4R0EA

Crystal structure of the poliovirus rna-dependent rna polymerase low-fidelity mutant 3dpol h273r
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHRLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
publication title Structural Dynamics as a Contributor to Error-prone Replication by an RNA-dependent RNA Polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
total genus 141
structure length 461
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4r0eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r0eA02
3VQSA 2ALZA 1EP4B 2UVVA 5KT7A 1JLBB 2VG7A 4FS2A 3RB4A 5KFQA 2IMWP 3IGVA 4K4ZA 4ZP6A 1TL1B 2JC0A 2QV6A 3EZUA 2XCPA 2FJWA 2UVWA 4WZMA 3DMJB 3HVTB 2IM0A 3CJ5A 2R2UA 2C22A 3LP0A 4KFBB 4YR0A 1N6QB 2YKNB 3IRXA 1RTHA 2IJFA 4ZVGA 4ZVFA 1D1UA 3QZ7A 3KK3B 2FVRA 4KO0A 2FVSA 3OL7A 4IG0A 3MR6A 1K1QA 1C2PA 3FRZA 4ZHRB 4LSLA 1TL3A 2XI2A 4ZVHA 3KK2A 5J1EA 1FKPB 4F4YA 3H59A 4ECQA 2BQUA 4K50A 4M94A 3E01A 1TP7A 2B5JA 1C0TA 2GIRA 4TXSA 4H4OA 1RT5A 3NKYA 4DEZA 4H4MB 2YNIB 3ITHB 3UR0A 3MR3A 3T5KA 3V6DB 4PQUB 5J2PA 1IKWA 4J9PA 1GX6A 4J9LA 3FFIB 4TQSA 2IM3A 3DM2A 3DRRB 5KFEA 2ZE2B 4NLVA 1TKXB 2J6TA 3DOLB 1LW2A 4MKAA 1RT3A 4QWEA 4RNNA 2D3UA 5KFZA 4QWBA 3V81B 2AGOA 3N6MA 2I5JA 2HAIA 2HNZB 1S0OA 2AX1A 5KFWA 4MIAA 4R5PB 1S4FA 3N6NA 3KMSA 1BQNB 3TAMA 2VA2A 3DI6A 3LP2A 4MK8A 1C1BB 2RKIA 5KT6A 4Q0BB 1GX5A 3KHHA 2HNDA 1ZTTA 3BSCA 3LANA 1R0AB 4URGA 1TKZB 5F8JA 2VG6A 4ECZA 4F4WA 2AGPA 4IRDA 4NLUA 4Y2AA 5L1LA 2VG5A 4O3SA 3T5JA 4Q8FA 3PW2A 4HKQA 2UUWA 4RW4A 4KKOB 2RF2A 1KLMA 1TQLA 1HARA 1TV6A 1LWEB 1HPZB 1NHUA 2YNFB 1NHVA 4TLRA 4EBDA 4ED7A 4EBEA 4JV0A 4Y2CA 3D28A 3OHAA 2V4RA 1QAJA 3GV7B 3G6XA 3PJWA 2VA3A 2YNHB 3PR4A 1D0EA 2YKMA 2UVUA 4RW7B 3GIMA 4K4YA 1HQEA 5I3UB 1LWCA 4DL6A 3RBDA 3GQCA 3M8QB 4WYWA 3IGNA 4K4VA 2W9CA 5J2QA 2HMIA 5K14A 3DDKA 1RT1A 5C24A 2BANB 4LQ3A 5F8NA 1REVA 4MFBB 1LW0B 4ED1A 5J2NB 5C42A 4ECSA 3H4DA 5KFMA 1T94A 3DRPA 2WCXA 4R8UB 3KK1A 4NYZA 1K1SA 2FVQA 1RT6A 3I0RA 3NAIA 1SUQA 4H54A 4ID5B 3NMAA 2YNGB 2R8GA 2AU0A 5C25A 4QWAA 3QLHA 5HBMA 2UUTA 3H5SA 2VG7B 4Q44A 5L1IA 4NRUA 5KG7A 1ZTWA 5KFBA 1S9FA 1QUVA 4IDKA 5KG6A 3M9MB 2DPJA 4RW6A 2XCAA 3ISNC 1JLFA 4QW8A 1CSJA 5KFGA 3LP0B 2R2RA 2JLEA 3IRXB 1RTHB 2D41A 3MF5A 5JUMA 2HMIB 3OLAA 1KHWA 2V4QA 1RYSA 1IKVA 1XR7A 5KFXA 3BGRA 3DLGA 2V9WA 4KO0B 2ASLA 3CO9A 4ZPCA 1YVFA 4IG0B 5EDWA 2HNYA 3GIJA 4LSLB 1TL3B 4TYBA 3KK2B 1RT4A 1MU2A 5J1EB 3MFIA 3LAKA 2B43A 4NLOA 5L1KA 5D3GA 3RB6A 3E01B 2JEIA 1SH0A 2B5JB 1C0TB 3C6TA 3FQKA 3QZ8A 1J5OB 4H4OB 1RT5B 5KFAA 3V4IA 4ED6A 1S6QA 1S1UA 4X2BA 5CYMA 1S6PA 2IA6A 4OL8A 4I2QA 3KJVA 5J2PB 1IKWB 3SI8A 1RYRA 1EETA 2OPSA 5KG4A 1N4LA 3QIPA 3PZPA 2QE5A 3DM2B 4Q43A 2EC0A 3HVAA 4IFVA 4MIBA 3DOKA 1S1WA 1SH2A 1LW2B 1RT3B 4ECUA 1JLQA 5KFNA 5KT3A 2I5JB 2BQ3A 3MEDA 5DLFA 3KLVA 4KHRA 4NLXA 4ZP8A 3D5MA 3TAMB 3DI6B 1VRTA 2E9TA 2RKIB 3LP2B 4ECWA 1HQUA 2HNDB 4M95A 2R8HA 4KB7A 5F8MA 4NZ0A 2VG6B 4FBUA 3CJ0A 4NLQA 4EO6A 4ECVA 3T1AA 3QGGA 5KG2A 3PR5B 2VG5B 2FLLA 3BQ0A 2F8EX 4LSNA 3QO9A 5DLGA 1HNIA 3CJ3A 4DG1A 4RW4B 3KLEA 2RF2B 1KLMB 1S1VA 4RNOA 1TV6B 5KFJA 4J9NA 1JLAA 3Q8RB 3H4BA 3LP1A 3GIKA 5DQHA 5DQIA 4NRTA 3H5YA 2YKMB 4PUOA 3KMQA 3PW7A 3RAXA 4Q45A 1HQEB 3M9NB 1LWCB 3GV5B 2XGQA 3DLKA 2FVCA 4I7FA 5KFUA 4TY8A 4WXWA 5KFVA 3H2LA 2IM1A 3HKWA 1S97A 2XWYA 3RBEA 2BRKA 3PJXA 2W9CB 5J2QB 1IKXA 5L9XA 1RTJA 1S49A 5K14B 4ED3A 2IM2A 4NLRA 2DPIA 1RT1B 5C24B 1N48A 2HWIA 1REVB 4WYLA 5KFLA 2W8KA 1JX4A 5EWFA 5C42B 2XC9A 2OPQA 3IG1A 3DRPB 3KK1B 3KLHA 1RT6B 3I0RB 5JXSA 5F8GA 1SUQB 1T05A 3JSMA 1HNVA 3UPFA 1BQMA 2WB4A 1C1CA 3QLHB 5C25B 5HBMB 3OL8A 4RNHA 3KHLA 2R2SA 4KSEB 4QWDA 1XR5A 1TVRA 4NLTA 3H98A 4IDKB 4G1QA 4RW8A 4RW6B 4O44A 4TN2A 5F9LA 2ASDA 3OL9A 4FBTA 3RB0A 3RAQA 1JLFB 3CWJA 4I2PA 5KT5A 5HLFA 2BE2A 3HVWA 3NGDA 1C0UA 3T5HA 4O4RA 4K4WA 1IKVB 2IC3A 3BGRB 3DLGB 5EWEA 4J9OA 4F4ZA 4DL2A 2FLNA 2W9BA 2V0NA 4DL7A 4R0EA 3LALA 2HNYB 4KHMA 5F9NA 5DG9A 4MKBA 1RT4B 1MU2B 5D3GB 2R2TA 4KV8A 2JEFA 3C6TB 4MK7A 1LWFA 3V4IB 1S6QB 1S1UB 4WE1A 3CDEA 5CYMB 3KHGA 3H5UA 2ZD1A 3IS9A 4I2QB 3KJVB 2FJVA 5C5JA 1EETB 2OPSB 1RDRA 3QIPB 3T5LA 1S10A 4IFVB 4O3PA 3CJ2A 3G86A 3DOKB 3I0SA 3GILA 5KT4A 3DRSA 4KBIA 1S1WB 5KFTA 1JLQB 1J5OA 2J6SA 3PW0A 1FK9A 1QE1A 4O3OA 3H5XA 1S9GA 2CJQA 4RNFA 3MEDB 3EPIA 3CIZA 5KFRA 2W7OA 1JLGA 3OHBA 4K4TA 3BSNA 4WXOA 1FKOA 1VRTB 2W9AA 3KHRA 1RA6A 4MK9A 1HQUB 3CDUA 2BRLA 3LAMA 4ZPAA 4IFYA 4O3RA 5KFIA 1RA7A 1IKYA 1N56A 3OSPA 5L1JA 2W7PA 4WFYA 4IOBA 1S1TA 2I1RA 3QGHA 3GYNA 4RUCA 4LSNB 3QO9B 3H40A 5HP1A 1KHVA 4NLSA 1HNIB 4DG1B 3QIDA 5DQGA 5KFDA 3KLEB 2W8LA 4ECYA 4NLGA 1S1XA 1S1VB 1JLAB 3V6HA 3T19A 3LP1B 3PHEA 3C6UA 2FJXA 3KLFA 3N6LA 1JLCA 2IAJA 3M8PA 2HWHA 4ED8A 2C2RA 2JEJA 4XPEA 1SV5A 2XI3A 2FLPA 4PUOB 3NBPA 5F8LA 2WRMA 3JYTA 2ILYA 1UWBA 3EPGA 4YP3A 3DYAA 4B3OA 4ICLA 5J2MA 3DLKB 4I7FB 4NCGA 4QPXA 5KFCA 4RNMA 1WNEA 4TY8B 2C2EA 1T03A 4EEYA 5I42A 4HYKA 3ISND 1IKXB 1RTJB 1N5YA 3OLBA 3OL6A 3MR2A 3KLIA 2UVRA 5DG7A 3Q8SB 4URQU 1W25A 4YR2A 1OS5A 4IQXA 2OPQB 2WONA 3IG1B 4RU9A 2E9ZA 4ZPDA 1S48A 5KG3A 3KLHB 3MEEA 4J9QA 4YMEA 2J6UA 2AGQA 3MFHA 1T05B 3JSMB 4U7CA 1HNVB 4Y3CA 1DTQA 2AX0A 4RUAA 1BQMB 3FSIA 1C1CB 4MH8A 1DLOA 3TVKA 3KNAA 1TVRB 3I5BA 4RW8B 4G1QB 2GIQA 5HROA 3BQ1A 4O44B 4RZRA 3KLGA 2C28A 4IR1A 2O5DA 2RDIA 1RT7A 2CKWA 4I2PB 4IH7A 2RDJA 1JLEA 2BE2B 5HLFB 1C0UB 4ED2A 4RW9A 5FDLA 5DG8A 4ZVEA 4Q8EA 4IR9A 2JC1A 2IC3B 2OPRA 3FQLA 1HMVA 2W9BB 2ZKUA 3CVKA 3G6VA 1JXLA 1S0NA 4O3QA 4IRCA 3NAHA 3BQ2A 4F50A 3NL0A 4U6PA 3BSAA 4QW9A 4KV8B 5F8HA 1U09A 2WK4A 3MECA 4NLDA 3OSNA 2BR0A 2E9RX 4O4GA 1LWFB 3CDWA 3BSOA 1Z4UA 4WE1B 3G6YA 4IKAA 2ILZA 3DLEA 4DL4A 3PW4A 2C2DA 1NNDA 2ZD1B 3IS9B 3UQSA 3FDSA 1RTIA 4EBCA 2OPPA 1TKTA 3PW5A 4PWDA 3I0SB 4IH6A 1HYSA 2AWZA 3DRSB 4IH5A 4TY9A 1XR6A 1JKHA 3SFGA 4JV2A 1FK9B 1QE1B 1S9GB 1RTDA 3E51A 4EO8A 1JIHA 2B6AA 4XO0A 4QWCA 3GV8B 1DTTA 4F4XA 1JLGB 1FKOB 2ATLA 5CYQA 2WTFA 2R8KA 2AQ4A 4WFZA 4IG3A 3MEGA 1RT2A 1S9EA 4IFYB 1VRUA 1IKYB 2WOMA 1EP4A 3BR9A 2ASJA 1S1TB 1JLBA 5HP1B 3ICLA 4EYIB 1TL1A 4ZPBA 1S1XB 4ZMMA 5KFPA 3DMJA 4K4SA 3HVTA 4JV1A 3MR5A 4ED0A 4JUZA 4KFBA 1N6QA 3C6UB 2YKNA 3KLFB 3V6KA 1JLCB 1MMLA 2IAJB 3M8PB 5DGBA 1SV5B 3CJ4A 2WHOA 4TYAA 4J9SA 1S6PB 3NBPB 3KK3A 3JYTB 4B3OB 1UWBB 4EYHB 1QAIA 3DYAB 4ICLB 5J2MB 4NCGB 5EWGA 3GIIA 4ZHRA 1RAJA 1T03B 5I42B 1FKPA 4ECRA 1N5YB 3BREA 4DL5A 3RB3A 1IM4A 3I5AA 4IRKA 3KLIB 3MTKA 4H4MA 3V6JA 1SH3A 2D7SA 4K4XA 2YNIA 4WZQA 3ITHA 3V6DA 4PQUA 2WONB 4KE5A 4ECTA 3FFIA 3MEEB 2JEGA 3DRRA 2FVPA 2ZE2A 1DTQB 1TKXA 3DOLA 4O3NA 3QGIA 4URSA 3V81A 1DLOB 4FS1A 2XGPA 1T3NA 2HNZA 5F8IA 4NLYA 5HROB 4GC7A 3KLGB 4R5PA 1BQNA 1RT7B 2IJNA 1JLEB 1C1BA 5KT2A 4Q0BA 3TQ1A 4RW9B 5FDLB 5KG5A 1R0AA 3Q8PB 1TKZA 4KAIA 5KG0A 4J9MA 2OPRB 5DGAA 1S0MA 5T14A 1HMVB 4DL3A 4ZP9A 4YQWA 4K4UA 3HHKA 5EUHA 1I6JA 4KKOA 4J9RA 5KFFA 4TQRA 2BQRA 1LWEA 1HPZA 3MECB 2YNFA 5KFKA 4NLPA 5KFOA 4O4GB 3PVXA 4NLWA 3DLEB 2R8JA 2YNHA 5KG1A 3BJYA 4LQ9A 5KFHA 1RTIB 5KFYA 4RW7A 2OPPB 4ECXA 1TKTB 5I3UA 4PWDB 3M8QA 1HYSB 1ZETA 1JKHB 3M9OB 4ZP7A 3UDLA 3QYYA 1RTDB 3I5CA 4Y34A 3Q8QB 2BANA 2B6AB 4MFBA 1DTTB 4G3IA 1LW0A 2R8IA 5J2NA 3KOAA 2D3ZA 5KFSA 4XPCA 4J9KA 5CYQB 3SFUA 4YR3A 2GC8A 4R8UA 2IBKA 3IN5A 4IG3B 2OH2A 3MEGB 1RT2B 1S9EB 4ID5A 2YNGA 1VRUB 4WFXA 4GC6A 2WOMB
chains in the Genus database with same CATH superfamily
2MKKA 1UZDA 1FO1A 5KFQA 2H54B 5SUHA 2C22A 1EARA 1HNXF 2YKNB 4C4WA 5CD4H 4KO0A 4OI2A 3D68A 4ZLJA 2CNNB 2GIRA 4TXSA 2GS8A 2DITA 2EKNA 3QJJA 4N7TA 4J9PA 2ABYA 1F9FA 1R8HA 4X65F 4UY85 2G1HA 4YDDB 2D3UA 7AT1B 4N8NA 2AEFA 3OR1A 4DCJB 1NLKL 2Z8QA 3BSCA 4V19X 1FDDA 3W2VA 2W4CA 2ZFHA 2FHJA 2DVIA 1SPBP 3ZZUA 1Q8KA 2JNJA 3BGFA 2ACYA 3PJWA 4CLTA 4UT4A 1D0EA 2NXCA 1UVJA 1WG1A 3HD2A 2NR0A 3IGNA 3CPWR 1X4CA 2QT7A 4FPIA 3CCVS 2EKYA 1HHSA 4NYZA 5BYRA 1PYOB 4HTIA 1SQFA 4I4BA 3SCKE 2HZCA 4IDKA 2V9WA 3DLGA 2RD5C 3VAMA 2DKOB 3TAQA 3A8JA 1P27B 3MFIA 5B0CA 1PBUA 2QX0A 1I3OB 1FFSB 1C0TB 2YKAA 2PSZA 2X1FA 4KH0B 4MTPA 2MXYA 2HGMA 5CABA 4I67A 2QE5A 4IFVA 3HVAA 2ZHBA 1P1LA 2FYXA 4RBUA 3R5GA 3JSBA 4X66J 3DXBA 4ANDA 3BQ0A 1MN9A 4K5SA 1T7PA 1HI8A 3Q8RB 1H3DA 2KZMA 3H5YA 2YKMB 2LLZA 2V2QA 5L9XA 2RVJA 4WTOB 2HWIA 2WBMA 1R89A 2L3MA 4USVA 2RILA 4DHVA 3IG1A 4ZVTB 4HHUA 1TL5A 1U1QA 1RWPB 5FJ4A 2ZHAA 3PX4A 4NLTA 2HG4A 2N4CA 3SV3A 1T9YA 2FD2A 1AFJA 4K4WA 1JXVA 3S7RA 5D77A 4DL2A 5K8MA 1IWGA 4LF2A 3L9ZA 5DG9A 2KT5A 2ZBPA 1FFWB 2JEFA 1EKRA 1O6XA 3OTDA 1LWFA 4WE1A 1Q78A 3QIPB 1WC0A 3R5AA 4NXMF 3TUJC 3H5XA 2ZC3A 2BJ1A 4XAKA 3BSNA 1VRTB 3MPVA 4DFKA 4OZ5A 1RU1A 3Q22A 4DG1B 4B9VA 1PYSB 3KLFA 1WTBA 1WC3A 4N56A 1URRA 1HI0P 5J2MA 4I7FB 4B9LA 4LF4F 2IRUA 3RR8A 4OYBA 4YR2A 1OS5A 1REGX 1GK8A 1Q8LA 3BS9A 3AJ2A 1C1CB 1Y5NB 4ZLNA 2ZNZA 1UVKA 3KNAA 4O44B 3KLGA 1XWLA 2ZZTA 4I2PB 3U1NA 4ED2A 5DM7Q 2JC1A 3DC2A 1Q95G 4DV3F 3AOBA 3GJTB 1TL4A 3D4JA 2BOPA 3D6MB 1NH7A 1S59A 2NXUA 2X3DA 3MECA 4NLDA 2BR0A 4DR6F 3FJ2A 3BSOA 4QOTA 4QIFA 3J7YI 2CQIA 3IS9B 1S79A 2VICA 2IY5B 2CZVC 3A3OB 5SZTA 1S57A 3M05A 1HBOA 1S9GB 1F1BB 3PV8A 3TA1A 2R8KA 2KHCA 4DCOB 1NJYA 2KRBA 5L8RC 3FVYA 2ZM6F 4QZVB 5HP1B 1H2VZ 1LWXA 2B4VA 4JV1A 4QCLA 3HHLB 5F3ZA 3NNHA 4XDCA 5EWGA 4ZHRA 3UW1A 2HRUA 2ZWOA 3BREA 2CFXA 3SSSA 1WKLA 3CD5A 4DR5F 1IBLJ 3R3TA 3MD1A 2XGPA 2VFTA 1YLXA 1KQGB 1S0MA 2ZZMA 4ZP9A 4EUVA 3MM8B 4NLPA 2EG2A 2DHHA 3LOUA 3NCQA 3Q89A 3MZIA 4KRWA 1RJJA 1GMWA 2B6AB 2MZTA 1DTTB 4I6AA 4J9KA 1WDTA 4YR3A 2GC8A 3M6XA 2W1BA 3MEGB 1S9EB 2YNGA 4WFXA 4GC6A 4ZPWR 2Q6BA 3N9UC 2M7SA 2UXBF 1WG5A 2R2UA 1ZPWX 3HPOA 4LFAF 3QNWB 1NU4A 2C3OA 3MR6A 2YKPA 3G6ES 4C0OC 3SZ2A 2CG8A 4HVZA 1AFIA 4JI4F 4JI5J 4ZPVR 3VAKA 2GHWA 3HI9A 1TK8A 3V81B 2B8PA 2HNZB 4DFMA 4M5MA 3D7SB 2CZ4A 2X7IA 4Q0BB 4ALZA 4ECZA 3FEZA 4ETXA 2UUAJ 1U1LA 3PW2A 4YS2A 1U4BA 3UCZP 2XYGB 4RR5A 3S01A 1EAYC 3G6XA 2QMXA 3O1LA 5CXTA 2J9DE 2F5GA 1LFPA 4JI0F 4K4YA 1LWCA 1ZBTA 3FK4A 3VHQA 2VQFJ 2NPFA 1KFDA 3KG1A 1U6FA 3H4DA 4ILLA 1R8AA 4WP9A 2CUYA 2R8GA 5HBMA 3H5SA 5KG7A 2ADCA 4XIUA 4DL0C 3M6UA 2IVYA 1JLFA 3O44A 1CS4A 1IKVA 3WDOA 1U6ZA 3E8OA 3MTJA 1N5SA 3K7RA 1UVIA 2CJAA 2OPSA 5KG4A 2HIQA 4KGMA 1AXQA 2LQ8A 2W4PA 4P71A 2P9CA 2A2DA 3KLVA 2W25A 1X7VA 3EGVA 4DQPA 4KB7A 4NZ0A 1ROFA 2HBRB 4DBQA 4B9SA 4WF9Q 2HLUA 2LCWA 2JHEA 1ELOA 4LRCA 5DQHA 5IC4B 1HBNA 3M9NB 1RWXB 3H2LA 4OX7A 2FJBB 4NYPA 4DSLA 1REVB 2U1AA 2ZITA 2BVZA 3ONQA 3M32B 5JXSA 1UEUA 3UPFA 3ZNUA 2LXFA 3H98A 1VK3A 2AYGA 4LBPA 2EXUA 3BN7A 1W26A 3HZEA 2XBPA 5GAHI 4J37A 3TZYA 2MJNA 5F9NA 5IXUA 3FCHA 4B9NA 2DCUB 2IMOA 4LVNP 1Y5LB 3HT0A 1FEHA 2K2PA 3GMGA 1T11A 2DNMA 2EWHA 2XS2A 3MD3A 1S1WB 4FVCA 3CCJS 4L73A 1F2HA 3J7AN 3UN2A 3K0JA 1U26A 2W9AA 1ZYQA 3AX3A 3EDQB 3QGHA 1OSDA 3H40A 4MMOA 1BWVA 1RACB 2W8LA 4OJ1A 1SKUB 3TEGA 3H2VE 3J81Y 2MKHA 3CJQA 2BBEA 2OP5A 4IO1A 1RHRB 4HYKA 1MROA 1N5YA 4MKYA 4CH1A 2KG1A 5DG7A 2DK2A 4IYQA 2UUCF 1HNVB 4RUAA 3OTOJ 4MH8A 2OFGX 1FFGB 2DR7A 4DR1J 1X4DA 2BE2B 3K5LA 5DG8A 2GVZA 2BJ9A 3I31A 1NK9A 4QW9A 3EE3A 3AY0A 2CJ9A 2CYYA 2E9RX 3LWLA 5D15A 3UO0A 4MKVA 4B9MA 2JFDA 1KBRA 2XY5A 1KVIA 1FK9B 1VBXA 1XMBA 4QWCA 4RWXA 1X9MA 3K8VA 4KGKA 3RRGA 3C16B 1YSJA 2ASJA 1JLBA 4PXEA 2HS4A 4KFBA 1TUWA 1S6PB 3K17A 2YKOA 4ECRA 2YH0A 2KH9A 1IM4A 5EX0A 3NG8A 4RUBA 4J5OA 3KKFA 4AUKA 1U1NA 2DXEA 5HROB 2M4MA 1BQNA 4F0MA 2XZDB 4HHJA 2DRBA 2MSTA 5IV3A 5T14A 1V3SA 1YKWA 3UVJB 2CVIA 1PG5B 4O4GB 2J8AA 2R8JA 1Q81T 5KFHA 1LEOA 2DISA 4W92B 1CLFA 2R4FA 2MB0B 3ZFVA 1L3VA 4CWBA 3D3BJ 3F44A 2OH2A 4J9VA 1W2BR 2BA9A 1F2GA 1H6KX 5CHCB 1TU0B 3T1HF 3CCMS 4A46A 2XCPA 4A48A 5JVHQ 2WVCA 1XIQA 3T9NA 1R27B 3JXOA 2JL9A 2E5IA 4KHPF 4X62J 1N0UA 5E3QA 4CLZA 4PZVA 3MM7A 5MAOA 3KK2A 3UD5A 3R2CJ 1MN7A 4K50A 4OJ3A 3BH6B 1TP7A 1B7YB 3V6DB 3MR3A 2XY6A 4C3KA 4J9LA 3W9HA 3FFIB 2YX7A 3CCUS 2UXDF 2MLXA 4DSIA 2DTJA 1TKZB 2LQJA 4EK2A 2A10A 1EB0A 5IQ6A 2XMAA 1A7GE 1FDBA 2XQCA 3GIRA 2Y0BB 1T3OA 3GIMA 2QA1A 2KB2A 2OI2A 4RWWA 3R1LA 3DLHA 2HMIA 5K14A 2BANB 4X4TA 5KFMA 1BQXA 2BZ2A 2YWHA 3POTA 3DHWC 2BKNA 1ITPA 1BE4A 4RW6A 2M2BA 3KJFB 1N34J 1K47A 5KFXA 3TUPA 1HA1A 1TL3B 2HK3A 3CEDA 4OX9J 1H72C 2LEBA 4ED6A 1S1UA 1PILA 2C2KB 2RNEA 1IQZA 3QRQA 4M5KA 2CZ9A 3TW0A 3GG0A 4YHHJ 4X4QA 1EQ0A 3PHTA 3BEGB 2F8EX 2M88A 3IM8A 4RW4B 4ZVUB 4J9NA 1VQNS 2JJ4D 2KFYA 4Q45A 2XY7A 4KJIA 3DLKA 1KQKA 4ED3A 3BB5A 2F40A 3HJVA 2OPQA 1VQPS 5HN0A 2QLFB 2GNKA 1EX8A 1RT6B 1L3KA 6FD1A 5HMXA 2OEMA 4G1QA 3RB0A 3DDNA 1CC7A 2E29A 3CWJA 5KT5A 3ZTQA 3HVWA 1C0UA 3UN3A 4NE9C 3VTIA 5EWEA 3MM9A 3PRVA 4EGLA 4JI8F 4GKKJ 1RWWB 3BPSP 3AWRA 2RE1A 3ZTSA 3DXSX 1NSKL 4M63A 2ZKTA 2W2NP 3VF0B 1NPRA 3L7OA 3GB0A 5KFIA 1FRIA 1TZ0A 1S1TA 3CXCR 2D3OR 2V34A 1O51A 2QEXS 2IAJA 5B08A 1SV5A 2FLPA 1FJEB 1N5TA 1YBAA 3EVOA 3MM5B 1IKXB 3Q0AA 1N0VC 2ZH3A 4UOFA 4O23A 2EK6A 2V50A 3MUMP 3TP2A 2MTLA 4KYZA 2AYEA 2QC3A 4KC5A 1C4AA 4K2JA 2CPJA 1WACA 4Y2MA 5K8PA 1YRXA 2GQCA 2DXFA 3HDSA 1NAQA 4DV3J 2MHNA 2BYCA 4ZIWA 2MZJA 1WI6A 4M5HA 1FX4A 3TA0A 4RU2A 3FSYA 4IKAA 1NNDA 1U2CA 2JFKA 4C3MA 2AWZA 3CC2S 2XSFA 1QE1B 3MMCB 1VBKA 5IQQA 2Q66A 2ATLA 2WTFA 3FBEA 3M30A 2OEJA 2VKRA 2ZM6J 1YZ6A 3Q8UA 2PFFB 1DQ9A 2QLWA 4JB8B 1X5OA 3KK3A 1NO8A 1QAIA 3DYAB 1JJHA 4YB7A 4UY8T 1HR0F 4AE5A 2YPYA 3CJ8A 2YXLA 2DNRA 2DH7A 4CIOA 4KE5A 4EWTA 1TMMA 4DR5J 4X64J 2XYPB 1NK8A 1NCLA 1RB0A 2HQFA 1Q7YT 5J1NA 4R5PA 1Z2LA 4CNYA 4RW9B 2G13A 2CDRB 1TKDA 3CDAA 3TEHB 4K4UA 1CQMA 3SSQA 1A9NB 2M9KA 3PG9A 2DB1A 5DRKA 1E6YA 1V9OA 2DHXA 2HHWA 3M8QA 3JSYA 4Z7YA 2KM8B 1IN0A 2F4FA 3PXGa 2W2PP 1UJ4A 3RW7A 2MJUA 4R8UA 3UI3A 2WOMB 5THWA 1ZS6A 2UU9J 2UXBJ 4ZP6A 2IM0A 4FF4A 2EVZA 2EFNA 1UA1A 5H9FK 3GFZA 4ZIVA 2RUGA 4ELVA 1RKIA 3W8GA 5AT1B 4PXBA 1FKPB 2A2CA 1XMQF 1IVZA 5DS7A 1OWXA 1NJIT 2VBXA 4NLVA 2DIVA 3G4SS 2BJDA 1I5OB 4OFZA 1VK8A 2VA2A 2AJFE 1R0AB 2AGPA 2UV8A 5CQGA 5L1LA 2CQCA 4PPDA 4Y2CA 3HXMA 4WIIA 3PACA 1NEEA 3PR4A 3LGHA 3C14A 5LT5A 4JI0J 2E66A 7FD1A 3A8EA 5C24A 2OMLA 4LRAA 3O2IA 4ED1A 3J81j 2MKSA 2HFOA 3PNIA 5KFBA 3P5TL 1B0PA 3FEXB 3ZZRA 2R2RA 2JLEA 3IRXB 3TX8A 2V4QA 2IDLA 1G7CB 3QZ8A 5LMUF 2VQEJ 1S6QA 1FNMA 1S6PA 4I2QA 2VODA 4P2XA 3RTVA 2CPIA 3TX0A 5KT3A 5I4MA 1PCAA 3UDVA 2R7UA 2LU1A 2OSQA 4ECWA 1CULA 4WFAQ 4I1TA 4DU8A 3CJ3A 2IFXA 4QU7A 5LJ3Y 2QMUB 1JLAA 3AFGA 2JZ5A 3VVUA 3VGVA 1SUQB 3FMWA 3KHLA 3OXFA 1EIYB 3SCJE 5T7LA 2R2SA 2HHUA 5CZXA 4CTAA 4FBTA 3WC2A 1SC4B 2HKEA 4PG4A 1MU2B 4DR3F 3PX0A 1V3ZA 4ES3A 3N01A 2MQMA 4FP9A 3SEOA 4JV5F 5C5JA 3VVTA 4F02A 2AD9A 4O3PA 1N33J 3UDEA 3PW0A 2ZC4A 1TL7A 4GO7X 3M8RA 4FPRA 3EPIA 2W7OA 1UAWA 1JLGA 2NCKL 3OHBA 4L76A 1RA6A 3MMBB 1YITS 3FZ2A 1IKYA 4TNOA 1SJ4P 3NWRA 1KHVA 4DFPA 3H0PA 3CJRA 3M8PA 1B3TA 2V63A 1S99A 4WP3A 1P9YA 4Q5VA 5I42A 1RTJB 2CXEA 2AHOB 2XSJB 3SBMA 1PJ7A 3HSDA 4G6VB 2DRAA 4OLPA 2UUCJ 1QLNA 1NRKA 1TVRB 2KXFA 2RDIA 4AL6A 4CQ1A 4QYZJ 4ETZA 4PR6A 3GPAA 2C2ZB 3DLEA 2JOQA 4JI6F 3TI0A 5B09A 2NS1B 1KOHA 3M8SA 4HHHA 1QSLA 2MQQA 3E51A 2CPZA 2LDIA 4F4XA 3GV8B 2E5LF 1S7HA 4UZCA 5AXKA 1UFLA 2NXEA 5LSLA 4CLYA 1EP4A 1CJKA 4CO5A 4ZPBA 2B7BB 3DMJA 1FERA 1X5TA 4ZN1A 3V6KA 2WHOA 4A8YA 4EYHB 4ICLB 1EKSA 3W66A 4DR2J 4EMDA 1MMDA 2WONB 1WHXA 1AYEA 2HHQA 3CTRA 1CQNA 5F8IA 2OO4A 2CJYB 1KSPA 4BBYA 4KAIA 1HL6A 4KKOA 3MPYA 5KFFA 1DURA 4TQRA 2Q6CA 1U49A 5D0GA 3T9ZA 4I64A 3K2YA 3J80Y 1TKTB 4PWDB 1MMNA 1HYSB 2O01C 3VGSA 2F65A 1FJ7A 4MFBA 1LW0A 1Q4RA 2RH3A 5CCLA 5J2NA 5CYQB 3G82B 3TJ9A 1VRUB 1TFWA 4U9RA 3T1HJ 2QV6A 4AXIA 2FJWA 4KHPJ 2EFVA 2DXDA 4ZVGA 5DM6Q 1MLAA 5FD1A 1GFWB 2N7CA 2J9EA 1AROP 3A1YG 1RT5A 3FRYA 4ZCKA 1UMJA 3DM2A 1FTRA 3DOLB 3M8ZA 4MKAA 5IT9U 5KFZA 4CH0S 2PN6A 2UXDJ 3MM6B 3TAMA 5IZHA 4DUZF 3LANA 2RHQB 3MR7A 2AP6A 2MKYA 1VIOA 1QVFR 3NNAA 4UZBA 3PKMA 4ED7A 2V4RA 1UW9A 2O66A 3GSIA 2UVUA 4LF6F 2GQ2A 2DRDA 2KZZA 2MSSA 5J2QA 1XK8A 3JAMU 1YRUA 3T1YF 2PIIA 5HANA 3UWTA 3DRPA 2WCXA 1FRXA 2YPZA 2AU0A 3TUZC 4TKTA 1XC9A 1RWKB 3LP0B 5D4LA 2CPDA 4W90B 1YVFA 4M5LA 2CPYA 2ZBIA 3E01B 3AB2B 2ZBRA 1NMEB 4WWSA 3OR2B 4NXNF 4A8WA 4C7QA 5ETTA 3FBFA 4BC9A 2QMWA 2F8MA 3VGTA 2CQ3A 4LFBF 4USWA 2VG6B 4FBUA 1XMOF 5KG2A 3G2XA 2WSFC 2KXHA 3H4BA 3LP1A 4QQBA 3CW2C 2NYHA 4LF7F 3LH2S 2EFOA 2KJWA 2BRKA 4P75A 1JX4A 2NPIA 5E33A 3KK1B 1G2EA 3CMQA 1T05A 3JSMA 4PKDB 2ZBQA 1FJGF 5ETNA 2HSEB 3WX8A 5H1SV 1X4AA 4ZS6A 3H8YA 3R2DJ 2DGTA 1YJVA 4BCAA 1PYTA 3LALA 1PAEX 1RT4B 1RP5A 3M2UB 4NI2B 2XS5A 4OYOA 4KQZA 1EZZB 1S7IA 1SJ1A 5IT9Y 2MQNA 1RDRA 1MSWD 2K06A 2CPFA 3DGVA 3U1LA 4C98A 3MEDB 3D54A 2XMKA 2CDQA 3KHRA 5ETRA 4ZPAA 4IFYA 2UUBJ 4NWBA 3B4DA 1VGYA 3KXDA 1S1VB 4HL9A 3C6UA 1ZPVA 3I4HX 1FESA 3IC1A 3NBPA 2WRMA 3JYTA 2KFZA 2Z56B 3JAMY 3H20A 3K89A 1HBUA 2H4YB 5IM0A 2DEIA 2XLKA 2HVIA 2B4UA 4IR1A 4PQAA 2B4PA 4IH7A 1WSRA 2QLXA 4ILMA 3R7NB 3G6VA 3BO3A 4CYUA 4OZNA 3G6YA 2P6SA 5JMNA 5IWAF 1DRZA 4HT7A 2DNLA 4IH5A 4WFBQ 2VL1A 2I8EA 4MAKA 1RWVB 5CA5A 2XMWA 5GAGU 1PKUA 1AUSL 4K4SA 3MR5A 2HVEA 1JLCB 5FIIA 1F9EB 4NEZA 4B3OB 1UWBB 2W2QP 5MLCV 3DU5A 2MMYA 3HFKA 4K2XA 1HR0J 3RB3A 2D7SA 3VV2B 3GCXP 2MZSA 3NGUA 4USIA 1UEKA 2R7OA 1M5OC 2Y3YA 1WC6A 3DHXA 1RT7B 4QYZK 5FDLB 5C2CA 1HBMB 2WAQD 2OPRB 4MJKA 1HMVB 4LSZB 1RADB 1LWEA 2JLFA 3CF5Q 3BGOP 1K9MT 4P7TA 2QJ3A 4RW7A 2N3LA 2QSFA 1M1KT 3N0VA 3QYYA 3THPA 2KYZA 4ELTA 4F8RA 3CJKA 1CJTA 2FJAB 4F26A 2MKCA 2H5IB 3VQSA 4X66F 4Y00A 1B64A 4YR0A 5M2RA 2XULA 2YWEA 3OL7A 4IG0A 3NWGA 1RTZA 2MQOA 3ENWA 4DEZA 2P9GA 1IKWA 3IO1A 3N5BA 1HWIA 3J7YU 4KT0C 3BBCA 1LW2A 2EBEA 1FVSA 3VALA 4QWBA 2MKIA 1PIEA 3KMSA 3FNNA 1PO6A 3BM7A 2MHEA 4BC7A 4F0HA 2VG5A 3GFXA 1T95A 2VFSA 1TV6A 2YNFB 3I55S 4EBDA 4WK1A 5BYSA 1VC5A 5LM7E 3EM1A 2CQ4A 3IR5B 2CG4A 2DGSA 3RUBL 3DOMB 1PGZA 4J91A 2FHJD 3NAIA 4ID5B 3W60A 3EGZA 1S9FA 2OUGA 2XCAA 2C3UA 4HH1A 1S12A 2VFVA 4ZJLA 5LJ5Y 2HRYA 1WKJA 4KO0B 3IRWP 3OV7A 3V4IA 4I0WA 2MPUA 3W8PA 1EETA 4PG7A 2QFIA 2WB1D 2FJDB 3DOKA 2VU5A 4ECUA 5KFNA 2DIUA 4QR0A 3G71S 4ZP8A 3OR1B 1VYAA 1IQTA 2MY7A 3W2VB 3QGGA 1RCXB 4LSNA 2ZBCA 5A8KA 3P6YC 5I3PA 3GV5B 4WXWA 3ZNJ1 5IFMA 2R7SA 1ULRA 2KJVA 1FRKA 2VBWA 1KR4A 1RAFB 1DY3A 4FF2A 3CD6S 1OQ3A 4JI2J 4IDKB 1VLOA 3W2WA 1VHFA 2GW8A 2AT1B 3CSKA 3DLGB 2VJUA 4YOEA 2XWXA 3MUTP 4DR3J 4ES1A 4X4NA 4NZ7A 3K5MA 1HW9A 2LEAA 1ZAVA 2ZHOA 4JV5J 3T5LA 2H4WB 4IFVB 3CJ2A 3GR1A 3UNGC 4KBIA 3THTA 4RNFA 3MMAA 1IBLF 4FF3A 1TK5A 3FZBA 2BRLA 2W2MP 3AB4B 4G65A 2M3DA 3BGUA 3AD9C 5F8LA 4NCGA 2J9CA 1T03A 3L95X 1RAGB 2KL8A 2KT2A 4IQXA 3IG1B 2HQCA 3MFHA 5A8WA 3A8IA 3M6WA 4WIQA 4IR9A 2RU3A 3L4BC 4R0JA 2RAQA 1S0NA 5CCMA 1VQKS 1LWFB 3CDWA 1LV5A 4WE1B 3I32A 2XNRA 5IS2A 3SYZA 2D74B 4CH7A 2BM1A 1XR6A 1B4SA 1SB6A 3HHDA 1BUXA 2PDAA 1LOUA 4ZVRB 2F4VJ 3B82A 2E5LJ 4DF8A 4IG3A 3W1YC 2DR8A 1XEZA 3D2WA 3HMJG 5KFPA 1N6QA 3KLFB 3KNGA 3X3UA 2UUAF 2PEBA 1RISA 5J2MB 1RAJA 3OTBA 2AZ3A 5GAHU 4IRKA 2DHGA 3I5AA 1KFSA 1Y9OA 5BJRA 1NJZA 2VQFF 3MUVP 4EI2A 3KLGB 2HS3A 2IJNA 5KG5A 1WF1A 2YTCA 3R97A 2VHGA 2HHXA 2IDEA 3HHKA 1BGXT 1Y0HA 4NA1A 3MECB 5KFOA 2BUNA 3DNCA 4CDIA 2G4BA 3A3PB 8AT1B 2DGUA 5HVHA 3NGTA 1VFJA 4NYOA 4ZP7A 1HBOB 1SJQA 3N5FA 3TWZA 2GGPA 4ZN3A 2IBKA 3IR6B 3A13A 3GQCA 1L3SA 3QWUA 4FS2A 4TU9A 2ZH7A 4LR7A 4ANEA 4C8LA 2NSBA 2P5VA 5HVFA 2VOPA 1HWKA 4C8YA 3QZ7A 3PYGA 2FVSA 1GMWD 4R25A 4ZHRB 3NY0A 4DOZA 3H59A 2KFNA 4CLUA 4H4OA 1B70B 3C15A 1UVLA 2IM3A 4DV6F 2RS2A 4QR2A 1Y00A 4F4KA 5KT6A 2ZH9A 4IRDA 4DSKA 3GFYA 4M1KA 1CG2A 4JYAJ 4TU7A 1NH8A 1UVNA 2DGXA 1NHUA 4JV0A 3J7ZT 1IUJA 4V1Ak 3GP9A 1UEVA 3RBDA 4CLFA 4QBUA 3ZZOA 4K4VA 2W9CA 3SDEA 5AJ3J 2V9KA 5C42A 1QVGR 1K1SA 4K7QA 2YNGB 4DZ6A 4C8OA 2V4JB 2ZH5A 1QUVA 3M9MB 3Q2TC 2ZNYA 3BGRA 3OJSA 4WJBA 3CO9A 5EDWA 5AE1A 4DSFA 2HNYA 5D3GA 5F0UA 1SH0A 5CAAA 1NPPA 3CMAS 3GJRB 5CYMA 4OL8A 2W01A 2SXLA 2J0QD 2F9JA 1L3TA 1JLQA 2BQ3A 2QG9B 3D5MA 3M1VA 5DZ6A 2R8HA 2V8VA 2G0CA 4DR1F 4QIGA 1N54B 3QO9A 7FDRA 3KLEA 2FPHX 1B7FA 4D3GA 4NCBA 4LF7J 3W3SA 4QIWD 1LWCB 5KFUA 5ETSA 2XWYA 2DPIA 1S49A 1Q79A 4C3LA 5EWFA 3GZ7A 4NX9A 4FNHA 2FHMA 4USHA 1B0TA 5HBMB 2Y1JA 4KPCA 1FJGJ 1XR5A 1HNZJ 4OYMA 4TVAB 1JLFB 3R5BA 5HLFA 3G87A 1CS4B 1IKVB 3GLJA 2W9BA 2V0NA 2MGZA 1TK0A 2O3DA 3ZZZA 4RJVA 4C2MA 2J7KA 3GE9A 1AB8A 1GEHA 1X5SA 4A8XA 2OPSB 1ZH5A 2CPXA 5B0FA 4A8SA 4W4MA 1VHIA 2CVEA 3MPUB 1BY9A 2QRRA 4YN3B 2HW3A 1R7IA 3P8BB 4LJMA 4OZ2A 1RBLA 4IOBA 3CJSA 3GYNA 4RUCA 4FXDA 3A4TA 1S1XA 2AMCB 3V6HA 1U1OA 1SIWB 4OYZA 2FZKB 3EX7B 4ED8A 1HBNB 4JP8A 4U7UK 2ILYA 3MOJB 2B9XA 5KFCA 2ERRA 2OAUA 1R8CA 3P45B 4JBCA 3KJQB 1HKAA 2VPXB 2J6UA 4YUDA 1DLOA 6FDRA 2O5DA 4O0NA 3BBBA 5DJBA 2FTRA 4DV4F 1D09B 4B3RF 1RHQB 3IWLA 1F3VA 1TTHB 5ETVA 1WTFA 4EFAC 5F8HA 3AXMA 4X62F 2GAGC 5GADI 5K5MA 2C2DA 1ZAXA 3RGIA 3PW4A 2UXCJ 2AEJA 5IWAJ 3GJSB 2PE8A 1KRPA 2N3OA 2ZZNA 2OMOA 3T6BA 1CBKA 3HSJA 4OX8A 2FHKA 1I51B 1VJWA 1Q5VA 4JUZA 2CPEA 1WEZA 1UFWA 2JX2A 4DSJA 1NJXA 4J90A 2M70A 3AT1B 1MROB 4CI0B 1N5YB 3EJMA 2G2YA 4H4MA 4FZVA 4UW2A 3D67A 3L7UA 2XMTA 2GCFA 2CQPA 4C48A 2XS7A 4G1IA 4ZDNA 2ZE2A 3UD3P 3PO4A 4FS1A 1T3NA 4OYIA 2XZ2A 1RWOB 1G1XA 2GVZB 4NCAA 2XZTB 1WHVA 2IYGA 4F4AA 3PKYA 1N34F 1HPZA 3PVXA 3JB9k 2R7VA 1XNRJ 3RYLA 4K5RA 1FWKA 4OX9F 3ZTPA 1SBRA 3U1MA 2BJ8A 4LF8F 3GSDA 1RSCA 4ZOSA 3CJTA 3FGVA 5HVGA 3LTOA 3NNCA 2CQ0A 1UPMB 1JLBB 2ATCB 4YHHF 3BDPA 2V5HG 3EZUA 4UQTA 4KIAA 4KFBB 2K1RA 1CJVA 1K1QA 1D9AA 3FRZA 4EZ6A 4LSLA 1SC6A 2KXNB 4LMZA 5B0EA 4QU6A 5J2PA 1GX6A 3P4UB 4TQSA 3N79A 1RT3A 4RNNA 5A2QU 4H4KC 1NZ8A 1S4FA 1BQNB 2F3JA 2RKIA 1M0SA 4NASA 2F7VA 4CCHA 5ETKA 3UDCA 1U1RA 4O3SA 3NGSA 2RQ4A 3OUYA 3IWXA 4AD6A 4O0IA 2DJWA 1VMBA 4PWWA 3AX5A 3D28A 3UE2A 3GV7B 4DN9A 3UFCX 2J7WA 4FF1A 1H7WA 4GKKF 3D1QA 5JJBA 1Q5YA 5D4OA 1HLWA 1RT1A 4AQYF 2HFUA 1YX2A 4AFFA 1T94A 3WX4A 5C25A 3ZO7A 5L1IA 1K73T 5KFGA 1CSJA 2HRTA 4C8ZA 5LXRA 5LXYA 3VGUA 2DR6A 4AL5A 4USTA 3MM7B 4TYBA 3KK2B 4OIXA 3CC7S 1CJUA 1PJ5A 2PI5A 2IA0A 3SI8A 1U0SA 1U47A 3I9V9 1M5HA 2C3PA 1HWUA 1LK7A 2D9OA 4IO9Q 1BHNA 3MAAA 2B51A 4NLQA 1XQIA 3ILLA 1HW8A 2LXUA 3D0HE 3HHLD 1HNIA 2RUSA 3M6VA 1UKUA 2A0FB 1RHJB 3Q23A 3RAXA 2CIMA 3JTPA 3HKWA 1SJFA 2HMIB 5K14B 2P9EA 5HMWA 1WOOA 2W8KA 2MYFA 1WKKA 3AX2A 3KLHA 3POTB 5G4DA 4KSEB 3SQGA 4RW8A 3G9CA 4RW6B 4LR8A 2IC3A 2QGFB 2KTQA 3C8YA 1BLUA 4ES2A 2QIFA 3GYXB 2KVQE 1AA1B 1S1UB 2ZD1A 1F5AA 4N76A 1S10A 2Y1LB 3I0SA 1WSVA 1DQ8A 2J6SA 5HSPA 1T9TA 3PJ9A 4QJVA 3D6TB 1YBTA 2JSXA 2Z4PA 4K4TA 2GA7A 4X64F 1UL3A 4ZLPA 4BDPA 3V2UC 2AEMA 1SCJB 4Y0FA 3QIDA 1OYEA 2CNOB 3Q86A 4M5NA 3N6LA 1SC1B 3PTWA 1GTEA 4CM2A 3EPGA 2HGNA 3DLKB 4ID8A 2JVOA 4FXWA 3M7VA 1IWAA 4YB1P 3Q8SB 2OPQB 5DDOC 1DTQA 3QFWA 3DGPA 2QSWA 1L3UA 1D8ZA 3DDIA 3DFEA 2ROEA 4G1QB 1H74A 1C0UB 4MIWA 2UU9F 3MM9B 1Y3KA 2V4JA 2QLJB 1QSSA 4GKJF 5H9EJ 3OSNA 4PG8A 1ZM3A 1YJTA 1OJ4A 4ANCA 5T41A 2VC0A 5A76A 1SJRA 3VAHA 4WFZA 1RT2A 2V69A 4LRBA 4WTYA 4WK3A 4A8FA 3BR9A 1S1TB 2MZQA 4OJGA 2IAJB 3PYFA 4C8MA 4WKYA 1SV5B 1AT1B 2AZ1A 1TUGB 4PEOA 3EICA 3HLUA 2G1DA 4PYAA 3ITHA 2JEGA 3DRRA 4ZCLA 1TKXA 2J5AA 2HVDA 2F63A 1WC5A 3KDOA 3FEYB 3TQEA 3EYZA 4KGXB 1C1BA 1C4CA 2XLJA 3Q8PB 4OZJA 1WEYA 4L74A 3C2PA 4NLWA 3Q8YA 1UJ5A 1PC4A 3EVWA 3BJYA 2VQEF 3I5CA 4PYDA 1YRTA 3EGWB 3M30B 3IN5A 2FIUA 4DJBA 3D0GE 2IMWP 2CWXA 2UVWA 4ZVFA 3KK3B 4I69A 4YFUA 1B99A 4WPAA 1FTCA 5J1EA 1WORA 3R27A 1T9XA 1ZZNA 3D1HA 3CB4A 5G0RA 3AD8C 4X4VA 2HGLA 4DV6J 2YWWA 3M2VA 2I5JA 2YY3A 4MIAA 4R5PB 3QJPA 2LECA 4DR4J 3O6QA 2HNDA 1ZTTA 4F4WA 4QPTA 2RF2A 3GU0A 4K0KF 1HARA 3MPWA 1NHVA 2EEYA 3ELHA 4OMFG 4OYAA 1E6YB 4DX8H 3IM9A 2VASA 5IT0A 3M8QB 1NJWA 1VQ9S 3DDKA 3OFHA 1N33F 2LFVA 4R8UB 1QY7A 1TFYA 3AODA 4H54A 5L46A 5M2UA 3TJ8A 2Q1LA 3MF5A 2CQBA 1GH8A 3CCRS 3W9JA 1YI2S 4WCEQ 3RB6A 2JEIA 4FYYB 3QT5A 4DPOA 1NXIA 5GAEI 4N47A 4E2FB 3SCIE 2VPWB 1X4GA 1JJ4A 2DO4A 5AXMA 4OI6A 1HNWJ 5BR8J 3AHPA 5F8MA 3CJ0A 1E6VA 1KVJA 4ZVSB 3PO5A 2XO6A 3GIKA 4KH1B 3C14B 2K7KA 2XGQA 3EUNA 4XTTA 5KFVA 1S97A 3PJXA 2IM2A 4OI3A 5C24B 3J7A1 3CCQS 1NK4A 3GG1A 4WYLA 2DY9A 5LL6d 1X4FA 3OL8A 1U45A 2ZH1A 2HQIA 2AW0A 4P72A 4DV5J 1KN6A 2YVSA 1O8BA 4KPYA 2WBRA 3ADAC 4R0EA 2H5EA 2R2TA 1U6BA 3H42A 1RWMB 1S6QB 1UZHA 1CVJA 2K7JA 4I2QB 5H9FJ 4DR2F 2FJVA 2HBZB 1FWLA 3R5CA 4B17A 2NUUG 4USUA 3GILA 2GVDA 5KT4A 2DH9A 4OHXA 4E8UA 1FD8A 1U1MA 4P9SA 2P6TA 4ZLLA 2HZVA 2RRBA 3MURP 3IFEA 2X1GA 1QJHA 4DS4A 2QA4G 1CULB 2GX8A 4WFYA 1OQ6A 2IIHA 2ZVIA 5KFDA 1SKWA 4I68A 1JLAB 3T19A 1XNQF 2FJXA 5HQLA 2HWHA 4XPEA 1K8AT 1URNA 3QPIA 3RBZA 2C2EA 1WNEA 2CRLA 1FX2A 1GT8A 2FC8A 4MYUA 2G9OA 2OTLS 2AX0A 4XK8C 3CIMA 5T7LB 4X4PA 1RABB 4CTAB 3K58A 4DV4J 3AD7C 3ET6A 4B3RJ 4DXLA 3CVKA 3NAHA 1X5PA 2A1BA 1U09A 2WK4A 2NQPA 4GVLA 4DV2J 2ILZA 2V2ZA 3DCAA 4ZCMA 2FY1A 3TO8A 3LGMA 1U2FA 1JKHA 3TYTA 1RTDA 1TL7B 3KFWX 3FKBA 1FDNA 1JLGB 4DFJA 4ZJQA 1IKYB 2UV8G 4Y2IA 3ICLA 1TL1A 3C66A 4OJHA 3R8YA 3M8PB 3CJ4A 3W64A 1IXKA 5I42B 1JMTA 4DL5A 3QWPA 2PO4A 1SH3A 3HT3A 1UUJA 3WZ0A 2FVPA 4N5SA 4O3NA 4CLPA 3QGIA 5A0YA 4JOUA 2K3KA 5H9EK 4YQWA 1M5PC 1FE0A 1S76D 2ASYA 3TANA 2BXJA 3OPKA 2Z2MA 3DLEB 2YNHA 4LQ9A 4DU7A 3ISZA 2B4OA 3KUHA 2DGOA 2R7QA 1QAXA 3VAIA 1FXRA 3HHLC 1FDAA 4LF8J 4E0DA 3Q8VA 4G3IA 3EMTA 3HZGA 1UPPA 1DFDA 4IOAQ 3P49B 5JVGQ 1EP4B 1JB0C 1CJKB 3RB4A 4K4ZA 2JC0A 1RKJA 3DMJB 2CJXB 4CO0A 2N82B 2J0SD 2DNNA 1RTHA 2XTJP 1D9FA 3BYRA 2FVRA 4P2MA 2QYGA 1J5OA 2BQUA 1O0PA 4BLGA 3GCWP 2LVWA 2B5JA 1WF0A 2DY1A 1PC5A 3PM9A 4UF4A 3DRYA 2OSRA 2H65B 1FRJA 3PYDA 4A8MP 3TUIC 1S0OA 2FZGB 3ENAA 3MCSA 2QLBB 3DI6A 3LP2A 2BV3A 1KVKA 2Z30B 4HKQA 2UUWA 4KKOB 3OFFA 5HMZA 2VA3A 2CQ2A 3OFGA 2XHWA 3TOQA 4ATNA 5C2GA 1OY8A 2PFDA 4LQ3A 4MFBB 1GMUA 4AQYJ 1LW0B 5J2NB 1Q53A 2C3MA 1JJ2R 4D3HA 1VQOS 2FVQA 3I0RA 2P8IA 5M2PA 3VAGA 1VDHA 4NRUA 1F5CA 2APOA 4CRJA 4QW8A 2UUBF 2L08A 2BABA 5B0AA 3OLAA 2CQ1A 3N4WA 1NKCA 1YDLA 3RU0A 4NLOA 1GXUA 1RT5B 2XYHB 3O3LA 4WKRA 3KJVA 2Q79A 3K8WA 1RYRA 3NLCA 3DM2B 2AF6A 1VC6A 2BX6A 1F0XA 4LF9F 3TAMB 4LF5J 3QSIA 4EO6A 2JLGA 1RUSA 4UTGA 5E5NA 1RBOB 1TAQA 3NXZA 3QBCA 1IJFB 4PUOA 3DLJA 3ZTOA 2FY8A 2FVCA 4DLEA 2DNOA 1R0BG 4TY8A 3LF0A 3US5A 2M5YA 4DQRA 5J2QB 4C11A 2VJVA 5KFLA 3KUEA 1FRHA 3DRPB 5EX3A 1IR0A 2B9EA 1P1TA 2AIRB 2QA4S 3TR5A 4RNHA 3BYPA 4QWDA 5E3PA 2UZAA 4O4RA 3QQCD 5AXNA 2FLNA 1VQSA 3D6HB 1N32J 1RHKB 4YB5A 3JSRA 4JI3F 2V6AA 3CDEA 4HTJA 4OI4A 1RWUA 2RQCA 1NB7A 2B8QA 4MT1A 1RLCL 3DRSA 3IAM9 3Q24A 4C97A 1FKOA 4ZK7M 2E1MC 3CDUA 3LAMA 2AJ2A 2A6OA 2CQDA 5D6GA 2IRXA 2O67A 4NLGA 4F3MA 3IBCB 4UOGA 3LP1B 1HWJA 2JEJA 3S1TA 2D68A 3W7BA 4J9UE 4DPUA 3NRBA 3ILIA 5DZ7A 3KLIA 1EJ7L 1Q8BA 4M5DA 2ZEJA 4NOHA 3MEEA 1T05B 3JSMB 3QGPA 1QD1A 2F8HA 1RI7A 4NEYA 3TVKA 5E0OA 1R6VA 1Y5IB 3T6JA 4LR9A 4Q8EA 5DDRC 3B54A 2B9WA 3D3CJ 1KD1T 3NL0A 1K0TA 1VRQC 4GKJJ 2EFGA 4H4KA 1FXDA 2Q3PA 4EZ9A 1RAHB 1U2RA 3PDNA 5GAGI 2E7WA 3AAWB 4EO8A 2GQQA 5GVQA 9RUBA 1NPKA 4IFYB 3I4PA 3HVTA 4ED0A 3C6UB 4U67Q 3NBPB 3JYTB 3AA8A 2AJ1A 1O5JA 1SL1A 4NPOA 4KR0B 1RGVA 2WVBA 1HBUB 2YNIA 1Z2ZA 4PQUA 3SSRA 1DAXA 5IM0B 2ZDOA 3CGIA 3F41A 2CJKA 4CLKA 2WW8A 3HVRA 4NLYA 1NKEA 1ZA1B 3CDBA 5A8RA 1YQHA 1U0HA 4CYUB 5LSRA 4RX6A 4J9RA 4C6AA 2BQRA 1SL2A 1MWYA 3OVBA 4FYDA 1ZM2A 2GV1A 4RL1A 5I3UA 5D8HB 2E44A 2DGQA 1MWZA 2J7UA 3QATA 1QTMA 3HSGA 2IHR1 3NMRA 3Q8QB 3DLLQ 1QUPA 2ZWPA 2R8IA 3MAQA 1YHQS 3TZWA 4P6QA 2OIHA 6AT1B 2QN6B 1LQ9A 5BYQA 3FUYA 2VG7A 3I9ZA 1S6UA 4LF1A 3DN9A 5E41A 4ED4A 1DJ0A 2IJRA 3K5NA 2I2YA 1K44A 1D1UA 4F4YA 1NSPA 3T5KA 1WC4A 4DS5A 3TVYA 2J6TA 3J7Z5 4YDXA 2AGOA 1N5VA 4X84A 1H38A 2VC1A 1AZSA 2GJIA 1TR0A 3K5OA 2PGCA 4JI2F 2Y1RI 2FGCA 1T02A 4Q8FA 1KLMA 3KJNB 1LWEB 4YY3J 4K0KJ 1CPZA 4GVBA 2NREA 4DDFA 4RW7B 1HQEA 1UW4A 2QFJA 2FJEB 2FC9A 1OMSA 4U95A 1NDLA 2HQDA 3BN4A 3CJKB 4Y65A 1CJTB 1WELA 4DR7F 4QWAA 3QLHA 1VQ7S 3IBFB 1ZTWA 3V5RA 1WOSA 2ZVSA 3K57A 4CP5A 3NS5A 4C8NA 4G1PA 2ASLA 4IG0B 4FXVA 1TMJA 3IA0A 1YTYA 2RB7A 4OI0A 4WU2A 3C6TA 3FQKA 2QA2A 5HL7Q 4LFCF 2VV5A 4X2BA 1IBKJ 2E1CA 3WBZA 1IKWB 3HFVA 4PABA 1Q16B 4MIBA 3AXKA 1LW2B 3F0NA 4DV0J 3TVZA 3M2RA 4U8VA 4USJC 4NLXA 1H2TZ 3W5YA 3JTOA 4DUYJ 3VCDA 1HQUA 5ETMA 1X0PA 1RHUB 1U1PA 2VG5B 4NL5A 4NMXA 2AKWB 3JQJA 2GFFA 2OD4A 1TV6B 5KFJA 2HBYB 1G4CA 4NRTA 5D4PA 1KNZA 3EZ5A 2XB2D 4OLOA 1X9WA 4Y6IA 4FN5A 2FZCB 4DX7A 1FRLA 1KC8T 1FD2A 5EGYA 4TLQA 4JI7J 1BQMA 2R7RA 2F4VF 3OL9A 4F67A 3I6PA 4XDDA 3T5HA 3LGNA 1RQ0A 4HI2A 2B56A 3J81U 3RJMB 4KHMA 2KI2A 4MKBA 4KV8A 4B9UA 2VIHA 1Q8IA 2FGOA 3V4IB 5B0DA 1I1GA 1EETB 2RQMA 2IPOB 3DOKB 1YZ7A 2I38A 5KFTA 2HHHF 2WW4A 2EC2A 3MCOA 4WXOA 5KOWA 2KHDA 3T41A 3OSPA 4LSNB 4HACA 3R7BB 2DNYA 4ECYA 2DNKA 5A8KB 2H51B 3KWMA 1XNQJ 2ZOGA 3QMQA 3H90A 3BKTA 2BJ3A 1TELA 4CZCA 3OLBA 5EN1A 4CM0A 1ZAWA 2V2VA 4OZ1A 1YWXA 2GZOA 1VBYA 4RU9A 2E9ZA 5KG3A 2AGQA 3NS7B 2HPUA 3W2WB 5HQMA 3BO4A 1JLEA 3JQMA 4I6WA 3EVMA 4ZVEA 5HK4A 3ZZTA 2E5HA 2LQBA 3B78A 3PX6A 1QDUB 3FDSA 2VOOA 1RTIA 1R31A 2OPPA 2VKZG 4F0KA 1OY6A 2HQ3A 2DHAA 3PFEA 3MMAB 2E1RA 2HLTA 8ATCB 1T0TV 4DQQA 2PMWA 2XNQA 3ZZPA 4L3KA 4DX5A 1YGYA 4M8LA 5GMDA 2B3TB 2YKNA 1NHKL 2Y8YA 4ZITA 4JYAF 1YJ7A 2HWTA 4NCGB 1T03B 3GTYX 1KLNA 3MTKA 3QRPA 4FVMA 3U7JA 2ZJRQ 2OKQA 5L9NA 2X1AA 4DCPB 5AJ3F 2NSCA 1JJCB 5A8WB 3AOAA 4P73A 3TQ1A 1UVMA 5KG0A 2Y1IA 2ROGA 1X0FA 2XHCA 4J7CA 5KFKA 5KG1A 1XERA 5KTQA 1M90T 1G6BA 1FF2A 3M9OB 4V19J 1RLDA 3KOAA 4IG3B 4B3MF 2BOAA 2XEXA 3O8WA 4F36A 2B9YA 1U02A 4WZMA 4ENOA 1HD0A 1H73A 1N6QB 1SVDA 1OSCA 3WQPA 5B0GA 2YBVA 5F3TA 2V8HA 4ZVHA 1T9WA 4AYBD 1UCNA 1RE1B 4M94A 1C0TA 2HVZA 2MLYA 5GADU 2AYBA 1KS2A 5KFEA 3ULHA 5CD4A 1WJ9A 1X9SA 2AX1A 5KFWA 3C3LA 1GX5A 3BZQA 5F8JA 2Y0SD 2KM8C 1HNZF 2V68A 1U25A 1VR6A 4PRFA 2OTJS 1U24A 3W65A 4P2FA 4YEAA 1J5EJ 3OTEA 2U2FA 3OHAA 2HBQB 3HHNB 3A3NB 1KP6A 4DI6A 2YKMA 4DL6A 2V8GA 5HMYA 2BMBA 2ZJQQ 4CT9A 3PYEA 2GGPB 3F73A 2IBOA 3WC0A 2DNZA 2WVEA 1N36J 3I87A 3CT9A 2KYXA 2GJ2A 5JUMA 3D6FB 1RYSA 1FA0A 3X1LB 1UP1A 2W2OP 4DV7J 2V1TA 3QAEA 4L6V3 4JI1F 3O5TB 3MWBA 4H4OB 1NSQA 3IAS9 2MEWA 3C15B 3QIPA 2RDDA 3AQPA 4LF9J 3OVAA 3HJFA 1VRTA 1BXNA 1HNXJ 3T1AA 2FLLA 3NCRA 4DG1A 2DR5A 1DQAA 5L38A 4KGVB 4CLLA 3KTQA 2DHSA 2HIYA 3NP5A 4GRSA 3NOCA 3PW7A 3H2UB 2RT3A 4I7FA 4U8YA 2IM1A 3RBEA 2W9CB 3SDEB 2HURA 4X65J 2XMMA 2UXCF 5J1PA 5C42B 1IBMF 1FNXH 3HK2A 4NZ6A 1SXLA 1C1CA 1Q7LB 3HSZA 4RUHA 2RSQA 4O44A 4LBHA 2HFSA 2WVFA 4I2PA 2MQPA 3BGRB 4F4ZA 2ZOFA 2DNQA 3QAUA 2HFZA 4DL7A 2HNYB 2LA6A 5D3GB 3P3DA 4JI3J 1RXOB 5DETA 3DKDA 5CYMB 3IS9A 4OYXA 1LNQA 1OO0B 4K8RA 1KWMA 5BXIA 1JLQB 1HIYA 1S9GA 3LA0A 4A4JA 1FHTA 1PJ6A 3M1VB 1OPZA 1ZA2B 1N56A 2Z2ZA 2HK2A 2V1SA 5HP1A 3QO9B 1N88A 1RU2A 3KLEB 1AUDA 3MDFA 1WF2A 3PHEA 3HHLA 5ETOA 2DNGA 1P8GA 1NK0A 2HAFA 4QPXA 3AA9A 2OELA 2MKJA 5GMEA 1XNRF 3OL6A 4QIVA 1UA0A 3ETOA 4USMA 2J76E 4U7CA 4Y3CA 2QYCA 1SIZA 4A8OA 5DDQC 2RDJA 5HLFB 1RAOA 2W9BB 2HHTA 1DBDA 3MMJA 2MGZB 9ATCB 2VUGA 3MM8A 1RAEB 3BSAA 4F2SA 2J8SA 4LIWA 1F6TA 3CCSS 1WI8A 1GXTA 3G8SA 5DO2A 3S6EA 1Q0NA 4FKYA 4EBCA 4IH6A 3SFGA 2B6AA 1DTTA 4PCQA 2GIFA 1FCAA 2E7VA 3MEGA 1S9EA 1VQ8S 4NA2A 2ZUAA 4OQJA 4RLEA 4FDFA 4EYIB 5ETPA 1S1XB 4W98A 5E3CA 4ZMMA 2LU2A 1SKRA 1EQMA 3GIIA 2VH7A 3OVSA 2CPHA 1SQGA 3NS6A 4NXMJ 3IP0A 4X4RA 1XTZA 3QRRA 2I6WA 3V81A 1DLOB 2HNZA 5AE3A 4GC7A 1NDCA 1Q1KA 4PXDA 2MY8A 5KT2A 2FDNA 1V6HA 4Q0BA 4C9DA 2BJ7A 5HO4A 4J9MA 1YJ9S 4B3SF 4DL3A 3F56A 4Q2MA 3PEHA 3H7HB 4LF4J 5F0WA 3CE8A 5KFYA 1OYDA 2M8HA 5FLXU 1Y7PA 5KFSA 5DDPC 4CO3A 1H7XA 1FKAF 2IVFB 5KT7A 2KVIA 2LXIA 2PC6A 2HS0A 2IJFA 3OT9A 3CUNA 4DR6J 3WIVA 3MI7X 1C2PA 2PMHA 1M5VC 5ETQA 2XI2A 4ECQA 2HEKA 4H4MB 1MNEA 1K0VA 2DBBA 1J2VA 3SV4A 1SC3B 2ZE2B 4NMLA 4ZJOA 1LXJA 3N6NA 2POKA 2LKZA 3KHHA 1J27A 2E5JA 2L41A 1HPZB 4TLRA 5GMKa 1TAUA 1QAJA 2YKQA 4HT5A 1APSA 5D0RA 2C2MB 2BE9B 2MZRA 1FI4A 1A6LA 1REVA 4P74A 3CC4S 5HI7A 4FYVB 3M32A 2G2OA 3NMAA 4WFNQ 4DR7J 3OJUA 4IUFA 1PSDA 2UUTA 2VFRA 4FKXA 3LWMA 1FNOA 1ZM4A 2D41A 2K1RB 4OZ0A 1CJVB 1VQYA 5ITHA 4DV1F 3OXGA 4ZPCA 4KGZB 3BKFA 1Q86T 4LSLB 3LAKA 2B43A 2O1PA 5KFAA 4LFCJ 5J2PB 2HYIB 2HVHA 3FMBA 2KT3A 4Q43A 2V67A 1VI7A 2CADA 1S1WA 3I56S 1RT3B 2YX1A 2IRYA 3FC9A 5ADZA 4KHRA 1Y10A 2RKIB 1HHTP 3GONA 1HQ2A 3QT6A 5HJYA 1P6TA 3KG4A 1OM2A 4LFAJ 5DLGA 3OUYB 1KKHA 3KDNA 4UUWA 3M8YA 1R43A 3TARA 4JI4J 2OEKA 4HDGA 4Q7AA 2LMIA 3D1OA 5FLXY 3FBBA 4NLRA 1RT1B 3MPDA 3A12A 2E1PA 1YJRA 5F8GA 1HNVA 5C25B 5IT4A 4TN2A 2LEPA 2BE2A 2MQLA 1ACMB 2RIJA 4A8QA 2HZAA 1CJUB 4MK7A 2KU7A 3SMZA 1KTQA 2MLZA 3RW6A 2RJZA 1FK9A 2HHHJ 2Z0GA 1R3NA 2CQHA 3MAAB 1RAIB 4M5JA 2KO1A 2EBGA 3Q2SC 2Q43A 2VFUA 3C16A 2W7PA 2HFNA 2MDAA 1HNIB 5DQGA 5K8OA 3FSXA 2ALYB 4RPFA 4B9TA 3T3FA 3CCLS 4RO0A 2XI3A 3W5XA 1FRMA 2VONA 3VZHA 2V8DA 2B7CB 3UCGA 3ISND 4I56A 2UVRA 4URQU 2C1EB 2JH3A 4J9QA 3KLHB 4UOHA 3NCPA 5GAEU 3L7PA 1KEKA 3SQGB 3NGKA 4RW8B 5HROA 3BQ1A 3AJ1A 2VBZA 4B3TF 3W9IA 2Z57B 5A6WA 2IC3B 4OHZA 2BW2A 4DX6A 1JXLA 4AXJA 2C2OB 3UVJA 4F50A 4U6PA 4O4GA 1Z4UA 2EW9A 4BHQA 3TJAA 2ZD1B 2BM0A 1JXEA 4BWJA 3I0SB 3BPDA 3BR8A 3DLBA 2RQKA 4DF4A 5L39A 2AQ4A 1HWLA 4ERDA 3E3XA 4OV6A 3H25A 2RS8A 4DR4F 4DQSA 2VPYB 5LMNF 2ZH8A 3G8TA 1N8RT 3FBCA 1V5VA 3J80U 2VDHA 5HQ8A 2NZ4A 4Z2XA 3CD0A 4I6YA 3V6DA 4K4XA 1UWAA 1M5SA 3BBFA 3B8HA 3FFIA 1DTQB 2N4DA 3DGPB 2RHSB 4UUXA 1Y3JA 1TKZA 1NSAA 4OZ3A 4CNZA 3MGJA 1I6JA 2OLWA 1ZOTA 2GO8A 4P7VA 3CULA 2L48A 2GJFA 2GMJA 4FYXB 3FCVA 2MQ8A 3JS9A 2BANA 1VLYA 3K5PA 4XPCA 2DNHA 3THVA 4X4SA 1RT2B 1KONA 4B3MJ 2ALZA 2UVVA 1KDNA 1ZM9A 3IGVA 3MAHA 4ELUA 1HNWF 5A6PA 3IBWA 5BR8F 3DRXA 1LKZA 3HCXA 1TL3A 2DR9A 3NKYA 3N28A 1AW0A 3ITHB 3CCTA 3CCES 3EGNA 4DPWA 3DRRB 5CZVA 1TKXB 3PIPQ 2M8DB 4QWEA 1ICEB 3N6MA 2PT0A 2HAIA 2F9DA 1C1BB 2YH1A 1I94F 2G2ZA 4F2RA 4Y2AA 1NM2A 4ZVPB 4DV5F 1T9UA 4RW4A 5ETLA 3HFZB 1D3WA 1YG0A 3BKUA 1H2UX 1WEXA 2E7XA 2EG1A 2YQ3A 1XJWB 2C2NA 4L72B 4DPXA 2YWGA 2C3YA 1N52B 2HHVA 4WYWA 4PG5A 5F8NA 2CNLB 2P2CB 3MHYA 2A18A 1RT6A 1KQFB 1MWQA 4DMZA 5KG6A 2CAJA 3ZZ0A 3SXLA 1S6OA 2VBYA 4DPTA 5HJXA 1JQGA 1SQEA 4L3NA 1XR7A 2BEFA 3CCZA 3CNQP 2E1AA 5J1EB 2XG8A 3VWSA 4JI1J 2GMHA 4C0BA 2BDPA 1NK7A 4CLSA 1RCOB 5G0RB 2XMUA 2KG0A 3PZPA 1SH2A 2X1BA 1WD6A 1XBWA 3M2VB 2I5JB 3M4XA 2HNDB 2V94A 2BKPA 2BACA 3PR5B 4ZVOB 1M5KC 3AH6A 2RF2B 4RNOA 1TUVA 3C19A 3LPEA 4QR1A 1D9DA 1T8EA 2BJEA 3ZZYA 4Y2KA 3MM5A 5CH7B 4DV2F 5IV4A 1IKXA 3VAFA 3NOGA 2XC9A 3BV8A 5EHHA 1IBMJ 4OYWA 3MCMA 4P52A 3QJLA 1FT8A 1Y11A 2W24A 3RAQA 1X4BA 5E3AA 3R7SB 4F3OA 2FUG9 2WSEC 3ZTRA 1HHQA 4OHVA 2JWNA 1VQ5S 2A6MA 3S8SA 2XLIA 3KHGA 4ED5A 4CO2A 2J0XA 2H3EB 4AL7A 4M5IA 1QE1A 4O3OA 3MMCA 1E6VB 1RA7A 5L1JA 3AOCA 4ZCIA 1R6YA 2YX4A 1R8PA 1H98A 4YP3A 3DYAA 4RNMA 1PBAA 1IR2A 3CO0P 1RZMA 4ZPDA 1S48A 3BGLA 3G96A 3HHEA 3JQKA 4EU0A 2DCLA 2GIQA 2DT9A 2CKWA 1HI1A 1R8BA 4RW9A 4F7VA 4HLBA 3OTCA 3UCUP 4A8KA 2ZKUA 4IRCA 5U47A 4OX6A 2Y8WA 2VB6A 1M1HA 4LBIA 4PAAA 4M5GA 3PW5A 4ZPTR 2GVDB 2WZ1A 4TY9A 3R9LA 2JRSA 1JIHA 4XO0A 2V2KA 3QT7A 2WOMA 5IC6B 2ZJPQ 1UETA 2YQ0A 4JI8J 1S4EA 2D3O1 2X3GA 1W7WA 1WWHA 2C42A 1FKPA 2GMLA 3D9BA 3MEKA 3QSYB 2DGWA 1UTAA 4WZQA 2JDJA 1Q82T 3U02A 2LP4A 1WDDA 1FE4A 1VBZA 3WHIA 3PFOA 2DNPA 2DD8S 4QIEA 1R0AA 2PA8D 1FEEA 3ET6B 4B3SJ 5EUHA 2R9LA 1MW7A 3G8QA 2FQQB 3MXHP 3EXYA 2PMZD 2CA9A 4P2SA 1JKHB 1SKSA 1H0HB 1RTDB 1P9QC 3RZAA 2NZCA 3SFUA 2QL5B 2GAHC 1N5QA 3VZIA 2COLA 1VIXA 1TL1B 4LF5F 1SI9A 2ZDPA 3AJDA 4K59A 3CJ5A 2YWFA 3IRXA 3HX9A 1NK5A 3LO3A 3BH7B 1LK5A 1QTNB 3E2EA 5E3RA 1G3OA 4ILRA 1VJQA 3LUYA 3MOZA 3GWCA 3EWGA 3KYLA 4ITSA 3W62A 1SJ3P 2NLWA 5A0YB 2G0IA 1X60A 3IWNC 4URGA 1JK9B 3T5JA 1YJNS 5D0EA 3UR3C 2YWKA 1QM9A 3RRKA 2RMLA 5CYJA 4X4UA 2YNHB 1N32F 2AJ0A 3GR0A 2XTDA 4GMKA 3RG6A 1F60B 1YJWS 4KTQA 5K8NA 5A2QY 2ZH6A 4ECSA 3OD2A 3GYGA 1SUQA 2K8GA 4Q44A 1KTVA 1B0VA 1UJ6A 2D9PA 4DSEA 3ISNC 3VAJA 4DZDA 1RTHB 3W61A 1RK8A 4DPYA 4DV1J 4B08A 1DHMA 4FNIA 3GIJA 1J5OB 1MU2A 2B5JB 1WC1A 2ACMA 1NK6A 2OGUA 3SQOP 2ZH4A 4QYRA 1S72S 4FYWB 3EZOA 5DLFA 3OW2R 3DI6B 3LP2B 2E9TA 2YQ1A 3MMBA 1UFKA 2I9SA 5E7OB 4LUBA 3BF4A 5K9FA 2AV5A 4F04B 3KG0A 2IYIA 4E98A 4LT6A 1QSYA 2KRRA 1XMQJ 1FWPA 3KMQA 2XTCA 2XO7A 4YB6A 1NB2A 1F9HA 2WVDA 1RTJA 4LIRA 4HR2A 5IOLA 4CO1A 2XSJA 2H48B 3OBIA 3JTNA 1VS3A 3I0RB 3R6LB 1BC6A 1TVRA 4HEA9 5F9LA 4LRFA 3EXCX 1MG7A 4UQGA 2ASDA 1GNKA 2H9ZA 2XZWA 2J0WA 3R6GB 1CEZA 1X4HA 4J9OA 3SIPB 3D0IE 2KN4A 3PRDA 1IR1A 2PI4A 1GAOA 3KJVB 1EHWA 3HF5A 1KOOA 1WHWA 3W5ZA 3PRBA 2CJQA 1YK9A 3CIZA 1HD1A 3RR7A 4MK9A 2BE7D 5RUBA 4NLSA 1WUUA 4U7UD 1IJEB 2D1CA 1U1KA 5LMUJ 4N77A 3PIOQ 3AQOA 1KQSR 4PUOB 3LPYA 4ICLA 4TY8B 5AXLA 4C11B 3MR2A 5HAOA 4HH0A 2QL7B 3HP6A 1W25A 2WONA 4YMEA 3ETMA 3FSIA 4WBFA 2B0GA 2NUHA 1YBUA 5LSOA 4RZRA 3R1HA 2C28A 2LYVA 2UP1A 2NXJA 3IR7B 4B3TJ 2AJ4A 3WIUA 1RHMB 3PY8A 1NDPA 2AJQA 2RU9A 3FQLA 2D69A 3QT8A 1OY9A 1BMQB 2Z2LA 5F41A 4PXCA 3BQ2A 1RAAB 3IMQJ 2ROPA 2BW7A 4WU3A 4DL4A 4PWUA 2F1FA 3UQSA 2MZ1A 3UD4P 1TKTA 4PWDA 3TZXA 2BKOA 1HYSA 3DRSB 1DARA 1M1GA 1IBCB 2EPIA 2ZH2A 2QZ8A 1FKOB 1F3FA 3G82A 5CYQA 3SCLE 1VRUA 3HO1A 1RBAA 2GHPA 3NEKA 1X4EA 1U8WA 3GJQB 1SL0A 5LMNJ 1MMLA 2GHVC 5DGBA 4TYAA 4J9SA 1W2IA 3UNYA 4YY3F 1OIAA 3IXQA 4BS2A 2H5JB 4HI1A 2FHOB 3K59A 1S0VA 3KLIB 5D4NA 4M5DB 3MEEB 3TRGA 3DOLA 4URSA 3TA2A 1LXNA 3EDRB 3TZZA 3ZC4A 3MM6A 1YJUA 1U48A 4CLWA 3HD1A 2VZ9A 5DGAA 2LA4A 4N8OA 2XTEA 2LDYA 3ENQA 1FVQA 2HHSA 2RRAA 4BWMA 2NXNA 3ENVA 1ZETA 2DEJA 1IBKF 4Y34A 4IOCQ 2A3JA 2D3ZA 3R5JB 3B6BA 4DV0F 4UOCA 5LOQA 4OV1A 4AT1B 3OFEA 1RWNB 4DUYF 4DUTA 2FB0A 1T9VA 1PAUB 2Y9HA 3HVTB 1CC8A 3LP0A 4B02A 1JNZB 2VPZB 3OXLA 4JI6J 3PEJA 2DH8A 2VF3A 3E01A 2EK1A 1VCTA 1NDKA 1NBEB 2YNIB 3OR2A 3UR0A 4PQUB 4JI5F 2M52A 3BDEA 3QFHA 2GO9A 3ZXWA 2HQGA 4DLGA 4IQMA 2W7AA 4GO5X 3I82A 1GMVA 3LW5C 3ILJA 1NZAA 4MK8A 3C46A 4JI7F 1QAYA 1I94J 2VG6A 4NA3A 1WHYA 5A8RB 3B4MA 4NLUA 3CCWA 1U0HB 3HKZD 1F5BA 1TQLA 1Z1ZA 4EBEA 4C8KA 3RRHA 4N41A 1VC0A 3A8KA 5I3UB 1LFWA 4DQIA 1X8DA 2IVMA 3DU6A 2LQ5A 1VQMS 1OPIA 2VD3A 3KK1A 3R5DA 4Q2LA 1WG4A 3L3CA 2VG7B 2CJBA 1VQ4S 4ZKAA 2DPJA 5AE2A 4ZVQB 1KHWA 2W4DA 2PA3A 2NYIA 3MCNA 1RT4A 5L1KA 5I3QA 2KDOA 3M2UA 4NI2A 3UN5A 4S0MA 2IA6A 4OI1A 2PD1A 4DN0A 2OFHX 1N4LA 1ZZFA 2EC0A 2QO3A 2R42A 2EFPA 2JVRA 3BO2A 3MEDA 4Y28C 1AZSB 3D66A 4M95A 3I96A 3U27A 3LQVA 4ER8A 4ECVA 2R3VA 4KY3A 1DZ5A 2R7TA 1GXLA 1VQ6S 1U7LA 1KLMB 1S1VA 2LQ9A 3ILOA 2CWKA 1Y4ZB 2J9DA 4PPZA 3V4MA 4GVBB 5DQIA 5D0HA 1HQEB 2L9WA 2QL9B 2HFVA 1YIJS 2H1YA 1N48A 1JNRB 4L75A 2G0JA 5E2QA 4LRDA 4DUZJ 2WB4A 3QLHB 3RBXA 4U96A 4Z7CA 5HATA 1L5UA 2E5GA 3NGDA 2AYMA 2VDIA 2OD6A 2XM3A 4LREA 1WOPA 4LF6J 3TAPA 3C6TB 2KKHA 4C0HA 3H5UA 4USKA 2CNKB 3T1YJ 3TNVA 4A47A 2ZOMA 3G86A 5C7PA 1A0OB 1NKBA 1VQLS 3M2RB 3GFHA 5KAKA 5KFRA 8RUCA 4WP8A 4X4OA 1HQUB 2RRNA 2L9NA 2OHDA 5K20B 3L09A 4O3RA 2M0GB 3VQTA 2I1RA 4OYPA 1XN9A 3KUGA 3M8WA 1JLCA 4OHWA 2DGVA 2HHPA 2C2RA 2WSCC 1X31C 4NXNJ 4B3OA 1UWBA 4CO4A 4EEYA 2R7WA 2FLOA 1VISA 1BD6A 3OQ2A 1HFEL 4Z37A 5D78A 3CMES 3OTOF 4LFBJ 1BQMB 5B0BA 1XMOJ 3I5BA 2V8PA 1RT7A 3P96A 5FDLA 3HM9A 1HBMA 2QTWA 2OPRA 3RAMA 2OJ3A 1HMVA 1GTHA 1S77D 4O3QA 2ZUGA 4KV8B 2DYAA 1FXLA 3W63A 4LVOP 4JV2A 3HULA 4ZA1A 1FJCA 4F25A 3VR1A 1NUEA 4HACB 2Z2YB 1R0CB 2XMJA 1JWWA 3FCWA 4OHYA 2XMVA 4RKUC 2CQGA 2Z58B 1J5EF 4RBTA 2DO0A 1IM6A 1GQEA 3P5BP 2PEHA 2N7YA 2X51A 5B7WA 2R7XA 3V6JA 4CT8A 4ECTA 4TU8A 4DWIA 1V5IB 3PCOB 2I0XA 4PG6A 3CD7A 3NGRA 4RBVA 1JLEB 1VOMA 1N36F 2EI5A 2K3IA 2YNFA 1D8YA 5KOXA 4HDHA 1V3RA 4DV7F 4P10A 1RTIB 2L9DA 2OPPB 4ECXA 1S5ZA 3UDLA 4MYTA 2EFQA 4F3QA 3Q83A 3DOMA 1U8SA 2ADBA 4OZLA 1BWEA 4ID5A
chains in the Genus database with same CATH topology
2IVFB 3D0GE 5KT7A 2MKKA 1FO1A 5KFQA 2IMWP 2QV6A 4AXIA 2FJWA 2UVWA 2KVIA 5SUHA 2LXIA 2PC6A 2C22A 1HNXF 2HS0A 2YKNB 4C4WA 2IJFA 2EFVA 5CD4H 4ZVGA 4ZVFA 3CUNA 5DM6Q 3KK3B 3MI7X 4KO0A 4OI2A 4I69A 4YFUA 1C2PA 2PMHA 1M5VC 1FTCA 5FD1A 2N7CA 2XI2A 2J9EA 5J1EA 4ECQA 1AROP 2GIRA 3A1YG 4TXSA 3R27A 1RT5A 3FRYA 4H4MB 1MNEA 2DITA 1K0VA 4ZCKA 1ZZNA 2DBBA 3D1HA 3QJJA 1J2VA 1UMJA 3CB4A 5G0RA 2ABYA 4J9PA 3SV4A 4X4VA 2HGLA 1F9FA 3DM2A 1FTRA 2ZE2B 1R8HA 4X65F 3DOLB 4MKAA 4NMLA 4UY85 4YDDB 2D3UA 5KFZA 4N8NA 3M2VA 4CH0S 2I5JA 2PN6A 2YY3A 4MIAA 4R5PB 1LXJA 3QJPA 3N6NA 2LECA 3MM6B 3TAMA 2POKA 3OR1A 2LKZA 5IZHA 4DUZF 3O6QA 2HNDA 2Z8QA 3KHHA 1ZTTA 3BSCA 3LANA 4V19X 1FDDA 4F4WA 3W2VA 2W4CA 2ZFHA 2FHJA 2DVIA 2AP6A 1VIOA 2E5JA 1QVFR 4QPTA 2L41A 3NNAA 2RF2A 4K0KF 3ZZUA 1HARA 1HPZB 3MPWA 1NHVA 4TLRA 5GMKa 3BGFA 3PKMA 4ED7A 1TAUA 1QAJA 4OMFG 2V4RA 2ACYA 2O66A 2YKQA 1E6YB 3PJWA 4HT5A 1APSA 1D0EA 4DX8H 2UVUA 4LF6F 2VASA 2GQ2A 5IT0A 1UVJA 1WG1A 3M8QB 2NR0A 1NJWA 2KZZA 3IGNA 3CPWR 2MSSA 5J2QA 1VQ9S 1X4CA 3DDKA 2QT7A 1XK8A 2MZRA 1YRUA 3T1YF 1A6LA 1REVA 3CCVS 3CC4S 2EKYA 3OFHA 5HI7A 1N33F 2PIIA 1HHSA 3UWTA 3DRPA 2WCXA 4R8UB 4NYZA 1FRXA 1QY7A 3M32A 5BYRA 4H54A 1TFYA 3NMAA 4HTIA 4WFNQ 2AU0A 5M2UA 4I4BA 3TUZC 4TKTA 3OJUA 1PSDA 3SCKE 2UUTA 2VFRA 4IUFA 3LWMA 2HZCA 1XC9A 4IDKA 2Q1LA 1FNOA 1ZM4A 2ZH7A 3LP0B 3MF5A 2D41A 2K1RB 4OZ0A 2CQBA 5D4LA 2V9WA 2CPDA 1VQYA 2RD5C 3DLGA 5ITHA 3VAMA 4DV1F 4W90B 3OXGA 1GH8A 3CCRS 4ZPCA 1YVFA 1Q86T 3TAQA 1YI2S 1P27B 4LSLB 3MFIA 5B0CA 2CPYA 3LAKA 2B43A 4WCEQ 2ZBIA 3RB6A 3E01B 2JEIA 3AB2B 1C0TB 2O1PA 2YKAA 2PSZA 5KFAA 2X1FA 3OR2B 4NXNF 4MTPA 2MXYA 2HGMA 4A8WA 4DPOA 5J2PB 2HYIB 4I67A 2HVHA 3FMBA 4C7QA 5GAEI 2KT3A 2QE5A 4Q43A 4IFVA 3HVAA 4N47A 1VI7A 3SCIE 1S1WA 1X4GA 2VPWB 3I56S 1P1LA 1RT3B 4BC9A 2ZHBA 1JJ4A 2YX1A 2IRYA 2QMWA 4RBUA 2F8MA 3JSBA 5ADZA