4R0VA

[fefe]-hydrogenase oxygen inactivation is initiated by the modification and degradation of the h cluster 2fe subcluster
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
426
structure length
416
Chain Sequence
LSHVQQALAELAKPKDDPTRKHVVQVAPAVRVAIAETLGLAPGATTPKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAHPHSDEPLPMFTSCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMVSIMPCTRKQSEADRDWFVDADPTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKETNITMVPAPGSKFEELLKHAAAHGTPGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKRQAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fe-hydrogenase
publication title [FeFe]-Hydrogenase Oxygen Inactivation Is Initiated at the H Cluster 2Fe Subcluster.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 141
structure length 416
sequence length 426
chains with identical sequence B
ec nomenclature ec 1.18.99.1: Transferred entry: 1.12.7.2.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02256 Fe_hyd_SSU Iron hydrogenase small subunit
A PF02906 Fe_hyd_lg_C Iron only hydrogenase large subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r0vA01
3.40.950.20 Alpha Beta 3-Layer(aba) Sandwich Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 4r0vA02
1HFEL 4R0VA 3LX4A 2N0SA
chains in the Genus database with same CATH superfamily
4I1VA 2PD3A 5D5HA 4CIDA 4ALIA 4TYPA 2UXBB 3NHPA 1K8ZB 4MP8A 4WZBA 2BEUB 1U7ZA 4L3OA 1T5TA 5CDHA 2Q1SA 3UXEA 3F4LA 2WDZA 2HJGA 3Q2OA 5CIQA 5FFFA 1I4WA 3GGCA 1D1QA 4GWKA 1G5IA 3N5KA 3R7FA 4F2HA 4FGSA 1BMQA 3HA3A 3NUZA 1L6RA 4UU7A 1WA5A 3WAGA 3IP8A 2QP3A 3DVRX 4EI7A 3UGTA 2JLZA 4TV8B 2K5UA 1ZNWA 3HP4A 4LF5B 2I6QA 3RFFA 3BD6A 1TMGE 3D43A 1L5ZA 1XZMA 2GA8A 3EGDB 3KK0A 3QHQA 4XUDA 5LNK1 1SVIA 1V1MA 1GTL1 4K3VA 3HCNA 3U3XA 2BTEA 1AZWA 1RXWA 1BDJA 3A4NA 2AX4A 4B3DA 1W87A 1WMDA 3VH1A 4TS4A 4JXXA 1VTKA 2DXIA 1FU8A 1NQVA 2DFVA 1MA3A 3VX4A 5L3VA 1WCV1 2H18A 4YMTA 3LBYA 3C4JA 4AJ2A 4DJEC 1Y4SA 4IRMA 5KHAA 1EM6A 2XE6A 2ZANA 3OFVA 1AZSC 1T9ZA 1QVZA 3KUKA 3LRXA 4EY7A 4XWGA 1G42A 3HLTA 1Q0ZA 1PJ8A 1Q0HA 3BF7A 2JBAB 3OWOA 4MR7B 4A8JC 3OO0A 1WIWA 4QGSA 4MGZR 4CEJB 4J8PA 3EZ6A 4NCJA 5G41A 1SC4A 2H48A 4J4BA 5ALVA 2HLPA 4J7UA 1HL3A 3ZQ4A 1SXIA 3DZFA 1L7EA 4L2IA 4I4NA 2H9IA 4OLBA 1J25A 5D5QA 4CM6A 3GLFB 4R98A 5KJEA 3O1LA 4JWTA 1WQ1R 3LBAA 4X66B 1U9ZA 1P9NA 3UV7A 1AUXA 3G2NA 1YVEI 3PFKA 2VSXA 1V6AA 1KAOA 4RVDA 3ITEA 4OHWA 4RD3A 4R2XA 1MJNA 2I33A 2E5WA 1ZH2A 3T1QA 1ZH6A 3FHLA 3ZHBA 5BVHA 1ST3A 1TUBB 5IH7A 1TIKA 2I71A 3DKVA 2LWIA 4KVZA 2V7EA 3U39A 5CA0B 3ZHOA 2ZP1A 5J4LA 1G21E 3FWZA 4R3NA 3PYLA 2OE2A 2TECE 3RJZA 2OEPA 3QPVA 1H2BA 4G5GA 4IIXA 4YUVA 4DLRA 1JR3E 3H8WA 3L7MA 4KYTA 4WBSA 3R9IA 3UJAA 4UOQA 4TT8A 2QAGB 4P0TA 3OJOA 4UASA 4WLOA 2ID9A 4F9GA 3M49A 2HDOA 1YZLA 4TV9A 2ZSBA 2XMGA 3DEJA 4MWGA 3E2MA 4CHTA 3LY9A 3R3ZA 3O73A 2PA0A 4EHJA 2IHBA 3EGOA 5TS2A 4JB2A 1L4LA 2WQZA 1O58A 4RZIA 3N87A 5HS4A 4XASA 3PVSA 1QLHA 4CLDA 3O9MA 1JILA 3GJXC 3G7SA 4DDMA 3QVGB 2P1DA 5K4AA 4PGAA 1NF8A 3D2BA 1X1RA 4OFBA 4D82A 4L8VA 5GMOA 1FS4A 1ONOA 3CKYA 1MKYA 3EFEA 4GLLA 1N8TA 4II3A 5FB3A 1C2YA 1ZH0A 1NFFA 2F17A 3JTMA 3LDFA 4O02B 3NNDA 5DGXA 5THXA 3RGWS 2IHJA 3PE6A 4JJAA 4QBFA 5THKA 4G1BA 4AJ4A 3N58A 2ZBGA 4G8CA 2B5WA 4UU1A 4B33A 4E09A 4P2GA 2VT2A 1P4SA 2IPOA 1H8HD 4PFKA 3T1TA 4IGKA 1UDBA 1O9GA 1XN1A 2WJJA 3BBLA 5EHQA 4MYSA 2EDCA 1A9ZA 3TE7A 1SU4A 1VRVA 1R5JA 2FCRA 4MYTA 5DIZA 3ZX4A 2W0MA 3O3MB 1P3DA 1QK3A 2VHJA 4NI5A 4I9GA 1JHDA 5DBGA 4FU0A 3UXYA 1OFIA 1OU0A 2VIIA 1G291 3GN1A 4OBWA 5EYPB 1XTRA 2HTEA 1H4QA 3L7JA 4ZVLA 1TJ4A 4A6DA 1G17A 2CHUA 4K46A 4BP9A 3OFJA 3ZLJA 1O9HA 1N3YA 4QDTA 1SCKA 5FBWB 5HMMA 3TAXA 1YRWA 2I03A 1M33A 2QRKA 4K8RB 4MUBA 4Z49A 3CB4A 4JL8A 3ZBUA 4OGLA 5K3EA 4DC1A 3PFFA 1ZVMA 4Q9HA 1YVUA 3UMCA 4UHKA 4AG6A 1DKMA 1XTUA 1SCIA 3RU9A 4BNLA 5IYZF 2IYZA 1E2IA 2EKBA 4KQGA 2GZAA 4Q24A 4DIUA 3Q5EA 5JV5A 1JLKA 3AI3A 4ZO7A 3L0YA 2DQSA 4MRMA 2J5BA 3STYA 3AEQB 2O8FA 3GNQA 4HNRA 4V2UA 1LVUA 1RR6A 3MUOA 1KI8A 1SCDA 3TKYA 1IN1A 5HF6A 3FZGA 1MRZA 1DC3A 1RJEA 3NPAA 1NRIA 4BQSA 3AVTA 3IQHX 2EFDB 4BU0A 4D92A 5F2NA 4DIBA 1TYBE 2ZRDA 3K1AA 4R9UC 5E2AA 2BVNA 5K4HA 2WUFA 4QHTA 3P32A 421PA 2DEUA 4LEIA 4RACA 1TFUA 3F6CA 2NV2B 4NAHA 1NP3A 3JQAA 3EQ8A 1UFVA 2ZJBA 3A28A 3GP5A 3KUUA 2H4YA 1YOVB 3L92A 1UC8A 5IFKA 2KLHA 4UOZA 4C4AA 1G4HA 1QQ6A 2Q9AA 1PVVA 4HX2A 3WO0A 4UMVA 3ZQUA 3KLNA 5BV7A 3TGLA 4QGFA 1DQPA 4XX0A 5IPFA 2OFFA 2P68A 4RKFA 2BZ1A 3NBAA 2X2OA 1Z35A 3ID6C 4X8MA 5CT5A 1IAVA 3N2NA 2W11A 3IQIX 4FDMA 2J48A 2YH2A 4QBGB 5COBA 2JRLA 3VNBA 2ZBUA 4YAGA 2ZIGA 1OXKB 4E15A 3Q0EA 2VO1A 3IQXA 4FILA 2ZSEA 4BJ6A 1W96A 1W76A 3V8PA 1KPIA 5JVDB 4EZBA 2X0RA 1DT5A 1J4AA 2QYSA 2VP4A 3KR2A 5C8VA 4XVQA 3ZV4A 1IHOA 1L2TA 1D07A 2FSGA 4M0EA 1IBLB 4DLTA 5T64A 1LF5A 2JAQA 3AIIA 4GE3A 3HN7A 2Q3HA 4PX3A 1C1YA 1JDUA 1A76A 1YUBA 5FBRB 4J1NA 2AMVA 1PD1A 1DBRA 2O2SA 2QM8A 1ZK3A 2WAMA 2ZJAA 2G83A 3BTOA 1T8WA 4LQ4A 1Z6YA 1WY5A 4KRYA 4OBBA 4OHBA 4B3SB 4RMNA 3NGMA 4HYQA 5HBRA 5KSWB 5SYNA 3TLMA 3W1VA 1B00A 1LJLA 1IRIA 1GPKA 1UBEA 1Y3IA 1BXRB 2Q2QA 4QICA 4B3XA 1GUFA 1TQ8A 4DDKA 4GWLA 1J00A 4B2PA 2Y66A 5D86A 4DSUA 1KVRA 1YMVA 1SQFA 4RLFA 3DP9A 3WDMA 4C76A 5K99A 3G7UA 2JJQA 3RUEA 1HXHA 1NYRA 2F9MA 3TLZA 3VO1A 1J8QA 3LH5A 1IOZA 2VYQA 2HJRA 1EZ4A 4I0WB 2D3WA 3RS8A 5M04A 1TYEB 1KQOA 2P62A 1IB6A 5GIPE 2I6XA 2CKDA 3HBAA 1YDHA 4YBZA 5TGTA 3TD6A 2PMKA 3QU2A 1BXKA 3WIOA 2Q3MA 2RCYA 4RQAA 5DXFA 3KQKA 1K75A 1QKKA 1NC3A 1FFXA 2CKMA 4NK5A 4INAA 4CQMB 4GEGA 5AKGA 1C7JA 3ICWA 4X3OA 5KU1A 1ZC4A 2O5RA 4OHUA 4F4JA 3PT5A 2H57A 4URUR 4CDMA 4ZQGA 1G98A 1CR2A 4BBJA 5C1DA 4F1KA 4L9SA 5CA0F 5CDYA 5KX5A 2ZJOA 5FTJA 4MQ5A 2QK4A 1HV8A 3ABSB 4X6UA 4ALLA 4BVBA 5JXGA 5TLSA 3DMDA 2RG7A 3CW2A 16PKA 4W7IA 3HP7A 4BKRA 2CK3D 2G1UA 3GJ8A 5DULA 4IW3B 3EPRA 4O59O 4UCQA 3EZ7A 5DHSA 3C6BA 4C7OA 4OPMA 4KQCA 5LOVA 3DFMA 3KKEA 3R8FA 2NO5A 3AMVA 2H1VA 4ILEA 3UFXB 4DJTA 2W6OA 5D3MB 4O2RA 3RC3A 4IGFA 2M2IA 4PC2A 5AM0A 3RUDA 2JF0A 1WS6A 3RYHA 4BOYA 4Z7JA 3NWOA 4UPDA 4Z9BA 1IOWA 3B8HA 4YJ3B 1IQRA 3IEIA 2C59A 4DA8A 3HFJA 2Y8EA 1SBTA 3QQ5A 2XZOA 3F5DA 2UYHA 1ECJA 3JARA 3T06B 1QANA 2JFXA 1OAOA 3JALB 4U6SA 4DV4B 1F0YA 2LD4A 1PWEA 4KE9A 1AZLA 3M1IA 1GRVA 1ZU4A 1PQWA 4RZ3A 4F11A 1MW8X 2ZG6A 1U28A 4Q93A 3C74A 1W88A 1ZOIA 1PYDA 2VLBA 2ZVQX 1IU9A 5JS1A 1EDOA 1OPXA 1PKEA 2WNSA 3I37X 1AE1A 1PQ4A 1VBNA 3L0ZA 4EEXA 1EVYA 3LT1A 2OGZA 2Y93A 5A4DA 4B74A 4MB6A 2G5TA 1WUKS 5LD2B 4HQRA 4KPGA 4UTOA 4NE2A 3JATB 1SEPA 1NBAA 5I6DA 1JEOA 4B09A 1Z0IA 1VKHA 2Q6OA 2YWCA 3HJGA 2X9GA 3V8RA 1II8B 4C1NA 2BT4A 1QZTA 4DQVA 3G0HA 4ARAA 4X1YB 3L49A 1STOA 3CVOA 3RVNA 4UAJA 5FBZA 2P65A 3MCZA 4RF3A 1WW8A 1V5GA 3DXXA 4P32A 4DEVA 5HPYB 4FMBB 2VSFA 2VTBA 3PWKA 4DLBA 4YJ2A 3OQHA 3VC3A 4WZZA 2C78A 2P69A 3I0ZA 3W2GA 2Z8XA 3TMKA 4QOFA 1ZGBA 2AG1A 3NHZA 3FVRA 1DQZA 4ZTUB 2WOOA 4LGVA 2O7NA 1SKAA 3KCQA 3ZZ1A 1VGVA 3OX2A 4RTQA 1GWNA 1GQFA 4OAOA 3SNKA 1ZM2A 2XA1A 1GPLA 2YY7A 2LE0A 4JXKA 4GP6A 2OPBA 1NULA 3SPXA 1N75A 3JQEA 5KNCA 1DGQA 2VDNB 5E95A 3KSUA 3TIGA 3NUQA 3FDZA 2UYCA 2WINI 4N9QA 1X2BA 1P5HA 1R7RA 1PF7E 2XNSA 3KJXA 4P4GA 5IKXA 3THYB 5TGZA 3NM6B 2RAPA 4HP8A 2PX6A 4FSXA 2XMBA 4FUQA 4N8DA 2F6RA 4YT8A 4JYPA 1AQIA 1Z8NA 3WA7A 5JASA 4P6VF 3SE7A 1M2VA 3UB3A 1D7OA 4G07A 1V0JA 2DZDA 5HA5A 3RIMA 3GPBA 4S1WA 3K6KA 4B7ZA 2DECA 1QWOA 1Y5IA 2ZTLA 3DMYA 1OIWA 3GCZA 3BD9A 3TZBA 2JGKA 3MWJA 4MICA 5D51S 2PVPA 5A6SB 3GG2A 1V9LA 4BHTA 4LSGA 4UFPA 3RBAA 4A7PA 2CHVA 2CZQA 2VHTA 4IVNA 2ZJ1A 2XNKA 2P2NA 2YFYA 3M7IA 2AXNA 4OQYA 4INPA 3BMCB 1D6JA 5FPSA 2I8CA 5FPQA 3W5UA 4A8JB 3ICQB 1CUJA 1QC5B 4DB4A 4B32A 4RPHA 1HLFA 4TS9A 3NBKA 4N48A 2L19A 1U1EA 6LDHA 3EXEA 2BFEA 2ZE8A 1DAHA 1XHFA 2YDYA 1QHNA 3Q10A 5CYFA 1LPPA 4V03A 3LTNC 4M89A 4TTRA 2AD1A 1XZKA 3FNHA 3ZV7A 1DWQA 1PTJC 3AESA 4CKEA 3NOQA 1E2UA 3OZSA 2JD1A 1CE8A 2ZIWB 1RI5A 1G3UA 3L8GA 3QFHA 2P35A 5EAIA 3TCXB 1E2DA 4B48A 4JOBA 1TZ2A 3TVDA 4CLXA 3I01M 4JK3A 1N3BA 1TEVA 1B2LA 2ZXFA 4F72A 5JI2E 3EUEA 4Z3DA 3VNQA 3BICA 3CGGA 4NYIR 1IVSA 2HCTA 1AKTA 2IY8A 1L3IA 4H35A 1YS4A 4LZOA 5CGQB 3Q9SA 3AU8A 4QJIA 1BKYA 3SNHA 1ZA1A 4RORA 2ADMA 2XE7A 3M6VA 5ITZB 1KI1A 4LOKA 5CLIA 1Y82A 1NM5C 5DOZA 1GYRA 1JHQA 5K3FB 1FNNA 2OB1A 1EFDN 5E7JA 3R7AA 3SDSA 2QOEA 4N0QA 1GR0A 3CO0S 1YR6A 1M7BA 2BMAA 4X97A 2SCUA 3IKVA 1RPAA 1H0HA 4P08A 3PLNA 2OO5A 3OEYA 3PGKA 2Q50A 2RFLA 1CDOA 4G0UA 121PA 1T9BA 2EYQA 4JSRA 3NV9A 3EFHA 1D9ZA 4WXRA 2ZI6A 5K3OA 3ONVA 4QT4A 1VL2A 2CDCA 3FSRA 4TWZA 5DI9A 3YASA 4YJFB 1VFPA 3MJDA 4MTCA 5A5EA 4S0XA 1BU8A 2FETA 1VCMA 2ZUBA 3L1KA 4ZHQA 3CG0A 4NE7A 4AQ7A 1GGKA 1P33A 1TU0A 5DNVA 4I5FA 5L3RA 1Y3CE 4WESA 3EJWA 1IOLA 2BKUA 5DM60 1I3OA 3V4SA 2Q5JA 3ZGOA 2FSUA 3UAYA 3QU5A 3UGQA 4F7WA 4A16A 3DVLA 4KKVA 4A6PA 3DO8A 3O4HA 2V7PA 2NQ8A 1POXA 1OBCA 4BNIA 2Y1CA 4B3TB 2OB2A 3EE6A 3GLVA 4Q4JA 2GCNA 1DUSA 1EXWA 1OYYA 2HLNA 3DZHA 4OXXA 1LBHA 4PVDA 2Z4RA 3H2YA 2IV3A 5CAEA 2ZRKA 4J4TA 2OCYC 3N2IA 1MQAA 2HA5A 2XB4A 4QULA 4EECA 3NEJA 2YCLA 3PUYA 3H9BA 5TSDA 1Y6JA 1I80A 1RLJA 4LRUA 1KQNA 5HZMA 2VYFA 4I99A 2VHCA 2I1QA 1IIBA 4UJ3A 5E1MA 3TPFA 4CIAA 3L6EA 4ME6A 4ROSA 3M4JA 2C4NA 6AT1A 3NANA 2AXEA 4LOLA 3RVOA 4AYWA 5FHRA 1B6SA 3V4RA 1G7TA 2CNDA 3FCYA 4QFCA 1XXHA 3K2IA 3F9RA 5I45A 1EB9A 2B5OA 3PVZA 1HUQA 2A5FA 1LKZA 2F1IA 2FUKA 3PQ6A 3QENA 4GYWA 5IAJA 3VYUB 2YJZA 3HKBA 1T2AA 4P4SB 1LS1A 4MWTA 2G0NA 1KVQA 4QECA 3WWPA 5A7HA 3M6LA 3WWZA 1BS2A 4M88A 5B1EA 4LBYA 1G8GA 1EVIA 3LUDA 3VR6D 1G8AA 4PX2A 4ANFA 3PX3A 1Y80A 2ETVA 4Q16A 3SIXA 5I5GA 3F2IA 1V35A 4PQEA 1E7RA 5B1YA 2OA0A 1IG0A 5L7YA 2PXHA 4F97A 5A03A 2B2NA 4YV1A 3D4OA 3I9LA 5LXTB 1ZKMA 4FJ0A 1Y6GA 2GAOA 1AHIA 2GN2A 2OY0A 3ILXA 3QG5A 2PH1A 2RGXA 1PNOA 1ZGZA 2ZRQA 3ZGLA 3WRYA 1TM5E 4KMOA 5JCJA 3RO7A 1Z13A 1PNQA 2XITA 4WDQA 5ESDA 3WFZA 3VSAA 5AI4A 4C0JA 3O2SB 3ND8A 1GL6A 3S81A 2RGCA 2Y76A 1EHYA 3B7WA 1N4AA 3W05A 5BRJA 4ZVVA 1M1NA 1PZHA 3FDIA 4IHJB 4DCPA 3REOA 1N3LA 2FDXA 4F1WA 3LW8A 3MINA 2VK1A 2OILA 3FSEA 3DXZA 2G9RA 4MV5A 3H99A 1CUDA 5DYGA 5E8RA 3SBXA 4RTNA 3ZU5A 2YS6A 4DDWA 2O06A 3ROMA 4K86A 3CWCA 2C8JA 2E4XA 2JDIA 2I65A 2Y1DA 1Z68A 3GJTA 1UBOS 2VHEA 3H5IA 1LSUA 4C89A 1O57A 4KK4A 3C3AA 4RLQA 4E21A 3TQFA 1CQZA 2QMUA 4WZAB 4AUKA 3T4PA 4TLDA 3S1LA 3W8DA 3WLTA 4E51A 3K5IA 4AS3A 5CEJA 5DNUA 1U63A 1JEEA 3HYSA 4C2UA 1L9KA 4QBKA 4JGBA 1XFDA 2XH8A 2XXAA 2PMBA 2HHLA 3OSUA 5B58C 3MRVA 5IYZA 4XWWA 1SUFA 5FL3A 3JQBA 5EERA 4HNVA 5J47A 4E30A 2G28A 4LFBB 7REQA 4XTRA 3DAOA 4RTMA 3O8CA 2EX4A 2XNDD 4MA5A 2JAXA 3GGOA 3V4LA 1A1SA 1EU1A 2J7PD 3DULA 3LQ2A 5CXSA 2C54A 4ZEVA 2HA3A 2PRKA 2AHRA 4MQEA 2H52A 3IIKA 3JQ8B 1MXFA 4R5HA 1K9VF 3QY9A 3QYFA 3SN6A 3HL0A 1VA5A 2IK8A 4MYUA 1Q21A 2Q7OE 2LIPA 5LLTA 3HDQA 3KSAC 4QUBA 1YZKA 3CWQA 4YXWA 3AILA 1Z12A 5FUMA 2AUMA 5CXXA 1XPUA 2VTEA 1KZHA 2F8MA 1VYVA 2BHRA 2Z9CA 3W5JA 2WV9A 3N2ZB 1G20E 3AF3A 1NLZA 2OYRA 4K40A 4I9UA 4ZO4A 3D7MA 1I36A 3H1EA 2C1ZA 3COWA 1ZL2A 1TDJA 2BEVB 4I7EA 4QPPA 3WZMA 1OZ0A 3D64A 4W9RA 1JFLA 1YJ8A 3RLIA 1BRTA 2GJ4A 3ETNA 4P92A 3VDQA 4MHSA 4ZGBA 4L5AA 3HDHA 4O6VA 4E7PA 2IGBA 2QL5A 2ZUWA 4CLEA 4CQJA 4XAQA 1JHMA 3KZMA 4O8CA 1T8SA 1D09A 1LBQA 1UMDB 1XAHA 2F3RA 2P8JA 1KP3A 3AINA 2RCNA 2FRDA 1TM3E 2FZKA 3IHLA 4XPIB 4FB5A 5JISA 8ATCA 4JU8A 3GRUA 4IVQA 1CLEA 3T1HB 1BJRE 2W8ZA 1S8OA 1XTZA 2G0TA 3D6VA 4D0LB 1E18A 1JG6A 1WMBA 2QZJA 1T6NA 2HK7A 1E2JA 2RJOA 5D01A 3TOCA 4C5CA 2C8VA 1Z6XA 2GPWA 3B85A 2IUEA 3BJMA 3CLRC 4V0LA 5AYVA 4F46A 4U7HA 4IIFA 4CKZA 1AJEA 3ES9A 2HOQA 5LQCA 4TX1A 4BZWA 2VDLB 1WRBA 3DFUA 3KPUA 2W2OA 3KQMA 5ESWA 4DMHA 4IR7A 4E33A 2FPGB 1PFKA 3RREA 5J4KA 3AF6A 3TW8A 2I8AA 1TL7C 1Q2XA 5ALPA 1ODFA 4PPYA 4JSYA 4FB4A 1ZGGA 2GYUA 4QU0A 5DPMA 1W0KA 4M1MA 2O2GA 5TY0A 4L6IA 1LXCA 2VDMB 3WNCA 3CRRA 3DDCA 4TKVB 5DSZA 3ADBA 4BUZA 4U2KA 1ZC3A 4IDQA 2ZSUA 5DLDA 4AYXA 3BIJA 3K0AA 3TEFA 4N7RA 5EE0A 1IY2A 1PQPA 2QV0A 1R0SA 5KYWB 4LQDA 1RQ7A 2R6JA 4NZOA 4O4LF 4BRWA 5SZKB 1LW7A 1U0HC 3TLYA 3W5VA 1S6YA 3ZY3A 2X23A 1JHOA 1TW2A 3COZA 4I6GA 2FX3A 1ABFA 1I0ZA 2WAYA 3H5AA 3OPYB 4KYIB 3R5FA 4DCSA 4Z7OB 5J63A 2J6IA 3OFND 5KPJA 2HHJA 3M6XA 1CHNA 5KNBD 4J90A 4OU4A 1MEEA 1IY0A 2FZCA 1WMSA 1CQWA 3ZCQA 4DCUA 4AL4A 1CJTC 2D0OB 1EUQA 3B89A 2C03A 1JT9A 3IPAA 4MWCA 1ELOA 1NMSA 1NG9A 3M5PA 2Y0BA 5CA0A 1BHO1 1IPHA 4RDCA 3KYDA 2DPLA 2EOAA 3EQ2A 2YZNA 2A9KA 4K9RA 4WJZA 1NJ8A 3DV2A 4AROA 1ORVA 2JIPA 2D00A 1TLTA 4HQOA 5EXDA 4ER6A 1TEXA 1AKWA 1CIVA 3PCXA 4BFUA 2PSEA 4X9XA 4DHWA 1XEXB 4EHDA 3GEPA 2R4TA 1LFAA 3F4KA 1K68A 3EFOA 1H1DA 3IJ5A 4L0CA 4TRJA 5CX1B 2ZI9A 3RRZA 1DBWA 5AVVA 1O6CA 2KPOA 5U4XA 1MVLA 1V39A 2HGZA 1BGWA 3OETA 4AF8A 2I4OA 4MWOA 4G9EA 8OHMA 1J2UA 1W1WA 2ADFA 3ESAA 4EG5A 1J6UA 2NUAA 2R9VA 5FOUA 4DFDA 1ECCA 2WG1A 4BMOB 5A9TA 5T41A 1QU2A 1AQLA 1FFWA 4HWKA 1ZNXA 1ESNA 4H27A 1AM4D 3AM5A 4KXMA 4CCYA 5DNDA 3C6KA 3TWOA 3GFFA 3IQFA 4MRRA 2QVYX 1SVNA 5FO1A 1IXKA 2D1FA 3A4LA 2XGSA 3A4TA 3UMYA 1FYXA 3MGBA 1SHJA 1W4AA 5AJWA 1FIUA 3DEFA 2ZFUA 3WTBA 5GZ6A 4RLSA 4DVJA 3K9LA 3ZUPA 1TJYA 2D0PB 2XDQB 3RAEC 4CM3A 3QBDA 4W7HA 3QEAZ 3RJ9A 1MG0A 1R0BA 4BCDA 2BR3A 3FUCA 3QFFA 5IEBA 2WY2D 2WFZA 8ABPA 5JANA 1W36B 1MDFA 1Z3IX 1UFRA 2BTQA 2M6SA 1UOQA 1JE1A 3EIXA 1NRJB 2H4HA 4PW0A 5BWNA 3LHSA 3L02A 3PXXA 1I0IA 2NPFA 1G66A 1IBRA 1U2GC 2L42A 4HDNA 4BKUA 2R1VA 1XNGA 2OBYA 4LQLA 1T36A 4WH0A 4CRWB 4DIMA 1V2GA 1ZNZA 1F7UA 3B1ZA 1XNRB 1QIJA 5LDDC 2CNWA 2VJCA 4ZTZB 3KWLA 4B79A 3DLTA 3K4PA 4GG1A 4MI6A 2UDPA 1MRNA 1QH8A 2XZPA 3L9XA 4QDUA 4QLBA 3RWOA 4G23A 3O1IC 3SYLA 3PC7A 3R0IA 4FMDB 3STVA 5K6AC 2J3JA 4PFSA 3AF1A 1ANKA 1WZIA 2VXYA 4RIHA 4JEMA 2CUKA 2VF8A 5LZ7A 3TLGA 1Z37A 3I9KA 2V1UA 4J0HA 2Q2NA 3HDGA 1SKYE 3R0ZA 4UVEA 1FF9A 2KSQA 5DLQC 3WAJA 3AR2A 3LRTA 4LOIA 3Q5GA 4R2WA 4GYKA 3GFOA 5K0NA 4L4YA 1ZW1A 1CJKC 4BTLA 4EQ6A 2YJ5A 3IAEA 4IQ4A 2C3YA 2OO3A 3DDZX 3DZDA 1E77A 3S40A 4B82A 4U2DA 2C29D 2UAGA 1SVMA 3LO5A 4OM7A 3SF8B 3TOSA 3AB3A 5CVUA 3UN1A 1PW5A 1ZCBA 2RGRA 1FX1A 2RGYA 3FUTA 5DEIA 4B3HA 1FFYA 3EISA 3LA8A 3Q7TA 3ZOKA 1WG8A 4ZT6A 5HDBB 4HDKB 3D8UA 3QX3A 1OZAA 2GJ8A 1VIDA 1YL6A 2JZNA 4C7VA 3EMDA 5FQNA 3U1BA 2FPKA 1L0BA 5TEVA 1TNDA 3AFHA 1NFRA 1WPRA 4PZYA 4G0WA 3L8DA 2QN7A 1AKYA 2X7XA 2HFKA 3I6IA 3TNFA 1E3TA 1Q7GA 2PMCA 2XUAA 4OB8A 4B7XA 3TTWA 1CERA 1KEVA 4G65A 4Z4CA 2GNAA 4R31A 2H4FA 3HZOA 2Z09A 5FORA 4JOCA 2WLSA 3LLVA 4OOEA 3ETDA 3O93A 1NONA 2EARA 3AP3A 3A25A 3ELWA 2MSDB 3R6TA 4EVQA 4ZZIA 3GCWA 2IHNA 3O3CA 4XM2A 4OI2A 5A7GA 3GD7A 3OJXA 1MD9A 3S68A 4PONA 4BVLA 5DM4A 3EZNA 2H5EA 2DCMA 1UKCA 3CSSA 3FVQA 1QYIA 3KDSE 2BGLA 3SJAA 3VAZA 5ILOA 1J5EB 3PF8A 4NBUA 4KXYA 3DEZA 2BKEA 4UD2A 5DV9A 1UBCA 4GOND 1GIAA 3AUYA 4GOXA 1ZI8A 1A95A 4MUMA 4UNSA 2MJLA 2WSSD 3PSHA 2ZRIA 4C0QC 2V4MA 1VDMA 1MB4A 1KYVA 4KIWA 1YFZA 4HYTA 2OYSA 5JZMA 2EZ8A 2E4UA 3GBPA 2OUKA 1CY1A 2OENG 3LXRA 1U0NA 3R3JA 4GYYA 4FLEA 4BASA 4JITA 5E9WA 3EXIA 2OOSA 2AZMA 4NJMA 2BBSA 1UC9A 2FHPA 3BJZA 4HNGA 4K5QA 3SAJA 3ZQJA 2BZGA 2DLNA 2XUKA 2Z57A 4QQ8A 2BMVA 5B57C 4HAYA 1G16A 1GG9A 5GINE 1SKBA 4MYHA 2M6LA 1C9KA 1JR4A 2AD5A 3HCBA 3OCJA 1ORHA 5B3JC 4L51A 3CUYA 3DW3X 4Z2AA 3GFVA 1W30A 3H19A 1V2HE 1J33A 2WMDA 2UXCB 1AKMA 1KYTA 2ZRPA 3FPFA 1UMCB 1RLOA 4XGQA 3ZE2B 1GQYA 4EHBA 2JIZD 2ZT6A 1USWA 1ULAA 2A9FA 2ORIA 3OC0A 3D2AA 4HRVA 4YFYA 5AKHA 5ALQA 5EMHA 3RKRA 1XZFA 1GRCA 4WUVA 4TYQA 3WK5A 2BEWA 5LR6A 4WOKA 4KMRA 1JA0A 1P77A 3QEOA 2CUTA 1WD7A 4JVNA 5AHRA 5DTRA 4ALJA 5FTLA 2QUIA 3G9QA 3HPRA 1C9DB 1QV9A 2GXQA 3U3KA 4YJDA 4BYMA 1QHIA 2GZ1A 1FJXA 3T9EA 2QX7A 1LBIA 4UNQA 2UZ0A 3D6JA 4ZRMA 3FIUA 2JVKA 2XEXA 3G2IA 1VIVA 1YCGA 2BFCA 3GL9A 2CSUA 2PT9A 4RCYA 3MA0A 1LBEA 1Z0KA 3W3AH 4BKQA 1RHUA 1YT5A 5E4TA 3AUKA 5KDDA 1UPXA 2IXGA 2AG6A 3QU9A 2VNKA 5E38A 2FDCA 2YV1A 4U39A 3FHCB 4CIYA 2CJFA 4CF5A 1PHRA 3JPWA 3AVVA 3K9FC 4C01A 2OD7A 4LVOA 1NX6A 1PFVA 1VL1A 1NN1A 2G07A 4EG8A 1NFQA 2YC4C 4FJ2A 4K28A 3D5QA 4DRXB 1VSVA 2A5JA 2PPVA 3NYWA 3U4IA 2NUTA 2DFNA 1KMNA 4O29A 3RHSA 3U7QB 4BWGA 1HT1E 3TNLA 4E94A 3PHGA 3DD5A 1YQQA 5BYJA 3HABA 3W2IA 5LQAA 3LCUA 1VSUA 5TMEA 2D4AA 2IEIA 3TSOA 3NUGA 3A26A 1DX9A 4QGGA 4R5MA 2B61A 3JZFA 5JH7B 2DTDA 1Z0AA 2ZIAA 3H8SA 4DMFA 4KE8A 4RHFA 3O82A 2I2CA 4J91A 5IAGA 1PG0A 221PA 1RRFA 1DT3A 1DC5A 1C5KA 4PSDA 1ZKDA 1M9NA 4FCVA 4N1AA 4PO9A 5TS3A 4KWHA 4MKRA 3TLKA 2OORA 3BSWA 1V8ZA 1I10A 4I1UA 5ITSA 1L4MA 1U5BB 4A15A 1K89A 1N5RA 1N6NA 3OUZA 3D0KA 4RJIA 4IHQA 4YUXA 3WK8A 4MAFA 2J87A 3U5TA 1U3FA 3SQDA 4HNSA 1FMLA 3ON5A 1NXTA 3FMFA 3VR2D 1LS6A 2QTNA 1Y4UA 4IKEA 1YAJA 3HB1A 1S2DA 1HH4A 5I7SA 3WMGA 4RMGA 3L84A 3D3NA 1OWOA 2H51A 2JI4A 2BPOA 2BL4A 3WY9A 2GWHA 1CHDA 2K6GA 4JY7A 3GEIA 1X7XB 4QX6A 1EGQA 4CMBA 5L95A 3RG8A 5JTUA 1ZFNA 3OWXA 3FTFA 4BLQA 2WIAA 3E8MA 1WDTA 4RS4A 1LDMA 5U1PA 3C0KA 3SU8A 1GV1A 2RSLA 3H1BA 3PFNA 2RKOA 4CKCB 1DRWA 1FTNA 3IIEA 2C4WA 3HUFA 4M1TA 4L0DA 3VO8A 3AL0C 3WIVA 3LP6A 4WFQA 3VI4B 4X20A 1R18A 2V97A 4OHXA 4KQEA 3O47A 1TA0A 1QZXA 5JSYA 3N74A 1QB8A 7MDHA 3V7NA 3LQFA 1I7DA 4O1MA 2BJHA 2ESRA 1PSWA 4DYVA 1KHTA 1C8BA 2RONA 1NPYA 5KNDH 1UWLA 2QENA 2IX3A 1JV2B 2NYRA 1XVLA 1ZHFA 5EUCA 1FP6A 3A70A 2ODTX 4AZ3A 1T10A 1YK1A 2QKYA 2R60A 3IPXA 5K3SA 3T3MB 2XA2A 4C0WA 4NHOA 3UWPA 5HF8A 4URFA 4ZVNA 1FZQA 3ZCRA 2PXXA 1JHZA 2JCXA 4LHZA 1SZPA 1UPCA 4YT5A 4V1CA 3K5HA 3T94A 3PUIA 3NHLA 2XCUA 1IHDA 2Z2KA 3RODA 4BNGA 4AZVA 4AQYB 2YIVX 2A6PA 1N7JA 1H5QA 1MFPA 1NJGA 3C85A 4KVFA 5HS6A 3WHLA 5CPBA 3VU9B 5MGBA 1MO6A 5EJIA 1OAKA 3R6DA 1IWOA 2R47A 3WWDA 4F7DA 3GIDA 1KO1A 3A1TA 4GE0A 5JMOA 1UH5A 2QW1A 3OIUA 1DRJA 1W5AA 4W1SA 2BKXA 4B0PA 3DAPA 4CN9A 2OLJA 3Q2IA 3OM8A 1VYUA 4AWBA 4DLKA 3ZWOA 1Q15A 3MUNA 1GITA 4JOSA 4BQNA 5HIKA 1S96A 2NO4A 1TVKB 2OMEA 2YHSA 3EZLA 1YTUA 2ORYA 3TI7A 3GFPA 3KWFA 3KOOA 1WM1A 1J8MF 4M2LA 1ENOA 4XD7A 4OLFA 3WIBA 2TRSB 4BPRA 1W8IA 1CX9B 2XKKA 4R81A 1E6CA 5AI8A 3V33A 3X44A 2X77A 1Z6ZA 2V4ZA 3GJ0A 5GGYA 3UMBA 1FP2A 1OLSB 1QVVA 2IXBA 2NAPA 3EH2A 3IHWA 3MVEA 5EUQB 5BV2P 4O0MA 4LQCA 3R7DA 1N2CE 3R7WB 2P40A 2J0UB 1M67A 4HAXA 3ZU2A 1L7DA 3KOWA 3X1MA 3VNVA 2V54A 2WWGA 2ZJ6A 1J23A 2JHCA 2W2VA 4DR4B 4E5VA 1CRWG 1PX2A 2VP6A 4HJXA 4A0HA 1MABA 3EQ6A 2AJTA 1GCAA 3LDAA 4CKBB 4XQ0A 3HA2A 3RVLA 3RC8A 1UJ4A 2EFYA 1D3AA 1VPLA 2H4ZA 4FR2A 4HO1X 3R3SA 4H18A 1AC5A 5CVVA 1THTA 4Z5XA 2QPTA 1AOXA 2D8MA 4DL9A 1I2AA 2A9JA 1O97D 1UJ6A 3LQRA 4LRYA 5EG5A 2GTPA 1GFWA 3AEYA 1N5IA 1OJ7A 1RWMA 2DYKA 4LMBA 1PFGA 4IJQA 1A96A 4K9KA 5ECYA 1DRVA 1NE7A 1JP7A 2CLKB 4POAA 2ZYHA 3K8YA 4KC0A 4D57A 3PP8A 3RRYA 3ZIDA 4HUJA 3ZKWA 1UJ2A 4V0RA 2HZBA 4UBKA 4C4OA 4P53A 5DNCA 3RTEA 3L01A 3BDVA 1Z5UA 5EMLA 1MMFB 1P7VA 1X9GA 1WUTA 2JAWA 4ZI3A 1MBZA 4HLUA 4LUCA 3WXBA 2A1TR 3QQPA 5KTSA 3UO8B 4TQGA 3C41J 4US2R 4QTUB 4X90A 1BNCA 2J31A 4KUEA 1IM2A 2V0NA 3OY7A 4U5QA 1I3CA 4I4TF 3V1YA 4QOHA 3V7YA 2QN1A 5KPDA 3ABOB 3BZUA 3NVDA 4ISCA 1RRMA 3OLCX 4NJOA 5JJIA 5TV2A 1WQ4A 1XCOA 1IZZA 1DZIA 2ZDGA 2Z95A 4KKXB 5B12A 2C3OA 2R5FA 2XLCA 3RBZA 1P62B 5IULC 1EXNA 1P1RA 1LVHA 1KEUA 1UJ5A 4JI8B 4QRHA 4I1IA 5TF0A 2BEKA 3DLCA 3MG9A 3JWHA 4A8HA 1IXRC 4HDRA 4HXYA 3LIPA 4NBSA 1QIHA 1HKHA 1DX6A 2P30A 3MMSA 4MUXA 1J70A 4S3MA 3QVMA 2F43B 4K2HA 4TT3D 3TG2A 4MPDA 1VI5A 1KJIA 3D3JA 1G6Q1 1F2DA 5BRAA 2IZ1A 5HVNA 5J2TF 1FY2A 4KODA 4ZU3A 3N6XA 3Q7SA 3CC8A 1O6BA 3S2ZA 2X41A 3HU5A 2IHYA 1LJ8A 5BT9A 2WYWA 1GGJA 4GEKA 3TJMA 4M38A 2IV2X 4KO4S 5DBFA 3RYFA 3SICE 3ZJYA 5BSWA 1MRSA 3H65A 5LU9A 3O9ZA 4EA7A 4UEJA 4FHCA 3AHCA 2CBXA 1YXMA 3LNCA 4TLEA 4BFZA 4QXMA 3FTPA 5IKMA 1RHKA 4MVCA 3UJ6A 5AM5A 5IP5A 3L4JA 2O8CB 2QE7A 3D1VA 3W2TA 3EQZA 3RROA 1FEZA 2W00A 4Y1GA 4CZ2A 3GBVA 5HHTA 1MAVA 5T6BA 2Q3CA 2OVFA 2DBQA 2PT5A 4R68A 3PHLA 3C24A 4JLAA 2O0HA 4IP0A 5JQGB 2N1MA 2OCIA 1S0UA 4KXFB 1EXDA 1EE2A 3N07A 1VPDA 4A10A 4O5AA 3GLIE 4F45A 3ZK9A 2A5GA 4ZYYA 3HV2A 1KRHA 3R1IA 2GASA 1DBVO 3NKVA 5DWDA 2I2DA 2KHZA 1KJQA 3X3HA 2VZLA 1C41A 4I55F 3IC5A 2Z3VA 3FWNA 4G4GA 1JG7A 3CG4A 2VJKA 1P2VA 1WEKA 2DFKB 1GNRA 4TWRA 3D6HA 3LUKA 3MN1A 3FROA 1K8XB 1L7VC 3HHEA 2PSHA 3L4BA 1HDEA 4F4HA 4KR2A 1WKVA 5C5DA 6CHYA 1CZHA 1KO7A 1QHHB 1UT6A 3F8WA 3CZQA 2X0IA 1JGTA 3K6RA 3QLTA 3QYPA 4GPEA 5DNYB 3UC5A 1E6MA 3KHKA 5CB6A 1QCDA 2QA5A 2REXB 4ZAXA 1JHUA 4RFSB 1I9GA 3DVAB 4ZYTA 4RX1A 3HR4A 4CIWA 1E9BA 1I8TA 3U61B 2P0EA 3GF4A 4AJ1A 4UHFA 5KWJA 2YOGA 3P9RA 5M29A 3QPCA 3PV0A 5LDHA 3TYXA 5KAMA 3H8VA 2HCRA 3TBKA 4JN6B 2RGUA 4C7KA 5KJCA 4E5NA 4PNPA 1F2VA 4UTXA 3G5TA 4MV1A 1UXIA 2H08A 1U02A 1AHPA 3PWZA 2IWHA 5BSTA 1IXSB 1CJMA 3NLLA 3C3BA 1Z38A 5B4UA 2J3EA 3EEFA 3IIIA 4IJVA 2BKVA 5JY1A 1AIPA 1I30A 3MCVA 1NF9A 1U2ZA 1T24A 1OKKA 3PWTA 5FBHA 4W5RA 4TROA 4FHEA 4IAOA 5CH3A 3RF6A 1UPAA 1T9DA 5SY4A 1CR0A 5ETJA 4CW7A 5H81A 3M0EA 2RH5A 1KJ9A 2FPUA 3O8OA 1YQUA 1FJ2A 1JQEA 1PR0A 3H9EO 4Q7KA 3WNZA 3M89A 2VNSA 1UM9B 3ORFA 4F04A 4MS1B 3U3JA 5KUTA 3AEKB 4G41A 1M34B 1O1YA 1SVSA 1JQDA 2BDUA 5CDFE 4BJ3A 1TQDA 3K9QO 4FW9A 4OJNA 2GSDA 5FOXA 3OE1A 1FSSA 1RWBA 5J1TB 2PT6A 4HVTA 5E7MA 7GPBA 1EBBA 3HXPA 2FUNB 2Q07A 2FJPA 4TXNA 3PPWA 4ZOAA 5DLYA 2RGGA 5FA5A 5K5EA 5JDCC 1U3DA 1P4RA 2O9JA 2A14A 1KFKB 5FAXA 5JSKA 3VR5D 5HQTA 3VHXB 3K73O 3HKEA 3ZHUA 4Q7JB 1WXHA 3QOFA 2EKZA 2SHKA 4NJEB 4FOOA 4NOMA 1V16A 2ODWA 1W5SA 3E4CA 4B6FA 3VBCA 2B0CA 1GNSA 4AKGA 2P2CA 4GLFA 2NACA 1NY6A 4ZZ1A 4RD1A 4YMWA 4LJ7A 1HEUA 3VJRA 3KLPX 1QIFA 3UHAA 2PVSA 2BGTA 2C2HA 3GUUA 4GIBA 4JWKA 5EKSA 3T0FA 3K15A 4YCSA 2CDBA 1L7OA 2JZCA 2ZAMA 3AUTA 3VO9A 1U2TA 1ZMTA 3OESA 2AH5A 1Y1LA 2H06A 2H54A 2PY6A 2RGNA 2X8WA 1A27A 3PYMA 3CS3A 4LJLA 2ZAGA 3RSHA 1CP2A 3KTAB 4DV2B 1MJFA 3FPEA 3HLKA 2AWOA 2VAVA 1WZ2A 2OGTA 4PQRA 4TL8A 5P21A 3TG8A 4MIYA 5CIYA 1OFGA 1YZ3A 4PRLA 1YL5A 4R9NA 3RV4A 3Q72A 4TMZA 2BR4A 4YGYA 4WK6A 1VBKA 1OT3A 2E6KA 4NYJQ 4TL7A 4UHBA 3CJTA 4DY6A 1Q0QA 1TYZA 4PHCA 4EB0A 3ESYA 1Z4OA 3SSMA 4MGEA 1VHDA 4JBLA 1SCUB 2GT1A 5A5FA 1ISFA 3I32A 2ONYA 4G56A 1GD1O 1SBHA 3T8YA 4CU5A 4ENPA 2JGMA 3RVBA 2XKJE 2HQBA 2JFZA 2DLCX 1WUIS 1DG1G 5IABA 1YIOA 4FXOA 2FF7A 1O9BA 4S2EA 4AUNA 2YY5A 3GA5A 3SBEA 4RZSA 2XCTB 1TVMA 3JVDA 1T25A 1II9A 3VSEA 2GOYA 2QRMA 1XCPA 4CM9D 5EE9A 3W9UA 4B87A 2QX6A 4N7MA 4L1KA 4LGMA 4U2GA 4DCMA 4ZOQI 3MIIA 2P4EA 2X7JA 2XWSA 1PR1A 2P5YA 1BCSA 5BWLA 1M2NA 1K3UB 1X1AA 2QR2A 1RC0A 3OCWA 3TX2A 4BP1A 4Z6KA 2QTZA 5CA1B 4OHVA 1AUPA 1Q17A 1QFZA 3CX4A 3E22A 1WVMA 1NN3A 1RZVA 1JG3A 1L7MA 3C3EA 3C8MA 3D8BA 4ZVUA 2HRDA 1KS2A 1FFSA 3GD5A 4PHHA 3W34A 3MCUA 1V11B 2JVJA 1PFUA 2TYSB 3UJNA 1FP1D 3W6ZA 1JTEA 1LNZA 1H1LB 4JLBA 2KI5A 2R6ZA 4RKQA 2R8XA 1CNFA 4ZOLB 3WLKX 1A9TA 1RYHA 2OV4A 3R6LA 4EPWA 1WCXA 3H5OA 5KMGB 3ILHA 5CB4B 5KKNB 1Q1BA 2WKSA 1SD2A 1H8EA 1Y37A 3H4TA 3NHRA 4ZP1A 5ITVA 1VHQA 3IAS1 3FOWA 4Z1MD 5KYTA 1ORTA 3HO8A 2F3TA 4B1FA 4FNMA 4WZBE 1GARA 5IT4A 4RVFA 3A9VA 3P2OA 4AMYA 4ENRA 1CKEA 2AZTA 2VH2A 1GAJA 2Y67A 3AR4A 4NK4A 1Y5LA 4OCZA 2XUPA 2POQX 5LQMA 3NW9A 3LSYA 4JB3A 4YDHB 2BEJA 5L4LA 4EFLA 5LMZA 4FN5A 3OICA 3BA1A 3TLCA 1LTHR 2HMAA 3TSAA 4PQYA 1IULA 2B2XA 1RXSA 3TW6A 2XZLA 3IXMA 4OHOA 4C4XA 3AB7A 4Y9TA 3EXFA 3D6UA 2P41A 1SUDA 1TU3A 3MFQA 5DN9A 5JAQA 3BSYA 2CF6A 5EJ9A 3JX9A 4HDMA 2C42A 1U8UA 3B3JA 4RMIA 1Z36A 4J1TA 5K8JB 1M5UA 4RHTA 3QWIA 3EWSA 4K1LA 1TJPB 1WZUA 2QUZA 3BAFA 2JEOA 3SZUA 1JSXA 4OA5A 1VL0A 3EVBA 1E2EA 3BB4A 4BMSA 3T5TA 2C94A 1CULC 1MGPA 1M6NA 2XT6A 4KK3A 1SFRA 5AKYA 3EC2A 3QLJA 5F12A 3ZYCA 3ZHVA 1SXPA 2JCVA 5BR8B 5AVJA 1DPGA 1TVCA 4ND8A 1D4AA 3SEZA 4ARVA 4M46A 2ZRMA 4CEHB 1VA4A 3CYFA 2HBZA 1E0SA 1PZMA 3QKRA 1UBHS 2E49A 2YBDA 5AHWA 4ZK2A 1GA4A 2VWPA 4E22A 2QM7A 4O2AF 1GDDA 5LC1A 5KQRA 4CLOB 4PPGA 2W2XA 2IYPA 2PGAA 5DBIA 4UE2A 1U0FA 3GMDA 1FNCA 3RUCA 4D6PA 5I8PA 1KAGA 3GJ4A 2PKQO 2DMRA 5TVGA 2N75A 5JXHA 1CDEA 1C4XA 1SB9A 2GD0A 4LJRA 1RAIA 3ZKAA 1X8LA 3NT2A 4I46A 5TQ2B 4MH0R 2JB9A 3WGLA 3VKWA 3RHTA 1MP0A 3RANA 3TIVA 3RUIA 5IF3A 3MOSA 2BLNA 4IS2A 3HV0A 2AFHB 3GIWA 4H1HA 4CL8A 4ZV7A 1M2WA 2FX2A 2W9XA 3OVMA 2J1LA 4HD8A 3K8OE 2OBMA 1JHAA 3WLSA 1FVFA 3JR7A 2H7YA 4F93B 5BPFA 1YMUA 3U7EB 5JAPA 3O3OB 1X3SA 3F49S 1ULZA 2P9GA 4CETA 5B5SA 2R1TA 3IDZA 4CG1A 3PEYA 5K2OA 1GGFA 1T1SA 4UNRA 4FEAA 5TNXA 4LG1A 2RARA 2ZR0A 3MPOA 4M21A 1N6IA 1VFNA 5EGNA 1ZK2A 1VKNA 2PEYA 4N5MA 1A9XA 2I66A 2WD7A 1M8FA 1IQUA 1W52X 2XTAA 4X41A 2V59A 2HF7A 4II2A 3SZLA 4CMEA 4RA6B 2O0LA 2EL7A 3KKKA 4GVLA 2IDZA 4X3CA 3UJ7A 4G1CA 5SZJA 5ALRA 4FFWA 4CT5A 2FLKA 4P3PA 4K9DA 3B3QA 1GOTA 2OLEA 5TVKA 3EEYA 3KYCB 1CZOA 1WB9A 1W29A 1XZBA 4K6HA 2HMUA 4I5DA 4M8KA 4C6TB 4AZ0B 3T7RA 4BDSA 5ES4B 1E7MA 4OXKA 2ATIA 5FTMA 1YC2A 3TKAA 4DCVA 2X9LA 5BV8A 4RKRA 4XDYA 5AXDA 5C1PA 1GCGA 4OXYA 3UC9A 2R84A 4IDDA 4NH4A 2VQSA 4RM2A 4XFKA 1GXSA 1Y7IA 2LV8A 3V1MA 1IG3A 2C5SA 2I4LA 4NCHA 2R5WA 2ZIVB 2DPHA 3BFJA 3ZDYB 4E88A 4QKQA 4ZHSA 5HWSA 4D26A 3PDWA 4RD2A 5HMLA 4MKHA 4MQ4A 3ZVKA 4D98A 4JC8A 5G53C 1ZH4A 3IEUA 1UINA 4K6CA 4WD3A 2WF5A 2HWXA 2YVKA 1IQ0A 2E9SA 3A58B 5EP3A 3NO4A 3A6GA 2AX3A 3V4ZA 4EI8A 2H1SA 5DHTA 2F4NA 1H3FA 4LZZA 4P9NA 1DWUA 1BHQ1 5FEUA 2Q28A 2WD9A 4S1NA 2WM2A 2GLXA 1T2FA 1XRJA 1PZXA 2PX0A 5CW1A 5D3QA 5BMVB 3HA5A 4JP5A 1UBGA 3DBVO 1U0BB 2G25A 3EOZA 3STXA 3QVJA 2BN4A 1N2ZA 1SPXA 4X93A 4HB4A 1QGOA 2TMGA 3O4GA 3ABIA 2WB2A 1DC6A 2B4TO 2QRVA 2OK8A 3HKDB 2JFFA 2V96A 5IVDA 3EPPA 4AY4A 2B4YA 2W4QA 4WBNB 2Y1XA 5MHTA 1D1TA 3AR6A 2CHGA 1F5NA 3C4VA 2ZJ4A 4HDCA 4F5WA 3OAAD 2H0RA 4GZMA 4F9EA 5AVSA 4BWFB 4MDFA 3ISTA 4Q39A 2Z2JA 2BF7A 4MA0A 1YI8A 2WPDD 3CEPB 1G18A 1LH0A 4K1XA 4XQCA 1EGAA 4XEUA 2YHIA 1NZFA 3T9AA 2OBFA 1KU0A 3JS5A 1G55A 4N03A 3VVBA 1WJGA 1E62A 1UXGA 1VB3A 2IXAA 3IH5A 1JRLA 3PFWO 5BN4B 3MHTA 1YZFA 3ADCA 2CXTA 4B6QA 3CNEA 1JFRA 2BAGA 3VFDA 5HR5A 2X13A 1OBFO 2UZ4A 3UB4A 4D9IA 2Y9MB 5FUYA 5AUOB 1XMVA 2ZRGA 2QY6A 5CFLA 4JHLA 4F38A 3I8OA 5J2UB 1U7UA 2L82A 5FUVA 4ERNA 1LNQA 3HFGA 3KQVA 5AVWA 2FX5A 4DJ5X 2GD2A 3SLGA 3Q8MA 2AE1A 1L4YA 2PL3A 3GRVA 1VJ1A 2CL0X 2B30A 4FWBA 4A2WA 2J3QA 3VA7A 1CJCA 3Q2KA 5DYTA 5TJHA 4KX5A 1H8HA 4YRQA 2QG4A 1QKJA 3WGKA 2CWDA 5C9ZA 1VP3A 4XQEA 5J2TA 4PC6A 1B43A 3A9CA 1U5CA 4FE7A 1I6LA 2IA5A 4KR0A 5LZ2A 2FJUA 3EYAA 2FGKA 4HFRA 1SBNE 3S70A 1OAOC 1SZJG 2BHLA 3FVWA 4R0VA 3ZWWA 1PT5A 3EGEA 3PEFA 2HU7A 4GICA 1IL0A 4JAVC 2WTMA 4NS4A 1O8CA 3DT6A 2ZITA 3CF2A 4YMLA 1U28C 2AYXA 2I8LA 3H5TA 3R76A 1VBFA 3PJFA 2XA9A 1YC5A 3M3HA 3PI6A 5JNRA 1ECBA 4NWIA 1D5WA 1SVWA 2CFTA 2A84A 3I64A 3ME5A 4BIMA 3UAVA 4M3NA 1I94B 3B38A 1C1HA 1RYFA 3ETLA 4RE5A 4YQYA 1H2XA 4D3DA 4N3AA 4ACBA 3EOAI 2W6ID 1SK8A 2L2QA 1YKSA 2OZPA 5BR4A 3WMFA 5EESA 2I9KA 3QP9A 4EWLA 2JRCA 1HQYE 2C2OA 4HXFB 3L6OO 1SUAA 4IMIB 3ZHZA 2Q6VA 2HT6A 1YQEA 1NF2A 3SG0A 2FW7A 4HG2A 5GOTA 5EZQA 2PX4A 3ICEA 2B0JA 5CITA 2GB4A 4I55A 4AN1A 1I2CA 2O8BB 3OZFA 3IBTA 1RQNA 4ZRNA 3KHUA 4NDNE 1XD2A 4MMYB 5EIBC 4KWTA 4A8PA 1Y1SA 2IS4A 3O74A 1GZ6A 4DMLA 3SMVA 4WE3A 1C3VA 5IJ0B 2GF2A 3DF9A 1YJ5A 2HV8A 3F8TA 5B30A 2GBPA 2AJLI 3AB8A 4RA9B 2VYND 3U4MA 1U0SY 2Z1MA 4BN4A 2QYHA 3CPHA 3AEZA 4F56A 1CRZA 3BWEA 3FBTA 1NLYA 2CHFA 5BSFA 4DA6A 3EGDA 4YONB 1FDVA 5I7WA 4CNBA 3G8CA 5EQTA 1EGMB 5C8YF 2QV7A 4QYSA 4FYMA 1HYQA 1SNYA 2YRFA 1QGYA 2ECOA 1BX3A 1P0CA 4TTQA 4OREX 2B99A 3L1IA 4L9WA 2XXJA 2ZSFA 5KX5F 3RFVA 3FTCA 1DEAA 1V1MB 3OZDA 3ZTWA 2V4UA 3VNUA 2VJYA 3OBBA 2J3IA 2HA2A 2QTBA 1T0JB 3E9CA 1FRQA 5K09A 1J07A 3JCZA 1EDBA 3LQQA 5IWCA 3G2PA 3WWEA 2JFHA 4KSCA 2UVPA 4S1TA 1UBMS 3WBBA 3HO1A 3OZWA 4KUGA 3VR0A 2OBLA 3TE6A 4KXWA 4FQ5A 2P3SA 5HBGA 1M66A 1OXXK 1WHSA 3FPGA 3O84A 5AR1A 4CEJA 3FJOA 3PA6A 5D87A 3THWA 1CQIA 3CZ5A 3V1KA 3HN6A 4QOJA 4BBZA 1GG8A 2FMFA 1H23A 5FYDA 5MF6A 1HQKA 3WB0A 1RHQA 1DINA 1KY5A 1BMDA 4F4DA 2FSSA 2WKRA 1T2NA 4YLGA 5F3WB 3TEJA 2MCFA 1KNQA 1Y9AA 4N0EA 3QIAA 4O2BB 3UAXA 2XGJA 2LRHA 2Q5CA 4PO1A 4XWAA 5B55A 3ZJTA 4JJGA 3OLYA 2UVQA 4FK8A 1Z39A 4FZRA 3NBUA 4L2IB 4LJ5A 4F3KA 4OA8A 2P4HX 4TUYF 4JP3A 1LDEA 4GNKA 2PFSA 2AJ8A 2RHTA 3K32A 3KZVA 2XQKA 3KSRA 3OJLA 3HR8A 1KSJA 1ZGAA 1C80A 2I1LA 4XX1A 3S29A 3RRNA 3GEBA 1OV4A 4K3UA 3UPUA 1HTTA 3GJ5A 4CQNA 2GHQA 2HY7A 3I9JA 4K0RA 2FN9A 2WJVA 4K81B 1T9AA 3E5RA 3ZI4A 4ZVTA 3N6VA 2PWYA 2IH5A 1K6MA 2V55B 2KJQA 5ED0A 4R8KA 4JBXA 4FFMA 2V5UA 4V24A 5GM2A 2FR1A 4X65B 1PGJA 3CZRA 2X7HA 5D7BA 3LE8A 4E2XA 3TD2A 4RK7A 5JRZA 4L07A 3UBTA 1Q0LA 4DQXA 2CK3A 2LDBA 1N1MA 4LVUA 4QO7A 3RAPR 2Q1UA 2C92A 2ZVPX 3H6KA 3R23A 3INNA 1QX3A 3SSNA 2WC1A 2JAUA 2OO5C 1OI7A 4JI6B 2CMHA 2Z2XA 2EZ4A 4NOKA 4F86A 5G1OA 4C03A 4ENVA 1KOJA 4IFEA 2FK7A 2PZ8A 3OCZA 4XOIA 3HVHA 5E6UA 3ZDCA 2RK4A 3KOXA 5I7OA 2XOEA 2RKWA 1HE4A 3IESA 3ANLA 4PC7A 5UKDA 5HW0A 1JFSA 3DHWC 1TJ5A 1PR5A 4G9BA 3ZQKA 4JROA 4HQFA 2IYSA 1O5IA 4WSOA 3ND7A 1W19A 2DBVO 4X6YA 5ALYA 3OT1A 4BATA 1EWQA 4EB6B 3UXMA 5G3YA 5HGXA 4IX1A 3FBWA 2ZSKA 3WGTA 1R0RE 1FMTA 3BEOA 1EBFA 5HDQA 4UD6A 4F91B 5DJ5A 1DAEA 5ADWA 2WQ6A 1GTRA 4Q4LA 4DLYA 5ARBA 2YQ5A 2P9CA 3BIWA 1HQDA 3DTYA 4DBVO 1UJNA 2P6NA 4ZI7F 3D2LA 2AK2A 2CUNA 2G06A 1IDN1 3R4VA 4OUDA 4R7ZA 1O96A 2EHJA 2C9MA 3A1FA 1V6CA 1WZEA 5E0KB 2F7SA 1XHEA 1NW7A 4M87A 2AQ8A 4FI3F 4PR0A 3EK2A 4E0BA 5JCZA 3L0CA 3T3EA 2A59A 5JROA 3EY9A 3H5NA 2X86A 3FHOA 3PNBA 3R0VA 1URPA 1W0JD 3L04A 1IVNA 5FOVA 1ZN2A 4QNNA 1B23P 4NZZA 3JQQA 1YCHA 3WL5A 3IOYA 4C3VA 3M4YA 4GOOD 3A31A 3KBOA 5F1KA 3KR9A 3GJYA 5CCBA 1KAMA 1JW9B 1LNSA 4MRMB 4ZAYA 5ELXA 1RM3A 3DMNA 2W98A 4NRDA 3L6UA 1JAZA 4MAAA 5CT4A 2WKWA 3D31A 4P3XA 5ERGB 2XX3A 4I8DA 3UJBA 5KVSA 5DYWA 4DOMA 1N2BA 1N6PA 3BTUA 4JJ8A 2ZI4A 3IAUA 4FW8A 1T35A 2XUGA 1GGMA 1KJWA 3K1AB 1YOVA 3FR8A 4V02A 3WZ2A 3FFAA 1X38A 3SOZA 3G9ZA 2AV6A 3LY5A 1P8AA 2ECPA 4KUHA 3HWX1 4XQGA 5IVIA 1HGXA 5IVHA 1EG7A 1FXWF 3JQAB 2FFHA 3C48A 4G0OA 3WRYC 1JR3D 1UBLS 4MUNA 1ODJA 1RRCA 3E2IA 3WG9A 5KYVA 2P5SA 4X54A 3B48A 5F33A 4DZZA 4EUNA 2D5AA 2J9ZB 2XTNA 3KZXA 1M74A 4ISBA 1OPRA 3MBOA 4XX0B 3WGZA 3CEJA 1HT2E 4GX5A 1G9TA 3UAZA 1MU0A 1T3LA 4J07A 4OI0A 3T9CA 1CS0A 4TYMA 3G59A 2CEKA 4Y6PA 1J9EA 3PUWA 3TFWA 1LX7A 4PFQA 4EGJA 3RYCB 2G8LA 1U7DA 3FDJA 2CJXA 3R4CA 3AL2A 2YIMA 5AJXA 1N0UA 4BV9A 5JAMA 4J9VA 1NOKA 4OGFA 1HA3A 2IPXA 2VHQA 3G2HA 2QLFA 2XHZA 3JD3A 4FOLA 5BR1A 4Q3NA 1KAHA 1OZFA 2O7RA 2XIQA 1FBNA 4IRUB 4M9QA 1EJ0A 3F6BX 4G5YA 4L4RA 4M37A 3BGWA 3TMAA 3DV9A 2RH9B 3D6NB 2VPXA 4IFBA 3TCKA 2C98A 3RUPA 3TQCA 4O2AA 3V42A 2X6TA 1L5HA 2VQEB 4W5QA 2I62A 1R66A 2Y92A 1YQXA 3IP5A 2Z04A 4D99A 1A2KC 2UYOA 1ONPA 2YHUA 3DCJA 3FJYA 1JFFA 4H3VA 1MZPA 2C4MA 2WJZB 1AUOA 2B98A 3DL0A 3JQGB 1G8JA 3PG5A 4X3PA 3KE9A 3JQBC 1FDTA 2ZCUA 3NAZA 3WOHA 4H0NA 4EG4A 2ODPA 1CJBA 7ABPA 2F4VB 3N8HA 3COJA 3QVTA 3H04A 3SEFA 2Q0HA 1JEDA 5EZ5A 1XXHE 2VDWA 5D5PA 2DOKA 3L82B 3TW4A 3S5JA 3GRPA 5BWBA 4UTNA 1QO7A 2BZSA 3FCUB 4Q19A 1QM5A 3CIFA 1DVRA 1G0OA 2JCBA 1FLAA 1RQ2A 2YJNA 3LF2A 3I4CA 2DUMA 3MJTA 5AXBA 2C5AA 4CKXA 3LBFA 4WMLA 1RRGA 4AD8A 1DO8A 1CQXA 2FTKE 1XRSB 5IMBA 1PLKA 1W35A 1W75A 1F1JA 2CVPA 3G17A 4FGUA 3RIGA 5J40A 1OFUA 4WKBA 5EFOA 1ACJA 1A8HA 3MQ4A 4FFPA 3IR6A 4HF7A 1EUYA 1P2FA 3GVHA 1I51A 3JZAA 2X0EA 2RIRA 1KI4A 2D0IA 4ZQIA 2CXPA 4KGDA 4K7JA 4OLJA 3CLSD 2XRZA 4Q15A 3GO4A 2PGXA 1M7GA 3NNNA 4LXIA 4QUIA 3JRXA 4MRVA 2YMMA 2MU1A 3HI6A 3PNSA 5TMBA 4ER7A 4DARA 3QM1A 4BJHB 3ONEA 4NAVA 2WOJA 5DM2A 5HRUA 2ZTUA 3TLJA 3VR4H 4US0R 1JWLA 4PV7A 2QIOA 3FVVA 5U9CA 2PJRA 1Y9JA 1I4TD 1IHYA 3L05A 4F5EA 4A5OA 1GPDG 4GDFA 5ICMA 1MO3A 1K5GA 4QQNA 1WKBA 2VHUA 3EFBA 4C7OB 5DTMA 4FS3A 3CUSA 3AHHA 4H08A 3HEBA 3T5DA 3H4MA 1XZGA 3TOVA 5KQLA 1QGED 3HQ4O 3QGMA 4KV9A 1X3LA 1KORA 1P6UA 1BW9A 2FR0A 3FPBA 3VPHA 2HWUA 5KYGA 2VJPA 1PFWA 2HPZA 4DNPA 3H17A 3DOOA 1W5TA 3ZVMA 1JG4A 5IHXA 1KFEB 1R64A 1H9CA 4M9ZA 4K9PA 3ADDA 3LKDA 2HMYB 4ZODA 4JVLA 4WK2B 4G5OA 5FRDA 2C7OA 4LBVA 1LQTA 4KYUA 2JASA 1NW8A 1EUDA 3W1EA 1L4GA 2WU1A 1QR6A 2ZWIA 3FGPA 2EYUA 2VSYA 1NYQA 1W88B 2EFEB 3B3GA 1SELA 2HFJA 3LDHA 4AJ9A 1DQSA 3ML1A 5L3ZA 1U2DA 4FDLA 3MCWA 1U3GA 1J0EA 1S1MA 1S3SA 2IUSA 2P2DA 2PXCA 4HI0E 2MSKA 2NU9B 2OZLA 1BDHA 3ESBA 2QT1A 3IODA 2IYFA 3DYIA 4H4CA 3WS7A 3DDOA 1E2FA 1P80A 3LGAA 1JDVA 1I24A 5ALOA 5C4MA 1XCLA 1ADCA 4B6PA 3B6ZA 4BMYA 2C88A 2GVDC 2PMFA 3VR6A 2C58A 2OHIA 1U7XA 1R4NA 2HQSA 3KSZO 3OE7D 3COPA 3IERA 4O33A 2JLCA 3FNFA 2H1RA 1GRRA 3OQ6A 4MX8A 3ZD9A 4WJLA 4GOJA 2QAIA 3IQGX 1HG0A 1ZN7A 4K9SA 2PSJA 2GBGA 4LNUA 1TO2E 4NONA 3JAMA 2EJTA 2VTBB 4YJ2B 3QKTA 2UXDB 4W5WA 3E5MA 1T0UA 1KMQA 2VFAA 2FUG6 2V7VA 5K9ZA 3KIPA 4YRGA 3QFTA 5ALEA 1WXGA 3TZLA 1ZCAA 3ED1A 4DA0A 2GPJA 3TQOA 1PJQA 5JFOA 3THYA 1U8AA 3HYNA 4QU8A 2GNOA 3D4LA 3GXBA 1UPBA 4TMKA 3PC8A 2H92A 4RL6A 1EH5A 2VUUA 5CK5A 4Z0HO 4P33A 3RH0A 3VXKA 1M8KA 4AMZA 1VHTA 5F1YA 5ADVA 1IAQA 2XVXA 3DBLA 3B8EA 5FO0A 1TD1A 4KWCA 1Z47A 5BWCA 4F4UA 1KO5A 2PLRA 3LCMA 3DR5A 5HXAA 1DSSG 1SBIA 3AIOA 3WGJA 1EX9A 2R96A 4WN9A 2JGLA 2OC4A 1RVV1 2XTJA 4OK6A 1X1TA 3K20A 1M2VB 2WA1A 1DO0A 3WNBA 1QNLA 2ID8A 2WVHA 2Z2YA 3INTA 3RVDA 4ZKEA 3VU3A 2ZRLA 1DEXA 3QTBA 3L6CA 2O4UX 3WB1A 4XWOA 5BXQC 5EN4A 2XWQA 2JKYA 1NV8A 2W90A 1R9JA 4MPTA 5JNUA 1G5RA 3LUBA 4QTTB 5LCXA 3FNBA 4C88A 2WWXA 2X5NA 4BMZA 2NTVA 3E0XA 1KH1A 4AX4A 3H1GA 3SC4A 1JEAA 5CLFA 3QUAA 1NUUA 1BD4A 5A9SA 5LJIA 1J8VA 1MORA 1NJ6A 1S4MA 1ZGHA 1R4ZA 2BKAA 2J07A 1UZLA 2PG3A 3S2UA 5CXQA 5AM4A 1E32A 3NJ4A 4O08A 3ZCTA 1UEIA 1U8CB 1PFYA 1WXWA 2GDZA 2MYTA 2XNDA 4TXLA 4UDNA 5DRYA 4BEJA 2J7PA 3WX0A 3W9YA 1SUSA 4DQUA 3EZFA 1F2TA 2IELA 4MI9A 4HB2A 4E32A 1NPTO 3EXEB 1CY6A 4UUOA 1L5LA 3SXPA 1O3YA 3ROKA 1SGWA 4HFNA 3MWFA 3OJWA 5ALNA 5ED4A 5FR2A 4DEYA 1L5WA 1NU6A 4ZZ2A 3AV3A 3AESB 2C57A 1CUHA 1AUQA 1QQTA 2FSVA 3LVFO 2E5LB 3TD9A 2XLBA 2C7BA 1CE8B 2FMXA 2GBLA 3P8ZA 1P3JA 1YI0A 2WHRA 2BFAA 1QO0A 3GGDA 3MC1A 4EFDA 4JUFA 5ITZA 4JR1A 2PUTA 4QU9A 1THGA 4O4JF 4CTKA 1SIBE 5D3ZA 4B0OA 1FNSA 1P0QA 3W1WA 1TCCA 1PR2A 2G36A 1DBSA 3RE1A 4RIFA 4YPFA 3Q3GE 4CUZA 5FLXA 3CKKA 3CZAA 4BO6A 4PCAA 1A2QA 3AKZA 3ZCVA 4YV0A 4UBMA 4Z4HA 1M2KA 1HYBA 3OSZA 2X4IA 5KKAA 5C8YA 1B3BA 1UOPA 2BE9A 3OUUA 1K2WA 2IUUA 3SR4A 3OMXA 3GI1A 5AFSA 1GZDA 1HNNA 1XF9A 1QZ3A 4YJFA 1L4HA 4FDTA 5IJAA 2SCUB 2X8BA 3T0IA 2DSNA 2VJBA 3DF7A 3KBBA 1XLTA 3GY0A 1NUTA 3L7YA 1PT6A 3IEKA 4JQCA 3MPUA 4Z7NB 2VAWA 5FPKA 1Z6GA 3GLHA 4A5SA 3DOUA 2AFIB 1K7SN 5B7GA 2CSXA 2O1EA 3PK0A 2Q7DA 4MDEA 5F5NA 1IEVA 4JT4A 2LVBA 4GBED 1OYWA 4GXTA 1Q1NA 1L4UA 4L02A 4N7BA 1B41A 4OYHA 3DQQA 4RY8A 3U4CA 1ORWA 3VPSA 2XB2A 1RCFA 3K70C 4WESB 3KCNA 4L57A 4PLHA 3RFTA 1MGOA 2G1KA 3RW9A 3V1NA 2Q8QA 8MHTA 4TLMB 1EFTA 3J7TA 3STHA 2OESA 1SXJE 2HRBA 1QOQB 5H3CA 2XUHA 1B0UA 2C2KA 4EUKA 4TYWA 2PU5A 4GX0A 2B20A 5EZSA 3SYMA 2VPYA 5ABPA 4LDJA 1W93A 2KMLA 3D6AA 4Q4JB 2NZ8A 3E23A 2QS9A 3B3FA 2I2XB 3WJ7A 5CAEB 1NNLA 2AOVA 2JHFA 3VAYA 2I4RA 2HQ1A 2P9YA 4XFDA 1QPZA 4LPKA 4TUYA 1BKSB 2WHXA 4RIGA 2QL7A 5IDVA 1QE3A 4KRFA 2NSJA 1A5SB 2BMEA 5L51A 1J9ZA 5AHXA 4OIFA 3TS1A 3R9KA 4NC9A 1AS2A 2FSPA 1CEYA 3H2GA 3I73A 4XVRA 1MB2A 2JFQA 2Q5OA 3OFNA 4RLHA 1LRKA 3OF5A 3A2MA 4FYVA 4FNGA 2NSHA 3FCAA 2QRNA 4LRSB 1QFSA 1C1XA 1E58A 1U7HA 2AGVA 2PWPA 3LA6A 4PTLA 4EJ6A 3IPRA 1NVUQ 4U2CA 4YPVA 1JLLA 1GZSA 1Y3BE 5I5EA 1S9DA 1E92A 1YRBA 2XCRB 1PWXA 3G2MA 3HKBB 3TDMA 3A3PA 5T5QA 4P2BA 3VTZA 5KZMB 4L50A 3AZOA 4FEYA 4H7IA 3TIFA 4EIWA 5HKKD 3L7IA 1E2PA 1RWXA 3OPVA 2H8KA 3EHEA 4I1SA 4U3JA 2Q3FA 1F4PA 1PBTA 1Y6RA 2CNOA 2P4SA 1UXKA 3KQPA 3OUTA 1MNAA 4XWTA 5ERYA 1BWSA 3Q5DA 2SECE 3CZMA 1B7GO 4HS9A 3UJHA 1RC8A 1OLUA 2RH4A 2WIBA 3M5WA 4B3MB 1OBVA 2XBLA 4RV5A 2O0KA 3NFRA 1LCIA 4N5IX 1YA4A 2OECA 2PZFA 1SZDA 2VRNA 3CZ4A 4C6RA 4LVCA 3FSJX 1I7SB 3WIDA 2JJ2D 2DJIA 9LDTA 2EF1A 3EEBA 1L5MA 2FWRA 2ILTA 3DONA 2EWVA 4QHSA 1RWNA 3KUXA 4IHJA 5KVQA 2JLWA 1ADBA 1ZM9A 4RANA 1GFIA 4M83A 1VSQA 3UJCA 1D2HA 1OFHA 2ZBFA 3C7AA 5TF4A 1VPTA 2PH7A 3M9LA 1CSEE 4QDKA 3D4BA 4XYBA 1V5FA 1T2VA 2RG1A 3P4YA 1M1NB 3QK7A 1N7HA 2JI9A 3MELA 4XGIA 5FPTA 2JKVA 3GJZA 5LQSA 5MN5A 2KBFA 1NV9A 4LY0A 1XBTA 3SXUB 4JNKA 3X2FA 3MINB 4E2YA 1NMXA 5BUSA 5E2BA 4QEDA 1YFJA 4BNDA 3HY3A 4CEIA 2WU8A 4P5EA 1IYZA 2XQFA 4WJKB 3I45A 5E3JA 4QYWA 3RS4A 4FKBA 5CLJA 1V1JA 4LY3A 3JWPA 4WZAA 5FTKA 2ZB3A 1DMRA 521PA 1ORIA 4FLMA 1CFZA 4TM8A 3PXGA 4ZI7A 2H16A 1YCFA 4PS0A 1YMQA 1NXQA 3LLCA 2IU4A 2OCLA 2HWKA 5JCPA 4YRPA 4MMXB 1PJZA 1JJAA 3GLSA 1UKYA 2WFLA 4F2PA 3HUDA 5CGZA 1KNXA 3CMCO 5JYBA 5IT0A 4LOJA 5AQ1A 4EGSA 3S8YA 3ZGXA 3F5SA 3PEVA 2XXAB 4I1PA 1YQTA 1C4WA 2AZDA 5IYZB 1NASA 3R5KA 3X1YA 4BX2A 5IHPA 4MKFA 5GAJA 1I4OA 3Q0IA 4TTPA 2H2IA 1E1QD 4JQZA 7REQB 4QRDA 4R84A 2Q6LA 4UZFA 3WB2A 2VP0A 2OMKA 2C3MA 3UENA 5GVSA 4LBZA 1KY2A 3GUVA 2EFGA 1E3SA 1CUIA 1J5XA 2WICA 4J0JA 4MQEB 3JW8A 2E18A 2POCA 4NVRA 3FGOA 5HIMA 1L4KA 4OTZA 1QF9A 2HU2A 1DADA 2VDKB 1EVKA 2Y1WA 2AN5A 3TB4A 3KLMX 4OD0A 4DTCA 1E2KA 3K8ZA 4PQFA 3QPBA 1EXMA 3E3LA 3V3TA 3DZGA 4JUIA 5DTQA 1AGNA 5F7OA 2CF5A 1ZK4A 3L9WA 3GEHA 1R3UA 3K16A 1B1AA 4PLGA 1Y3DE 3ESXA 5CFQA 4JYBA 5CFRA 3F3MA 1FXWA 1M0SA 1LD3A 1ST2A 4GC9A 4HLNA 2R11A 5KSOA 1PEYA 3FPCA 3A27A 2OXFA 1WY7A 3ST7A 4D4IA 1XD9A 3AR7A 1SURA 2D0DA 5DGHA 1E2NA 2XQVA 5EJFA 2O59A 2R65A 1BJTA 2WUEA 1ZXLA 2R00A 4R0NA 1UMDA 2O7QA 3F9CA 3LV8A 4MP6A 1FW8A 4FYKA 5CH5A 4F21A 5JTTA 4RMJA 2A0XA 4F85A 2P9JA 1C7FA 2Y6VA 4F06A 1W1IA 2D2EA 4EFNA 1OH8A 5HCIA 4U6NA 4I5EA 2IYVA 2ZUCA 1DEHA 4K87A 4PZ9A 4WLNA 1RZUA 1D6NA 2ZETA 3WNVA 2IYLD 3U4GA 3E1KA 4HRYA 4EKIA 1J39A 4GMFA 1JXMA 1MLDA 1JU4A 1XYVA 2XUOA 3JZMA 1BXZA 5HUHA 2H2WA 4N5DA 2AN3A 1B8VA 5D6NA 1XQWA 5CW2A 5ICGA 2BE7A 3KE8A 2HADA 2QL9A 1A50B 5L4SA 1D8AA 5JZSA 2XD4A 3TIIA 1TE2A 3EVNA 3GZNA 3WV4A 3DSRA 4UUMA 3E53A 1EFUA 2O3RA 4TQAA 1REQB 3OHMA 4N54A 1Z2CA 2AFRA 4HQ0A 4JNCA 2BFFB 4OHZA 5ICFA 5G1PA 4WVFA 4M9XA 2NLOA 1I5EA 4BN5A 1O5TA 2NU8B 4EJ2A 4UBLA 3BIFA 4KOAA 3TDNA 4C1BA 2PNJA 3QE2A 3D4NA 1JXAA 1EK2A 4AIIA 4JXZA 4M0CA 5J43A 5IC4A 3GGSA 3K0AB 3ZWDA 1SKUA 2EJWA 5CR9A 3OZGA 3UY4A 3BUSA 1W9MA 1IEWA 1BVRA 3A36A 4G37A 4X61A 1OROA 3DNFA 5I7HA 2IHTA 3SLRA 5JS8A 2BGGA 4L5CA 2B36A 4Z4EA 1WUHS 4FN4A 2JIZA 2BUCA 2YXDA 4IMRA 2VRCD 4JX9A 3PQ5A 4IDPA 5DM0A 4DPMA 1K92A 2FN8A 2Y4OA 5IWAB 2AFVA 2D1SA 2PT7A 3ENQA 3DTVD 1G59A 4UQOA 3SYNA 4YROA 2NZVG 3PRHA 4ZFNA 1P7ZA 3I6MA 1I1OA 4EKYA 3CCFA 1SQ0A 2CLFB 2YY6A 3Q8XB 3NVKI 3IILA 1ZLYA 5AICA 2HA6A 4ZT4A 3USZA 4ZICA 5AJTA 2YN2A 2JI7A 3FLBA 3E35A 3KYDB 4NV3A 3TPCA 3PJDA 1B15A 3HYCA 4RCZA 1F8XA 3RSCA 1PJRA 3AVUA 1G0NA 4I9HA 2O19A 4ESOA 2J6CA 4PTYA 1VXRA 2RHHA 2EU8A 1PN3A 4H16A 5FADA 1TKRA 1DKLA 2CYBA 1EFVB 1F0PA 2G6TA 3P45A 3P97A 1E1YA 1MFZA 1CR4A 2FE4A 1V47A 3TZEA 1KMHA 1ZXBA 3IAM6 3W90A 2YOHA 3QKUA 3GROA 3OP4A 1B14A 2NUAB 2YZ7A 1KSFX 1M73E 3A6HA 4FR5A 4HH1A 1P4GA 4LYEA 5FULA 1JN0A 2GJKA 5JMPA 2XDQA 4HLUC 2A57A 4CCYB 3QXHA 1UDXA 3T1NA 1NUPA 2I22A 3FI0A 4RD0A 2DHQA 4NY1A 4UQLA 3ESDA 3K3PA 4MDHA 2IITA 2J3LA 4KXQA 1KOLA 4N5NA 2G40A 4YQEA 3PVCA 5DP2A 4I81A 4J7XA 2OCAA 3M6AA 4QQFA 3WRWA 2CV2A 2NYUA 4EEKA 5JYEA 1F6BA 4ZCQA 2RK3A 2C9CA 2X8JA 3IIMA 2FWAA 1MJGA 1CUFA 2FGJA 3GFGA 1YZHA 3AERA 2BTQB 3V8QA 5GWXA 4BUJA 3D7RA 2EQAA 3ORSA 4MS3A 1HYEA 4YA6A 1J90A 5H70A 3FTNA 4N3GA 4IV5A 1NRXA 1UDCA 2WBLC 1VHJA 1Z18A 5TMDA 3CEMA 2FLWA 2O2IA 3HH8A 5HIJA 4EF6A 4LYAA 4TLLB 2GYYA 2VAXA 5ANRB 3NEAA 4OO3A 5K8UA 5KTTA 4G1MB 1QH8B 4Y1EA 3C3DA 1ISIA 5F3RA 3VR2A 4GW3A 4O0LA 1A8UA 5DDIP 1E2BA 1MG5A 2QDXA 5LU8A 1W6RA 4U8GA 3EEOA 1XOIA 3E27A 2UZAA 2FEPA 1SCAA 4CR8A 3OIGA 3V5NA 3TLGB 3SF8A 4C0KA 2CXNA 3MTAA 5EIAA 2AB0A 3Q9NA 5E1BA 1FFDA 4CLHA 5FJIA 4ND1A 4CM1A 1UC5B 2WWHA 4I08A 2PUVA 1NXOA 3R0XA 4EQ6B 2BBWA 4HDKA 4HGRA 4WK0B 2QMZA 4MJXA 3UIEA 2QZSA 3DKIA 5IXJA 3HXQA 5JU6A 1DBPA 5FHQA 1SZCA 3CGWA 4ZVRA 1H6AA 5JSZA 3U4AA 1Q14A 3E58A 4I4IA 2N42A 2AMLA 2WSBA 3AETB 4GZ6A 3BG5A 4BVKA 4ZJPA 4C0XA 3I76A 3MEQA 2NVWA 4BN0A 5FXMA 4YHBA 5KQPA 1SQ6A 2H5IA 2O3SA 3EBPA 1BD3A 3AHFA 1M76A 4P5DA 4PX5A 4TXHA 2O2ZA 2HNBA 1SIUA 4NU5A 4WLFA 1DKRA 4YC7A 2PRZA 5EPUA 4D80A 4P22A 5JWRA 1RWVA 4GPBA 3LLMA 4K6FA 5EJGA 4N3CA 4LV6A 3OPNA 4UW9A 1XNQB 3FMIA 1E79A 3VZPA 3IPLA 4XXHA 4X92A 3N2EA 2Z30A 1WE2A 1N92A 2SKDA 5FNVF 3N8DA 3LKBA 2RBKA 4JX8A 3RU2A 5JRJA 2GPSA 2WWIA 4U9HS 1XMSA 4HWPA 5T3YA 2AIRA 4QUEA 1ISRA 2R6FA 4BNYA 3L4BC 3CLRD 2AJDA 1BCRB 4BQIA 2Y77A 3NOVA 3PNKA 1DJQA 1EWTA 5CDSA 2HI0A 1K3FA 1PD0A 3H6HA 4GXRA 2ZJ7A 5AVZA 3STWA 1ODCA 3MSXA 5DHUA 5JZ9A 4C6HA 4A36A 1GVNB 1E9CA 3X1KA 1XYGA 2BISA 4W5HA 4DGSA 4RJTA 3FZNA 3AXSA 4X71A 5I7EA 1H2FA 3NAMA 4DJAA 1RJFA 3EXIB 4MW1A 4NJMB 4CHGA 1ZMXA 3LYHA 4NZNA 1MHPA 3CR7A 1ZS9A 2O3QA 3TR5A 1M1YB 1EB8A 4ZPJA 4YR7A 2QUKA 2FW1A 2HLHA 3MGAA 5G0SA 1YE5A 1AN0A 3N2GA 3TK1A 3C5EA 4O4JA 3SJ7A 4XRGA 2HKIA 3IUSA 2QVZX 2RK6A 1NUAA 1E2QA 4PXYA 5LP6F 3TRJA 5TXGA 3FNEA 3HXKA 5JI3E 2IP1A 3O94A 4CKWA 1CETA 3DHNA 1BEUB 4PVCA 1RABA 3TAHA 3HACA 3S3TA 2IDJA 4UM9D 3M33A 1A82A 4RY2A 1H9AA 2BCEA 1GPYA 4UEQA 1ECGA 2UUPA 1BGVA 1W5FA 1HRDA 2BEWB 2EJCA 5FIUA 2DE0X 4AKIA 1BMFD 1EX6A 4FWTA 4ONEA 1Q0SA 2VKQA 4D3XA 4OOFA 2I67A 2QBYA 2JH9A 5KJ6A 4ROTA 1JSRA 2H1HA 2RGWA 3OY2A 4GKBA 5FWYA 3ISJA 4KN6A 3QWBA 4B6SA 4KRGA 2I2WA 3TQTA 4MUEA 4Z0NA 1R8XA 1JX6A 3A1DA 4N8EA 2BFCB 3RUFA 4R01A 3QKWA 1GA6A 3F1LA 3K0CA 1YH3A 3IL2A 3H83A 3OQIB 3WAKA 4RVGA 3PXCX 1ZA2A 4JFRA 1KERA 2R85A 3LO8A 3RWBA 2PUFA 1OFUX 1K1EA 1CF9A 1YJAA 4TMXA 5FKJA 3AQ4A 4B80A 3E9QA 1B4DA 5CG2A 3BCUA 1W6UA 4TL9A 3AVYA 1CZRA 1XZQA 3TINA 4RV9A 5AK6A 1T8UA 3C8ZA 4CIVA 2NUTB 4WAUA 2NZUG 4G3XA 3T41A 4B17A 5LYJF 1NC1A 4Q6WA 5JE8A 3GU3A 2MHCA 5ADHA 5HOEA 1OYOA 1DCMA 3D8HA 1FRVA 2HZ7A 4KSBA 4CE6A 4ZMBA 4Z2YA 3MWEA 3UMSA 5C7OO 4MPJA 3LXXA 5E6SA 3PPYA 2IOFK 1KSHA 1PKXA 4D0RA 2ODBA 2RGNC 5A2GA 4P0QB 1J21A 1OTYA 3NXSA 4ZVPA 2AKYA 4GVXA 3IKJA 3RJ5A 3S7ZA 1AGYA 4BBAA 4DCTA 2LGJA 2XTZA 3A6ZA 1C8VB 1DDIA 4ND7A 1H94A 1K3TA 2FXVA 4A26A 1XDGA 5F7ZA 3DMRA 3RTDA 5KWIA 2IP4A 3MJ4A 4JLOA 1JF8A 2QNIA 2XRFA 5KHLB 4J2HA 4RY9A 4B4DA 4ZC1A 4UTPA 2BDTA 1OXSC 4KNVA 3A04A 4TT3A 3B2QA 4D42A 3DE4X 1BVHA 3NONA 2O6LA 2EFHB 3AI2A 3KALA 4RTLA 5DCLA 1RKVA 5DRTA