2R4FA 2PO4A 3V4IA 4J9NA 5GADI 3IAS9 4WYWA 2CQPA 3SCJE 1X7VA 3LQVA 5F3ZA 2MKIA 5BYSA 3OSNA 2W8KA 1W2IA 1KTQA 4C97A 2BM1A 2RT3A 5D78A 1UA1A 4KBIA 4NYOA 4J9SA 2CPYA 1FNXH 5CZXA 2Q66A 4F3OA 4UW2A 2DH9A 2A1BA 5B0EA 2JZ5A 1UMJA 2ACYA 1R7IA 2AJ0A 4ATNA 2G9OA 3C6UB 2VPZB 1ZM3A 3PEHA 4IYQA 2FJEB 4OHZA 1JXEA 1TFYA 2YNHA 5KFLA 3QGPA 4H4MB 3OL9A 3MOZA 3MEKA 1VQ7S 3CCUS 3KK2B 4K4WA 2R9LA 4WK3A 3CCSS 3CCTA 4N76A 5K9FA 3E3XA 5CYQA 2XWXA 1TUVA 2IM2A 2AJFE 5A8KB 2IA6A 3DLEB 3KG0A 5D8HB 3ULHA 1RTDB 2WBMA 5I3UA 2KXFA 1RT2B 1JWWA 3CO9A 4QQBA 1C1BA 1H6KX 4O0IA 3HM9A 1K0VA 2JDJA 3M2UA 1JNZB 4HVZA 4OHYA 3DI6B 4HEA9 4LIRA 3M30B 1NB7A 2HAIA 1N6QA 2XY7A 4NLXA 4AXIA 4OI0A 2J0XA 4X4SA 1RAJA 1U09A