4R0EA

Crystal structure of the poliovirus rna-dependent rna polymerase low-fidelity mutant 3dpol h273r
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
461
structure length
461
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHRLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
molecule tags Transferase
source organism Human poliovirus 1
publication title Structural Dynamics as a Contributor to Error-prone Replication by an RNA-dependent RNA Polymerase.
pubmed doi rcsb
total genus 141
structure length 461
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4r0eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r0eA02
1N5YB 1FKOB 5J2MA 2J6SA 3TQ1A 3V6DB 4Q8EA 3H40A 5HROA 3RAQA 1DTTB 3DRSB 1TKZB 1S48A 4K4ZA 4ZP6A 3MECB 4QWBA 4FBTA 4PUOA 1HQEB 3FDSA 1HMVA 3T19A 3MR6A 5KFCA 4ZPCA 2R8KA 1IKWB 2JLEA 3E51A 2IAJA 2R8IA 4QWEA 2C22A 1S6PB 3KLIB 4URSA 5KFUA 2VG7A 2R8JA 4IG3A 1HQEA 4H4MA 4ECRA 5C25A 1RDRA 1T05A 3I5CA 4PWDA 1TKXA 1RTHA 1LWFA 3DRSA 4R5PA 4RU9A 4NLUA 4IH6A 4NLWA 2OPPA 3G86A 2FLPA 4DL3A 3KK1B 3BR9A 4R5PB 2UVRA 2ZKUA 2YNIB 3CJ0A 2IJNA 5K14B 2BRLA 4DEZA 2R2TA 2VA3A 4PWDB 2ZE2B 4KO0B 3I0SA 4ECQA 3KHHA 5DG7A 3HVAA 2IBKA 5DGBA 2I1RA 4YP3A 4IRDA 3MEGA 4EO8A 5KG4A 1KHWA 3KJVB 1JLBB 5CYQB 4RZRA 2YNGA 4Y2AA 1SUQA 3Q8SB 3BSAA 4IG0A 4JV1A 3IG1B 1LWCA 1EETB 1RT6B 4WZMA 4G1QA 1JLFA 2C2DA 3I0RA 3RBEA 4I2PA 3JYTA 2JC0A 4WFXA 2D3ZA 1HQUB 3KLHA 3I0RB 2W9BA 4URQU 3KLVA 1FKOA 2RF2B 2DPIA 4G1QB 3CIZA 2XCPA 3FFIB 5EDWA 4LSNA 4ECVA 4WFZA 4O3RA 1RT1A 4IFYA 2BE2A 1FKPA 1JLAB 1RA6A 1S1WA 1QE1B 3MEDB 3MFHA 5I42A 1C1CA 1WNEA 5EWFA 3M9OB 1TP7A 2E9TA 2RKIA 1RT1B 3DM2B 3VQSA 5HBMA 4EBDA 5T14A 3QYYA 3UDLA 3QZ7A 1LW0A 1VRUB 4DL7A 2ZD1A 5KFLA 3RB0A 5DLFA 5HLFB 4ZPAA 4ECWA 2C28A 1JLGA 1HARA 4IQXA 4WXOA 5KG1A 4NLGA 2AGQA 3DM2A 3H4DA 3QZ8A 2C2EA 3BSNA 3T5JA 4WZQA 2VG7B 1JLFB 1C1CB 2WHOA 5EWGA 4Y34A 4IFYB 2QE5A 2CJQA 1JKHB 3IS9A 2FVPA 3QGHA 2VG5A 4RNHA 1N4LA 4U6PA 4RUCA 3MECA 2ILZA 4IDKA 4M95A 2YNIA 4ZP7A 2HMIA 4TY8A 2XWYA 2BANA 5KFXA 4FBUA 5KFHA 2V9WA 5J1EA 1RAJA 1REVB 2AU0A 3GV7B 2IA6A 4WYWA 2ASLA 3H5YA 1RTHB 4IG0B 2R8GA 1S1UA 4NRUA 4RNNA 4XPEA 2R8HA 3SFGA 1IKVB 5DQGA 2V0NA 4EYIB 1S9EA 2V4RA 1QE1A 2W9AA 1RT7A 1S1UB 2GC8A 2XI2A 4MK7A 3BQ1A 4MKAA 5L9XA 1D1UA 3CO9A 5CYMB 2I5JB 4ED6A 2YKNA 3FRZA 4KV8A 2J6TA 4TY8B 1C0UA 4O4GA 5KT2A 1S1TB 3T5HA 4Q8FA 1DTQB 3OLAA 1Z4UA 4KV8B 1BQMA 5KFZA 5D3GB 1NHVA 4QWCA 5F8GA 4O4RA 1RT4A 3I5BA 3KJVA 1C1BA 3D5MA 1T94A 4TXSA 1C0TA 5F9NA 2V4QA 3BSCA 1EP4B 3KHLA 5KFQA 4LQ9A 3MR5A 1S1VB 5KFKA 1JLGB 3KLFB 3KK2B 3FQLA 2WTFA 4KE5A 3HHKA 4FS1A 3DYAB 4KB7A 2ZD1B 5KFPA 1R0AB 1N48A 4Q0BA 3V6DA 5L1JA 1XR5A 4ZVGA 1RT2A 3N6LA 4R8UB 4IR9A 3N6MA 3DRRB 1LWFB 2FVCA 3H98A 2HNYA 3QGIA 5KG3A 4RNFA 1YVFA 5KFOA 2BQ3A 4KAIA 4H4MB 1TL3A 1JXLA 1RT5A 1C0TB 2YNHA 1RTJA 1S1WB 4ZVEA 1XR6A 5I42B 4ECSA 4Q44A 3V81A 1JX4A 2IAJB 5KG7A 4J9PA 2ATLA 4ECTA 4WE1B 3MTKA 4ICLA 3KLGA 1D0EA 2HAIA 3DI6A 2DPJA 1REVA 5C5JA 2VG6B 3NL0A 3H5SA 2EC0A 4O3SA 5KFBA 1JLCA 1TKZA 4ZPDA 2B6AA 3G6VA 2JEGA 3LP0A 3BQ2A 2VG6A 2RDJA 1RTDA 2RDIA 3UR0A 2YKMA 4ICLB 3KLGB 3M8QA 1RT6A 3JSMB 2FVQA 4HKQA 1TL1B 1DLOA 3NMAA 5KFFA 3GIKA 3GILA 4ED7A 1HPZA 4OL8A 4K4VA 2IC3B 1RTJB 1ZETA 5L1KA 1LWEA 3LALA 2W8KA 3CJ3A 4ZP9A 4KO0A 1VRTA 4IFVB 1S0NA 4IOBA 5I3UA 4ECZA 2XCAA 3DOKA 3QGGA 1HQUA 4RUAA 3KLHB 2BANB 3OHAA 2XGPA 3H5XA 3T5LA 3IGVA 4RNMA 4IH5A 3KLEA 1QUVA 1S1XA 2HNZA 3LP2B 3OL8A 3DOLB 5KT4A 2R2UA 4TYBA 2AQ4A 2BR0A 3QO9B 5J2PB 1K1SA 2HWIA 4ZHRA 4K4YA 1T3NA 4TN2A 3OHBA 3V4IA 3PZPA 1BQNA 2XGQA 1SV5B 4TY9A 1S1XB 3NBPA 3QLHB 4EYHB 4RW6A 2D7SA 2WK4A 5L1LA 5F9LA 3DRPB 3M8PA 4RW7A 4RNOA 2JEFA 1CSJA 4ED1A 1RT2B 4IR1A 2WONA 4LSLB 4ZPBA 4WXWA 4J9NA 1N5YA 2ILYA 1HNIB 4MK9A 3G6XA 2IMWP 4U7CA 4JUZA 1FK9B 1K1QA 3NKYA 1S0OA 2O5DA 3PHEA 4K4XA 1GX5A 3PR4A 1IKXB 3KMSA 4EBCA 1C1BB 1HPZB 5KFAA 3H2LA 5JUMA 3HKWA 2F8EX 1U09A 5DQHA 2JEIA 1HNVB 2WOMB 1RTDB 4YQWA 3BGRA 5F8IA 1R0AA 3LP0B 3M8PB 4MIBA 1C0UB 4O4GB 4NCGA 5HROB 3FSIA 2CKWA 4QW8A 2ASJA 3DLKB 5CYMA 3DI6B 2WOMA 5HP1B 5KFIA 3UPFA 2YNFB 3T5KA 4M94A 2AWZA 3C6TA 5F8JA 5HP1A 2FLNA 3DOLA 5F8NA 2FVRA 3QIDA 1DTQA 3TAMA 3IGNA 4O3PA 1IKYB 4MFBA 5K14A 4F4YA 4YR3A 3N6NA 3CJ5A 3SI8A 2I5JA 5KFEA 2C2RA 4J9MA 5J2MB 1S0MA 4LQ3A 1NHUA 4DL2A 5KFVA 4K4SA 1TVRA 2HMIB 3KLFA 3KK2A 3C6UA 4RW8A 1TKXB 1RT7B 3KK3B 4I7FB 2JEJA 1BQNB 3H5UA 4RW4B 1RT3A 2B5JA 3DLEA 4KKOB 5DG8A 3MR2A 4F4XA 3RB6A 4PQUA 4KSEB 2OPSB 1S4FA 4IH7A 3GV8B 3OSPA 1TL1A 4LSNB 4O3NA 1QAIA 4NLSA 1TKTA 4GC6A 4DG1A 4EEYA 3DLKA 2ASDA 1HYSA 2GIRA 3KLEB 4NCGB 4K4WA 4GC7A 1RYSA 1DTTA 3JYTB 4IRKA 3BGRB 1TV6A 1N6QA 2YKNB 3M9NB 4Q45A 3GIJA 3GYNA 5KFRA 3M9MB 5KFNA 4WE1A 4NLOA 1JLEB 3CJ4A 1LWCB 5FDLA 3PR5B 3HVTA 1XR7A 1JLQB 1T03B 3V81B 2UVUA 3QO9A 3H4BA 3E01B 2E9ZA 1IKVA 4F4ZA 5KG0A 3KHGA 2R2RA 3LAMA 4I2QA 4ED3A 1JLQA 3GV5B 1S6QA 4H4OB 5C42A 1RTIB 3V6HA 4MIAA 1JLEA 5KG2A 3KOAA 2RF2A 4NLQA 2QV6A 2OH2A 4NRTA 3KMQA 1N56A 3SFUA 4URGA 5I3UB 4O44B 3TVKA 3MF5A 3OSNA 1IKYA 4IDKB 1JIHA 4MFBB 2WRMA 3V6KA 4DL5A 2FLLA 5KT6A 5KFDA 4DG1B 2GIQA 3I5AA 3KLIA 2IC3A 3MR3A 4F4WA 3V4IB 1JKHA 1T03A 4TYAA 1DLOB 4ZHRB 2YNGB 4KHRA 2BQUA 3EPGA 5KFTA 5D3GA 4KFBB 4NLXA 2E9RX 3M8QB 3RAXA 3EZUA 4O3OA 2W7OA 4ECXA 4PUOB 1I6JA 5KT5A 3OL9A 1MU2B 1W25A 2B6AB 1RA7A 3DMJA 4ID5A 5EWEA 4QW9A 4MH8A 3PW7A 2W7PA 1S10A 2OPPB 3FQKA 2UUWA 3OL6A 4YR2A 1S97A 3DYAA 2B43A 4JV0A 4QWAA 1EETA 4QPXA 2AX0A 5DGAA 4ZVFA 1IM4A 1S6QB 4H4OA 1SUQB 5C42B 5KG5A 4DL4A 2IM0A 3BREA 1T05B 1EP4A 2YNHB 3MEGB 1J5OA 3CDWA 2ZE2A 3C6UB 3CDEA 4RW8B 1SH2A 3LP1A 1TQLA 1HMVB 4NZ0A 4ED2A 2WONB 4LSLA 4YR0A 1UWBB 4O3QA 1S1TA 4YMEA 3Q8RB 1GX6A 1S1VA 4J9OA 5C25B 3PW2A 3UQSA 5KFGA 2OPQB 4FS2A 4ECYA 4B3OB 3IS9B 3RBDA 3NAHA 2AX1A 5KFYA 5F8MA 5L1IA 3RB3A 5DLGA 4J9RA 3MFIA 1C2PA 4B3OA 2W8LA 4K4TA 1BQMB 4NLTA 1S9GB 3LANA 2W9CB 3I0SB 4R0EA 5KT3A 2HNYB 2UVWA 5KFWA 4O44A 3PW5A 1S49A 3IRXB 1HNIA 4Q43A 5HLFA 3PJWA 1RYRA 4NLVA 3ISND 4IRCA 1LW0B 5F8LA 5KFMA 4MK8A 2FJVA 2D41A 3IRXA 5C24B 2OPRA 2IJFA 4K50A 1VRTB 3NBPB 3QLHA 2RKIB 4IFVA 1S9EB 3BJYA 3CWJA 4EBEA 1S6PA 3Q8QB 1FKPB 2BE2B 2BRKA 2D3UA 1RT4B 1S9FA 3GIIA 4HYKA 3FFIA 4MKBA 4NLDA 3DLGB 1SH0A 3IN5A 2AGOA 2FJWA 3OL7A 2HWHA 2WCXA 2HNZB 4IKAA 2XI3A 3LP2A 5J1EB 2W9BB 5DQIA 4F50A 3V6JA 3DMJB 3CJ2A 4ID5B 3DRPA 4RW7B 3KNAA 1NNDA 4RW9A 4QWDA 3T1AA 3GIMA 2JC1A 4WYLA 4XO0A 1KLMA 2HNDB 4ZVHA 3KHRA 4J9QA 4J9LA 4WFYA 3DLGA 1HNVA 3EPIA 5J2QA 4DL6A 4ECUA 2BQRA 5HBMB 4NYZA 2OPSA 4J9SA 1J5OB 4NLYA 4NLRA 1LWEB 1IKXA 5J2NB 4RW4A 2VA2A 1TL3B 4ED0A 4NLPA 1FK9A 1JLAA 4ED8A 5F8HA 1LW2B 3QIPB 3HVTB 3D28A 3PW0A 3LAKA 1ZTWA 5C24A 5J2QB 1OS5A 4R8UA 4J9KA 3CDUA 1VRUA 1KLMB 2HNDA 4Q0BB 2IM2A 1TV6B 3DOKB 5JXSA 2UUTA 3PVXA 4TQSA 4TLRA 4Y2CA 4RW9B 3ITHB 2UVVA 1RTIA 4EO6A 1MU2A 4RW6B 4I2PB 1LW2A 3QIPA 3TAMB 2J6UA 4I2QB 1HYSB 3MEEB 4IG3B 1SV5A 2IM1A 2VG5B 5J2NA 3ICLA 1TKTB 3E01A 3OLBA 4KFBA 5EUHA 2R2SA 3C6TB 4Y3CA 3Q8PB 1IKWA 5J2PA 1JLBA 2IM3A 4X2BA 5CYQA 5KT7A 3PW4A 3RB4A 3GQCA 1RT3B 2YKMB 4KKOA 4KHMA 3JSMA 4PQUB 2OPQA 3ISNC 3MEEA 4XPCA 3KK3A 5DG9A 4K4UA 5KFJA 1N6QB 1SH3A 1ZTTA 2OPRB 4ZP8A 3ITHA 3DRRA 1JLCB 5KFSA 4ZMMA 3KK1A 2ALZA 1UWBA 1QAJA 3DDKA 4G3IA 2FVSA 3LP1B 4JV2A 3NGDA 4KBIA 3BQ0A 2WB4A 3IG1A 3H59A 3CVKA 5KG6A 1MMLA 3G6YA 3HVWA 1S9GA 1KHVA 2W9CA 2B5JB 3DLEB 3PJXA 4TQRA 1RT5B 3BSOA 2AGPA 3MEDA 4I7FA 2FJXA 2XC9A 2YNFA 1TVRB 5FDLB 3NAIA 4H54A
chains in the Genus database with same CATH superfamily
1N5YB 3QSYB 2YQ3A 4RWWA 2OFHX 1E6YA 2L9DA 3VWSA 3VAGA 4DFJA 1VQ9S 3G9CA 1U02A 1N0UA 3MPWA 1IJEB 4P73A 3G96A 3QPIA 2GS8A 2WSCC 3P45B 3RAQA 4PPDA 1NDPA 3WDOA 3P49B 4PUOA 2JWNA 1HQEB 4N8OA 1HBUA 3M8WA 1XK8A 4RZRA 2CPYA 2ZITA 5KFCA 4X66F 4LVOP 2RQ4A 4NXNF 1DY3A 1IKWB 3DLBA 2HVIA 1OWXA 3P5TL 5C7PA 1NH7A 3BBCA 4Y00A 1PG5B 4QWEA 3O3LA 2C22A 4A8QA 1SJQA 1RBAA 2YWKA 2VG7A 1P9YA 3K8VA 2ZH4A 2LCWA 3RBXA 3MUVP 5C25A 1RSCA 2PE8A 1WI6A 3K89A 2RHSB 2RRAA 4R5PA 2ACMA 1HNZJ 1VC5A 4NLWA 3CJ8A 2WVCA 2OFGX 2DNMA 3EDQB 4RPFA 4DL3A 2ATCB 1S76D 2EBEA 2UVRA 2GO8A 1NSPA 5GMEA 5K14B 2BRLA 1PIEA 2DYAA 2NZCA 1U8WA 1PC5A 2ZE2B 2QTWA 4PWWA 4A8MP 2I1RA 1HWUA 2MHNA 3VAMA 4U7UD 4EO8A 3KJVB 4RKUC 2R7QA 2YNGA 2DGWA 1NZAA 3PYDA 4IG0A 3Q8SB 2DRBA 4JV5F 1UETA 1RT6B 2XMVA 2OIHA 3THVA 1NDKA 2MY7A 1YZ6A 2C2DA 1S6UA 2PA3A 2Q79A 5B09A 1V3SA 1FJGJ 4I2PA 1U24A 3JYTA 2YPZA 1RWUA 1U7LA 5K9FA 3G6ES 3QNWB 2D3ZA 3KLHA 4LF2A 3H90A 3KLVA 1FKOA 2RF2B 4A47A 2RU9A 3PEJA 3CIZA 3M8ZA 2VPYB 4ECVA 3PKYA 2CQGA 4UZCA 2VODA 1GMVA 1KR4A 2BE2A 1RA6A 4FZVA 5GADU 2DISA 3MFHA 2LU1A 3GR0A 2DHAA 4GVLA 4M63A 4EK2A 1VBZA 4AL5A 5C2GA 2D3O1 4LF4F 2ZDPA 1B0TA 1NEEA 2RKIA 3DM2B 5HBMA 4JI3F 3MUTP 1XMBA 2WVEA 2QYCA 3UDLA 5IV3A 4MIWA 5KTQA 2QZ8A 4N77A 2VFUA 5B0EA 4P9SA 1UFLA 1LW0A 4J9VA 4AT1B 1VRUB 5K8MA 4DL7A 4X64J 1JJHA 5DLFA 1N32J 2XNQA 1CULB 2DHHA 3H42A 4WXOA 3OFFA 3TX8A 3GWCA 3G71S 3H4DA 3VAJA 2AGQA 3BB5A 3BSNA 2HVZA 2OGUA 1R6VA 3UN5A 4HLBA 3B78A 2VG7B 3UVJB 1C1CB 4FP9A 2XZTB 3VZIA 5EWGA 1KP6A 5LXYA 2BJDA 2ZH2A 2QE5A 1H38A 2XYGB 3CF5Q 3PIOQ 2G9OA 2CJQA 2YKOA 1HBNB 1H0HB 1K44A 3FEXB 4XK8C 4YDXA 4CI0B 3QGHA 3AJDA 1P1TA 4P72A 4DZ6A 2ZM6F 1NK8A 2XLIA 4U6PA 2CQIA 1U2FA 4PG7A 2ILZA 1FE0A 1Y10A 3F41A 1WKKA 3AJ1A 4FKXA 2ZM6J 4W90B 2MKSA 2XWYA 5KFXA 4FBUA 4N5SA 1FHTA 2V9WA 3ENAA 5J1EA 5M2RA 1LOUA 1REVB 2JNJA 3NGTA 2BKNA 4KJIA 2FUG9 1EAYC 5U47A 3GV7B 4USMA 2P6TA 2P9GA 3L9ZA 2IA6A 3H5YA 4NCBA 3N01A 4ELUA 4KGKA 4QYZK 1MN9A 3NNCA 4XPEA 1FRJA 4L6V3 2BW7A 4DX7A 3U1LA 3LPEA 3HT0A 4DI6A 2I6WA 2RHQB 1VDHA 4LIWA 3BQ1A 2JOQA 4HEA9 2Z56B 4LT6A 4MKAA 2ADCA 3CJQA 3OFHA 3Q0AA 2V4JB 2H3EB 1RHRB 2E5JA 3Q89A 4TY8B 5LMUF 1KC8T 3UCZP 2NXCA 4DF8A 4B9UA 5D15A 2C3YA 4F36A 4MYUA 1U1QA 2L3MA 1CJKA 1DJ0A 3G2XA 1X0PA 3HO1A 4C8OA 1VC6A 1FEHA 1KWMA 1NHVA 1RT4A 4ZS6A 3RYLA 2Y1IA 2K06A 2VU5A 3PRVA 3AD7C 2PI4A 5GADI 1T94A 1C0TA 2V4QA 1K0VA 1G7CB 5KFQA 4OZ2A 1V3ZA 2HPUA 2QA4G 2AV5A 3B8HA 1S1VB 3S01A 4AD6A 3B54A 3F44A 1JLGB 4OI3A 3KLFB 2AJ2A 1PO6A 2WTFA 3K0JA 4PAAA 4G6VB 2ZD1B 4CLLA 4Q0BA 1Q8IA 5L1JA 3AX3A 2MKCA 2Z2MA 3H2UB 3J80U 1VISA 3DRRB 2LEBA 4Z7CA 3QGIA 4DQPA 2BQ3A 1L3TA 4I0WA 4EU0A 3ZFVA 1TL3A 1WF1A 1RT5A 3OFEA 2V67A 5LSOA 1JXLA 4DN9A 4LR8A 4HHHA 1XR6A 4ECSA 3UW1A 1JX4A 1VQ4S 4GVBA 5LL6d 2IA0A 2QLFB 1JJCB 4CWBA 1VR6A 4KPYA 5E7OB 3NGRA 2C42A 4ICLA 5H1SV 1ZOTA 3DI6A 3JSBA 1NDCA 1REVA 1G1XA 2HK2A 2EC0A 4O3SA 9ATCB 4CIOA 4ZPDA 5A0YB 3G6VA 5F41A 3SBMA 3BQ2A 1OY6A 5LMUJ 2RDJA 2I38A 1M90T 1YJVA 3UR0A 4ICLB 4OJHA 3M6UA 2QG9B 3VALA 1TL1B 4C8MA 4OYIA 3VAHA 3MMAA 3ELHA 2IC3B 1ZAXA 3A1YG 3CCWA 3IR5B 3T3FA 2KZMA 2LXUA 1LWEA 5HJYA 5T41A 4KO0A 2GNKA 5BYSA 1J5EF 3VV2B 2LKZA 4NEYA 4YUDA 2RH3A 2K7JA 3DOKA 3FK4A 3MM6B 3EWGA 3R5DA 1H2UX 4PABA 2MZTA 2BOPA 2J9DA 2XGPA 1TU0B 4I69A 1F0XA 2VFSA 2G2YA 7AT1B 4X4SA 4YY3J 2DITA 3H20A 2KO1A 3KLEA 4FYWB 1S1XA 4NI2A 2CQ3A 2JX2A 4DSFA 4LR7A 1WI8A 1S57A 4TYBA 2BR0A 3C15A 3MOJB 2WVBA 4X4NA 3D1HA 2WVDA 2J7KA 2BE7D 4TN2A 5HMWA 4DR6J 4YEAA 5ETKA 2KXFA 4ZKAA 4C48A 4UTGA 3UE2A 1SQGA 2HHXA 4C0HA 4G65A 3NBPA 1N5SA 3MMJA 4RW6A 1UVMA 4CO3A 2WK4A 5L1LA 2W24A 1SQFA 3EXYA 4KPCA 4IR1A 4ZDNA 2HYIB 4LSLB 1FKAF 3GJQB 3FRYA 3EVMA 4OYZA 1NKBA 1XTZA 4H4KA 4J9NA 2ILYA 2ASYA 2CZVC 5ETQA 5LSRA 1NJZA 1Q5VA 3G6XA 2XMWA 3MTJA 3UFCX 4IUFA 1VJWA 4F0HA 4KTQA 4NZ7A 3PR4A 4ED3A 1TMMA 2NSCA 1IKXB 5LM7E 2F8MA 4EBCA 2MKJA 3JTOA 3C46A 4J90A 1KKHA 4ER8A 2HZVA 1VGYA 1GXTA 3ET6B 3HKWA 4MT1A 4OX7A 2JEIA 2WOMB 4OZJA 2AEMA 4CH0S 1RTDB 2NREA 2CVIA 3PIPQ 2D9PA 1R0AA 3LP0B 2DNQA 3D0IE 3LUYA 2VKRA 4X4QA 1M0SA 2FLOA 1PKUA 4NCGA 1U0HB 3O2IA 4M8LA 4WFNQ 3CCMS 4B3MF 5ADZA 2F3JA 2HIYA 3AT1B 3GQCA 4YY3F 1CC8A 5B0DA 1Y5IB 2GIFA 1CLFA 3ISZA 3T5KA 2LVWA 4M94A 3FCVA 1HW9A 2AWZA 1SKUB 4DR2F 2PFDA 1PBAA 2J0SD 3C15B 3IRWP 5HP1A 1I51B 3BGLA 4O23A 5I3QA 5I42A 5ETNA 3L7UA 4UY8T 1DTQA 3KFWX 3M32A 5K14A 1IBLF 5DDQC 5D4NA 5HQMA 3W5XA 2RQKA 3CJ5A 3IWLA 2ZWOA 5AXNA 3TA1A 3BV8A 3G4SS 2ZVSA 4LQ3A 2BYCA 4K4SA 1N5QA 3U7JA 4RW8A 3OUYB 3KK2A 2AHOB 2DNNA 2H4WB 2KI2A 2VH7A 4A4JA 4DV6J 3H5UA 1TL7A 2KDOA 1X4FA 3RB6A 1HWLA 1H98A 2H5JB 2Q43A 4DPTA 4IH7A 4JI8F 3FEYB 2N3OA 1TL1A 2L08A 3D3BJ 4DG1A 1WSVA 3G82A 5AJ3J 4EEYA 4CO4A 1XC9A 2FDNA 2PSZA 1XWLA 1RWMB 3A3OB 1NK5A 1B64A 1X5SA 3D9BA 1HBOB 1ZBTA 2QSFA 1SL2A 1DTTA 4CO0A 3JYTB 2DNZA 1A6LA 3AODA 2AP6A 1XNRF 2ZZNA 2YKNB 4PEOA 3W9JA 5DDRC 3PX6A 1RHQB 1NLKL 4NLOA 4QIWD 3CJ4A 4DQSA 5IT0A 2ZBQA 2I2YA 3ET6A 2J9CA 4QR1A 2CPEA 1JLQB 1TL4A 2XWXA 5CD4A 3CCZA 1IKVA 1WDTA 1X5OA 4F4ZA 4XDDA 5KAKA 1S5ZA 1G3OA 2BJ8A 1P6TA 3LAMA 4I2QA 1V5IB 1PSDA 2FHMA 3AOBA 2G2OA 4H4OB 4OX6A 2OHDA 5C42A 1RTIB 5LJ5Y 5KG2A 1S7HA 3V6HA 1IN0A 2YPYA 1GK8A 2RF2A 2KRRA 1IQTA 2OH2A 1FE4A 3BDPA 1FWLA 5A8WA 1G4CA 4FYXB 3KMQA 3SFUA 2DD8S 2FJEB 4O44B 3W63A 1WOSA 1IKYA 2XTJP 4NA1A 4WK3A 5D4OA 5HK4A 1JK9B 2H5EA 4ZCIA 5KT6A 1VRQC 2QC3A 3PYFA 5CH7B 5KFDA 2GIQA 1OO0B 1H7WA 4ZCLA 3CNQP 2WW4A 1M5SA 2XHCA 2HS3A 4RX6A 3KDNA 4ZHRB 3CCVS 4OJGA 3EPGA 1JJ2R 1YJWS 3DFEA 1I94F 3M8QB 1MWYA 2HVEA 4DR3J 1G6BA 2KM8B 1JJ4A 5A8KB 4ECXA 4F3QA 1HWIA 4B9TA 4M5MA 4F4YA 1UVLA 1RAIB 3MM9A 4F7VA 1X31C 4UUXA 4K5SA 4QW9A 3JTNA 2AD9A 4LFAJ 2W7PA 2OTJS 4YHHJ 2OPPB 3NOGA 1YJTA 3F73A 1WACA 3IP0A 1BQXA 4JV0A 1EETA 4QPXA 3I9V9 2DVIA 2E7XA 4H4OA 3ZZZA 5C42B 3SZ2A 1T05B 2A2DA 3J7YU 2JZ5A 2YNHB 1RADB 2QFIA 2D69A 4I68A 1J5OA 3IXQA 1S99A 2F63A 4KHPJ 3NP5A 1SH2A 1R89A 4GRSA 3WX8A 2XBPA 2WONB 5HANA 2HHUA 1CS4B 4RJVA 3MM7A 1UP1A 4HL9A 2CQHA 3DC2A 4WP8A 5KFGA 4FS2A 2W25A 4I6YA 4N76A 1QVFR 1FFWB 3NAHA 2HQIA 2GHVC 3QAUA 1YJ9S 2W01A 1TFWA 2XSJB 5KFYA 5F8MA 3D0GE 3TJ8A 3DDNA 5DLGA 1CEZA 3W9IA 4J9RA 1GMWD 1XIQA 3H8YA 5LSLA 3E8OA 1KVIA 3I0SB 4BC7A 3FBCA 5B7WA 2CNKB 1HD0A 1MMDA 3HSDA 4HTIA 1K47A 1UEUA 2BBEA 3LGHA 4E98A 1RYRA 2XY6A 2FVRA 4NLVA 2EG2A 3ISND 2MZSA 3GSIA 1PJ5A 3MDFA 2F1FA 3A4TA 3GTYX 4CNYA 2D41A 3HD1A 1HLWA 2AYMA 3EGNA 2ZBIA 2OPRA 5DG7A 2W4CA 4UOFA 2ZNZA 3UI3A 2FHJD 3EM1A 3LQVA 2M2BA 5A2QY 1CJVB 3OR2B 1T8EA 4EBEA 3ZNUA 4ZLNA 3PACA 1S6PA 1IBKJ 1FKPB 3W2WB 1WC6A 4GKJF 4CYUA 1RT4B 3M8YA 4OQJA 4HYKA 4GKKJ 2IRYA 2YWWA 1T0TV 3DLGB 3FSXA 2AGOA 2BM0A 1SC6A 3FCHA 2V8HA 3LP2A 4M5NA 3DMJB 2UP1A 4JI4J 4ITSA 3HXMA 1K0TA 3SMZA 2X7IA 1JXVA 1KQKA 4WYLA 2NPIA 3R5CA 4OMFG 1WUUA 2BACA 3DLGA 2FGCA 1PAUB 4OV1A 4GKKF 4QIEA 2J0QD 1TELA 1VQ8S 2OPSA 4J9SA 4DF4A 1VHIA 1EB0A 1IKXA 1QM9A 3IBCB 3PJ9A 4RW4A 5J2NB 2CYYA 3QRRA 2VDHA 1GMUA 5F8HA 2HHQA 1NDLA 1LW2B 2G2ZA 3MI7X 1FJGF 2UUCF 2GMLA 4KY3A 4QR2A 1EJ7L 3BDEA 3NS5A 4CNZA 2E1PA 1MROB 2MYFA 3CJRA 1CG2A 1KLMB 2IM2A 1GAOA 3DOKB 1KDNA 2UUTA 1BGXT 4CLPA 5K8NA 2XYHB 4TLRA 1ELOA 2Y8YA 2KFZA 2UVVA 2COLA 4JP8A 3GONA 4ETXA 4DR7J 2YWEA 3TAMB 2HZCA 4JI2F 1WC3A 1U4BA 2M70A 3L95X 3N79A 2VKZG 3BGFA 1TKTB 3OLBA 4KFBA 2JLGA 3A12A 4OI1A 1IKWA 1ZS6A 4X64F 2IM3A 3HSJA 1IBKF 3EICA 3MMBB 1X4CA 1SC3B 4KHMA 4PQUB 1OY8A 3FBFA 3PRBA 5DG9A 4K4UA 5GMDA 3MM7B 3K59A 3K57A 2EFNA 4NEZA 5CCLA 2OPRB 1ZTTA 1KN6A 3ITHA 2E5LF 4LSZB 4ZMMA 3KK1A 2FC9A 2ZH1A 2HFZA 2ADBA 2FVSA 2XLJA 5KOWA 1E6YB 1NXIA 4K2XA 3MM6A 4JV2A 4KBIA 3RBZA 3KUGA 3HKZD 3AHPA 1XQIA 3ENVA 4PZVA 2M8HA 1CQMA 2H1YA 1F60B 1MMLA 3H59A 2JVRA 3HVWA 3M32B 3O6QA 4PYAA 1I1GA 4DU8A 1FXLA 2B5JB 1SBRA 2DH7A 4UW2A 4DXLA 3TUZC 2FY1A 5CQGA 5IC4B 8ATCB 4KRWA 3MOZA 3CPWR 5H9FK 2NXJA 1VOMA 4NA2A 5M2PA 1U1OA 4LFCF 1UEVA 3TWZA 2XC9A 1UVIA 2X3DA 4LVNP 4H54A 4UF4A 5HVFA 3M8RA 1FKOB 4F02A 1R8CA 5J2MA 3TQ1A 2J6SA 3QGPA 2B56A 4LFCJ 3QT6A 3H40A 5HROA 2CZ9A 1YDLA 2GVDB 3DRSB 3ZXWA 2MKIA 4ZP6A 4JI7F 2CG8A 3FDSA 3SIPB 1RU2A 3T19A 3MR6A 2BABA 5JJBA 4KYZA 4F4KA 2DNYA 1X5TA 1NCLA 3HJFA 2R9LA 2R8KA 2HBRB 2LU2A 3CJTA 3FJ2A 1HQ2A 3OTEA 4QQBA 3RZAA 4CLKA 3K5MA 2R8IA 1FD2A 4R0JA 1VK8A 4URSA 3R1LA 1CJVA 3OR2A 9RUBA 1YRXA 5FD1A 1LFPA 5FIIA 1W2IA 1T05A 3VGUA 3HF5A 2XTEA 2OSRA 2PMHA 1TKXA 4L73A 3U27A 4DPUA 3ILOA 4U9RA 1RWVB 2ZFHA 6FDRA 2XS2A 2KYZA 1NK9A 3UDEA 2RRBA 3MEKA 3SCJE 2OPPA 5HMZA 2FLPA 1RCOB 1IBCB 1QTNB 1Z1ZA 4YB5A 2VICA 1SCJB 4OYMA 4R5PB 8AT1B 2YNIB 3GYGA 2IJNA 4X66J 1SC4B 1B99A 4DEZA 2VA3A 3GPAA 1SXLA 4IYQA 4BBYA 3GIRA 3HVAA 1H6KX 5DGBA 3KHHA 2IBKA 3MEGA 2LQ8A 1U48A 3WIVA 1FDBA 2AMCB 1WG1A 5KG4A 1KHWA 2CWXA 2EBGA 1B3TA 2XNRA 1RHMB 2P5VA 2HHSA 3IG1B 3W9HA 5GMKa 3CD6S 2LA4A 2RQMA 1FESA 1JLFA 2H54B 3EJMA 4OI6A 5F0UA 1HNXJ 3HHLD 3BKFA 4AL7A 4A8FA 2MKHA 1HNWJ 3VTIA 1NK6A 1QSSA 1JB0C 3R5JB 4OZNA 3TARA 3J7AN 4PRFA 1HQUB 3W3SA 1HFEL 3I0RB 2BM1A 4EWTA 2MHEA 4K0KF 1PJ7A 2HSEB 3RW7A 2HHWA 3H2VE 3HZGA 4BDPA 2Z57B 3HFKA 4HT7A 4K8RA 1RWXB 5IV4A 1VI7A 2NYHA 3PCOB 1FVSA 4FYYB 1RT1A 4IFYA 4N47A 4DUZJ 4J91A 1KS2A 1YZ7A 2P6SA 1IJFB 1C1CA 2KRBA 3H0PA 3SSQA 3M9OB 2EFPA 2ZC4A 1RBLA 3EGVA 4F04B 2E9TA 3NS7B 2FJAB 3PO5A 3SYZA 2DIVA 3D6FB 4EBDA 4C8ZA 3QYYA 1UPPA 2BJ1A 3OTBA 3K8WA 4Z37A 5GAHI 1J2VA 1RP5A 5KOXA 1L3UA 2RQCA 2ZH7A 4PXDA 4W4MA 2WSEC 4WKYA 4QYRA 2E7WA 2QLJB 5HLFB 2HBYB 3S8SA 3ZTSA 1HARA 1N5TA 4IQXA 4CH1A 4ECWA 2C28A 1SJ4P 4NLGA 1D9FA 2HGLA 3CC2S 3T5JA 1K8AT 2Y8WA 1R7IA 3A3PB 1JLFB 1RBOB 1Q86T 4DR2J 1NM2A 4IFYB 1IWAA 2GFFA 3RRKA 4ZN1A 3IS9A 3R7BB 1VC0A 3PKMA 4F0KA 3QQCD 4OHVA 4RNHA 1LV5A 4WIQA 2QEXS 1H3DA 3WQPA 5G0RA 1T9VA 2YNIA 1UFWA 3SSRA 2UUBF 1FRKA 3OXLA 1P8GA 1SL1A 1S77D 2R7UA 4UUWA 1VS3A 2E1MC 4YFUA 1Q16B 2W2OP 1RTHB 2HGMA 1VMBA 2CNNB 1S1UA 4NRUA 3EZOA 2B8QA 1TAUA 3TUJC 4RNNA 2QLWA 4LREA 2N4CA 3SFGA 5DQGA 2R8HA 4EYIB 3HI9A 1YK9A 1QE1A 3FEZA 2V4RA 4WK1A 1QD1A 3C66A 3D66A 2I8EA 1Y5NB 3N9UC 2DRAA 4I67A 1KQSR 1SL0A 4AQYF 5L9XA 4LF9J 4X4RA 2F7VA 1T9WA 2DT9A 2HHHJ 2YKNA 1AFJA 2P2CB 3O44A 2VL1A 3TNVA 3RW6A 4Q8FA 3OLAA 2DNHA 2RUSA 1IVZA 2G1DA 2OD4A 1WTFA 3CCUS 3TEGA 4QWCA 3HZEA 1DQAA 3KJVA 4TXSA 5CD4H 1NAQA 1D8YA 4LBHA 3KHLA 1M5VC 2ALYB 1J27A 5H9EJ 2OJ3A 3R6LB 4K7QA 4DV1F 4KE5A 5IOLA 1E6VB 2ZNYA 4KB7A 4LJMA 5B0FA 4BCAA 5HMYA 2C2NA 1XR5A 3M6WA 3P8BB 3GFZA 3R5GA 2R4FA 2M4MA 2DNPA 2OKQA 3PHTA 4K59A 4E2FB 1U1KA 1IBLJ 1LWFB 1WD6A 3WHIA 1YX2A 3DHWC 4DPWA 4RNFA 2GVZB 4ZJLA 2V2KA 3CD0A 1TK0A 1UKUA 2KHCA 1RTJA 3R1HA 3UR3C 4QR0A 1S1WB 3PEHA 1HBNA 1RAGB 1SVDA 4ZVEA 1N33J 1CC7A 1PYOB 1Z2LA 2HGNA 2OELA 2PGCA 3LO3A 4J9PA 4LFBJ 4ECTA 3W65A 3AB2B 2ZZTA 3W5ZA 3KLGA 1NSKL 1H74A 2MSSA 1D0EA 3UVJA 2JEJA 3NXZA 5HSPA 4B9NA 3H5SA 2CQ1A 4LF7J 5LJ3Y 3I55S 1QDUB 3AD9C 1RAFB 3AB4B 1TKZA 5I4MA 5FJ4A 1F2GA 4DV4J 2AYEA 2JEGA 3LP0A 1DHMA 3BGUA 3BN7A 2RDIA 4LF6F 4L74A 4HI1A 3Q8UA 2QIFA 1PYSB 3CXCR 1YBAA 3TVYA 1OYEA 1OYDA 4GVBB 4AE5A 5KFFA 4ED7A 2LDIA 1HPZA 4C97A 3UD5A 4PG4A 2CNLB 4FKYA 5L1KA 3D7SB 3LALA 3WZ0A 3A8JA 3D67A 5HQLA 5LOQA 3MMAB 2ZBCA 4IFVB 4U7UK 3OXGA 1S0NA 2M8DB 1M5HA 4IOBA 5IXUA 3P6YC 3CUNA 1S7IA 2GAHC 1SJ3P 1VIOA 3DGPB 1NRKA 3QGGA 2JVOA 1M5PC 2W1BA 2VQEF 1HQUA 1ACMB 1WORA 2BANB 2MSTA 3OHAA 2CVEA 1FRHA 3H5XA 1HHQA 3T5LA 3IGVA 3AD8C 1W2BR 3UD4P 4IH5A 1N88A 4C98A 2HNZA 3LOUA 3OL8A 1SQEA 5KT4A 2R2UA 2MLYA 1K1SA 4ZHRA 3CE8A 1AT1B 2HFOA 2RDDA 2P8IA 4CLTA 1VQNS 2HEKA 1N54B 1SV5B 2J7UA 3TUIC 2J8SA 3D4JA 4NE9C 3AA9A 4F2RA 4RW7A 4P2FA 2GMHA 2VUGA 1CSJA 2DHGA 5T7LB 1ZYQA 1TR0A 2HKEA 4G1IA 4P6QA 3ZZPA 2DGUA 1U6FA 4G1PA 3SCKE 3W2WA 4LF8J 3TZXA 4U7CA 4ZK7M 1FK9B 1K1QA 3TANA 2O5DA 1IQZA 4K4XA 1GX5A 1YRTA 2GMJA 3PHEA 3W1YC 3AAWB 1HPZB 3HSZA 3UDCA 5KFAA 3OTCA 3H2LA 5I3PA 3Q23A 1URNA 2MLZA 4NA3A 1U09A 1PAEX 2AJ1A 1LKZA 2CA9A 3HX9A 3OBIA 3SV3A 1AZSA 1HNVB 2ACYA 1NB2A 4DL0C 2MXYA 2DR5A 1AW0A 3ZTRA 1IBMF 2A6MA 2IYIA 5ETPA 2YKAA 4MIBA 3J81U 4QYZJ 3GJTB 5HROB 2Q6CA 2CKWA 2JFDA 3M30B 1HI0P 2F65A 4B02A 3K5NA 3DI6B 4ANCA 3OD2A 4YB7A 5HP1B 3KKFA 1HW8A 5KFIA 1A0OB 2YX7A 1RACB 3KDOA 4DUTA 5HO4A 1BUXA 1DAXA 2XSJA 3C6TA 2ZOMA 1YJUA 2MKYA 2N82B 4NXNJ 4ZIVA 2FLNA 4A48A 3DOLA 5F8NA 1UJ4A 4Y65A 5FLXU 2CUYA 5IT9U 1OQ6A 4ES1A 2VBWA 4MFBA 2ZHBA 3TA2A 1ROFA 4RBTA 1T11A 2MZQA 4TNOA 1M1KT 1S6OA 2I5JA 1ZPWX 2BJ9A 3GLJA 1QTMA 4DL2A 3HCXA 4A8YA 2ABYA 3MCOA 2DCLA 1S72S 4DMZA 1RJJA 4OI4A 4PXCA 3CMQA 2VC1A 1RT7B 4DR7F 2MY8A 3KK3B 5A8KA 4RW4B 4PQUA 3DLEA 1FXDA 5DG8A 1O5JA 1VYAA 1JNRB 2DGTA 4OYAA 2UXCF 2LP4A 1Y4ZB 2V68A 1FT8A 2CJBA 3PFEA 2N7CA 3GV8B 4N56A 3QFWA 1L3VA 2HHTA 1NPPA 1A9NB 3AWRA 5L39A 5A2QU 1TKTA 2OSQA 2B7BB 3LF0A 3I32A 3HFZB 3DLKA 4JYAJ 2HFVA 2GIRA 2HRUA 2H5IB 2NXNA 3TEHB 4NCGB 1CVJA 5E3AA 2SXLA 2ZH5A 5IC6B 4ZIWA 8RUCA 2LA6A 1TV6A 2RJZA 1P9QC 3M9NB 4DQIA 4AYBD 2ZEJA 4HT5A 4DSLA 1GTEA 4HTJA 2VASA 3GR1A 2PC6A 4WE1A 3M1VA 4YHHF 1LWCB 2J5AA 1B4SA 3MWBA 4Y2IA 1SKRA 3HHDA 1GH8A 1XR7A 2UVUA 3V81B 4ZLLA 5AE1A 4B9SA 3E01B 3IFEA 1IR2A 1DZ5A 2B51A 3KHGA 3PX4A 2R2RA 3T41A 1H2TZ 3DKDA 4JYAF 1JLQA 4DHVA 3GV5B 2AZ1A 1B0VA 4ZITA 2ZH8A 3M1VB 3HSGA 3HJVA 2MQNA 3D6HB 3TUPA 2UXDJ 4W92B 4NLQA 2RS8A 2GGPA 3EGWB 2HHPA 2KZZA 2JLFA 2W7AA 2V63A 4BWMA 2X1AA 2KJVA 1KONA 4CLFA 3TVKA 5K8OA 2Q3PA 3OSNA 1JIHA 1QSLA 2WRMA 2KM8C 1S4EA 3OJSA 2EI5A 1FI4A 3T9NA 4B3TJ 2CG4A 3TZZA 1L3KA 1T03A 2GA7A 4TYAA 1Y7PA 2Y0BB 2YNGB 5KFTA 5D3GA 2X1BA 3NCRA 2POKA 3EZUA 3DLJA 4O3OA 3G8QA 4P7VA 5EGYA 2GVZA 2EKNA 4PUOB 1U45A 1I6JA 3M30A 3OL9A 1MU2B 1W25A 3HULA 4CDIA 4DQRA 4ID5A 1HHTP 3Q83A 1S10A 1U6BA 2Y9HA 5K5MA 2E29A 4D3HA 4GMKA 1AFIA 2AW0A 2R3VA 3FQKA 3G82B 1HNZF 3DYAA 1TFYA 2V8VA 2QLBB 2AX0A 1NU4A 2CQ0A 3DGVA 4ZVFA 2DNKA 3PG9A 3HM9A 5DGAA 2UU9F 2YKQA 4NXMJ 1G2EA 3GE9A 2UV8G 1D09B 1EP4A 2KVQE 4WU2A 4CTAA 2D9OA 4P74A 4U8YA 1WC0A 3IM9A 4RWXA 2DEJA 1X0FA 4DUYF 3CDWA 4DFKA 3VR1A 1HI1A 1NUEA 3CDEA 1U8SA 4RW8B 3SQGA 2QT7A 3GB0A 4ELTA 4AFFA 5K8PA 4LMZA 1TQLA 1HBUB 3IM8A 4NZ0A 2Y1LB 3NWGA 2BKOA 3U02A 3TZYA 4DUYJ 1UWBB 4O3QA 1S1TA 3S1TA 3FUYA 2IVMA 3GJSB 3Q8RB 5ETTA 1H73A 1S1VA 4ED5A 4NYPA 4JI4F 2EPIA 4DSJA 3UQSA 2OPQB 2F4VJ 4FPRA 1BD6A 1F9EB 2Q1LA 2FPHX 2NZ4A 2ZUAA 5ETVA 3GFXA 3OVSA 1N52B 2XULA 4DFMA 1SJRA 3FZBA 4EZ9A 1UZHA 2GQQA 4B08A 5LMNJ 5L1IA 3RB3A 2RS2A 4B3OA 1C2PA 1KEKA 3FMWA 4HACA 1YKWA 2KT3A 4NLTA 1S9GB 3C19A 4M5KA 2BW2A 3EVOA 3G87A 2W9CB 4B3RJ 1ZA1B 2B0GA 5HN0A 5H9EK 2NQPA 2G13A 4GO5X 3GFYA 2K1RA 2FHOB 3PJWA 5A8WB 4UT4A 2M7SA 1M5OC 1UJ6A 3I96A 4MK8A 3O8WA 3IRXA 2Q6BA 2B9YA 3RTVA 1CJUA 3D0HE 3DN9A 2E5HA 4K50A 4IFVA 1I3OB 3CCSS 3M2VB 4C7QA 2QA2A 4FVMA 4DJBA 3QJLA 1YHQS 1JNZB 1WEZA 2ZKTA 1R6YA 4CLUA 2KG0A 3A3NB 3GIIA 1RAHB 3RR8A 5D78A 3CD5A 2E5IA 2VC0A 1SH0A 1JMTA 3OL7A 2DXEA 2W9BB 2HNZB 4IKAA 4TU9A 2W2NP 2CFXA 4JI3J 3FMBA 4KQZA 4M1KA 4DV7F 3EE3A 3K5OA 2M3DA 4X84A 3DRYA 3T1AA 3GIMA 2V34A 2Q66A 1WHVA 2JC1A 5G0RB 4XO0A 2HNDB 4J9QA 3C3LA 2VONA 4UQTA 4J37A 1CBKA 2A1BA 2IVYA 4LRAA 3EPIA 5J2QA 1S12A 4USIA 4ZVUB 1DQ9A 4ZCKA 2YWFA 3ZZRA 4K0KJ 4NLRA 1LWEB 2OLWA 3R3TA 4Z7YA 1M5KC 4NLPA 1JLAA 2CQDA 2Z2ZA 3ZO7A 3QIPB 3VCDA 2MLXA 4OI0A 3LAKA 1CULA 5C24A 5E3CA 5B0AA 5HAOA 4WF9Q 2K2PA 3BS9A 4DLGA 2AYGA 1GXLA 3CDUA 1R8HA 3R5AA 4FDFA 1B7YB 3GZ7A 2XZDB 4J7CA 4TKTA 2XB2D 2HAFA 4JI5J 4RW9B 1PCAA 3ITHB 1MU2A 3I87A 1N34J 2IPOB 2Z2LA 3QIPA 5A76A 1DARA 4RU2A 1NZ8A 2QL5B 4JOUA 2IM1A 2MMYA 5A6WA 3QT8A 3VGVA 5J2NA 3ICLA 3QSIA 3E01A 1YTYA 2JL9A 4PQAA 4PCQA 3EUNA 3E2EA 3C6TB 2BDPA 3JQMA 4Y3CA 2DPIA 2ZHOA 2C3OA 1XBWA 2CXEA 2M5YA 2W4DA 2EWHA 2AEJA 2V1SA 2DGXA 1BHNA 1F5BA 1TL7B 1TUWA 1WSRA 2KHDA 2ZDOA 3ISNC 5DZ6A 4CQ1A 3SSSA 5HQ8A 1YI2S 2A3JA 1N6QB 1OM2A 1SH3A 2CWKA 2YBVA 4FYVB 4JI5F 1QAJA 2FY8A 2ALZA 1UA1A 3QJPA 3NCQA 1JQGA 4A8XA 3VQTA 4QU7A 1ZPVA 1DQ8A 3JB9k 1WEYA 2GJIA 3LP1B 1L5UA 1RLCL 3R2CJ 4DX6A 4LF6J 2HVHA 2WB4A 1NJYA 5EN1A 2HBZB 2HFNA 5D4PA 3BM7A 3IG1A 5E0OA 4ES3A 2ZOFA 1X60A 2V50A 3CVKA 1VLYA 1GXUA 2PFFB 1KHVA 1TAQA 2LXFA 3DLEB 4TQRA 1RT5B 4I6WA 2AGPA 3MEDA 5A6PA 4I7FA 4L76A 2FJXA 1FRMA 1YJ7A 2VDIA 3KNGA 1Q4RA 3NAIA 3CDBA 3PW5A 4OJ1A 2C2OB 3H7HB 5FLXY 3V6DB 2DJWA 2WW8A 5J1NA 1U0HA 1XNRJ 4PR6A 1YGYA 4K4ZA 3MECB 4QWBA 1F5CA 2VFRA 4FBTA 4JI2J 1UCNA 1R0CB 4H4KC 2QMUB 1N34F 3MPVA 3RAMA 2CJ9A 1O0PA 2JLEA 4BWJA 1FD8A 3E51A 3IC1A 1S6PB 1F2HA 2UXCJ 3KLIB 4EUVA 5KFUA 2EC2A 2YVSA 4R25A 5EHHA 4IG3A 3N5BA 2R8JA 1HQEA 1MSWD 1FRIA 1RDRA 2VOPA 3I5CA 1F5AA 2LQ5A 1RTHA 5DO2A 5AXKA 3DRSA 4P75A 1Q82T 3FGVA 2EEYA 1MG7A 5LT5A 3T1YJ 4JI1J 2X1FA 3EGZA 1IR1A 1EARA 2VQEJ 1WHXA 1Y5LB 2HQCA 3BYPA 2R2TA 1PGZA 2JHEA 2LECA 5CAAA 2RSQA 3I0SA 4KO0B 5E3QA 3B82A 4J5OA 2MQLA 1FDAA 2HLTA 2BA9A 4ZJOA 3T9ZA 2F9DA 4BC9A 1V5VA 4YP3A 2IMOA 1VQPS 4ZVSB 2XS5A 1PBUA 1I94J 4LBPA 1APSA 4Y2AA 2W4PA 1FRLA 3BSAA 3FZ2A 1L3SA 4JV1A 4WKRA 1ZM2A 2D68A 3GCWP 4DV1J 5BYQA 4G1QA 4QIVA 1WF0A 3P4UB 2FGOA 3I0RA 7FD1A 3VAIA 3ILIA 3FBBA 1ITPA 1C4AA 2F5GA 5SZTA 1V3RA 1FA0A 2JC0A 1OY9A 4WFXA 2XZWA 2VPXB 3GCXP 3OQ2A 3QWPA 3G8SA 3AOCA 2PMZD 3BBBA 2W9BA 4M5LA 4LF7F 3BO3A 2IRXA 4G1QB 2XCPA 3FFIB 4O0IA 1U1NA 1U1LA 1ZM4A 4LSNA 1OMSA 4WFZA 2XO7A 4ZA1A 2G0JA 4UOCA 3SV4A 2E1CA 1MMNA 4EFAC 4JI8J 1KVJA 1JLAB 1FFGB 1S1WA 1ZH5A 4JBCA 2Y3YA 4V19J 2EXUA 4TU7A 1D9DA 1RT1B 1KD1T 1CJTB 2A18A 3IMQJ 4LF9F 2IY5B 1OQ3A 2B3TB 2CQBA 5DM6Q 3QZ7A 2Z58B 3KWMA 3O1LA 5CHCB 1MROA 5EX0A 4I1TA 5D0HA 3RB0A 5IWAF 1JLGA 3GMGA 3MCNA 4ZPWR 5KG1A 2C2EA 3DM2A 2P9CA 2V1TA 3TW0A 5HVGA 1NKEA 1VK3A 1FDNA 2HFSA 3HHLC 3MZIA 3LH2S 4Y34A 3ZTOA 2A6OA 2BJ7A 2EK1A 3RB4A 3DU5A 1JKHB 3OR1B 1KFSA 3D3CJ 2XMKA 3I31A 1CJKB 2ROPA 4N41A 3GJRB 4CLZA 1N4LA 1GT8A 4PYDA 3MECA 4IDKA 2B9XA 3AA8A 4MJKA 4ZP7A 4C9DA 4OYOA 4V1Ak 2MZJA 1T95A 2WBRA 4TY8A 2HMIA 1RB0A 2BANA 2JRSA 2NCKL 4M5IA 2C2KB 3VVTA 1RAJA 1RISA 3T6JA 4ILRA 1Y00A 2NS1B 4FXVA 4WYWA 4IG0B 4F0MA 2R8GA 2OEMA 3M2UA 1IM6A 4X62J 1NPRA 4FNIA 2J9DE 2FZKB 1IKVB 2V0NA 2W9AA 3C8YA 2OO4A 1RT7A 1S1UB 3B4DA 4OYWA 1UW9A 5L46A 2MJNA 2GC8A 2XI2A 4MK7A 1KSPA 3QATA 3JXOA 2CDQA 4DU7A 1VIXA 3CO9A 2W2MP 3U1MA 1R31A 2I5JB 1URRA 3FRZA 2PMWA 5CYMB 2GW8A 3FSYA 3TP2A 4FF2A 1CS4A 1MWZA 2KJWA 3OVAA 1C0UA 5KT2A 2GJFA 1HBOA 1UVNA 2UXBF 1JXEA 1S1TB 2IDEA 3GFHA 3OXFA 4U67Q 1UUJA 2YX1A 1Z4UA 1WF2A 4KV8B 2V9KA 3CCES 4USHA 4XAKA 4PXBA 3TA0A 5KFZA 4WWSA 1UW4A 5D3GB 2WAQD 3GSDA 2MGZB 1XMOF 4DR6F 3I5BA 3FCWA 1S0VA 2XMJA 3CCLS 1C1BA 1ZM9A 4PG6A 3SEOA 3CIMA 3BYRA 3TQEA 1KBRA 3V5RA 2LFVA 1EP4B 3BSCA 5CCMA 2ZWPA 2EG1A 1F6TA 3BGOP 2QA4S 1Q7LB 1HBMB 3DU6A 1R8PA 2J8AA 2NUUG 3KK2B 3FQLA 2I9SA 4DCOB 2Z0GA 2CPFA 2ZBRA 1FVQA 3DYAB 1OSDA 2CQPA 1LFWA 1T3OA 4EMDA 2NYIA 2DGSA 5KFPA 4ZVGA 4CLWA 3MCMA 1RT2A 3N6LA 5IT9Y 2YX4A 4IR9A 1RU1A 2EFQA 2FVCA 3BR8A 2HNYA 3H98A 5KG3A 3UN2A 1YVFA 3SCIE 3CMAS 2H65B 3QBCA 3M7VA 4H4MB 2V8PA 1UL3A 2O3DA 3E3XA 4ENOA 1FJEB 4USWA 2YNHA 1HA1A 4X4UA 3V4MA 4X62F 2XTCA 3HP6A 3UN3A 1SB6A 3WX4A 1SC1B 2IAJB 1RK8A 3TI0A 3ZNJ1 3QWUA 4WE1B 3MTKA 3W64A 2HAIA 1GFWB 1RWKB 1FNMA 2IVFB 3UWTA 5C5JA 2DPJA 2VG6B 3NL0A 4FF1A 1W7WA 4NZ6A 5DS7A 5BJRA 2V2VA 1WC1A 3RUBL 1VJQA 2OP5A 2VOOA 1FCAA 1WJ9A 1BC6A 1Q0NA 1EQ0A 2XM3A 4V19X 4OZ1A 2GQCA 2B9WA 1RTDA 5JVGQ 4YDDB 2G0CA 2YKMA 3PTWA 2FVQA 3M8QA 3AH6A 3ZZ0A 3PO4A 1ZAWA 4JI6F 5MLCV 4F8RA 4X4PA 1DLOA 3NMAA 3GIKA 3ADAC 3GILA 4JV5J 4I64A 2DXDA 3MD1A 3VZHA 3ZZOA 3NEKA 1ZETA 3BPDA 4X65F 2R7XA 2W8KA 4ZP9A 2RE1A 1SJFA 3MGJA 1H72C 1Y9OA 3N0VA 4ECZA 3UDVA 4DR4F 2BV3A 1WDDA 4NMXA 4UOGA 3KYLA 4DCPB 4DS5A 3KLHB 3DXBA 1B70B 2EVZA 4FF4A 1CJTA 1KQFB 2QMWA 4LRFA 5CZVA 3LP2B 3MXHP 3DOLB 4HH0A 5BR8F 2V2QA 5J2PB 1XMOJ 1KQGB 2DK2A 4C11A 3CCJS 2L9WA 3V4IA 3PZPA 3TX0A 1X8DA 2DH8A 2VJUA 5DDOC 1KVKA 2NXEA 3JTPA 1T7PA 1KOOA 1A7GE 1S1XB 2V8DA 4EYHB 3MUMP 2D7SA 3P3DA 4RLEA 2XMAA 1N32F 3DRPB 3M8PA 4ID8A 2MZ1A 2JEFA 4P2MA 4ED1A 3MAAB 4TLQA 1MWQA 2WONA 4WXWA 4E8UA 2IMWP 2W2QP 2OEKA 4JUZA 4XDCA 2QO3A 4OFZA 2HRYA 3KMSA 2YXLA 3SDEA 2ZZMA 5B08A 3HMJG 2E7VA 4DR5J 1U0SA 4USKA 2F8EX 2MGZA 4ZPTR 4GKJJ 1GQEA 2C3UA 3IWXA 3TAPA 2FD2A 2D74B 3IBFB 4WU3A 5AE3A 2BOAA 3R27A 1Y0HA 3BGRA 2HQ3A 5F8IA 4A8SA 4U95A 1U49A 3C2PA 3M8PB 2Z8QA 3KUEA 4O4GB 1W26A 2K3IA 4RUHA 3FSIA 2YY3A 4D3GA 3AX2A 4CP5A 4NXMF 2ASJA 5AT1B 5CYMA 5L38A 1FERA 2DNGA 2RIJA 5IS2A 2WOMA 2RVJA 1K73T 4ETZA 2GQ2A 5HJXA 3OTOJ 3KJFB 3VGSA 3KTQA 4C3KA 4X4VA 3GG0A 5F8JA 2HK3A 4RBVA 1FDDA 2CJAA 2MQPA 4DV3F 2UUAJ 2DO0A 2YTCA 1RWNB 1VBXA 1J5EJ 2GX8A 3QIDA 3M2UB 2NPFA 3TAMA 2EFOA 4OIXA 2CPXA 5E2QA 1RUSA 3HFVA 4PKDB 4O3PA 3R97A 3TR5A 2VBXA 4F67A 4X65J 4YR3A 3C14A 1D3WA 2CPHA 4K5RA 5AE2A 1Y3KA 1FO1A 1LEOA 2IJRA 3K5PA 5KFEA 1VQKS 4J9MA 1MW7A 1Y11A 1S59A 2N7YA 4LIRA 5KFVA 3TYTA 1QUPA 3MM9B 3KLFA 1TKXB 2HLUA 1UJ5A 3DXSX 4DZDA 2H51B 3K7RA 4FXWA 4I7FB 4BS2A 2ZOGA 3VHQA 1WC4A 2DH9A 2FB0A 4HR2A 4WFAQ 4DX8H 1FFSB 1RT3A 2B5JA 3MR2A 4F4XA 2BVZA 2OPSB 2LQ9A 3RRHA 1QAIA 4NLSA 4GC6A 3ZZUA 1U47A 3TO8A 1R8BA 3D6TB 1RLDA 1VQ6S 4JI7J 3KLEB 3PRDA 4DPOA 1HYSA 1RYSA 1HI8A 2AKWB 5C2CA 4GC7A 1UTAA 1VBKA 2JFKA 4OI2A 2KU7A 2LMIA 3BGRB 2JH3A 4J9UE 2FHJA 1N6QA 2HZAA 1HNXF 2CZ4A 4Q45A 4BLGA 2RUGA 3GYNA 2RU3A 3FVYA 3MMBA 5KFNA 2R7WA 2MB0B 4ZLJA 2V69A 3SQGB 1IWGA 2K3KA 3HVTA 3P5BP 1EKSA 4CYUB 4KGZB 4OX8A 2D3OR 3QO9A 5IM0A 2OUGA 3H4BA 2PI5A 2QJ3A 4I4BA 1UWAA 2C2MB 4CTAB 3OPKA 4C0OC 2KKHA 2AJ0A 2G0IA 2CJXB 1S6QA 1EX8A 1M1HA 4F3OA 4KH1B 2J0WA 4EI2A 1KNZA 3KOAA 2B8PA 2QV6A 3J7YI 2C2ZB 2BX6A 3R7NB 4QBUA 5DDPC 4MAKA 3W7BA 4DL5A 4MFBB 4WIIA 2RNEA 3CCTA 4Z2XA 4WFBQ 3S7RA 3PFOA 1WEXA 2G4BA 2FJDB 2DIUA 3KLIA 4DG1B 4F4WA 1R0BG 2IC3A 3V4IB 3RU0A 3TJAA 3PW4A 3JQJA 4C0BA 1FJCA 4P71A 1RXOB 4KHRA 1SIWB 1RHUB 4OJ3A 4P10A 4KFBB 4NLXA 2E9RX 3RAXA 3ENWA 4WP3A 3RRGA 3PYEA 1Q95G 2CPDA 2HQDA 3DOMA 1XEZA 5KT5A 3V2UC 4DV3J 1WC5A 2F8HA 5A0YA 2LLZA 3F56A 2ZHAA 4AL6A 1VQ7S 5D8HB 4ZJQA 1NBEB 4MYTA 5EX3A 3TJ9A 4YB6A 5EWEA 2DKOB 2QGFB 3T1YF 4JI1F 2UUWA 3OL6A 1FJ7A 2B43A 4YQWA 4QWAA 1F3VA 1UVKA 4CO1A 2JDJA 2LQBA 3OJUA 3CC7S 2XG8A 3B4MA 3H25A 1S6QB 5KG5A 4KR0B 5DRKA 1Z2ZA 1OIAA 1H2VZ 4K2JA 2VJVA 3MEGB 4QU6A 3KG4A 2K7KA 4HDGA 4WP9A 1JWWA 3W2VA 1NK7A 4M5GA 2ZE2A 1O8BA 5D0EA 2DGVA 5ETRA 3JAMU 4B9LA 3JQKA 3C6UB 2R7VA 4ANDA 2UXDF 3CGIA 4MKYA 4DQQA 1QY7A 4KH0B 2DXFA 3N4WA 2QX0A 5E41A 1HMVB 1U1MA 4ED2A 2AZ3A 4LSLA 2PD1A 4JI0F 3SQOP 4YR0A 4DV7J 1FNOA 1D9AA 1Y3JA 3DNCA 1GX6A 1OPZA 4KT0C 5ETOA 4DS4A 4B17A 4J9OA 1ZM3A 2XEXA 4KGVB 5C25B 2RMLA 3PW2A 1X7VA 3J80Y 1YWXA 2VQFF 4B3OB 3RBDA 4C8NA 4EGLA 1TTHB 1VLOA 2VBYA 3AJ2A 2QN6B 2XMUA 4NWBA 1WG4A 3GP9A 1IXKA 2VQFJ 4ES2A 4NOHA 2W8LA 3IA0A 1BQMB 1KRPA 2DGQA 3RG6A 1X4BA 3R8YA 3US5A 4R0EA 2E66A 5H9FJ 3EXCX 5KT3A 2HNYB 2HS4A 5KFWA 4O44A 5AJ3F 2UVWA 1MNEA 1S49A 3IRXB 1HNIA 5GAEU 4Q43A 1RKJA 5THWA 2XS7A 2DY9A 4DPXA 1NB7A 4IRCA 3THPA 2VHGA 5KFMA 1V9OA 4LUBA 4PPZA 2IIHA 2KB2A 1YITS 2FJVA 3NNHA 1UVJA 1LXJA 4Y2MA 3UCUP 2PA8D 2XMTA 3IBWA 3NBPB 2Y1JA 3CCQS 1UFKA 3BJYA 2X51A 1BY9A 4B3TF 3NGSA 5LMNF 3Q8QB 2GAGC 2BRKA 1HNWF 5MAOA 1TK8A 4F3MA 2MKKA 2JJ4D 2QA1A 3FFIA 4HHUA 1NSAA 2DO4A 1FWPA 3IN5A 4NI2B 1KOHA 2XI3A 5J1EB 3ETMA 4PWUA 1UMJA 3HD2A 2BZ2A 4ID5B 4F50A 2AF6A 3Q22A 3DRPA 4FN5A 4IQMA 3W2VB 3KNAA 1NNDA 3CMES 1TL5A 2DB1A 3LGNA 1PC4A 3LW5C 2B4VA 4JI0J 2VB6A 2XY7A 2NR0A 2R7SA 1SIZA 1Q7YT 2OAUA 2YQ1A 4WFYA 5F3TA 1XMQJ 1UA0A 4ELVA 4RO0A 4USJC 3MMCA 3HVRA 5L9NA 4DL6A 1NMEB 4WTYA 4ECUA 4OYXA 4TVAB 4NYZA 1VQMS 2ROGA 3QT7A 5DM7Q 2APOA 4C6AA 4NYOA 3LA0A 1MLAA 3Q8VA 1BWVA 1TL3B 3NG8A 4ED0A 1FK9A 4ED8A 3RR7A 3HVTB 4L72B 3GG1A 1LNQA 1RAEB 3MMCB 5RUBA 2A2CA 1OS5A 3DLLQ 1XMQF 1T9YA 1VRUA 4HHJA 2HNDA 5JXSA 3W62A 3PVXA 4TQSA 4LFAF 2FYXA 4FF3A 3CJKA 1RTIA 3BKTA 4DV6F 3ZZYA 4ZVOB 4P2XA 1LW2A 2CPZA 2KG1A 4OYPA 1FXRA 3MEEB 4A8KA 1V6HA 4IG3B 1HYSB 3D54A 4MTPA 2VG5B 2A0FB 3NMRA 1RZMA 5DETA 5J1PA 5EUHA 4ILLA 2GO9A 2GV1A 5GAGI 4P52A 2DR8A 5J2PA 1NJIT 2KH9A 4KKOA 4OLPA 1OJ4A 3UNYA 1RABB 5BXIA 2OPQA 3JSMA 1U1RA 3MEEA 4NX9A 4YN3B 4XPCA 4QCLA 2C3PA 4A46A 4ZP8A 5KFSA 3DRRA 1JLCB 2GVDA 2FVPA 2BXJA 1UWBA 3UNGC 3F0NA 1YQHA 3A13A 2CDRB 3C16B 3HHLB 2DHSA 4UOHA 3THTA 3NGDA 1Q78A 3L09A 1QVGR 6FD1A 1Q1KA 2LEPA 1BXNA 1UPMB 2PIIA 5KG6A 3W5YA 1VCTA 2G1HA 3W60A 2RAQA 2KT2A 3ZTQA 2UXBJ 1X5PA 3L7OA 3PJXA 2DGOA 2CPIA 1KTVA 1YJRA 2DY1A 3L4BC 1AA1B 1GNKA 1R3NA 2YNFA 1GTHA 4GO7X 1T9UA 2BJEA 1P1LA 3GU0A 1AXQA 1O6XA 4LFBF 4Q8EA 3TZWA 1F3FA 1F9FA 1RGVA 2V5HG 1DTTB 1TKZB 2M52A 1RHKB 1S48A 4NMLA 1HMVA 4LR9A 4JI6J 4ZPCA 4OZ5A 3VAKA 4LF8F 1RE1B 2UZAA 2HQFA 1R8AA 3D1QA 5B0GA 1AUSL 3NRBA 2N3LA 2IAJA 2WBMA 5K20B 4DX5A 4LF1A 3EX7B 3EMTA 1QJHA 4H4MA 1YRUA 4OZLA 4ECRA 4PWDA 4F4AA 3QRQA 2I0XA 1WKLA 1LWFA 3J81Y 2ZH3A 4RU9A 2LQJA 4X4TA 4NLUA 2GHWA 2RD5C 4IH6A 2MQ8A 3G86A 3HK2A 1E6VA 2VFTA 3KK1B 2HIQA 2FQQB 3BR9A 2L48A 2ZKUA 3CB4A 4DLEA 3CJ0A 4S0MA 1YIJS 2ZH6A 2QSWA 4ZN3A 4PWDB 4ECQA 1HWJA 2MDAA 2HQGA 3PYGA 2BMBA 3EDRB 4IRDA 2H48B 2PEBA 2B9EA 1DRZA 4Y28C 1JLBB 2E1AA 2YWGA 2HWTA 3MR7A 1SUQA 5CYQB 5CA5A 1HL6A 1WOOA 4OZ3A 1X4EA 1LWCA 1EZZB 3LGMA 1EETB 1EHWA 4WZMA 1WTBA 1D8ZA 4USVA 3C16A 3ULHA 5CYJA 3BO2A 1TVRB 3RBEA 1FNXH 2P9EA 1VQ5S 3WIUA 3J7A1 4DV2J 1EKRA 5M2UA 2W2PP 4ZCMA 1UZDA 4ATNA 4URQU 3CW2C 4CO5A 1BWEA 2YQ0A 5EDWA 3HHNB 1BMQB 1SI9A 1VQSA 4ZOSA 4O3RA 1FKPA 1QE1B 2EK6A 3M05A 3MEDB 1N33F 4DR5F 2MQOA 2XY5A 1VQLS 1WNEA 5EWFA 2CIMA 1TP7A 3VQSA 4HH1A 2E5LJ 5T14A 3IAS9 4WPAA 2H4YB 2HRTA 3MPUB 3MURP 4F2SA 3MPYA 2VD3A 1AROP 3NOCA 2KXNB 1DURA 2ZD1A 5KFLA 4C2MA 5T7LA 4ZPAA 4DBQA 3DRXA 4ZVQB 4FVCA 3MAHA 3CCRS 1AYEA 3MM5B 4ZVPB 3K2YA 3QZ8A 1MN7A 5E33A 4WZQA 3NGKA 1CPZA 5GVQA 2YH1A 3POTA 1TK5A 2WZ1A 1NHKL 1KTQA 2WHOA 1NK4A 3WBZA 3J7ZT 1XNQF 3K58A 3MHYA 4OHYA 4I56A 4KGMA 2AIRB 2WVFA 4LRBA 2VG5A 2Z2YB 1OSCA 1GMWA 1NK0A 1DBDA 4RUCA 2XYPB 4DV4F 5KFHA 1IBMJ 3A8IA 3N28A 3DGPA 3JSYA 2GHPA 1RWPB 2AU0A 2IDLA 4ERDA 2C1EB 4W98A 2ASLA 1EQMA 1Q81T 2RB7A 3CO0P 2DBBA 4DV0F 2AJQA 4CO2A 1FX2A 1S9EA 3R6GB 4QZVB 2AYBA 2YKPA 1LXNA 4IO1A 3DHXA 4DV0J 4X4OA 4NASA 2NUHA 3BPSP 3FNNA 1D1UA 2O01C 1YJNS 4CLYA 4USUA 4ED6A 3JSRA 4KV8A 4CZCA 1FWKA 2J6TA 1B0PA 3O5TB 4O4GA 3OW2R 4CCHA 2KYXA 2WB1D 3ETOA 2L9NA 1DTQB 2J0XA 2XSFA 3M8SA 3LWLA 2L41A 3T5HA 1BQMA 1N0VC 4CM2A 3RJMB 2A10A 2PT0A 5DZ7A 4DR1J 4B3SJ 4E0DA 4CRJA 2HHVA 5F8GA 4O4RA 1LK7A 2QRRA 5SUHA 1RAOA 4Q7AA 5ETLA 3BH7B 3D5MA 1XNQJ 3KJNB 3IWNC 5F9NA 4RUBA 1XN9A 4HVZA 3DDIA 4OX9J 1R27B 3M2VA 4KIAA 4LQ9A 2QL9B 4ZPVR 3MR5A 4CH7A 1WG5A 5KFKA 2HW3A 1X9SA 2FIUA 1M1GA 3HHKA 4FS1A 3K17A 4ALZA 1R0AB 1VQOS 1N48A 3HHLA 3V6DA 4N8NA 1NKCA 2BE9B 3MAAA 4R8UB 2EKYA 4FPIA 3N6MA 4A8WA 4Q2MA 4M95A 4PG8A 5KFOA 2QYGA 2V6AA 1AUDA 4KAIA 2UUAF 5CZXA 4P2SA 2MQQA 1C0TB 3BKUA 4OX9F 2VPZB 5I42B 2ZJPQ 2CJKA 2GCFA 4Q44A 3V81A 5D77A 3I6PA 5KG7A 2ATLA 2GJ2A 2LDYA 4FNHA 5BR8J 5JVHQ 4P7TA 4I6AA 3I4HX 3M6XA 2HVDA 4HI2A 4KHPF 1HWKA 4WCEQ 2AT1B 1KLNA 2KN4A 3PNIA 3MM5A 3WC2A 3IR6B 2MTLA 5F3ZA 1JLCA 1NPKA 5KFBA 2B6AA 2IBOA 2M0GB 2X1GA 2VZ9A 5DJBA 2VG6A 1VBYA 1REGX 1IUJA 1SPBP 1VHFA 2E5GA 2OEJA 3JSMB 3KLGB 4C8KA 4HKQA 1RT6A 1SJ1A 1U2CA 2CQCA 2OTLS 3LTOA 4OL8A 2DNOA 1U6ZA 2HURA 3HPOA 4K4VA 3NNAA 1XJWB 3M2RB 1RTJB 3AXKA 2YH0A 2CQ2A 3B6BA 1Q5YA 5HVHA 3CJ3A 2DR6A 5ETMA 1VRTA 3AQOA 2AJ4A 3OUYA 2BKPA 2HG4A 5A8RA 5I3UA 4ZLPA 5CXTA 5CABA 2XCAA 1RHJB 4ED4A 1ZAVA 1NO8A 4RUAA 2U1AA 2N4DA 4N7TA 5AXMA 2V2ZA 2MEWA 1FF2A 2O66A 3L7PA 2R7RA 5D0GA 4RNMA 2ZH9A 2ZJQQ 3R2DJ 3DOMB 1QUVA 1WKJA 4B3MJ 3BZQA 2IHR1 4LF4J 2RT3A 4IO9Q 2AQ4A 2FZGB 1NJWA 3QO9B 2R7OA 3VAFA 2HWIA 3J81j 4K4YA 3HHEA 1U26A 2XHWA 1T3NA 3DLHA 3OHBA 4B3SF 1T02A 3LPYA 1BQNA 2XGQA 1H7XA 4TY9A 4B3RF 1RAAB 3QLHB 3ZC4A 1ULRA 4DPYA 4L3KA 1K9MT 2DNRA 2B4UA 5F9LA 4RNOA 3FC9A 3M4XA 4DOZA 1Q53A 3P96A 1RT2B 4UQGA 1RKIA 4UY85 1QLNA 2XQCA 4ZPBA 3CTRA 3CEDA 1N5YA 1HNIB 4MK9A 5E3PA 1NJXA 3CD7A 2KL8A 2V94A 1S0OA 1HR0J 3NKYA 2LEAA 3AOAA 4RR5A 5GAGU 3L3CA 4HDHA 4DFPA 4IOAQ 1C1BB 3LWMA 2H9ZA 3I9ZA 5JUMA 2CRLA 5DQHA 4DSEA 4C8LA 4XTTA 1WELA 5IZHA 3Q2SC 3NLCA 3R9LA 4CT8A 2UUCJ 3FBEA 2UUBJ 3JAMY 5HMXA 2K1RB 1P27B 2IFXA 3ZZTA 4C3LA 1C0UB 1YBTA 4CM0A 5HI7A 4QW8A 6AT1B 2HHHF 5B0CA 3DLKB 1HR0F 2UU9J 3X3UA 1TZ0A 3I56S 3PXGa 4A8OA 3UPFA 3AX5A 2FZCB 2YNFB 4DSKA 2V8GA 2Z4PA 1U1PA 3PDNA 2E1RA 1QAYA 1Q8KA 1WOPA 1X4DA 2CNOB 2CPJA 3CT9A 3AY0A 2ZJRQ 2PN6A 1X4GA 2NSBA 3HLUA 4KC5A 4Y0FA 3IGNA 3D2WA 3EZ5A 1IKYB 1CJUB 3N6NA 3OT9A 4LRDA 2DNLA 3TRGA 4UZBA 1QSYA 2O1PA 3BBFA 3Q24A 3SI8A 1HIYA 1HD1A 2V4JA 2KFNA 2C2RA 5J2MB 4MKVA 1S0MA 1NHUA 2HMIB 1TVRA 3BF4A 1RQ0A 3C6UA 3TVZA 4DR1F 3Q86A 3ILJA 2GZOA 2FTRA 1BQNB 5D6GA 1UEKA 4KKOB 2Y1RI 4FXDA 4YS2A 4KSEB 4M5DB 4YOEA 1S4FA 3W61A 5LXRA 4DUZF 3OSPA 3VF0B 1N36F 4LSNB 4O3NA 2F4FA 3D1OA 4LF5J 2OMOA 4AQYJ 3JS9A 3DCAA 3AXMA 2ASDA 1GEHA 4IOCQ 2NXUA 4K4WA 2BUNA 4NCAA 3CJKB 1YLXA 4IRKA 4LRCA 2KTQA 5ITHA 1RWOB 3HT3A 2EFGA 2EW9A 1OPIA 5GAEI 3GIJA 3RGIA 3K5LA 3T1HF 2LXIA 2ZBPA 5G4DA 5KFRA 3M9MB 5FDLA 1JLEB 3PR5B 1SKWA 2F4VF 4ANEA 2PEHA 1T03B 5F0WA 4PXEA 3SDEB 4L75A 2E9ZA 5AXLA 5KG0A 1Q8LA 1LWXA 2RRNA 3A8KA 2XZ2A 2AEFA 2QLXA 3W8GA 3MAQA 2YWHA 2XLKA 5IT4A 1NSQA 1B7FA 4MIAA 1JLEA 4AUKA 3MPDA 2DR9A 4BHQA 4Y6IA 1F1BB 2E44A 2MQMA 4OZ0A 2HFUA 2ROEA 5ETSA 3SCLE 1DFDA 4NRTA 4DN0A 1N56A 1RTZA 4LBIA 4URGA 5A8RB 5I3UB 2JSXA 3MF5A 3OV7A 2M9KA 4IDKB 1S79A 3UD3P 3V6KA 4CLSA 4QOTA 2FLLA 3CDAA 2X3GA 4QIGA 4Q5VA 2VIHA 2VF3A 3I5AA 1X9WA 2R7TA 3M2RA 3MR3A 3GYXB 1ICEB 1HKAA 5IWAJ 1JKHA 3KG0A 3OR1A 3T6BA 2DEIA 1DLOB 2QMXA 4C11B 2BQUA 4M5JA 2UV8A 1T9TA 1SKSA 3X1LB 1TKDA 2W7OA 3BH6B 3MD3A 2DRDA 3OVBA 4AXJA 3MCSA 1IR0A 1PJ6A 2F9JA 2ZC3A 3N5FA 4C8YA 2B6AB 3KG1A 5B0BA 1RA7A 3DMJA 3PW7A 4MH8A 2GGPB 4RBUA 1N8RT 1S97A 2ZUGA 4YR2A 2ERRA 2DTJA 3NWRA 3OFGA 3SXLA 3AFGA 1NH8A 1IM4A 1HHSA 1SUQB 5D4LA 4DL4A 2IM0A 3BREA 5GAHU 4B9VA 2B7CB 1X9MA 2U2FA 4QPTA 7FDRA 3IAM9 3R7SB 2OI2A 3QFHA 5E3RA 1WHYA 5IQQA 1QAXA 4DCJB 4NL5A 3ILLA 1I5OB 1RI7A 4WTOB 1N36J 5L8RC 3LP1A 2FHKA 2PO4A 4O0NA 2VPWB 3A8EA 3BEGB 3MM8A 3NY0A 2KXHA 4CT9A 2KT5A 4YMEA 2FC8A 1EIYB 1Q8BA 3BO4A 1HBMA 3ENQA 1BLUA 3ONQA 1C4CA 5E5NA 3W66A 3I4PA 4U96A 3NCPA 4WBFA 4ZVRB 4ECYA 4ILMA 3IS9B 3T1HJ 4DR3F 2WSFC 1VQYA 2R42A 2AX1A 1VFJA 2EFVA 2VFVA 1PYTA 3PM9A 2AJFE 3MFIA 4Y2KA 4OYBA 4YB1P 4K4TA 2M88A 3WC0A 2CAJA 3LANA 4RL1A 2QFJA 2BEFA 3IR7B 4OHXA 1AB8A 2MJUA 3FKBA 3NS6A 3I82A 1FTCA 5HL7Q 3S6EA 3KXDA 2DHXA 5HLFA 3J7Z5 1Q79A 1WWHA 2Y0SD 2QL7B 3CSKA 3M6VA 1LW0B 2J9EA 3TOQA 3NGUA 5F8LA 4NPOA 2J76E 3EVWA 1U25A 5C24B 3VVUA 2IJFA 3UO0A 1VRTB 3QLHA 2RKIB 1S9EB 3CWJA 1FEEA 2XMMA 4DV2F 4EZ6A 1LQ9A 1LK5A 1TMJA 1WHWA 4QIFA 4QJVA 5IM0B 2BE2B 1TUGB 2D3UA 4OLOA 5BYRA 2IRUA 1S9FA 2K8GA 3POTB 4MKBA 2CJYB 4NLDA 4Q2LA 4AXIA 2FJWA 1YG0A 2HWHA 2WCXA 3BN4A 4U8VA 2B4PA 3V6JA 5DQIA 3CULA 3U1NA 3CJ2A 1KFDA 1N5VA 1O51A 2HBQB 1UAWA 4M5HA 4RW7B 3QAEA 4WJBA 4RW9A 5HATA 1R43A 4QWDA 1RWWB 1PILA 3MM8B 3PX0A 3G8TA 1KLMA 4ZVHA 1ZA2B 2MZRA 3KUHA 4L3NA 4OHZA 3D6MB 3KHRA 4J9LA 3OTDA 1AZSB 1HNVA 3TAQA 2DR7A 4F25A 2KFYA 5IFMA 1YSJA 2BQRA 5HBMB 4FYDA 4M5DA 4DV5J 2Z30B 4TU8A 4C3MA 4NLYA 1J5OB 2VA2A 1U2RA 2ZVIA 2BJ3A 3AQPA 4LF5F 1T9XA 3D28A 3PW0A 3HDSA 1ZTWA 5J2QB 3QRPA 1ZZNA 4R8UA 2RILA 5JMNA 4J9KA 5IQ6A 2XTDA 4XIUA 4Q0BB 1TV6B 1FX4A 4Y2CA 2OD6A 4OV6A 4DDFA 4OHWA 4EO6A 2MPUA 1CQNA 4RW6B 2PDAA 2CQ4A 2VV5A 4I2PB 2J6UA 4I2QB 3W8PA 1FTRA 3PV8A 1SV5A 2D1CA 3D68A 4HACB 4USTA 2OMLA 2R2SA 3QMQA 3CC4S 4DR4J 2C3MA 3IO1A 4KGXB 1JLBA 4X2BA 3Q8YA 2FJBB 5CYQA 5KT7A 3Q8PB 3OTOF 1RT3B 2YKMB 3VGTA 1RCXB 2KVIA 3KK3A 5KFJA 2HS0A 2IYGA 4PG5A 1XERA 3EYZA 4G3IA 4B9MA 1F9HA 3DDKA 2DCUB 2LYVA 3PY8A 3QT5A 4JB8B 2NLWA 4MMOA 5D0RA 3ZTPA 3BQ0A 2VBZA 3C14B 3KJQB 1TUVA 4F26A 4DSIA 3UCGA 3G6YA 4C4WA 1YBUA 1S9GA 3CJSA 4ZVTB 2W9CA 4DWIA 3R5BA 3BSOA 4DV5F 3QJJA 2F40A 2XO6A 3Q2TC 1X4HA 2O67A 2CADA 2B4OA 1FRXA 1X4AA 5FDLB 1BE4A 2J7WA 1ZZFA
chains in the Genus database with same CATH topology
1N5YB 2YQ3A 4RWWA 2OFHX 1E6YA 2L9DA 3VWSA 3VAGA 4DFJA 1VQ9S 3G9CA 3MPWA 1N0UA 3RAQA 1IJEB 3G96A 4UY8T 3QPIA 2WSCC 4PPDA 3WDOA 3P49B 4PUOA 2JWNA 1HQEB 4N8OA 1HBUA 4C4WA 1XK8A 2CPYA 2ZITA 5KFCA 4X66F 4LVOP 2RQ4A 4NXNF 1IKWB 3DLBA 2HVIA 1OWXA 3P5TL 1NH7A 4Y00A 4QWEA 2C22A 3O3LA 4A8QA 1SJQA 2YWKA 2VG7A 3K8VA 2ZH4A 2LCWA 3MUVP 5C25A 2PE8A 1WI6A 2RRAA 4R5PA 1VC5A 4NLWA 2OFGX 2DNMA 4DL3A 1S76D 2EBEA 2UVRA 2GO8A 5K14B 2BRLA 4A8MP 2ZE2B 1PC5A 2I1RA 1HWUA 2MHNA 3VAMA 4EO8A 3KJVB 4RKUC 2R7QA 2YNGA 2DGWA 1NZAA 4IG0A 3Q8SB 2DRBA 4JV5F 1UETA 1RT6B 2XMVA 2OIHA 3THVA 2MY7A 2C2DA 1S6UA 2PA3A 2Q79A 5B09A 1V3SA 4I2PA 1U24A 3JYTA 1RWUA 1U7LA 5K9FA 3G6ES 2D3ZA 3KLHA 3KLVA 1FKOA 2RF2B 4A47A 2RU9A 3PEJA 3CIZA 2VPYB 4ECVA 3PKYA 2CQGA 2VODA 1KR4A 2BE2A 1RA6A 4FZVA 5GADU 2DISA 3MFHA 2LU1A 3GR0A 2DHAA 4M63A 5I42A 4AL5A 1VBZA 4LF4F 2ZDPA 1B0TA 1NEEA 2RKIA 3DM2B 5HBMA 4JI3F 3MUTP 1XMBA 2QYCA 3UDLA 4MIWA 5KTQA 2QZ8A 4N77A 2VFUA 5B0EA 4F4KA 1UFLA 1LW0A 5K8MA 4WF9Q 1VRUB 4DL7A 1JJHA 5DLFA 2XNQA 4B3TF 3VAJA 4WXOA 3TX8A 3OFFA 3G71S 3GWCA 2AGQA 3H4DA 3BB5A 3BSNA 2HVZA 4HLBA 3B78A 2VG7B 1C1CB 4FP9A 3VZIA 5EWGA 5LXYA 2ZH2A 2BJDA 1H38A 2QE5A 3CF5Q 3PIOQ 2G9OA 2CJQA 2YKOA 1HBNB 1H0HB 3FEXB 4XK8C 4CI0B 4YDXA 3OTOF 3QGHA 2ZM6F 1P1TA 2FVPA 1NK8A 2XLIA 4U6PA 2CQIA 1U2FA 4PG7A 2ILZA 1FE0A 3F41A 3AJ1A 4W90B 2MKSA 2XWYA 5KFXA 4FBUA 4N5SA 1FHTA 2V9WA 5J1EA 1HD1A 5M2RA 1LOUA 1REVB 4KJIA 2FUG9 5U47A 3GV7B 2P6TA 2P9GA 2IA6A 4NCBA 3H5YA 3N01A 4ELUA 4KGKA 3NNCA 4XPEA 1FRJA 4L6V3 3U1LA 4LIWA 3BQ1A 2JOQA 4HEA9 4MKAA 4LT6A 2ADCA 3OFHA 3Q0AA 2V4JB 2E5JA 4TY8B 5LMUF 1KC8T 3UCZP 4DF8A 4B9UA 2C3YA 4MYUA 1U1QA 2L3MA 1DJ0A 1X0PA 3HO1A 4C8OA 1VC6A 1FEHA 1NHVA 4ZS6A 1RT4A 3RYLA 2Y1IA 2PI4A 5GADI 1T94A 1C0TA 2V4QA 1K0VA 1G7CB 5KFQA 1V3ZA 2HPUA 2QA4G 2AV5A 3B8HA 1S1VB 3S01A 1PO6A 3F44A 4OI3A 1JLGB