4R0EA

Crystal structure of the poliovirus rna-dependent rna polymerase low-fidelity mutant 3dpol h273r
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHRLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase
publication title Structural Dynamics as a Contributor to Error-prone Replication by an RNA-dependent RNA Polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 141
structure length 461
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4r0eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r0eA02
4RU9A 5J2MB 4O3RA 1FKOB 3KLGA 2R2RA 5KG7A 2BANA 2XGQA 3RB3A 2ZD1A 1LW2A 3NAIA 3E51A 3KK2A 3I5BA 1WNEA 4TXSA 1VRTA 5KFKA 1JLQB 5KG6A 4Y3CA 5KFRA 2IM0A 2V0NA 2YNHA 3KLIB 4RNHA 2OH2A 3KHLA 4Q44A 1S0MA 4ECTA 4IFYA 1S1WA 5J1EB 4DL6A 3DI6B 4K4ZA 2UUTA 4RW6A 5HLFB 2GC8A 4NCGA 3KNAA 3M8PB 4QW9A 1S0NA 1LWEA 4K4SA 3QLHA 4XO0A 3OSNA 3DDKA 3OL9A 3FRZA 1RTIB 1RTJB 5I3UB 5EWFA 3C6UB 3PVXA 2AGOA 3MEGA 2IM2A 1C1CB 4IDKB 2WHOA 1FK9A 4TY9A 4QW8A 1T05A 2RDIA 1RT4B 2GIQA 4YR3A 2UVUA 3IS9B 4ECZA 2C22A 4WFXA 4RUAA 1DLOA 5KG0A 3MEEB 5KFQA 4NRTA 2VG7A 3T19A 4FBTA 2CKWA 3PHEA 5KG1A 1IKYA 5KFTA 5L1IA 4U7CA 4NLTA 5C25A 2OPPA 3JSMB 4ZHRA 2ILYA 5KFPA 2QE5A 5D3GB 1HARA 1VRUB 4URQU 3V81B 2OPRA 4H54A 5KFWA 4TY8A 3CO9A 1S49A 5DLGA 3OHBA 4I2PA 4NZ0A 3H40A 4URSA 3SFGA 4O4GB 3DOLB 3MR6A 3DM2A 3MEDB 1T94A 4NLGA 4IQXA 4RW8A 4ED7A 1KLMA 2B6AA 1LW0A 4PUOB 2FJWA 1TL1B 4O3NA 4GC7A 3E01B 1MU2A 4DL5A 1JLBA 2I5JB 2JC1A 2YKMA 2RF2B 1S1TB 3IGVA 4O44A 4MKBA 1LWFA 3GIJA 3TAMB 5KT6A 2ASJA 2ATLA 1MMLA 2QV6A 2HNYA 3LP2B 3KJVB 4KO0B 5L1KA 2JEGA 3DRSA 2IC3A 2XI3A 3NBPA 1C0UA 1FKPA 5KFJA 5KFSA 4KE5A 2W9CA 3SFUA 3DRRA 3H5YA 3MECB 2HNZB 1RT6A 2XWYA 1RT5A 3JYTB 4ECWA 1ZTWA 2VG6B 3D5MA 1EETB 2E9TA 2RKIA 2ZE2A 4KV8B 1NNDA 3ISNC 4R8UB 1GX5A 3CDUA 1LWCB 5KT3A 2EC0A 1QUVA 2JC0A 3MTKA 1IKWA 3DLGB 1K1SA 4DG1B 1S9GA 3T5HA 1HNVB 4IG3B 2JEIA 4WXOA 2RDJA 2C2EA 1DTQA 4GC6A 2UVWA 3HVTA 3V6KA 3RBEA 1N5YA 2XGPA 1HMVB 5CYQB 5KFFA 1RTHA 3CJ0A 3DOKA 5EDWA 2FVSA 3G6YA 4QWDA 1RYSA 4ECRA 1J5OB 2ILZA 1SV5B 5KT4A 5KFAA 5KFVA 3FQLA 4J9RA 2I1RA 2O5DA 3C6TA 4ED3A 1QE1A 2WK4A 1BQNB 1R0AA 1JKHB 3IG1A 1S1UA 5F9NA 4H4OB 4WYWA 4NLDA 4NLOA 5KFHA 1T03A 4KKOB 2HMIB 4M94A 3BSAA 4NLPA 4ECQA 1S1XB 5FDLA 5J2QB 3Q8QB 4JV1A 3KLFA 3PR5B 3DLKA 3GV8B 4DL3A 3M8QA 3H98A 2WONB 2R8KA 2DPJA 3CJ2A 3V6DA 4RUCA 4NYZA 3PW4A 2B5JB 1XR7A 3FFIA 1RT7A 4NLYA 4H4MA 3M9OB 4OL8A 2W8LA 4KB7A 1XR6A 2BE2A 3BREA 2VG5A 5KFNA 4J9OA 4Q8FA 5J2PA 4TN2A 5DGBA 4LSLA 3LP1B 1S97A 4ZVFA 4G1QB 3FSIA 5L1LA 3T5LA 5C42A 1RT2A 5HROB 4Q43A 4KHRA 4M95A 1T3NA 2YNIB 3QIPA 2E9RX 1TKTA 3CDWA 4U6PA 1S1VB 4ZP9A 2OPQB 4DL4A 3QGHA 5HBMA 2WB4A 5DQIA 3QO9B 4ICLA 2J6UA 3HKWA 4KFBB 4ZMMA 1HNIA 3MFIA 1JLQA 4TLRA 3KLEB 1N6QA 2D3UA 3KLHB 4F4WA 4EO8A 1SH3A 4K50A 1EP4B 1TV6A 1NHUA 5C5JA 3H5UA 4NRUA 5J1EA 1TKXB 4F4XA 3VQSA 3DI6A 4MK9A 3LAMA 5KFIA 4YQWA 2W9BA 5HLFA 4IR9A 1RTDA 3UPFA 2BRKA 1JLFA 4MIBA 1YVFA 2YNGA 3KLGB 1JLAB 3EPGA 3C6UA 3V6HA 4TYBA 3PJXA 2HNDB 1SH2A 4ZP7A 3CJ4A 2XC9A 5KFXA 4WYLA 5F9LA 3I5AA 2B43A 4K4YA 3ITHA 4R5PA 3IS9A 3V4IA 4IRCA 4URGA 3QZ7A 3KK2B 1DTTA 1TVRB 2C28A 4IR1A 1S9FA 1RT1A 2YNHB 5KFMA 5KFGA 3NGDA 1S6PA 5KG4A 2R8JA 4IFYB 1JX4A 3JSMA 2ALZA 3KK3A 3QYYA 5C24A 2AU0A 5D3GA 5KFUA 3UQSA 1VRUA 1RYRA 5J2NB 1SH0A 1LWEB 3DMJA 2IAJB 3QLHB 3MR5A 1BQMB 2R8IA 1W25A 4IH7A 4Q0BA 4QWCA 4RW9B 5I42A 4QWBA 1HQUA 2IA6A 3MEGB 1T05B 1FK9B 2BQ3A 4O3SA 1HPZB 2FJVA 2FVQA 4MFBA 4IG0A 1U09A 4I7FB 1DLOB 4DL7A 3PW0A 1TL1A 2R8GA 2VG7B 1RT3B 4WE1B 5F8MA 1IKYB 2HAIA 4I2QA 3HVWA 1S1TA 5C25B 2OPPB 3N6LA 2J6SA 4WFZA 5EWEA 4ZHRB 4ID5A 3GILA 3GV5B 3LAKA 4ECYA 4LSNA 3CIZA 2OPRB 1D0EA 5KT7A 3BSCA 1HQEA 4Y2AA 4TY8B 3V6JA 2WOMA 5DLFA 2V9WA 4XPCA 4I2PB 1C0TA 2FJXA 4PWDA 1JLEA 3DM2B 4RW8B 2VG6A 1KLMB 2V4QA 2B6AB 3QIDA 5KFLA 4NLWA 3BGRA 1CSJA 3DRPB 3UDLA 1S9EA 3I0RB 2AX1A 5F8GA 1REVA 4PQUA 1MU2B 2XI2A 4JV0A 1SUQA 1HYSA 4DG1A 3IN5A 2YKNB 1HNVA 2BRLA 3EPIA 3KK1A 3I0SA 4O44B 3GIIA 1LWFB 5DGAA 3H5SA 3BR9A 1S10A 1HMVA 4RNMA 3NL0A 2ZKUA 3IRXA 4RW4A 1UWBA 5CYMA 4TYAA 5K14A 4IH6A 2IC3B 3NBPB 4IFVA 3LALA 1C0UB 3TVKA 3LP0A 3QZ8A 3QGGA 2WCXA 3DLEB 5T14A 4R0EA 4EBDA 3DRRB 2OPSA 4FS2A 1RT6B 1RT5B 3H5XA 3KHGA 5L9XA 2AGQA 4ZVGA 4H4OA 3Q8RB 1IKXA 5HP1A 2RKIB 2ZE2B 4J9KA 4NLUA 4ZP8A 1TL3A 1S4FA 4O3QA 5KFZA 5KG5A 1IKVA 3GYNA 1TKZA 1IKWB 1TQLA 1S6QA 3KHHA 3PW7A 1JLCA 3GIMA 3MFHA 5KT2A 4NLXA 2FLPA 1TP7A 1C1BA 1RTHB 3DOKB 2BQRA 3BJYA 5JUMA 5F8LA 2W8KA 3Q8SB 3DYAA 2BR0A 4B3OA 3GV7B 2WTFA 3HHKA 4NLVA 2YNFA 4RW7B 4O4RA 1KHVA 5KG2A 3KLVA 3RAXA 3RB4A 3PW2A 4QPXA 3C6TB 5J2MA 1QE1B 4G3IA 1FKOA 1R0AB 4KHMA 4YR2A 3IG1B 1S1UB 3NAHA 3IGNA 1JXLA 3SI8A 4ZPDA 2YNIA 1T03B 3N6MA 4J9MA 4EBCA 4J9QA 5KFBA 5FDLB 4RNNA 4F4YA 4DL2A 3ISND 4WZQA 4MKAA 3PR4A 3KLFB 3M9NB 3RB0A 3DLKB 4KBIA 4TQRA 3M8QB 4K4XA 4ED2A 5DG8A 1IM4A 3KLIA 1EP4A 2J6TA 2UVVA 3OHAA 3FFIB 1RT7B 4MIAA 1RA6A 4H4MB 4YP3A 4Q45A 1S48A 3OSPA 1JLGB 2IM1A 3GIKA 2BE2B 2VG5B 3M8PA 4IRDA 5J2PB 4LSLB 1JLAA 2IJFA 1RTJA 1RTIA 5I3UA 5C42B 1RT2B 2HNDA 2UUWA 2BANB 4IDKA 1C1CA 4NLRA 5F8JA 4K4TA 3QIPB 1TKTB 2ZD1B 5DG7A 1LW2B 5HBMB 1RT4A 4ZPBA 3OL8A 4ICLB 4JV2A 1TVRA 3G6XA 1HNIB 3OL6A 4ZPCA 3MEEA 3PZPA 1VRTB 2C2RA 1N6QB 4K4UA 3BQ2A 4YR0A 2XCAA 5JXSA 1TV6B 4K4VA 5KG3A 4MK8A 2AGPA 1S1WB 2W9BB 4J9LA 2VA2A 2E9ZA 4RW6B 5J2NA 1RTDB 4NCGB 2IAJA 3V81A 1JLFB 1BQMA 2YNGB 3BQ0A 4WFYA 1XR5A 3BSOA 1JIHA 4IOBA 4RW9A 4Q8EA 4ECSA 3H4BA 3CJ3A 4O4GA 1HPZA 3DOLA 2AQ4A 3ITHB 4IRKA 4R5PB 3V4IB 3MEDA 2FVCA 4I7FA 3HVAA 1DTTB 2V4RA 3T1AA 5KFEA 2R2TA 3Q8PB 2W7PA 4ZVHA 2ASDA 4PUOA 1RT3A 1RT1B 5KT5A 3E01A 4WE1A 2R2SA 3FQKA 1KHWA 1S6PB 2I5JA 1GX6A 3OL7A 1RDRA 2RF2A 4J9SA 2D41A 1ZETA 5EUHA 4RNFA 5C24B 3CJ5A 4RZRA 3TAMA 3KK3B 5KFCA 3LP2A 2CJQA 3DMJB 4ECVA 3NKYA 3KJVA 4KO0A 2HWIA 4Q0BB 1N4LA 4F4ZA 1RA7A 3H2LA 1RAJA 4O3OA 1HQUB 2AX0A 5I42B 3BQ1A 3TQ1A 3RAQA 2IMWP 2R8HA 3FDSA 3OLBA 3MECA 2HNZA 2BQUA 4FS1A 1QAJA 3JYTA 4MFBB 4IG0B 4EYIB 3DRPA 1EETA 3I0RA 2C2DA 2XCPA 4KV8A 1LW0B 4KSEB 3RB6A 4R8UA 2JEFA 4DEZA 4WXWA 1LWCA 4WZMA 2W7OA 2F8EX 5F8NA 1S0OA 3CDEA 2YKNA 2R2UA 4Y34A 4I2QB 1JLBB 3DLGA 2YKMB 3H59A 5F8HA 4IG3A 4IH5A 4YMEA 5L1JA 1Z4UA 4EO6A 4ID5B 4J9NA 4LSNB 3N6NA 2HNYB 4ED8A 5CYQA 4ZP6A 4JUZA 4QWEA 1HQEB 3KMQA 1K1QA 3I5CA 2WOMB 3DRSB 2IJNA 5KFDA 1J5OA 2VA3A 3D28A 5F8IA 4FBUA 1SV5A 1FKPB 3DLEA 5DG9A 1C0TB 2W9CB 4PWDB 1JLEB 3T5KA 5DQHA 1BQNA 2FLLA 3OLAA 1JKHA 4EYHB 4RNOA 3BGRB 4ECUA 2JLEA 4ED1A 4J9PA 1S9EB 2AWZA 1REVB 4KKOA 4ECXA 2HMIA 3LANA 4PQUB 4Y2CA 3BSNA 1SUQB 2FVPA 1QAIA 1HYSB 1S1XA 1NHVA 4K4WA 1I6JA 5J2QA 4QWAA 1S9GB 3KK1B 2IM3A 3I0SB 3T5JA 3RBDA 2FVRA 1DTQB 3HVTB 3MR2A 4X2BA 2WONA 3KHRA 4ED6A 4RW4B 3IRXB 3QGIA 5KFOA 1UWBB 3KMSA 4MH8A 5CYMB 3KOAA 5K14B 3PW5A 4NLQA 2B5JA 3EZUA 4IFVB 4MK7A 4ZVEA 3LP0B 3H4DA 4RW7A 4HYKA 3CWJA 5DQGA 2OPSB 4ZPAA 2UVRA 4ED0A 2D3ZA 1N56A 2DPIA 1D1UA 3LP1A 4EEYA 4G1QA 1IKXB 5HP1B 5HROA 3UR0A 1OS5A 1TL3B 3G6VA 2D7SA 4LQ3A 1S1VA 4IKAA 1IKVB 3NMAA 1C2PA 2OPQA 1TKZB 4O3PA 1N48A 1S6QB 3QO9A 3CVKA 1JLCB 4KFBA 4KAIA 1ZTTA 2ASLA 4NLSA 2FLNA 4EBEA 2IBKA 4HKQA 3M9MB 3KLEA 2JEJA 3MR3A 5EWGA 3KLHA 4LQ9A 1C1BB 3V6DB 2W9AA 2GIRA 4F50A 3ICLA 2WRMA 3GQCA 4TQSA 3DYAB 1TKXA 5KFYA 4B3OB 1JLGA 4XPEA 3PJWA 2YNFB 1N5YB 2HWHA 3G86A 3MF5A
chains in the Genus database with same CATH superfamily
8AT1B 4USJC 3E51A 1NO8A 3HT3A 3AT1B 4AYBD 5D8HB 2IM0A 2XO6A 2V0NA 1YJTA 5ETQA 3J81j 4L72B 1RWPB 4NCGA 3R97A 2DVIA 1L3VA 2UVUA 1Q8IA 1FDDA 4L3NA 1XNRJ 4NRTA 1X4GA 1Y5IB 2LXFA 3POTB 2OPPA 1ZH5A 4PWWA 1N32J 3S7RA 3A8IA 1HD0A 1JXEA 5DLGA 1HL6A 3G82A 3CCUS 5CZVA 1U2FA 1LW0A 4PUOB 2MSTA 3WC0A 4B02A 2JX2A 2RF2B 3IGVA 3PRBA 2LQ5A 1URRA 2JLFA 3R5DA 4GKKJ 1H73A 3NBPA 4TLQA 3M2VB 3SFUA 1R89A 3H5YA 3D0GE 3OR1B 1ZTWA 1EETB 3ISNC 3B4MA 1F9FA 2V5HG 1S9GA 3CULA 2BE9B 2HFOA 4QPTA 5I4MA 4QWDA 4M5MA 1U02A 1WG4A 5D0EA 4ZVRB 2YH0A 3MMAA 1QE1A 5FD1A 3PFOA 4WYWA 1BXNA 2HGNA 4DR4F 3GV8B 4DL3A 5J1PA 2YWWA 1XR7A 4QU7A 2QMUB 2ZKTA 2R7VA 1GK8A 4TN2A 2EFOA 3M05A 2YNIB 3L7PA 1X5PA 2C3YA 1NSQA 5E0OA 1HNIA 4Y00A 3UDCA 3W63A 5CD4H 3FEXB 1K0VA 3TUPA 1HQ2A 1RAEB 2OO4A 2QMWA 1YVFA 3GG0A 1WDDA 2E7XA 4QCLA 1H72C 1SKUB 2PE8A 5B0EA 4ZJOA 2DISA 3I9V9 3KG0A 2AU0A 2DR5A 1HBMA 3DMJA 3IM8A 2OMLA 5I42A 4DV2F 4WIQA 2GIFA 1Y00A 2FJVA 2UXBJ 5JMNA 2W1BA 2DJWA 3AOAA 4OJGA 4I2QA 5EGYA 4DU8A 1FWLA 1R8CA 2XTCA 2R7UA 2OPRB 2GJIA 5MAOA 3GFHA 4UQGA 1YG0A 4PWDA 2CNNB 2ZZNA 2HHTA 3C2PA 1K0TA 2OUGA 4IO1A 3JS9A 1REVA 1CQNA 3AXMA 4CH7A 4DG1A 4Y2MA 1HNVA 4GVLA 1Q5VA 4I6AA 4TNOA 2UV8G 1C0UB 1HR0F 4EGLA 3SCLE 5HVHA 5L9XA 4H4OA 4LF6J 3RRGA 1FO1A 2ZVSA 3B4DA 3B8HA 1WC6A 5GADI 4KY3A 4C4WA 4QPXA 2H5EA 4F3MA 1FKOA 5HI7A 2JFKA 2YVSA 4KH0B 1NCLA 4F4YA 4DL2A 1X9MA 3HK2A 2KT2A 4P2SA 4X62F 2DNZA 1CJKB 1N34F 4QQBA 3UI3A 2AJFE 4X4PA 5GMEA 3UCUP 3BGFA 1TL5A 2APOA 2BOPA 4J9LA 3OXGA 1T3OA 5J2NA 1QVFR 3BSOA 4IOBA 4ZVUB 3S6EA 1LV5A 1RWNB 1DTTB 4KGXB 2KRBA 1UFLA 1HI8A 2KU7A 4DPTA 1Q7YT 1HQUB 2XHCA 1WHXA 1M90T 1HNWJ 4K5RA 2WSEC 2BQUA 3AAWB 5CD4A 2BJ9A 5F8NA 2C3MA 4B3RJ 2ZJRQ 3MPDA 3CF5Q 2QLBB 3O2IA 4CLZA 4DSJA 1FFSB 3FGVA 4LR8A 2CPFA 3CDBA 2IJRA 3T5KA 1BQNA 5LL6d 2RS8A 2W24A 2VFRA 3KK1B 3T5JA 5FLXY 1FVSA 2YWFA 3K5LA 4DR2F 3PW5A 3KMSA 5K14B 5ETTA 4JI6J 3GCXP 3EYZA 2OIHA 2YKAA 1S59A 2ZOMA 3QT5A 4M5JA 1FRKA 4KFBA 2FLNA 4HKQA 3M9MB 4LQ9A 4WJBA 5CAAA 2DNQA 2WRMA 4OLOA 4B9MA 3CTRA 4M1KA 4B17A 2R2RA 4B3MJ 4X66J 3UN5A 2ROEA 3NS7B 2PIIA 1VIXA 3NP5A 5ITHA 3E2EA 3L95X 3TWZA 2UUTA 3IR7B 4HH0A 3OSNA 3CJKB 1CC7A 2UU9F 1GQEA 4YR3A 1FE4A 4ZCMA 3TX0A 2C22A 2EFVA 2Q6CA 1IKYA 4C9DA 2VDIA 1FWPA 4BWJA 3D4JA 1B4SA 3R5BA 2R7OA 2VJVA 1KLMA 5E3AA 1ZAWA 4CH1A 2I5JB 2C3OA 1LWFA 4YFUA 1NB7A 2ZDOA 3R9LA 3VAIA 5B0AA 2GQQA 2IIHA 3AODA 5D77A 1PJ6A 2KL8A 1XMOF 3QRQA 1RTHA 4DFKA 2V8GA 2QG9B 3J80Y 3IG1A 2H3EB 3TO8A 1OQ6A 2Z2LA 2WSFC 1YX2A 1U45A 1SC3B 2OTJS 1V3ZA 1K73T 2MQQA 2B56A 1CS4A 2W8LA 2VG5A 2W4CA 5A8WB 1REGX 1S97A 1PSDA 2OELA 5HROB 4OI3A 4ZJQA 3DLJA 2WB4A 3MM6A 1SL1A 2DGVA 1TAUA 1VK3A 2PI5A 1IWGA 3UPFA 1L3UA 4RWWA 3C6UA 3PTWA 2HNDB 1NK4A 1SH2A 2RRBA 5F9LA 3DRYA 1S79A 2H1YA 4IRCA 3QZ7A 3NRBA 1S6PA 2PEHA 4PXEA 2DGTA 3QYYA 3UQSA 3AX2A 4OI4A 2Q3PA 2QMXA 3AA8A 3WDOA 2ZBPA 3M8WA 5F41A 1AUSL 1X5TA 3CCSS 3NCQA 3W5ZA 5EWEA 3CIZA 1IR2A 2WOMA 3G71S 4QJVA 2LYVA 1JNRB 2F4FA 4RW8B 3I0RB 3GFXA 2OSRA 1HYSA 4OHXA 3CMES 4NYOA 1WELA 1YITS 3MEKA 2MQPA 3BKUA 3ISZA 1OO0B 2Z56B 3M8RA 3LALA 2CPHA 2A1BA 1G1XA 3O3LA 4KQZA 4LIWA 4C8MA 1TTHB 1T9WA 4R25A 4FXWA 1U1PA 1TP7A 7AT1B 4DX8H 3N79A 1UVMA 4HR2A 3NCRA 4PYDA 2J8AA 4B3OA 1ACMB 2WTFA 4O4RA 2ZNZA 1X0PA 4C11A 2L41A 2AMCB 5KOWA 3SDEB 1VQYA 1KD1T 3PR4A 1R27B 3KLFB 3DLKB 4PG6A 1UZHA 4M5HA 2WW8A 4YP3A 3U27A 4FF2A 3HF5A 1FX2A 3HSDA 4IRDA 3FSXA 1FNOA 1RTJA 1RTIA 3PRVA 2G2OA 1WTBA 4UZCA 5IQ6A 1VLYA 2XCAA 5LOQA 1TV6B 1O51A 2RU3A 2AGPA 2YQ0A 4NCGB 2IAJA 1XR5A 4RW9A 2AJ4A 1HBOA 3MD1A 4B9UA 2KYXA 2R2TA 2QL9B 3OL7A 3KK3B 4CIOA 1HNZJ 3UN2A 4DV0F 1U1QA 3DXBA 3G82B 4Y0FA 4FS1A 3JYTA 2CPZA 1LW0B 1B99A 4DXLA 2KB2A 1M5OC 3CMQA 3RR8A 4HH1A 5CYQA 2JH3A 1IBKJ 1HQEB 4LF2A 3DLEA 5DG9A 3HM9A 1YJ9S 1JLEB 3GFYA 2FLLA 3BGRB 4KKOA 2HMIA 4K0KF 2DGXA 2B0GA 4RU2A 1S9GB 2BUNA 4X2BA 3D7SB 2NUHA 2V9KA 3H4DA 3OUYA 3CMAS 2ZH4A 1U0HB 1VQ4S 2OPQA 4DF4A 1I5OB 4EBEA 4X4TA 2GIRA 3GQCA 3DRXA 3MTJA 4AQYF 2BANA 1X4AA 4MKVA 2CIMA 4P7VA 3ENWA 1VRTA 2RB7A 5U47A 1RCOB 3W64A 4YB7A 2KHDA 3R2DJ 4K4SA 4PKDB 3MXHP 4I0WA 1FNXH 2KRRA 4DUYJ 1DLOA 2DNNA 5A8KB 3VWSA 3SQGA 1ZM9A 2ZEJA 4JP8A 2MHEA 1V6HA 4ZCLA 1N5QA 2WVCA 4I2PA 4NZ0A 5CH7B 3TZWA 2FDNA 2MKSA 3W2WA 2M9KA 4RKUC 2XS2A 1NSAA 3FK4A 2HRTA 5JVHQ 3U7JA 3G87A 2YH1A 2LEAA 5IT4A 2EC0A 1RKIA 3FSYA 1R8PA 2JC0A 4DG1B 1HNVB 2YKQA 4IUFA 4OX9J 1AA1B 3HVTA 4XAKA 3PX4A 1KEKA 3FVYA 3DOKA 4ECRA 1U6BA 3NG8A 4H4OB 3ETOA 1FWKA 2AJ1A 4EK2A 3K89A 5FDLA 4DFPA 3D1QA 3HHLA 5K20B 3CJ2A 4I56A 2WAQD 2B9EA 1HI1A 4J9OA 2BE2A 3BREA 4WK1A 1NDLA 1X0FA 2CADA 4C0HA 4X4VA 1L3SA 3CEDA 1TKTA 1Q82T 1FXLA 4DR3F 4WFAQ 4C0BA 2YPYA 3UDEA 4ENOA 1ICEB 3NOGA 2DNRA 3H5UA 3DI6A 4ZIVA 5KFIA 3H90A 2J0WA 1RAIB 1F5CA 3CUNA 4LJMA 1JMTA 3VR1A 3PJXA 3QFHA 1RACB 5D4OA 4M5GA 1AFIA 4IR1A 5LSRA 2WVEA 5D3GA 1Y0HA 1RYRA 5J2NB 3TI0A 1FK9B 2RH3A 3UD4P 3M2RA 7FDRA 4B3TF 2R8GA 1FRJA 2IRYA 4K2JA 1JNZB 3PIPQ 2B7BB 4WPAA 4CZCA 3AJDA 2V9WA 1O6XA 1WG5A 4KC5A 2ZH1A 1LXNA 3DM2B 4MYUA 3OTBA 4FYXB 3PFEA 3QIDA 1YJ7A 2N3OA 2AX1A 3NY0A 2BJEA 3D67A 2W25A 2C3PA 3QZ8A 3DU5A 2FTRA 3DC2A 2OPSA 4FS2A 1ZAVA 4C0OC 1UA1A 1IKXA 4YEAA 4B9TA 3C66A 2QA1A 1WKKA 1C1BA 2PEBA 5HANA 3RAXA 3THVA 2VL1A 4YR2A 1SKSA 4H4KC 3C46A 3BO3A 3RB0A 7FD1A 3B78A 2CRLA 5LMNF 1U24A 3TOQA 2NXNA 4Q45A 2KM8C 1VRQC 3UWTA 4NLRA 2QRRA 2HHUA 2HK2A 3UO0A 3MOZA 2GS8A 5B0FA 3R1LA 4YR0A 1B7FA 2VFUA 2FHJD 2LQ8A 1W7WA 2VBXA 1Y4ZB 1JIHA 2V2KA 4PXBA 2Z8QA 3H2UB 4O4GA 1BD6A 3ITHB 4R5PB 2CQ1A 4DSLA 1RU1A 3FQKA 3T1YJ 3TAMA 3BYRA 4KO0A 1N4LA 4F4ZA 2E5LJ 2PGCA 2BJ7A 4MFBB 3DRPA 2XMTA 4JI7J 3HCXA 4NXNJ 5F8HA 2M5YA 2VIHA 4DPOA 2AHOB 2QT7A 4EU0A 1FCAA 5AXMA 1U1MA 4KJIA 4ED1A 3FRYA 2FB0A 4W4MA 4DV4J 1QTMA 4PQUB 3V4MA 2EKYA 2FVPA 4UOCA 4K4WA 3CB4A 1VISA 4ED6A 3GLJA 4J91A 3F0NA 1YJUA 4ZVEA 3LP0B 5DQGA 2UVRA 4U96A 3US5A 3LP1A 4KGMA 1KVJA 1TL3B 2Y0SD 1VJQA 2J7WA 2D7SA 2ZH8A 1TKZB 4NXMF 4NLSA 1RABB 4OI2A 3K57A 4DR7F 1TKXA 3SSQA 3M4XA 4P10A 2HWHA 1KN6A 2ALYB 2HHHJ 3TYTA 2GVDA 1RHQB 2UXCJ 2BX6A 3I5BA 5KFKA 4Y65A 4DLEA 3MM5A 1FRXA 2HPUA 1I3OB 3NGSA 2N7YA 2Y8WA 3WX4A 4LVOP 3VVTA 5I3UB 3C6UB 3T1HJ 1T05A 2GIQA 3QWPA 1S72S 5HO4A 2COLA 2EVZA 3M2UA 4I6WA 3BBCA 4NLTA 5DETA 5BYQA 5B0DA 3QATA 2MJNA 4TY8A 2KT3A 5M2UA 4DUZF 5B0GA 3PKMA 1L5UA 2HBQB 1MU2A 2JC1A 2EEYA 4O44A 2AZ1A 3R7BB 1HWUA 2JEGA 2IC3A 3CW2C 2JVOA 4XIUA 4A8OA 1RT5A 4FF1A 5EX3A 2H54B 4R8UB 3TA2A 3JXOA 1N0UA 2X1BA 5IV3A 4GO5X 3MCSA 2DIUA 2D9PA 3ONQA 5KT4A 5KFVA 4DR6J 3D66A 1U26A 4CP5A 2ZBRA 3KKFA 4QIEA 3Q2SC 1YRUA 5F0UA 3JAMU 4U9RA 5IT9Y 1ZAXA 1RT7A 4JI8F 2CQHA 4LSLA 5L1LA 3HFVA 1X4FA 3OT9A 1N36J 4M95A 3QIPA 3D6MB 2AJ2A 1ZBTA 3QGHA 4NEYA 3L09A 2V69A 1ZOTA 3MFIA 5EN1A 2DHAA 2D3UA 2UUAF 5HLFA 4ZS6A 2BRKA 4USUA 1RB0A 3V6HA 2XC9A 2HHPA 1XK8A 2NSCA 4HDHA 3EGVA 1WEXA 2H51B 4OFZA 5KFGA 3A3PB 4Y2IA 1FTCA 1UW9A 1JJCB 4S0MA 3LPYA 2ACYA 4IOAQ 2IAJB 4QU6A 4RW9B 2ZM6F 3CC7S 3JSBA 2V63A 1GEHA 4CLPA 2VG7B 5H9EK 1TU0B 3N6LA 4ID5A 4USMA 2FJAB 3GJTB 2EK1A 3C19A 1C0TA 2JVRA 3BGOP 4KPYA 2ZITA 1HWIA 1NK6A 2YWGA 1UZDA 4JI5F 1D8ZA 4OZ0A 2F40A 4RW4A 2HQIA 1KQKA 2X1AA 3DLEB 3DRRB 2R42A 2XNQA 4GRSA 2D9OA 1WWHA 3UW1A 4EUVA 2LCWA 5HP1A 4HACA 3TUZC 4WP3A 4ZP8A 4CO3A 3PCOB 5KFZA 5KG5A 3OJSA 1WKLA 3DHWC 3EZOA 4ZCIA 2BQRA 3ZTRA 1Q16B 2EFGA 4J5OA 4X84A 1JXLA 1QJHA 1T9YA 2QL5B 1AT1B 2DRBA 3PRDA 4MIAA 4H4MB 4DCJB 2GO8A 2QTWA 2XYGB 4ZN1A 3GIKA 2RJZA 3EXCX 4BWMA 1F2HA 3M8SA 5C42B 2BANB 4IDKA 1IJFB 5DG7A 1HNXF 2KG1A 2E5GA 5HMXA 2VD3A 4UTGA 4JV2A 1TVRA 3I4HX 2ZDPA 1VRTB 4NA3A 4MK8A 3FBBA 1RBLA 1UVNA 3IA0A 5B0BA 2H5JB 3EICA 1HPZA 4EWTA 1HLWA 2V4RA 2IBOA 2IDLA 1XERA 3E01A 4WE1A 1H6KX 3CC2S 1KKHA 3T6BA 1RDRA 1UJ4A 2D41A 4OYPA 2QLJB 4JI1F 1LK5A 1SJRA 1X8DA 1J2VA 2X51A 3NKYA 2CQGA 2JOQA 1RHJB 1MNEA 2LXUA 3NNAA 2HNZA 1MMDA 4FF3A 4N47A 4IOCQ 4Y34A 2DNMA 4JI0F 2CWKA 2FC9A 3H25A 2ZH9A 4NZ7A 1R0CB 4EI2A 5B08A 4ES3A 3D28A 1C4AA 4DSEA 2D1CA 2HQGA 4DI6A 4RNOA 4A8WA 1QAIA 2V2ZA 1NHVA 5J2QA 4G1IA 3HVTB 3QGPA 3AH6A 2N4DA 4PCQA 5CYMB 3FC9A 4MK7A 4ZPAA 1OPIA 2DPIA 3DGPB 2VPXB 3HJFA 3G6VA 2CNOB 1X5SA 2DD8S 2HSEB 4O3PA 1N48A 3QO9A 3CVKA 2C2KB 2JEJA 1OY8A 3R6GB 3DYAB 5KFYA 1JLGA 3C14B 2QA4S 3OQ2A 1YBAA 4A8KA 2ADCA 2XGQA 5LMUJ 2F3JA 2DT9A 2L48A 3MMCA 1CC8A 3O5TB 5D4LA 1KR4A 2OH2A 4YB1P 4NCAA 3DI6B 2PDAA 1MSWD 4CWBA 3W60A 2D3O1 1N33J 2MKCA 3L3CA 3FRZA 5EWFA 3PIOQ 2FZCB 1RT4B 4I4BA 3EMTA 3EZ5A 2HHWA 1UETA 5D3GB 3V81B 2DH8A 2Z30B 1BMQB 1YHQS 1EKSA 3M2RB 4O3NA 1I94F 2XZ2A 5EX0A 1NJXA 1UPMB 3DRSA 1WJ9A 3K5NA 1VQMS 4JYAJ 1NNDA 3W9HA 1GX5A 4LRBA 1TK8A 3TANA 3FCHA 4IG3B 2FLOA 3V6KA 1RYSA 2Y8YA 3T6JA 3CJTA 2POKA 5KFAA 4ZVQB 3EGZA 1JKHB 1S1UA 4OX8A 2LLZA 4ECQA 1N5TA 2RVJA 4DX5A 4DCPB 5DM7Q 4BC9A 4YY3J 4JBCA 3P4UB 2DGUA 3K17A 1CJVB 1T7PA 4IYQA 1LWXA 1AROP 4KHRA 1S1VB 1TR0A 2LECA 2HKEA 4ICLA 4E0DA 2F9JA 3LA0A 2ZWPA 2OEJA 1SPBP 1FX4A 2HG4A 3I31A 3PNIA 4OHYA 4BDPA 3HHNB 2HZVA 5J1NA 3Q89A 4ANDA 4DZDA 1P9YA 4CT8A 1GTEA 3UVJA 1YIJS 1RT1A 2E29A 3N4WA 5E2QA 4IFYB 4OI1A 4CH0S 4DN9A 1LWEB 2K1RA 4F02A 1RLCL 4QWBA 1YJVA 2B8PA 3MEGB 4LFCF 1FJGF 2FZGB 5H9FK 2FPHX 4BHQA 4WCEQ 2AJQA 1UVKA 4C2MA 4RPFA 1KC8T 2CQCA 3LAKA 5IC4B 1BY9A 1GMUA 1JJHA 3IMQJ 1LKZA 3L7UA 2DNYA 2M70A 3NGUA 3CXCR 1RZMA 3DRPB 2OAUA 3VHQA 3P45B 3IN5A 2R7QA 2ZHOA 3G8TA 1S10A 3QSIA 2ZH6A 1HWJA 3K2YA 1T11A 2V94A 2RNEA 4IFVA 1SJ4P 4UOHA 3I87A 1VBKA 4ZLPA 2AGQA 4J9KA 1IKWB 1TQLA 2MLYA 5IM0B 3D2WA 2MXYA 2NCKL 4JV5J 1KHVA 2CQ3A 3C6TB 3U1LA 3NAHA 3A8EA 4BCAA 1JJ2R 2QO3A 2ZHBA 4MKAA 1WTFA 3M9NB 4F7VA 2UVVA 4X4QA 3BEGB 4HVZA 5BR8F 2FJEB 4OV6A 3A1YG 6AT1B 5T41A 3BGLA 1RT2B 2KFNA 3IBCB 3R7NB 1XMBA 2L08A 2OSQA 4R0JA 1WHVA 3MM5B 1RTDB 1H74A 2YNGB 4OQJA 2ZNYA 5ETPA 1WDTA 3CJ3A 3GIRA 1RUSA 3HVAA 2MZTA 3GWCA 5AE3A 5KT5A 2Y0BB 5EUHA 1RLDA 5KFCA 5I3PA 4Q0BB 4OZJA 2XS7A 1W2BR 1YBUA 1DARA 1PO6A 2DYAA 1QAJA 1T9TA 1KQSR 3AY0A 1RAFB 2M4MA 5IFMA 2JEFA 4DEZA 4WXWA 2DHHA 3DLGA 3H59A 4RBUA 1U6FA 3ZFVA 4LF4F 4JUZA 2AJ0A 2BW7A 4A48A 3MPUB 4OYWA 3PKYA 1XNRF 1FERA 4LRCA 2AWZA 1QDUB 3NOCA 2HS3A 2OFHX 3RGIA 1WOSA 1JXVA 2XZWA 2IM3A 3MR2A 3IRXB 1P8GA 3V5RA 3J81U 1A7GE 3M1VB 3RRHA 1MROA 5G0RA 2F1FA 2XMJA 4UY8T 4DV2J 3AA9A 2MJUA 4WBFA 3M32B 1JLCB 4LF7J 3KLEA 4CO5A 1DQ8A 2P9EA 2ZZTA 1T8EA 3K7RA 5J2MB 2EW9A 4ZOSA 2MKJA 2FHOB 2ROPA 5AXNA 3WQPA 5KG6A 1R8HA 4DF8A 1S0MA 3HT0A 1CLFA 1F3VA 5HLFB 2GC8A 2RE1A 3M8PB 4XO0A 3JSRA 2DK2A 3QMQA 3I56S 2E1RA 5GAEU 4N41A 3IWLA 3FKBA 2YKPA 2R9LA 2E5JA 5AT1B 3AB2B 1LQ9A 1SJ1A 1U1OA 2DO0A 1XTZA 2B6AA 1U0SA 3QPIA 4QIFA 1VCTA 3VAGA 1ZPVA 1O8BA 2VU5A 4HHJA 2HBRB 2RAQA 1R8BA 1RT6A 2XWYA 5LSLA 2ZBIA 4H4KA 3D5MA 2C2MB 1UJ5A 1VJWA 1N34J 1NK8A 2QC3A 1TUWA 2ZVIA 1IM6A 4ETZA 1X60A 1RK8A 1SV5B 4WU3A 5D78A 3R6LB 4J9RA 2BOAA 2WB1D 3CCES 4M94A 4TU7A 4ERDA 1FF2A 1S1XB 1VFJA 3UNGC 3PR5B 2VASA 3C15A 2Y1LB 4UOFA 2V50A 1XR6A 3P96A 4O23A 4G1QB 2VONA 2VH7A 5DQIA 2J6UA 1JLQA 1I51B 1N6QA 3AX3A 2C3UA 4F4WA 1P27B 3M6VA 1NHUA 2A6OA 5J1EA 3O44A 4F4XA 2MDAA 3J7ZT 3BM7A 2RRAA 3SV4A 3D6TB 3K0JA 3KLGB 4C3LA 2MPUA 1MW7A 4LF6F 4K4YA 4I64A 3V4IA 3KK2B 1TVRB 4PWUA 2DIVA 1S9FA 2KZMA 3W2VB 1EAYC 2DH7A 4DJBA 3I9ZA 2IA6A 4D3GA 4HTJA 3MDFA 2BQ3A 1HPZB 4CTAA 2J76E 5L46A 3GSIA 4WE1B 2CA9A 2X3DA 4M5NA 3HVWA 2YY3A 4LSNA 1PAEX 2G1DA 1Y9OA 1V5IB 2N82B 3V2UC 1WI8A 2V4QA 4NLWA 5HK4A 1SUQA 5L39A 1DJ0A 2BRLA 4EZ9A 2W01A 1F3FA 1UWBA 2NLWA 5ETSA 4I67A 3TVKA 5GAHU 4OHWA 3B82A 4ZVGA 2YBVA 4CLYA 2RKIB 3H0PA 5IT0A 2GMHA 4CLFA 1FJEB 1IR0A 2FLPA 1RWXB 1HNWF 4NZ6A 1R0AB 1CQMA 4NYPA 3P5BP 1T03B 3MZIA 3KDNA 4J9QA 5KFBA 4RNNA 4B3RF 2CPDA 3F44A 3KLIA 3OD2A 1S48A 1JLGB 2HVZA 2ERRA 3W3SA 5J2PB 3HHDA 4K2XA 2CYYA 3VAHA 4K4TA 4DU7A 5DZ6A 1RKJA 3G6XA 4JI6F 1X4CA 2VA2A 2V34A 4F3QA 4ECSA 2OD6A 3DOLA 3MEDA 2ASDA 1KHWA 2PFDA 1N88A 2HW3A 3MM8A 4P72A 9RUBA 3H20A 3NCPA 2AX0A 3BQ1A 2A0FB 3MECA 1M5PC 3MMBA 2AYBA 2GFFA 1HBUB 4IG0B 1VK8A 4OZLA 2XCPA 5ETRA 3EGWB 1NKCA 2MZSA 5IWAJ 4YMEA 5L1JA 1UAWA 3HHLD 1SXLA 2VPWB 3DRSB 3NS6A 1J5OA 4YB6A 1DAXA 2XTEA 3UNYA 1N0VC 1RAAB 2AZ3A 4PQAA 2LMIA 2J0SD 1FRMA 1SJ3P 1P1LA 5ADZA 1NJWA 2B5JA 2J9CA 4ED0A 2D3ZA 3QSYB 4EEYA 1Q7LB 1D9FA 1E6YA 2HBZB 2J8SA 1OQ3A 4LR7A 4AE5A 4HI1A 1FXRA 2Y3YA 5K8PA 1GXLA 1OIAA 4F50A 1V9OA 2CVEA 3GR1A 2HFUA 2IRXA 2YNFB 3T41A 4DV6F 4NEZA 4OZ5A 2MY8A 3IM9A 3BR8A 2N7CA 3AB4B 2QSFA 3RUBL 3AD9C 1WNEA 2JDJA 2YNHA 4ECTA 4K4ZA 4LRDA 3KNAA 3VGUA 1EJ7L 4C98A 3QLHA 4N8NA 2DXDA 4DFJA 1C1CB 2DNHA 4ZPTR 4RUAA 3MEEB 1ZA2B 3R2CJ 1RAGB 2FHMA 4HT7A 3B54A 3PO5A 1GH8A 2MGZA 3CIMA 2DEIA 2I8EA 4DR5F 2AD9A 1WF2A 4JI3F 1WG1A 2VFVA 3FNNA 1U7LA 2E5HA 2VKRA 5DM6Q 1NK0A 4PPZA 3R5CA 2QV6A 1W2IA 2QL7B 4KE5A 2W9CA 4CCHA 3VQTA 4WP9A 3MWBA 1LWCB 1YJRA 2LDYA 1FDAA 2F65A 3CCRS 4USWA 2M7SA 4F4AA 3Q24A 4ZLJA 3TUIC 1HBNB 3IR6B 5A2QY 1XMQF 1E6VB 1CVJA 4BBYA 3M8ZA 4KB7A 2QA4G 2AT1B 5IXUA 3OPKA 2AV5A 3L9ZA 3LGMA 1UFWA 3E3XA 3CDWA 4C8OA 5HBMA 3DOMB 4QR2A 2XQCA 2PMWA 4ZMMA 3MM9B 3KLHB 2VOPA 2QN6B 2HYIB 1OWXA 5SUHA 4ECYA 1Z2ZA 1JLFA 4DHVA 1URNA 4ITSA 4DS4A 2VUGA 1FT8A 3Q8YA 2P6SA 3HHLC 1WSRA 2NXJA 4LREA 1KNZA 3TAQA 3G6ES 5AE2A 4ILLA 3JB9k 3MD3A 4C7QA 1IBCB 4KGVB 2KJWA 3HZEA 3EXYA 2J6SA 3FZ2A 4WFBQ 4MJKA 1SQEA 3TJAA 3QNWB 3LTOA 5CCLA 2FUG9 2R4FA 3BZQA 1Q1KA 2XY7A 4LBIA 1NMEB 2DNGA 2VDHA 4LF9J 1FD2A 3S8SA 3CNQP 3RW6A 4Z37A 3M30A 3UN3A 3I32A 2WCXA 4HT5A 3QJLA 2HVEA 2V2QA 5SZTA 2XYHB 3PACA 3C3LA 3PW7A 3H42A 3DCAA 1DRZA 2OEMA 5E3CA 4NLXA 1HNZF 2JRSA 3PM9A 2E1PA 1SJQA 1NK5A 3RB4A 2F5GA 1AW0A 1K47A 3CO0P 3LGNA 3ZO7A 4B3SF 4DSIA 2WBMA 3DLLQ 4LR9A 3CDAA 1TK5A 3OTCA 2DB1A 2MQ8A 1VBZA 5A8RA 3FFIB 2GQCA 3OVSA 2M52A 1VQ5S 2J9EA 1R7IA 5IS2A 2NXCA 2VB6A 4DPXA 2BMBA 2QYGA 2UP1A 5CYJA 1V3SA 3Q2TC 4V19J 1WC0A 1U1NA 5D15A 2CDRB 2FVCA 4I7FA 3F73A 3ZTPA 4M5DA 3SCIE 4B9SA 3EVMA 1AZSB 4BLGA 4J9SA 2E7WA 5B09A 3LP2A 4CLKA 4RL1A 4O3OA 2DGSA 2WVFA 3HO1A 2JJ4D 1Y11A 3D6FB 1N8RT 5M2PA 3RU0A 4DOZA 4OZ3A 3AHPA 3OR2A 4DN0A 1VIOA 4DR3J 4IH5A 5LT5A 2CJAA 1LOUA 3ZTQA 1NU4A 1K1QA 2KO1A 3M7VA 1M5HA 5KFDA 1CJUB 4DQIA 4ED5A 1S9EB 3BSNA 2B9YA 4V1Ak 1I6JA 3I0SB 2XS5A 2WONA 3JTOA 2IMWP 2EFPA 2VHGA 4DV5J 4CLLA 3BGUA 2OEKA 4CYUB 4KAIA 2FY8A 4B3TJ 2MSSA 3K5OA 3C15B 4TQSA 3G86A 5LM7E 4RU9A 1NPRA 1X5OA 1KSPA 2ZD1A 2UXDJ 3Q22A 4V19X 1JLQB 4Y3CA 5KFRA 2E7VA 3KHLA 5J1EB 4NI2B 2OJ3A 2CQ4A 1DQ9A 5AJ3J 4CI0B 1VC6A 2RDIA 4C3MA 1T9UA 5DRKA 4I1TA 4J90A 2L9WA 3TJ8A 4WF9Q 2ILYA 1VI7A 2DR7A 4QOTA 2E1MC 1LNQA 4P2MA 3FMWA 2HLTA 3GIJA 5KT6A 1RGVA 4TVAB 1U2CA 3KJVB 4O0NA 5L1KA 5LMNJ 4YS2A 3X3UA 2H65B 3H2VE 1RP5A 4ZPWR 2E9TA 4KV8B 4WIIA 3MTKA 4OV1A 4RR5A 4AFFA 1CJTB 3VV2B 4GKJF 5D4PA 1VGYA 3MR7A 3RR7A 3G6YA 3KTQA 2LQBA 2EG2A 4ED3A 4NLDA 4NLOA 1BGXT 3HXMA 3G2XA 2QZ8A 4ZVOB 3GP9A 5HL7Q 2EC2A 4C8YA 4OZ2A 2HZAA 3M9OB 2GVZA 4FN5A 5A6PA 4USTA 5DZ7A 1RHMB 2E9RX 4U6PA 4F0KA 5E3PA 2BW2A 2XSJA 4NRUA 2DRAA 3LAMA 4OX6A 4UT4A 4LFBF 1LFWA 2B8QA 3HULA 4UUWA 2VQEF 3EVWA 3JSYA 4NL5A 3TEHB 1IQTA 2NZCA 5GAGI 2R8JA 2BJ3A 5C24A 3MR5A 2RUGA 2KG0A 3TP2A 4ANEA 3DLBA 4FYVB 4O3SA 2HS0A 4KH1B 3PW0A 5G4DA 1EQMA 5F0WA 2OLWA 4PG7A 5C25B 4NXMJ 1CULA 2NR0A 3UD3P 4ZHRB 4TU9A 1D0EA 1UEVA 2P9CA 4XPCA 5E33A 4LF8F 5F8GA 2XI2A 2P5VA 4JV0A 5A76A 2V8HA 3GIIA 2UUCF 3DDIA 1WEYA 1XJWB 2XM3A 1VMBA 4UOGA 2MQMA 2BBEA 1RBOB 2ZE2B 1WHWA 2HGLA 1Y10A 1IKVA 3FZBA 3AJ2A 4UUXA 3IR5B 3MFHA 2RHQB 4FXVA 4RWXA 3GV7B 4NLVA 1M1HA 4ED4A 2E5LF 3PW2A 2Z0GA 4G3IA 2VPZB 3DHXA 3AOBA 4E2FB 1E6YB 4DV3F 1GMWD 1VBXA 3IP0A 2CPYA 3MMJA 3M8QB 1EP4A 3MI7X 2CG4A 2GNKA 2B4UA 3OL6A 1IQZA 4K4UA 2KZZA 1K44A 3POTA 2NUUG 4K4VA 2W9BB 2GO9A 5DDOC 3OXFA 4ETXA 2ZBCA 2H4WB 4PABA 1YJNS 4PUOA 5I3QA 3TVZA 2GV1A 1FTRA 1GX6A 3D68A 2RF2A 5ETOA 4RNFA 4A8YA 2ABYA 4ECVA 2WSCC 2HHHF 3H2LA 4JI8J 2W2QP 3M2VA 4CLWA 3FDSA 5CABA 2UXCF 5H9EJ 5MLCV 2BM0A 3OR1A 1JWWA 1EETA 4KYZA 2R7TA 2KI2A 2NXEA 1KQGB 3VGVA 3N6NA 4QWEA 3A4TA 3N28A 2VA3A 3T1HF 1NRKA 3AJ1A 2W9CB 2KJVA 4NOHA 2JLEA 2HHQA 3LANA 1X7VA 4HLBA 2PD1A 4NMLA 4Q2LA 4HYKA 3ZNJ1 5ETKA 1NZ8A 5DDPC 2W2NP 2MZQA 3NMAA 4EFAC 1S6QB 4OYBA 2IBKA 2YX1A 5EWGA 2W9AA 3PYGA 1RWVB 1WEZA 4P2FA 1UPPA 4AXJA 3PYFA 1KTVA 5BYRA 2CQ2A 1PBUA 3H8YA 1VQOS 1FJ7A 3W8PA 3K59A 1SVDA 4JI5J 2GHPA 3RRKA 2DCLA 3SCJE 1S1WA 1VS3A 4QW9A 2Q66A 2AGOA 4DBQA 3TZXA 1NEEA 3HD1A 2NQPA 4WFXA 5KG0A 5LJ5Y 3I82A 4U7CA 2CNKB 1HARA 2OPRA 2MQLA 4LF5J 2NS1B 1N36F 2RSQA 1G2EA 2HEKA 1SC6A 1CEZA 1T94A 4NLGA 4IQXA 1OSCA 3BO4A 4ILMA 2NYHA 2KFYA 4F67A 3HFKA 4XDDA 1RQ0A 4ZPVR 2XO7A 2ZOGA 3THTA 1HHQA 1C0UA 5KT3A 1HNXJ 1QUVA 2V4JB 3PV8A 1YKWA 1OYEA 4PG4A 2X7IA 3VZIA 1PC5A 4I69A 3NWRA 3NGTA 2Z57B 2ZBQA 2DXEA 4WU2A 3LH2S 3ENQA 3UE2A 4NLPA 8RUCA 4GVBB 4OYOA 3H98A 2DTJA 3L4BC 4N7TA 4I68A 4RUCA 3PW4A 4NLYA 4CNYA 4JI1J 4Q8FA 5HATA 1Y3JA 4DX6A 2QEXS 1KP6A 5HMWA 2EPIA 1G6BA 4Z7CA 2W4PA 3I55S 2F9DA 4RBVA 5AXLA 3VAKA 4DL6A 3GE9A 3DNCA 4RLEA 1IN0A 1T95A 4KR0B 1XQIA 4WP8A 1FNMA 2LQ9A 3NEKA 1DTTA 4M5LA 1YZ7A 1RAOA 5LJ3Y 1WD6A 2ALZA 5H1SV 4OJHA 1N54B 1F6TA 1HQUA 1RHRB 3W8GA 2H9ZA 2EXUA 3EWGA 1QD1A 4I7FB 4DL7A 3D6HB 3R5JB 3ELHA 3MAHA 3A12A 4GMKA 2GGPA 1S1TA 2OPPB 3IRWP 3FBCA 3GILA 3GV5B 2H48B 2QLFB 4LIRA 1BE4A 2XTJP 4DX7A 3TAPA 2O01C 2OKQA 3OFHA 3VGSA 1HWLA 3OR2B 3MPYA 3EPIA 3KK1A 4L74A 1VQ9S 1GAOA 5BYSA 4TYAA 5K14A 3NBPB 4EBDA 2NZ4A 3IC1A 4AL7A 2B4OA 3KG1A 3GG1A 4O3QA 4FYWB 4UZBA 2RRNA 3HPOA 3KFWX 3OTDA 1EQ0A 3H7HB 1YZ6A 3W9IA 2MHNA 5F3ZA 3U1MA 4LVNP 3MMAB 1QE1B 3DKDA 1HW8A 1T0TV 2RMLA 3HSGA 3P3DA 2ZHAA 3C16A 5DG8A 1I94J 5E41A 1H0HB 3OSPA 2IM1A 3LPEA 1N52B 4M5IA 4HI2A 3CJKA 2HQDA 4DV7F 3VZHA 1PILA 3HFZB 2ZD1B 1HNIB 2G0JA 3EJMA 1UEUA 4OI0A 2G2ZA 1UFKA 3RAMA 3T1AA 4ZVHA 2VJUA 1UW4A 4ZKAA 2R2SA 4P7TA 4M63A 2DCUB 2I5JA 4PG5A 2B4VA 1KQFB 5H9FJ 1HBMB 3DMJB 1RA7A 5I42B 1RCXB 1DHMA 2E44A 3RB6A 4WZMA 2CQIA 4I2QB 2YKOA 4EO6A 4G1PA 3HZGA 1RWKB 3U1NA 1S6UA 3MOJB 1RWWB 3AFGA 4PWDB 2XMVA 1QY7A 1RWOB 4ECUA 3GSDA 1REVB 3N5BA 1N5VA 3A8KA 3K5MA 1RHUB 2JFDA 3R5GA 1NJIT 4P74A 3HD2A 1BUXA 2VZ9A 5HROA 5GMDA 1ZTTA 3MR3A 6FDRA 3ICLA 2GVZB 1FKOB 2CXEA 1K9MT 1X31C 2DR9A 2ZZMA 3QT6A 4TXSA 3OW2R 1VYAA 4A8QA 1HHTP 4Q44A 2IA0A 3GPAA 1S0NA 1XNQJ 1X4EA 3WHIA 4QW8A 2WHOA 2GMLA 2DNLA 1Q95G 5KFQA 1D9DA 2CKWA 3Q8UA 3PHEA 4JI2F 2XG8A 4ZA1A 3JQMA 2VC0A 1VR6A 4QBUA 2IYGA 1UVLA 5HMYA 1S49A 4HHUA 2XHWA 4TU8A 3H40A 3SFGA 4RW8A 1S76D 2FJWA 3SEOA 2KYZA 4MKBA 1CULB 1OSDA 4X65F 3K8VA 3FEZA 3UDVA 4ID8A 3ZZRA 4IQMA 5C2CA 2HBYB 1FESA 1DBDA 3ZC4A 1K1SA 1VQ7S 2RDJA 3MAAA 2C2EA 1ZM4A 2M8DB 4LSZB 2I1RA 1VQ6S 1BQNB 3BPDA 3M6XA 4NMXA 5KFHA 3SDEA 3GONA 5IZHA 4QIWD 3KLFA 1IBLF 3DLKA 4AUKA 2R8KA 3V6DA 1H3DA 2O3DA 1HHSA 5KFNA 5HJXA 2LQJA 1T3NA 4P71A 2XY6A 1FFWB 4ER8A 1TUVA 4KFBB 4TLRA 3OBIA 2Q43A 3CGIA 4ZLNA 2F4VF 1EP4B 1TV6A 2HRUA 2IFXA 1Q8KA 1J5EJ 2I38A 2RDDA 4LF4J 4MIBA 3RBZA 2B43A 4YHHF 4DR1F 3G8SA 2VBWA 1JX4A 2YWHA 3JSMA 3KK3A 4JV5F 1VRUA 1YK9A 3RJMB 1FEEA 1IKYB 1U47A 2DNKA 3RG6A 3UCGA 5HAOA 3EUNA 2QIFA 3D3BJ 2DY1A 2VOOA 1U1LA 2VV5A 1HQEA 4FKYA 3CCVS 2FJXA 2ZFHA 1JLEA 2CJYB 1KLMB 5KFLA 3BGRA 3Q86A 2EBGA 2HFSA 1EIYB 5DGAA 1LWFB 5D0RA 4PR6A 1A9NB 2DR6A 1U6ZA 2E1AA 4W98A 5K8NA 4KHPF 1GMVA 1MWYA 2YPZA 2XEXA 5T14A 2Z4PA 3H5XA 1Q8LA 1NDKA 1U0HA 5FJ4A 1FVQA 1UTAA 4LRAA 1CPZA 1VQKS 1TELA 1BC6A 3GYNA 3GIMA 2RD5C 1SL2A 1RTHB 3DLHA 5F8LA 2ZH3A 4DS5A 3IG1B 5EHHA 1F1BB 3SI8A 3BH6B 4HHHA 2R7WA 2MY7A 3KJQB 4QZVB 3D1OA 3OHAA 1CS4B 2OGUA 2VG5B 2D69A 1JLAA 2DH9A 3W7BA 1SI9A 2EI5A 3O1LA 3MM6B 1EARA 2CVIA 3F41A 5A8KA 3DN9A 3MCOA 4ZN3A 1S1WB 1XEZA 4HEA9 2LA4A 2BACA 3SIPB 1CG2A 1DFDA 5BJRA 1IBMF 4Q8EA 2ZUAA 3H4BA 4Q7AA 1DQAA 4LF7F 2FJBB 4X64J 5FLXU 1S6PB 2LP4A 2ZC4A 2CJQA 3SSSA 2X1FA 1Q0NA 3BKTA 3OLBA 3AQOA 1ITPA 3MCNA 2VQFF 1S0OA 2F8EX 4FNHA 2R2UA 4PEOA 5A0YA 2XMUA 4DQPA 3ZZOA 2PFFB 3NXZA 2WOMB 1HWKA 2IJNA 1NHKL 1S5ZA 3DDNA 4UY85 1QM9A 2BM1A 2K3IA 1HYSB 2DGQA 1TL7A 2A6MA 4QYZK 3KHRA 2BE7D 1SB6A 3GMGA 3QGIA 1PYTA 1HIYA 1CBKA 3CJSA 1OY6A 2GZOA 2C2OB 4YDXA 4DV1J 2ZH5A 2V6AA 3Q0AA 3HMJG 1J27A 2RQCA 1MN7A 2M88A 1S4EA 4B3OB 1RADB 4AXIA 2HFNA 4C11B 1ZS6A 4O3RA 2CJXB 3RB3A 1KDNA 4XTTA 3SXLA 3M8YA 3BPSP 3L7OA 4RNHA 1DURA 5DDQC 1HFEL 4CLTA 2C2NA 4ZVSB 2HFVA 1RTIB 1RTJB 3ZZYA 2ZJPQ 1FK9A 2HQCA 2Q1LA 4ECZA 2PN6A 5KFPA 3J7YU 1TUGB 1SKRA 4URQU 3PJ9A 5KFWA 2B9WA 1HBOB 2BYCA 3J80U 3DM2A 2Z58B 1H2VZ 4ED7A 3GZ7A 4ZVPB 2FJDB 2GGPB 2H4YB 1S1TB 4FDFA 1RTZA 4Z2XA 4YOEA 3JYTB 2LEPA 3BF4A 2JEIA 2F63A 3K8WA 5CYQB 5EDWA 5IOLA 2K3KA 1VQSA 1PJ7A 2D68A 2DRDA 2OI2A 3DU6A 4KKOB 2HMIB 3BSAA 2KVQE 1YTYA 2J7UA 1V3RA 2BEFA 3MPVA 3VTIA 4OL8A 4YUDA 1TL4A 1WUUA 3J7Z5 3BV8A 4ELUA 1YDLA 3OUYB 3I6PA 3B6BA 2K2PA 4ZVFA 3P6YC 2OPQB 1NKBA 3HKWA 2M3DA 2ASYA 3C16B 2FD2A 3E8OA 1SH3A 2RS2A 4LRFA 2GAGC 1OYDA 4YN3B 3X1LB 2UUBJ 4OYIA 2FHKA 3GU0A 3UCZP 4NPOA 1FA0A 2F8HA 4OHZA 5KFXA 3P49B 3ITHA 4R5PA 3FBFA 3IS9A 4NA2A 2MKIA 3C8YA 3LQVA 1Q8BA 4RUBA 3JAMY 3IBFB 2ZUGA 1FDBA 2RT3A 2OTLS 1X4HA 2YQ1A 3MUTP 5E3QA 4OJ1A 4MFBA 2MMYA 2XZDB 2HGMA 1DLOB 4OYXA 2VFTA 3SQGB 2HAIA 3CD0A 2GA7A 1VC0A 4XK8C 1LXJA 2ZH2A 4M8LA 2CQPA 2ZWOA 4I2PB 3QJPA 2VG6A 1CSJA 4DV6J 3W2WB 4PQUA 3WIUA 4NX9A 1VHFA 3LP0A 4R0EA 2V8PA 1TFWA 2OMOA 3NMRA 5HMZA 4Q5VA 1TL3A 3MM7A 1YSJA 5GAEI 2LA6A 2IVFB 1TKZA 2MB0B 3W61A 3ZZ0A 5KT2A 4PPDA 3VAFA 3DOKB 2FZKB 1VQPS 2VKZG 3TW0A 1M1GA 5GVQA 2FIUA 1SCJB 2CPXA 1GXUA 4F0HA 4J9MA 5FDLB 4DR5J 5CZXA 2PSZA 5IWAF 3HHLB 2PA3A 4JI3J 4KBIA 4OMFG 3LO3A 2XB2D 3K5PA 2J6TA 4DQQA 4F26A 2WW4A 2BE2B 2V67A 4UQTA 5I3UA 2K8GA 1TKTB 4HL9A 2A2DA 1YJWS 3I4PA 3W5XA 2IRUA 3KYLA 3BQ0A 1H38A 2MKHA 1GMWA 2C2ZB 3IFEA 1KTQA 3TEGA 1SL0A 1F0XA 3MUMP 2AQ4A 2G13A 2FC8A 2W7PA 1RT3A 1XMQJ 2F7VA 1NKEA 1U8WA 4LFAF 1S12A 3TQ1A 3N0VA 5D0GA 5BXIA 3CJRA 3JQJA 3OTOF 4R8UA 5HQMA 5A6WA 3ILLA 2JHEA 3DXSX 4JI4J 3HX9A 2A2CA 3KMQA 1D9AA 4CLSA 1T9VA 1H2UX 4Y2CA 1KFSA 1Y5LB 1ZA1B 4F25A 2CG8A 2EFQA 3MAAB 1TKDA 1D09B 1UKUA 4FVCA 3THPA 1QSSA 2NYIA 1RHKB 2OPSB 1NZAA 3WBZA 1D1UA 2R7RA 1KOOA 3D0HE 3QFWA 1IKXB 3UR0A 3OV7A 3HJVA 4G6VB 4FF4A 4YB5A 3KJNB 2PT0A 1C1BB 3M6UA 3V6DB 2CQDA 2EK6A 2D3OR 3PJWA 1RI7A 4DUTA 1TFYA 3GFZA 3MAQA 1VLOA 4RW6A 3BB5A 1XBWA 3KUHA 4DZ6A 5GAHI 3KJFB 3PVXA 2BKPA 1YQHA 2KXHA 2K06A 3W1YC 2C42A 2DITA 2VG7A 3T19A 5KFTA 1NSKL 3JSMB 2KXNB 1GXTA 5GADU 1K8AT 2QE5A 1VRUB 5THWA 2BJDA 3CO9A 4FPRA 1WC1A 3UD5A 4O4GB 4ELVA 2ZJQQ 4B3SJ 4J7CA 2KHCA 5D0HA 4BC7A 4DL5A 1NXIA 4M5KA 5E3RA 1U49A 4DPYA 3TAMB 3HP6A 2ASJA 3ZZZA 4KO0B 3UR3C 1SIZA 3PYEA 3DRRA 1NM2A 1UL3A 1AYEA 2VPYB 4DDFA 3CDUA 1TMMA 2CZVC 3T5HA 4WXOA 1G7CB 1M0SA 4GC6A 2UZAA 5GAGU 3RBEA 1N5YA 2RHSB 2KH9A 4USHA 1H2TZ 2PMZD 1APSA 1R3NA 3AQPA 3Q8QB 2Z2YB 4FYYB 4NYZA 4H4MA 1KFDA 1ROFA 4ES1A 2OD4A 1SIWB 3IO1A 3LP1B 3PG9A 5C42A 4LF9F 3BS9A 3HLUA 2NREA 3CCMS 3ILJA 1TKXB 2BKOA 3DFEA 4YQWA 4AL5A 4N5SA 1JLAB 1FRIA 2GX8A 3KUGA 1YBTA 1L3KA 4U7UD 2GVDB 2DBBA 1UA0A 5KFUA 1SH0A 1Y3KA 1G4CA 1W25A 4U8YA 1T05B 5K8MA 3SSRA 4WWSA 4PRFA 3M2UB 1NSPA 1IR1A 1TMJA 4DR4J 2YXLA 2AEJA 1RE1B 2HVIA 3BDEA 1XN9A 4TY8B 1UJ6A 3SZ2A 1TK0A 1Q86T 1BLUA 2FYXA 1Q81T 1UEKA 5FIIA 1MU2B 2XULA 3CJ8A 4O44B 4DCOB 3H5SA 3BR9A 3ILIA 5A0YB 1M5VC 1HMVA 2CZ9A 2MQOA 5CYMA 4IH6A 2IC3B 2HRYA 3QGGA 1RT5B 1RWUA 3DGPA 1XC9A 1OPZA 4X4OA 1NDPA 2IDEA 4DQSA 1N32F 1TL7B 3EVOA 3DYAA 3C14A 3HHKA 3PY8A 1P6TA 1F9EB 4KHMA 4A8MP 4EBCA 1QSYA 4ZLLA 3OTEA 3OJUA 4GKKF 4L75A 1U8SA 1RT7B 4P75A 2RUSA 2L9NA 2GCFA 3GJRB 4LSLB 2LU1A 1B70B 1P1TA 2VBZA 4PG8A 3QIPB 4AT1B 1RT4A 3OL8A 3PZPA 2UV8A 2AYGA 1WC4A 1HW9A 4W90B 4USIA 1S77D 3V81A 1BQMA 4GKJJ 1PIEA 4AD6A 4HTIA 4GO7X 4ANCA 4DV5F 2OHDA 1HR0J 5D4NA 2P2CB 1B0PA 3Q8PB 1OY9A 4F3OA 2PC6A 3KWMA 5F3TA 1MN9A 2FGOA 1KOHA 1WOPA 3IAM9 4JB8B 1KONA 2EFNA 1QVGR 4KTQA 2UXDF 1RU2A 2XMWA 1KVIA 2MQNA 1ZPWX 1X9SA 4IG3A 4ID5B 4N8OA 3ILOA 4C6AA 1U1RA 4PYAA 5AJ3F 1MWQA 1C0TB 4X62J 4EMDA 4LFBJ 4CRJA 1JKHA 2HIQA 4EYHB 4ECXA 2NPIA 2VQEJ 4C97A 1EB0A 2CQ0A 2VBYA 1S7HA 4RW4B 2QYCA 3CD6S 3EZUA 4RW7A 3CWJA 1CJVA 1UUJA 1YI2S 2UXBF 1QSLA 2W7AA 5HP1B 4HACB 3A8JA 3CJQA 3EM1A 1S1VA 2YWEA 4KRWA 2AEMA 3BH7B 3AXKA 2QSWA 1NBEB 3RZAA 1SKWA 4NE9C 2A3JA 3PO4A 4CM0A 4LBPA 1LW2A 3NAIA 2G4BA 4ZDNA 4LF8J 1TZ0A 3ENAA 2DHSA 3GYGA 2ADBA 4IFYA 3J81Y 2ZOFA 2UUCJ 3GYXB 2GW8A 4MMOA 1LWEA 3DDKA 4F8RA 4Y2KA 3MEGA 2IM2A 1DY3A 4IDKB 1WF0A 2XZTB 3IS9B 2PO4A 4B9VA 4OZ1A 5L1IA 2MLXA 4OYZA 4DR2J 1ELOA 4DMZA 3ULHA 1F60B 1P9QC 2BVZA 4OIXA 2BABA 4DV3J 3E01B 2MTLA 2ZC3A 4D3HA 5IT9U 4CO1A 1X9WA 3GTYX 2ROGA 1D8YA 2XI3A 2NSBA 5KFJA 2HNZB 2ACMA 1Z2LA 2VG6B 1IKWA 3HDSA 1ZYQA 2UVWA 1FE0A 5IM0A 4QIVA 4C8ZA 3K58A 3MURP 2VF3A 2HZCA 2B51A 2F8MA 3C6TA 2HHSA 1GT8A 4X4RA 3VAMA 3MM7B 3EE3A 4DSFA 2UU9J 2E1CA 5J2QB 4OLPA 2NXUA 1YRXA 2P8IA 9ATCB 1VDHA 4K7QA 1MWZA 5DGBA 1RT2A 1KBRA 4LMZA 4FVMA 3QO9B 2CNLB 2WBRA 1B3TA 4FP9A 4A8FA 3RTVA 2J7KA 4P9SA 1EZZB 2R7SA 2BA9A 3NGKA 1RTDA 2YNGA 1V5VA 3CE8A 1M5KC 4ZP7A 3CJ4A 4KGKA 3I5AA 3MMCB 2IVMA 4P52A 1Q79A 2O67A 1XWLA 3G4SS 2JNJA 1X4BA 4DLGA 3NGDA 5D6GA 2GHWA 2BKNA 1SQFA 5T7LA 2JSXA 1XMOJ 3W5YA 2XSFA 3T3FA 4Q0BA 1PCAA 4NA1A 2CPIA 2Y9HA 3MGJA 4MT1A 1TL1A 2XYPB 2U2FA 2M8HA 1RT3B 5F8MA 4WFZA 1QLNA 2L3MA 2X1GA 5DLFA 4X66F 4B3MF 2LDIA 1PG5B 3SBMA 1MMNA 2FQQB 2YX4A 3O8WA 4CDIA 3UDLA 1JK9B 5HVFA 3VALA 2Y1RI 3QT8A 3FCWA 4RNMA 4OHVA 2ZKUA 3IRXA 3QRPA 4WTOB 1H7WA 3M1VA 4OYAA 3HKZD 3TRGA 3EDQB 1LK7A 3FMBA 2Z2MA 3M32A 2LVWA 3KHHA 3TX8A 4PAAA 1JLCA 3NLCA 3CCJS 1Q5YA 3BJYA 2W8KA 2FY1A 5L8RC 4CT9A 5KG2A 1ZM2A 2KFZA 1NB2A 3IXQA 5J2MA 1S1UB 5C2GA 4Z7YA 1R0BG 3N6MA 2CDQA 3ETMA 4TQRA 1NDCA 1RA6A 5HVGA 3J7AN 3QBCA 3M8PA 3MHYA 4F0MA 4X4SA 4F2SA 3R8YA 3HVRA 1BHNA 1WSVA 4ICLB 4X4NA 1WI6A 2RQ4A 3BQ2A 3ZZTA 4RW6B 3PDNA 1B0TA 3CD5A 1U25A 1AB8A 3UVJB 1RT1B 2MKKA 1O5JA 1L3TA 2W2OP 4MAKA 4IO9Q 3CJ5A 3WIVA 2BZ2A 2K1RB 3A3OB 3UFCX 2G1HA 3NWGA 4ZK7M 4EYIB 2DR8A 4N56A 1SQGA 3FUYA 2W7OA 4KPCA 5ETLA 5CA5A 4ED8A 2XMAA 1PYOB 1NJYA 4FBUA 1SV5A 1M5SA 4U7UK 4ZJLA 2HQ3A 3N9UC 2W2PP 3RBXA 4J9PA 1NUEA 3ZZUA 1NH8A 1FEHA 3VCDA 1S1XA 3RBDA 1RWMB 2RIJA 3ADAC 1N5YB 1VOMA 4IFVB 2SXLA 5CCMA 4LF5F 3I96A 4DL0C 3W9JA 2JLGA 4G1QA 2CWXA 4K8RA 1OS5A 2X3GA 4PZVA 1WORA 1FKAF 3OFEA 3IWXA 5DDRC 1Q53A 2RQKA 4U8VA 3ZZPA 2BJ8A 5LXRA 4DV0J 1N5SA 3KLGA 1MLAA 2KN4A 2R3VA 3KK2A 3CT9A 2IPOB 4ZVTB 4P6QA 2XNRA 1GFWB 3W2VA 3OL9A 4QR1A 3PX6A 1VQLS 3R5AA 3R7SB 3LOUA 1A6LA 4I6YA 1ULRA 4Y6IA 2M2BA 4K0KJ 2YWKA 5KG1A 2G0IA 4DSKA 1U1KA 4OX7A 4H54A 3TZZA 2A18A 4URSA 1S0VA 3OVBA 4J9VA 4ZIWA 3LW5C 2QFJA 5HJYA 4GC7A 4XDCA 1YGYA 3D3CJ 3SMZA 2HNYA 3M6WA 2GJ2A 1NH7A 2HQFA 4P2XA 2HHXA 2IY5B 3MCMA 1FKPA 3BBBA 2D74B 4ECWA 2PI4A 4DV7J 3PHTA 4AQYJ 2RKIA 3FJ2A 4HDGA 3DLGB 1DTQA 1HMVB 4CO4A 2ILZA 2MZRA 2O5DA 4CO2A 2WK4A 1R0AA 1HKAA 1KWMA 1T03A 2XWXA 4F04B 2LEBA 4B9NA 2B4PA 2P6TA 4JV1A 2QGFB 2DPJA 4U67Q 1U4BA 1S6OA 2HVDA 1MROB 5G0RB 5J2PA 3FSIA 3T5LA 2MLZA 3LUYA 4Q43A 5C7PA 4DL4A 2V1SA 4CNZA 4USVA 2Y1JA 1EHWA 2U1AA 4G65A 4C3KA 3KLEB 1IBKF 5C5JA 3BKFA 2E5IA 3ET6A 2HAFA 3TNVA 4WYLA 1TAQA 3HSJA 4OJ3A 5KFMA 2PMHA 2XMMA 2HWTA 2RU9A 2KT5A 1BQMB 4QWCA 1IWAA 1RISA 2IHR1 2V2VA 3P5TL 3TA0A 5LSOA 1HBUA 4IG0A 1U09A 1BQXA 1WKJA 3OFFA 4YDDB 2OP5A 5KT7A 4Y2AA 4C8KA 1RAHB 3SCKE 1T02A 4DPUA 3GR0A 3CSKA 1FHTA 2B6AB 2P9GA 2KXFA 1QAXA 5K8OA 1EKRA 3GJSB 1VHIA 2DGWA 4TKTA 4WFNQ 4A46A 3IAS9 3U02A 1RT6B 2V8DA 3AD7C 4DUYF 2ATCB 4QR0A 1ZZNA 4NLUA 5CXTA 1S4FA 4USKA 1NPPA 5K5MA 4DPWA 2KM8B 4JI2J 2KDOA 5IC6B 2YNFA 4RW7B 2I0XA 4RBTA 3J7A1 1D3WA 3IGNA 2V68A 4DQRA 3AD8C 4NCBA 4K4XA 5HSPA 1AUDA 4X65J 1JB0C 1QAYA 3AWRA 2MYFA 1C1CA 5F8JA 1B7YB 1LW2B 4ZPBA 5AXKA 4OX9F 4ZPCA 3MEEA 2C2RA 1N6QB 1UVIA 5JXSA 4U95A 2HHVA 1OM2A 2EG1A 4C8NA 4K5SA 3A3NB 1R31A 3CCWA 4IRKA 3V4IB 4QYRA 1ZM3A 1U2RA 1SC4B 5M2RA 2KKHA 4ZCKA 3RYLA 3GCWP 4RZRA 5DO2A 1IBLJ 2QJ3A 1NK9A 2Q6BA 4CTAB 1UMJA 4KSEB 1LWCA 2MZJA 3CDEA 2YKNA 1NJZA 1IJEB 1Z4UA 1O0PA 1B0VA 4LSNB 4ZP6A 2F4VJ 1XNQF 3TJ9A 5F8IA 1G3OA 5DJBA 3D0IE 1MG7A 2CUYA 4FXDA 1HBNA 1SUQB 1E6VA 4YHHJ 4DR1J 3W65A 4FYDA 1UWBB 2WZ1A 1UCNA 1KLNA 4RJVA 3MUVP 3F56A 1N56A 2FGCA 4BS2A 4LQ3A 1C2PA 1PGZA 3DOMA 3MM9A 1KVKA 2M0GB 3KLHA 2EBEA 4XPEA 6FD1A 2XTDA 5KG7A 2W2MP 2K7KA 3CCZA 1WACA 3OXLA 1LEOA 3KLIB 3TA1A 1H7XA 1FRHA 3IBWA 3HI9A 3PEHA 3P8BB 3ZNUA 4KHPJ 4TY9A 2V1TA 4EZ6A 3CCQS 3BN7A 3N5FA 4WKRA 1FRLA 2JZ5A 5T7LB 3Q8VA 3T9NA 4E8UA 1QTNB 1PAUB 2HS4A 4MYTA 3DOLB 3JTNA 2EWHA 1W26A 3MEDB 2AF6A 3O6QA 1TL1B 3WC2A 5HQLA 3TUJC 1JLBA 2YKMA 3WX8A 5B7WA 3TARA 3MM8B 2ATLA 4ES2A 1J5EF 4DR7J 2QFIA 2CJBA 5KFSA 2A10A 3MECB 5L38A 3MMBB 1FFGB 2HVHA 5CQGA 4Y28C 1VQNS 3GB0A 2QLXA 2VC1A 2LKZA 3W66A 4A47A 4L3KA 5KFFA 3QAEA 4AL6A 1J5OB 1AXQA 3FQLA 2XY5A 5F9NA 4A8XA 1IBMJ 4QYZJ 1GTHA 3T1YF 5CHCB 4CQ1A 4N77A 2DNOA 3TQEA 2HFZA 3TZYA 3QRRA 2B5JB 3FFIA 2XLJA 2VICA 5ETMA 4JI7F 4NXNF 4QIGA 1WC3A 4DUZJ 2VQFJ 3G8QA 4EO8A 2G2YA 4ZITA 1GNKA 4IR9A 1YLXA 1FI4A 4TYBA 4DV4F 2J5AA 1HA1A 1OMSA 4URGA 2AYMA 2C28A 2YNHB 1AZSA 2JWNA 1IXKA 1SC1B 1WC5A 2K7JA 3QLHB 2EKNA 1PKUA 5JJBA 4CO0A 2FVQA 2DNPA 1NAQA 2GHVC 4RUHA 3IWNC 2YTCA 1HI0P 2MGZB 3Q23A 2YX7A 3V6JA 1CJUA 2GJFA 2AYEA 1S9EA 2NPFA 1FXDA 1RXOB 3LGHA 3I0SA 2HLUA 3NL0A 2O66A 2XLIA 5HN0A 2UUAJ 1B64A 4Q2MA 2DEJA 2C1EB 3D1HA 4MKYA 3Q8RB 1IUJA 4X64F 3LWLA 4OYMA 4LF1A 4CYUA 5RUBA 4DWIA 4LBHA 2KTQA 5JUMA 3Q8SB 2BR0A 4UW2A 1Y7PA 4ZPDA 2YNIA 2ZM6J 1VBYA 2IYIA 2CJKA 1HD1A 3GJQB 4WZQA 1WHYA 4ED2A 4J37A 2B3TB 2QLWA 1UVJA 1WOOA 3PXGa 4FKXA 4NI2A 4PXDA 3HHEA 1XIQA 2IJFA 2QA2A 1F2GA 3D54A 1JJ4A 1F9HA 2BJ1A 5HBMB 1FDNA 1WF1A 2HK3A 4F2RA 5KG3A 3VGTA 4L76A 1ZZFA 3BYPA 4DR6F 2E9ZA 3MPWA 1JLFB 2J9DE 4WFYA 4X4UA 2G9OA 4FNIA 4DV1F 4KT0C 4L6V3 3FEYB 1RSCA 1EX8A 4F36A 1UWAA 3FBEA 2GAHC 2IMOA 3TR5A 8ATCB 4FPIA 4ATNA 3FCVA 1ZETA 2WVDA 1FD8A 3KXDA 3ZTOA 3KJVA 2HWIA 2R8HA 4KV8A 1NPKA 2DO4A 5HQ8A 3AX5A 1BWVA 1AFJA 3QWUA 4RX6A 2HNYB 1CJTA 2J0QD 5KAKA 2AP6A 1FKPB 3W62A 1R43A 2ZH7A 3PX0A 3RW7A 2GQ2A 2FVRA 2HURA 2CQBA 3M30B 1DTQB 1FJCA 3KOAA 1R6VA 2VODA 5ETNA 2AEFA 4KGZB 2E66A 3N01A 4IKAA 5KOXA 3AOCA 2Q79A 2ASLA 3PEJA 4C48A 5AE1A 2BXJA 1C4CA 2LU2A 2XMKA 2BV3A 3CCLS 4L73A 2Z2ZA 1CJKA 4FZVA 2J9DA 5A8RB 3D9BA 1VC5A 4UF4A 4JI0J 4O0IA 2LXIA 1R8AA 3ET6B 4J9UE 5B0CA 2R7XA 2QX0A 3CC4S 4FBTA 1I1GA 5C25A 4ZHRA 2AIRB 2PA8D 4ELTA 4NWBA 1RJJA 4NASA 3DGVA 1R6YA 3OHBA 3MR6A 1OJ4A 3T9ZA 5A2QU 4M5DB 1Y5NB 3HSZA 2FHJA 4A4JA 5IQQA 4WKYA 1MMLA 2CPEA 3LP2B 5LXYA 2UUBF 2GMJA 1S57A 2DHGA 1U48A 2V8VA 2CPJA 2MEWA 5GMKa 2ZE2A 2HIYA 4W92B 2XGPA 3CJ0A 1SBRA 2FVSA 1X4DA 4ALZA 3G96A 3VAJA 2AKWB 3CCTA 2XBPA 3SQOP 1Z1ZA 2DHXA 3PYDA 1JQGA 2DXFA 1S99A 1QUPA 4KIAA 3M8QA 2WONB 3OFGA 4WTYA 1F5AA 3ZTSA 5E7OB 4LFAJ 4ZP9A 3BN4A 5KTQA 2CJ9A 3KUEA 3OTOJ 2RILA 2XLKA 4K50A 3WZ0A 3VQSA 4MK9A 2W9BA 1KS2A 1KRPA 3EPGA 2MZ1A 1LFPA 3VF0B 1T9XA 4ILRA 3TVYA 3QJJA 5KG4A 1H98A 5IV4A 3KG4A 2R8IA 5L9NA 4IH7A 3S1TA 3EGNA 4DFMA 3Q83A 2L9DA 3QQCD 2N4CA 4PXCA 1UP1A 2DGOA 3BSCA 5JVGQ 4CLUA 5LMUF 4LUBA 3KNGA 2I2YA 3G9CA 2G0CA 2I6WA 2W4DA 2YKNB 1N33F 3SYZA 1PYSB 2JL9A 3KHGA 2H5IB 1DZ5A 4LT6A 1S6QA 3NNCA 4OI6A 3CPWR 3BDPA 1Q78A 3J7YI 2CZ4A 3KLVA 5A8WA 3R1HA 4C8LA 4LFCJ 1FJGJ 4B08A 1Q4RA 3ISND 3SV3A 3BBFA 4JI4F 1IM4A 2CFXA 3JTPA 3BO2A 2BDPA 4JYAF 2J0XA 5DS7A 2OFGX 2HNDA 2UUWA 5E5NA 1PJ5A 4RO0A 1RBAA 2KVIA 4OZNA 2XSJB 4F4KA 1A0OB 4K59A 5ETVA 4JOUA 3KDOA 2DY9A 3NNHA 3R3TA 3NS5A 1VQ8S 5KFEA 3A13A 3OVAA 3ZXWA 3QT7A 4YY3F 5C24B 3NGRA 1S7IA 2Y1IA 3VVUA 1RAJA 3RAQA 1NK7A 3JQKA 3R27A 1F5BA 3EX7B 1SJFA 2C2DA 3I0RA 2LFVA 3LWMA 4N76A 2DKOB 2B7CB 1JLBB 2V4JA 2YKMB 4MIWA 4J9NA 2I9SA 2CAJA 3I5CA 3QAUA 3CD7A 2YQ3A 1PBAA 5BR8J 5DQHA 3OLAA 1NLKL 2AW0A 1IVZA 3ENVA 4GVBA 4QWAA 4E98A 2B9XA 4P73A 2IVYA 5KFOA 4MH8A 4NLQA 3LF0A 2WVBA 4A8SA 2N3LA 3S01A 1YRTA 1YWXA 4MTPA 1BWEA 1IKVB 2RQMA 5K9FA 2VFSA 1PC4A 4WK3A 2O1PA 2MKYA 1M1KT 4B9LA 3EDRB 3MF5A 4CM2A
chains in the Genus database with same CATH topology
3OQ2A 1YBAA 4A8KA 2A3JA 2ADCA 4AXJA 2XGQA 3PO4A 2F3JA 1KTVA 2DT9A 1LW2A 4USJC 3NAIA 2L48A 3MMCA 3E51A 5BYRA 2CQ2A 4ZDNA 3H8YA 1VQOS 1CC8A 1NO8A 3HT3A 2G4BA 1FJ7A 3K59A 1TZ0A 4AYBD 2DHSA 5D8HB 3O5TB 2IM0A 5D4LA 1KR4A 2V0NA 2GHPA 1YJTA 3RRKA 2OH2A 2ADBA 2DCLA 4IFYA 1S1WA 3SCJE 4YB1P 3DI6B 4NCAA 4L72B 1VS3A 2PDAA 2ZOFA 3GYXB 2GW8A 3J81Y 1MSWD 4NCGA 4MMOA 4QW9A 1LWEA 2MKCA 3L3CA 3DDKA 4F8RA 3FRZA 4Y2KA 5EWFA 2Q66A 3PIOQ 2AGOA 4DBQA 3MEGA 2IM2A 4IDKB 2DVIA 1NEEA 1RT4B 1WF0A 1L3VA 1Q8IA 1FDDA 4I4BA 3IS9B 4L3NA 2UVUA 2NQPA 2PO4A 3EZ5A 4WFXA 5KG0A 2HHWA 4B9VA 4NRTA 5LJ5Y 4OZ1A 1X4GA 1Y5IB 2LXFA 3POTB 5L1IA 3I82A 4U7CA 2OPPA 1ZH5A 1UETA 5D3GB 3S7RA 1HARA 3V81B 1HD0A 1ELOA 2OPRA 1JXEA 2DH8A 4DMZA 5DLGA 1HL6A 2MQLA 3ULHA 2NS1B 1N36F 3CCUS 2RSQA 5CZVA 1YHQS 1U2FA 1G2EA 1SC6A 1CEZA 1T94A 4NLGA 4IQXA 1F60B 3M2RB 1OSCA 3BO4A 1P9QC 4ILMA 1LW0A 2BVZA 4OIXA 4PUOB 2BABA 4O3NA 3E01B 2MSTA 1I94F 2XZ2A 2KFYA 5EX0A 3WC0A 4B02A 4F67A 1NJXA 2JX2A 2RF2B 3IGVA 3HFKA 3PRBA 2LQ5A 1RQ0A 4XDDA 1URRA 2ZC3A 4ZPVR 4D3HA 4CO1A 2JLFA 3R5DA 2XO7A 2ZOGA 1X9WA 2ROGA 3DRSA 1D8YA 3THTA 2XI3A 3NBPA 1C0UA 2NSBA 5KFJA 4TLQA 3M2VB 3SFUA 1R89A 3H5YA 3D0GE 2HNZB 3OR1B 1Z2LA 1ZTWA 3K5NA 2VG6B 1VQMS 1EETB 1NNDA 3ISNC 1GX5A 3B4MA 5KT3A 1QUVA 1F9FA 2V5HG 1TK8A 1IKWA 2V4JB 3TANA 3FCHA 1S9GA 3CULA 3PV8A 3HDSA 4IG3B 1ZYQA 2UVWA 1FE0A 2FLOA 3V6KA 5IM0A 2HFOA 4QIVA 4C8ZA 4PG4A 4QPTA 5I4MA 3K58A 4QWDA 1RYSA 3VZIA 3MURP 3T6JA 1PC5A 2HZCA 2POKA 4I69A 1WG4A 5KFAA 2B51A 2F8MA 3C6TA 2YH0A 3MMAA 1QE1A 3EGZA 1JKHB 5FD1A 1S1UA 3PFOA 4WU2A 2HHSA 4WYWA 3LH2S 4OX8A 2LLZA 3ENQA 1GT8A 3UE2A 4X4RA 3VAMA 4NLPA 3MM7B 4ECQA 1N5TA 4DSFA 2HGNA 2RVJA 2E1CA 5J2QB 4OLPA 4DR4F 2NXUA 1YRXA 5DM7Q 3GV8B 4DL3A 3H98A 2DTJA 4BC9A 5J1PA 4I68A 4RUCA 3PW4A 1XR7A 4QU7A 4NLYA 4JBCA 4CNYA 1MWZA 2DGUA 2ZKTA 4Q8FA 2R7VA 4TN2A