4R0VA

[fefe]-hydrogenase oxygen inactivation is initiated by the modification and degradation of the h cluster 2fe subcluster
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
426
structure length
416
Chain Sequence
LSHVQQALAELAKPKDDPTRKHVVQVAPAVRVAIAETLGLAPGATTPKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAHPHSDEPLPMFTSCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMVSIMPCTRKQSEADRDWFVDADPTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKETNITMVPAPGSKFEELLKHAAAHGTPGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKRQAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe-hydrogenase
publication title [FeFe]-Hydrogenase Oxygen Inactivation Is Initiated at the H Cluster 2Fe Subcluster.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
total genus 141
structure length 416
sequence length 426
chains with identical sequence B
ec nomenclature ec 1.18.99.1: Transferred entry: 1.12.7.2.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02256 Fe_hyd_SSU Iron hydrogenase small subunit
A PF02906 Fe_hyd_lg_C Iron only hydrogenase large subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r0vA01
3.40.950.20 Alpha Beta 3-Layer(aba) Sandwich Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 4r0vA02
4R0VA 2N0SA 1HFEL 3LX4A
chains in the Genus database with same CATH superfamily
1H1TA 4OK5A 3ZJYA 3I5UA 4CGZA 3Q7RA 2XTAA 1O6BA 5CVEA 5FH9A 3Q15C 2GLXA 1YR9A 2BAGA 4E7PA 4KACA 3TRHA 4S05A 1JHXA 3NW9A 2WKRA 5ICEA 1RHQA 2ZRHA 2I4RA 4XKJA 2WJ4A 2RAVA 3M2PA 4H7HA 4O1IA 1FLNA 4A8JB 5FWYA 2XCSB 4HFMA 1NRXA 1XNHA 5FI5A 5CK4A 3SR4A 1W46A 2DJ5A 3VPBA 5FBVB 3LPNA 2C7PA 2VCHA 5AKGA 3R6WA 1D07A 4IRXA 1SXGA 3PV0A 1FSFA 2QI9C 1PSWA 2QJOA 3TSWA 3MS2A 3TUJC 1KRWA 3ZWAA 1GKIA 1YT5A 2F8LA 3ESQA 1C3JA 3FF1A 3KB1A 4IV0A 5EIBD 4GOXA 2IYEA 5EWMB 1R74A 4XIFA 5K0EA 5GIOE 2YBEA 5LDGA 5LDDC 1Y5RA 3OMXA 3T4UA 4HWSA 1FUEA 3TCKA 4NJMA 2WAAA 5T57A 4CF4A 3DE7X 4ZQGA 5AW0A 3CVWA 4FGLA 2WV9A 4NBWA 4UAUA 3Q7EA 1X94A 4CUKA 4QLAA 3EAQA 4MV4A 5KWSA 1T0JB 3KYDB 3PXEA 1KMHB 4TXNA 3FOFC 5C37A 2GCOA 5B64A 1UMDA 2MYTA 2QV7A 2RHDA 1ULAA 5DBOA 2HY7A 2HU7A 2O2CA 4F1WA 4G0PA 1OC4A 3D6NB 2PSHA 4GOMD 3IO3A 4MV1A 9LDBA 5L53A 4G4SO 1ST3A 2FQWA 3KYIB 2BUBA 5CM9C 3OF5A 1PJ2A 2GPNA 2YWRA 3U44A 1DHRA 2OC9A 4F4DA 4TMXA 5L3VA 3KC2A 4HYYA 3LP8A 4G89A 1FRFS 3CIFA 3R3WA 4OXKA 1AXEA 2AR9A 2BCGY 3UJCA 3VAAA 2JARA 2P7IA 1J5EB 5KYVA 2Q9CA 1ATZA 2CCGA 3ZHTA 3L07A 3U3XA 2A94A 1AQLA 5B36A 3DC2A 2R751 4V39A 3K1ZA 4FDUA 3AILA 1IJEA 5I7OA 3X3HA 2KSQA 2HK9A 4AP6A 1WCIB 1JMVA 2QMYA 1E2DA 5AVXA 1MT3A 1XTSA 1NM5C 3H9EO 4H4DA 4X6YA 3H4IA 2DM6A 1EINA 4E3WA 4YXFA 1VRVA 1YTLA 4OYYA 2IIQA 1E64A 1YK1A 3TLXA 5JNWA 5BMOA 2LW7A 3W5HA 2PLRA 1JL3A 5BW8A 1NNI1 4Z4IA 2FPGB 4W9NC 1DAOA 1N7GA 2VPZA 2C77A 3JASB 2VK1A 3QE3A 3OAAD 2XTJA 4LOJA 4QVIA 3HGMA 2PFSA 2HF9A 1CSEE 4IJVA 3RYHB 5HJ7A 1KZ9A 1IQUA 1U6IA 2P35A 2BDUA 2Y3IA 5LFAA 3RYTC 5DF1A 2WTBA 2C4UA 4NHOA 2C00A 4AMBA 2WM9B 3F7MA 3L0OA 3RK0A 4EM6A 1VDZA 1X70A 2YWCA 5DX0A 3ZC3A 3O2JA 4QU9A 3IKTA 3DYBA 1OZAA 3BA6A 3NBXX 1ECPA 2EZTA 3UAYA 4X1OA 1GPUA 1DKLA 1OAOA 5JSQA 4OJMX 5HZMA 2IH4A 3GRVA 4DJ5X 5IU6A 3LUBA 1L9KA 2AEFA 1XB2A 2PKEA 2XMQA 2M98A 1CF2O 1EK6A 2Q6OA 3KZMA 3AHCA 4GMGA 1NI5A 5TS3A 2LCIA 5J4KA 1G4HA 2B8NA 3EDRA 4B2IA 2B1QA 1JBQA 2SICE 3TOSA 3ZK9A 1OXVA 3RW9A 1C4XA 5IKOA 3HKEB 1M1UA 2O06A 1W5TA 2Q46A 4BLPA 3QOXA 4GDFA 4ON9A 5CLGA 1V6CA 3F6PA 3REGA 3I2GA 3E9DA 1ABFA 2RCNA 1REQA 4D9HA 4IQGA 4YI5A 1F2VA 3PB3A 4ZT2A 5CB4A 2NU8B 4A03A 4PCUA 3J7AC 4ZV4A 3U3JA 1UUFA 2YC2C 3OZFA 1C3EA 2BL4A 1F1BA 2IL1A 4RHEA 1USWA 4UQLA 4D0RA 5ALGA 3ZJUA 2GPAA 1EP2B 4OJNA 4S1TA 2G67A 4ARBA 2GPYA 4CL8A 3W5BA 1D6JA 2I7VA 1PR5A 3DL2A 3Q8WA 3TB6A 2ZT8A 2HWYA 3QELA 1BNCA 5CA0F 1W88B 4KYTA 1X9GA 2O3UA 4CQMA 1AS2A 2CLMB 2GCEA 3VI4B 4GP7A 3PKZA 2Q99A 2DLCX 3BIWA 3Q8XB 4KE7A 1EJ6A 1ZQ1A 3JVDA 2HCJB 2VZ9A 2DVMA 3R8FA 4RCVA 3NKLA 1Q17A 2JK1A 2PD3A 5FOTA 3AL3A 5K51A 1LBHA 4QXPA 3GJSA 2H1VA 3RS0A 4KRFA 3EMKA 1UM9B 5E7JA 4ECAA 2NO4A 3PQ4A 1DEXA 1EE1A 3QEJA 1MW8X 3K20A 5B58C 5I4BA 1C7RA 2FPWA 4QAJA 3QWHA 2RJOA 3A4VA 4M9XA 2J5QA 1X1EA 4B7UA 5BXYA 4ACAA 1A8IA 1KK1A 5TEWA 1F4LA 2GXUA 4MULA 3LT4A 1EFTA 1JQ5A 2BR5A 2ZTSA 3L0BA 1PUIA 4MK4A 5AVZA 3IVCA 1AKUA 5CEFA 4CQLB 2J4FA 3WA7A 2O4UX 1EKXA 1U0RA 1BCRB 2M32A 7AT1A 1QVRA 4AN1A 3MCAA 3R4VA 2FTKE 2W48A 4LX0A 3LUGA 4EHAA 1N6LA 5DYNA 4KO4S 4EI7A 4A2WA 1EFKA 5FUQA 5JY6A 4KRXA 1XMOB 5K8JB 1VSTA 1UBUS 2CY0A 3NJRA 4MUGA 4PANA 1A9SA 4REQB 2NZ8A 3SQNA 1NI4B 4M8SA 1DC3A 3HNPA 3D6FA 5B1YA 4NXNB 1FSPA 1LGYA 3NUQA 1P2SA 3C8HA 4DCPA 3ZW9A 3AUAA 1TADA 3H8SA 3IIKA 5CHEA 5EEHA 4B44A 5KSZA 3EW9A 4RMGA 2HWWA 1M34E 4Z4CA 5AVYA 5KQRA 2FW8A 4UTPA 4QDKA 4QFDA 3MLBA 3V8EA 4D4LA 1E5DA 2M6RA 2R3SA 3ZUPA 5K0JA 5LQMA 2WP8J 2X6TA 4FHZA 4B6SA 5BYBA 1JR6A 1PD1A 3QMVA 4HXYA 3JALA 4X7PA 3RRBA 5BN1A 5DU2A 1W36D 3OQHA 2Z6UA 4I19A 1T8PA 1OLUB 3KVRA 2JAOA 4RADA 4UM9B 2G8NA 2Q5LA 3AFGA 3KVYA 3ENQA 4RLQA 5F33A 1US8B 2DTDA 3K16A 2AEEA 3R0VA 3RUDA 4EGAA 4EYEA 4I3GA 3CR3C 2C31A 4IH9A 1QRAA 3ZWKA 3ZLJA 4HWTA 2VPYA 3L3BA 1KA9H 5EIAA 3L4BC 1BHJA 4C2BA 5C1DA 1I6MA 2IWHA 3GRFA 2ES4A 2E9SA 3JYOA 3PGA1 3PITA 1EK0A 3CNBA 3H2ZA 4FGZA 1ISHA 5FO1A 1W2GA 2FGJA 4Q3KA 2YS7A 2IDMA 2GA8A 1WCYA 3N74A 1JB9A 2PR7A 1I4OA 1VPLA 3EIFA 3BD7A 3HGTA 3WLPA 4ZPJA 2R00C 2Z1DA 3REFA 2LGJA 3FXAA 5G4LA 1DFGA 3CLSC 4QYMA 1E2KA 1R5BA 2P11A 1NJ1A 1HY3A 2I3BA 1NXXA 3MG9A 4O2LA 4WINA 2O8BA 1SVLA 2IKQA 2EDAA 1DIHA 2ZE6A 3F9IA 1AKQA 2DFVA 5FRDA 3VR3A 1B93A 4G56A 1MB0A 4U2GA 3ZGVA 2O54A 1J42A 1ML3A 1AUQA 1B74A 1FP1D 1X1CA 2WC1A 3E9MA 2EFHB 1UMCB 4INOA 4JJEA 4KGXA 4OYRA 1ANKA 3T06B 3U4CA 4DJTA 2FPKA 1KPHA 4FFPA 5JZBA 2E6UX 1NW5A 4F6CA 1M8JA 1N5MA 1Z6ZA 3ELYA 4HR7A 4P82A 4RK4A 3VBEA 3KOWA 1MIOA 3WYEA 3OE4A 8LDHA 5KREA 1WEHA 3BFPA 3PEUA 4RTMA 1P17A 2FH5B 3ZWPA 5BW4A 3OC0A 3TNDA 4EX6A 1L6RA 4ILEA 1V1RB 2HMVA 1MU0A 4IXMA 4O3FA 1GUYA 2JJ1A 3A9UA 3KSUA 1PO7A 4QFCA 1C9KA 2YYSA 4NZNA 4OK6A 1EFPB 3ZX5A 4Z51A 3IYLW 4YK7A 2CL5A 1WABA 3E9ZA 4EO4A 4ZMSA 1XROA 2RGRA 1Z2AA 2DPMA 1JAYA 2NZYA 1EK2A 3DMRA 3IHKA 4D4IA 4EG0A 3K0AB 5CH8A 1Z35A 1ISRA 5H5JA 1J0DA 2WRZA 3LYLA 5EP2A 4HF7A 3ZDXB 2IS1A 5LL6P 3TTTA 2FMUA 1SOMA 1XDBA 4ZOQI 1SK9A 4PSDA 5AI0A 1TM5E 3CUEF 3F5FA 1SXPA 2K7FA 5DLQC 4PONA 3RGGA 2KM1A 1BXRA 3GLFE 1SVMA 5SZKB 1U6KA 4BBAA 4TS4A 4YJ2B 1W35A 4PIPA 2GLTA 5LKAA 1DUVG 2Z6VA 5KJ1A 4RVSA 5JNTA 2PH3A 3EA0A 4E88A 2ZXUA 5HIIA 1H5NA 1KY2A 1TJNA 4BNMA 3T8YA 2X0KA 1R0WA 1QQ5A 1XNJA 2P3QA 5A4KA 2O8DA 3RUPA 4Q9LA 1K7YA 1ZMTA 3QGMA 5P8WA 2FOXA 4OO3A 3RDPA 4DC1A 5K3OA 4I1RA 2EIXA 4LHXA 3WWYA 3HCBA 1O2DA 4DAEA 4LX8A 5I5EA 2PWBA 4IJUA 4IIUA 1I5RA 4MW6A 4MSUA 1LK0A 1QJ4A 1IIRA 4I9NA 2D2IA 1ZH2A 2AGVA 2PK3A 2VTDA 1EVIA 3A70A 4QATA 1NW9B 3QY9A 5E0OA 3ZVNA 2PL1A 1TQ4A 5KINB 2QVYX 3E2IA 1E5VA 4KUHA 5JXIA 1CHNA 2N42A 1B3BA 2C5LA 2JGEA 4XDYA 4C03A 3SF0A 2W2LA 3BXZA 3U0BA 2YDYA 4MWCA 2FMKA 8GPBA 2QI9F 3DAOA 3EVNA 2QUZA 2BM0A 3GDGA 4KBYA 4OUKX 2GZAA 3CHYA 3EGXA 4HUQB 4HWPA 1YRLA 4RQTA 3NCHA 4PZZA 4XWKA 1E1NA 4HEJA 4FFNA 3HYSA 3SNHA 5HE9A 1V41E 4FQ8A 3GEEA 4BO5A 5C34B 3VJKA 1QYXA 2XNHA 1XV5A 4ARUA 2I34A 1ZJ5A 5JC8A 2XNSA 5IVKA 1FRQA 1X86B 3E9CA 4QWWA 1BQ3A 5ALDA 1X1QA 1EUCA 2HIAA 5CG2A 5JS8A 2G3YA 4QEDA 2DKNA 5K20A 1E69A 1H66A 1JLKA 1N8TA 3R40A 4G0XA 2WAMA 5LZ7A 4P0TA 3L6UA 1YRAA 4LY3A 4OQDA 2JA2A 2FN7A 2V98A 4ABYA 5IX8A 2W9XA 5JO0A 4ZHQF 3KTFA 1V5FA 1W5BA 2ZYDA 3GZJA 3SX0A 3KDPA 2YXPX 5AJYA 3K9FC 1MV8A 4BB9A 1RI2A 1O5OA 3T7AA 2D0IA 1U2SA 3EDMA 3HVKA 2E4YA 2ZIUB 3JS5A 1OAKA 4OSPA 4IVRA 1UJNA 2APJA 1CIPA 2HO4A 2WMNB 2AF4C 3CVJA 3FYTA 3CCBA 3IQHX 2HBRA 1T2FA 1K6XA 4CMGA 4K0RA 3V8RA 1IY8A 1T1RA 3Q40A 3KEOA 4U7FA 3WKBA 5AW6A 2Y0EA 4NCBA 3N58A 4LHVA 3F9CA 4P80A 3EXG1 3FAZA 1K4MA 3B6JA 4ZZ3A 4URXR 2Q7OE 4AZ3A 3L2OB 3UOAB 2ZVQX 1NW6A 4EA7A 4KEAA 3PFIA 2VLIA 5FQNA 4WIAA 3M4JA 3OSUA 1WZ2A 2A1TS 1LW6E 3CSDA 1TA4A 4L78A 1RSZA 4I1YA 1NA5A 4RPLA 3ZTYA 1K3TA 2OWDA 3IR5A 1TW2A 2HSWA 5CB6A 1RR6A 2QYTA 4XYGA 1XKXA 1QU2A 4P86A 1VJ0A 4KNWA 3B1ZA 3DEIA 2TRSB 2PL5A 4Q18A 4Q6BA 4AI6A 5AKYA 5AJZA 3F8WA 4X24A 3VX4A 1HLGA 3GRPA 2MSDB 1B1CA 2G04A 1BH2A 2ACKA 4UE6A 1DX9A 2FCRA 1NVBA 3ZV3A 4F86A 4FLEA 2XA2A 1N7HA 2XUZA 2EKPA 3EOZA 4JSYA 3KTOA 5CX1B 2ZUCA 2F00A 3R8CA 4DCVA 4TROA 2K2QB 3I4CA 4RVDA 2E82A 2IK8A 1NMQA 1B8OA 1UH5A 2XY4A 1XLTC 2NYRA 2WR8A 2O2GA 2L2QA 3QU7A 3UB2A 3AGPA 2CF6A 1IRXA 3SHOA 2EDCA 4TTTS 4QYTA 4OKIA 1YE8A 4K0KB 1E2QA 4M0LA 4ZOLA 1GZ3A 1IUPA 2A35A 3IT3A 4KXYA 3JWGA 2C0CA 3W2TA 4BGUA 4YX9A 1MAAA 1ZJ4A 1GNRA 1ZU5A 4I2VA 5TF0A 5K6AA 3EXHA 1QC5A 4Q1EA 9LDTA 1GA6A 1M6NA 1Z4PX 1OA0A 3HI6A 2OZPA 3I12A 3WG9A 1LRKA 3I9V6 3EH1A 3GD7A 1RBYA 4DTIA 1VGQA 3EISA 4L07A 2B35A 2PLAA 1VFNA 3K9HA 2AW3A 3BRSA 2WIDA 4ZVSA 2F4NA 1J8YF 5AKHA 1IE3A 13PKA 3M4XA 3E61A 2W58A 3HA3A 3K05A 1TKCA 3LLMA 4KBGA 4TXJA 5LLDA 4AKGA 4ENSA 2PZFA 2JIBA 2VTVA 5T6MA 3FOZA 1DO2A 1YOVA 2JGDB 4NBNA 4Q4JA 3FCCA 2JAWA 3U60B 3WV4A 2H1FA 3UJDA 1G7SA 3EVGA 1R6XA 1SVNA 2AFHE 2FAXA 3EULA 5EHNA 1G4UR 4MB2A 4CCYA 2J9ZB 4F3CA 5IZ4A 3C8ZA 3EWIA 1QDEA 3WKAA 2P8JA 5FOUA 1CZHA 1EBBA 3OT5A 4KRGA 3BG5A 4UNPA 1H4TA 2D0OB 2PGXA 3HL0A 2JLXA 4PX9A 3UV3A 1C3VA 1UOPA 1QKKA 1EAMA 2R5FA 2JIOA 4XPZA 1TM1E 5LNK6 4XTRA 4ZOCA 2QIOA 2CZGA 2NZVG 1JNXX 5D84A 4BTLA 4EK9A 3LWZA 4K6HA 3LUFA 2YV5A 3BD9A 1EVYA 1SWVA 3ZUGA 3NVAA 4Q4HB 1UIMA 2I55A 4JEMA 5SY9A 4YTEA 4EOGA 3EVZA 3CNLA 4QDXA 2JFGA 5CW1A 5F9FA 3CW8X 1TKAA 1OYYA 3IXLA 1H1DA 1KGSA 2CSUA 5CAEB 4LF6B 1T91A 5EGNA 2C8VA 2C3OA 5K0FA 1LZLA 1YU9A 3RABA 4FUQA 4RA6A 3AKCA 3FDZA 4XD7A 2M6LA 2FUG6 4E31A 3GFSA 4M60A 4IDFA 1L3CA 5A9TA 2A3NA 3W4KA 4G23A 5CG1A 4XEHA 4W6QA 3N3AC 1YB1A 1CVIA 4NYMQ 2V9PA 1XWIA 1W25A 2PKQO 4UULA 4P34A 4G5HA 1RMQA 4U3JB 2M6KA 1K6MA 1KJYA 1OB5A 2YHUA 3EFHA 1GAQA 1XJWA 2A5YB 3BGWA 5KOJB 2PZ8A 1CR0A 2YCBA 4FT4A 4RQAA 4EVIA 4A0QA 4OP3A 2OB1A 3PWSA 2C61A 3E5RA 1P62B 1J33A 4CU2A 3DD1A 3R9KA 4WKPA 4DARA 5KTMA 4XEUA 4IQFA 3T95A 2WU1A 3IQXA 4YUZA 1SXHA 2YN2A 2YXNA 5IKEA 1G98A 1Z5OA 3UMMA 1WXDA 4OUDB 3C3KA 3IFSA 1RYZA 1G0OA 2YINC 1EWTA 4NOLA 5K0CA 3A3NA 5E9JA 3C6YA 4OOEA 4J0JA 5A9SB 1XZPA 1B0ZA 8MHTA 1Q21A 5AI8A 3D43A 1KDYA 1R15A 1QHHB 3STXA 4LRWA 2CYCA 5CMLA 3TM4A 4CVNA 5HK8A 3FTDA 4TVKA 5CTAA 1I4EB 5JMTA 2Y66A 3E22B 4WEQA 1K5HA 4TN5A 4LGVA 1P9LA 2YHIA 4WKGA 1IVNA 2WK1A 3PNYA 3WL3A 3LUDA 4FWBA 4KMOA 4LDRA 1PGNA 4QGGA 3NIBA 2BBTA 4QG7A 2HAEA 5E8JA 5EFZA 3R44A 1C80A 2DFTA 1RXEA 1W96A 2QR5A 5H81A 4FGKA 1IXZA 1C1YA 1JBEA 5IVDA 1KXJA 1TUIA 2YJ4A 2A0YA 4M1ZA 5DTIA 2L18A 3EYWA 3RJ9A 2WWIA 2ENUA 1XVIA 1QCYA 3NIWA 1Y9AA 1D7AA 3ZD8A 2C2GA 1RXYA 3GEMA 1RFGE 1WSBA 2WSLA 5L3SA 5D85A 2XRZA 2G7ZA 2CE7A 3UICA 4E3ZA 3QBTA 1CYDA 4C89A 1N2HA 4J2OA 4QRIA 1J2JA 5C46F 5FAKA 1KTVA 2G40A 2I6GA 4FYWA 4OFXA 2NLOA 3OT1B 2OHJA 1PG2A 1UBEA 1M67A 1EVQA 1PQWA 1GCOA 2Q2WA 3SVZA 4CCWA 4U4AA 4BNFA 1Q3HA 1KC3A 3L8HA 5JQGF 1T8YA 2NTEA 3UUWA 3QKTA 2IYQA 1Y1PA 4G8CA 3RODA 1JU4A 4BNWA 1QPZA 1OFTA 1GQYA 1X0VA 3K31A 1NOKA 1XTIA 3I32A 3ROQA 3VR3D 5CFPA 4U7TB 1OWOA 3KZVA 2H0AA 4Q4LA 2RK4A 4AJIA 2WV7A 2BFEA 3PD0A 1NVFA 3JRWA 3OLVA 4UMEA 2W4QA 3PT5A 2NO5A 3I64A 3IUJA 2ZK7A 1P7CA 1NM5A 3VPSA 1T9ZA 5HQTA 3PX7A 1V2HE 2JATA 2I33A 2PNJA 2OV3A 4A2CA 4TQGA 1JIXA 1OLXA 5CM2Z 4A2PA 3SR3A 3HNRA 2C1XA 3VH1A 4UU0A 4C07A 1AZTA 5H3CA 4W9NA 3RKUA 1FUUA 2PGAA 3KL2A 3AVQA 2BRUC 1NURA 4JC8A 4WX2B 5J47A 2ZANA 4A9AA 1SAYA 2EU8A 1WV0A 2J87A 1XNQB 4IDCA 5I51A 3RIXA 2HRQA 1WXXA 3IVAA 3B5EA 2WVJA 4OP1A 2H17A 2VT6A 1NT4A 3K0FB 1COWD 3G9XA 1JT2A 3KYCA 3BQMB 2NV0A 4MVWA 4W7IA 3P7MA 4Q1AA 1SKUA 4PR0A 4KO8A 4HVLA 1D1SA 2CF5A 3ZCSA 5B4TA 4JJGA 1NLFA 1Y7LA 2PQMA 2WDPA 3D4IA 3HGQA 1HFKA 1UXJA 2FG6C 3FBWA 4CHGA 4CIVA 4J1NA 1TVKB 5F23A 5FPKA 2AC4A 2IDKA 4KFUA 3HJFA 4B3HA 4C1NA 2P3OA 5SZHB 1Z39A 2BZ0A 4EX7A 1XEFA 1PNQA 2PRKA 2Q45A 3NP7A 4AMYA 4DANA 3UOGA 4DXAA 4XRGA 4CNQA 5EYPB 1HSOA 4L4SA 1Y3DE 3T5CA 2CNOA 2WNHA 1QP4A 2GBPA 3CWQA 1XCPA 3AVYA 3CH6A 3GMDA 2PLFA 1Q3KA 4BJ1A 1JAHA 2CZCA 5TGZA 4X90A 2ODWA 3DTVB 4OMFG 4ZZ2A 2WSIA 3HG7A 1TVCA 1T2VA 2P5SA 2VDRB 5CYFA 1M7GA 2X7JA 1L7QA 2XNDD 3R7DA 2XUAA 4N8DA 3TZEA 2JFQA 3UY4A 2QB5A 2OLKA 3Q12A 4WLOA 3EOBI 2XT9A 3L7MA 5JADA 2IYTA 4P5DA 4MQFB 3GRAA 3SYNA 1WQ4A 2O3RA 2XGSA 2GARA 3HVHA 3I04M 3OQPA 1CRWG 3QTTA 4FZJA 2DBVO 4JLMA 1BVYF 4A26A 5C5IA 1RM5A 1UFQA 1Z4KA 1N6RA 1XD8A 2C92A 2ZJ0A 3OZUA 4GP6A 5FA5A 1UJ6A 2F90A 4RZSA 2QLTA 5FNVA 1B16A 3SN6A 4OXRA 3VYTB 3VHXA 1ZUHA 3DT9A 5I8WA 2WU3A 4HL6A 1HK7A 1HZZC 1TVMA 2EOAA 1QMGA 4IHAA 2BT4A 2NZUG 1CBUA 1J2TA 1WPXA 3OTIA 4OBBA 1PWEA 2Q9AA 1XTUA 2O5EA 3Q0EA 4IO1A 3L77A 4EPRA 2QUJA 3OQ1A 1K7CA 1Y9DA 4H3VA 1KI9A 2JHAA 3BSFA 1RPNA 2H11A 3KCNA 1R8SA 3R2JA 4TTAA 3B1XA 4PBSA 2DG2A 1VB3A 4S1VA 1LQTA 3FW1A 3WLRA 1JIVA 3R3HA 1JKXA 4RGQA 5EJGA 1BS1A 2EFGA 3HDYA 1P1JA 2F3QA 1E60A 2VK8A 1Z5NA 3IT2A 4Y7DA 3DBRA 3L04A 4YDQA 1OW3B 1UBNA 3LHSA 4PAWA 4PYQA 2HK8A 3DXFA 1F2UA 1YR8A 4AJEA 5C4MA 2IYXA 5CFMA 5DW0A 4KPYA 3WHKA 2Q6KA 3IJ5A 1XZLA 2HUPA 4QX6A 5ARCA 4UBLA 1K0UA 1YCHA 3OPXA 5J5AA 2ZI3A 3OTOB 1E8MA 4QOIA 2Y1XA 1KO1A 1OFHA 1YC2A 2BFCB 2J5RA 1V8BA 4U02A 4LCEA 4E4TA 3PNOA 3GEGA 4YAKA 2JVJA 4YQYA 5TMBA 1CE8B 1FU7A 3HACA 1I4DD 2IUYA 3VDMA 1OYWA 5BRJA 1V35A 1U2DC 2YIDA 4UU7A 2OL4A 1U9YA 1JU3A 4DILA 4BKUA 4EY6A 4M55A 4E08A 4RMIA 3M49A 3TIIA 3ZCXA 1NUUA 3G2OA 4K6FA 4P22A 5IAOA 2HA6A 4DGSA 1BVHA 4E11A 3ZWVA 3S29A 4O2AF 3FFWA 4XCQA 5FUMA 4BKRA 1XD2B 1GT6A 3HY4A 5A05A 4NOJA 4AG3A 3HABA 2B25A 1N5IA 1T36B 1CDDA 1RHUA 2NU9A 2A0UA 5FI3A 4C6SA 2H1OA 3C6XA 1JFRA 4KZKA 4EKNB 1CY2A 3EXIB 4O4HF 4PTZA 2ZB7A 4MGZR 1NBME 2C8LA 2GSWA 3EH2A 4AVYA 2DC1A 4D3ZA 4G8BA 2YWDA 1PX2A 1E77A 3HCPA 1RZVA 4BKOA 4RM2A 4BO9A 3ZHSA 3ABSB 1V5IA 1Q0RA 3T4PA 3QEKA 3DVRX 3L4BA 3W9SA 1E6MA 1Y48E 3NTLA 1PEAA 3SX4A 4DLWA 3G5UA 3F6YA 1Y7TA 2XD9A 2WQ6A 2AUTA 2XRYA 1TZKA 5BXQC 1KQOA 3DQQA 4X97A 1Z0JA 4F2PA 1AU9A 4GLFA 2Z09A 4IJKA 4IXDA 2R00A 1X6VA 1ONSA 3FN4A 4DRXA 1WRBA 3I53A 2ZUBA 2ZWMA 3OZIA 3PNKA 5ER9A 1LK7A 4NS1A 1TCAA 1U7DA 4C4SA 4YRNA 3B52X 4FONA 1SBYA 4UTOA 1KP3A 3GXBA 4KXMA 3MD9A 1ODLA 1C3XA 2IXFA 1OAAA 4DIOA 3OZXA 2HC9A 1UJCA 3UYKA 2OWEA 1ZHHA 3UN1A 4C06A 4A27A 2BEVB 1AHNA 1AKNA 3SP1A 1L5FA 4FYMA 4G5YA 3S7TA 2IQ5A 3NLLA 3TX6A 3WYGA 1LNQA 3ZWYA 2GN2A 2ZS9A 2Z5LA 4F5YA 3OU2A 5B4VA 1WY5A 2J4CA 3H3FA 4TKUB 2GS9A 5JYEA 2GWHA 1C9YA 1Y4AE 5CLFA 3W8RA 2XMRA 2C5SA 1P3JA 5HG0A 4DG5A 2NX2A 3ZQKA 1ACLA 1UZMA 1AHIA 2P0EA 1BXGB 2C88A 2ZWPA 3I83A 2ZCUA 4CFYA 1O89A 1AK2A 2COUA 3ENWA 1GZDA 1L7VC 3FOEC 3G88A 3W3ZB 4GUAA 1YS9A 3VC3A 4DYHA 1D2HA 1K4KA 1F8UA 2VDWA 4TMWA 3IALA 1YOBA 3PYMA 4DCTA 2OMKA 2YN4A 5KB3A 1PRYA 3HO6A 5CX4A 4B85A 4RPKA 4WVFA 2CHGA 1MX3A 2X8JB 3UUEA 2PA3A 3SHFA 1R4MA 1JXOA 3AR6A 4Y98A 2ABWA 3AVUA 2W2NA 3ODPA 4RJKA 4CM5A 1CZLA 3T5TA 4HXEB 1Z6GA 4PC1A 4B3CA 1FEZA 4FCWA 3B48A 3Q11A 1ZR4A 4AYXA 2NPOA 4EY3A 2VHYA 1V6AA 1YBVA 4GI1A 1L4YA 3LQFA 1ZIYA 4TT8A 5EL0A 4MQ6A 2QSUA 4Q16A 3PWTA 1T3TA 3EXG2 3L6RA 1Q2XA 5IK2D 2R87A 4FLMA 2PUAA 4NPCA 3HBMA 3K32A 4M38A 1A5TA 4HGNA 4HYQA 1RADA 3EVCA 1A9QA 4EHNA 3ND6A 1RD4A 1NC3A 5G53C 3F71A 3EK2A 5A6VA 2W6ID 3EC7A 3GO4A 1SG6A 2WJ3A 5JT1A 3HUFA 1BMQA 3BTOA 3CB4A 4V3BA 4RBNA 1FRNA 3U7HB 3CXRA 4KLCA 1RAFA 2P40A 5EXEA 1N2JA 5C4GB 1PJ3A 4NYMR 1YL6A 4RA9B 3ZE0B 1Z82A 2CNKA 3HKBB 2GM5A 1ORIA 1SHUX 1BMDA 3LCRA 3BMNA 1AZSC 2WWVD 1DZ3A 2C9CA 4I5IA 3QBVA 3QHQA 2BOVA 1HI9A 4MVJG 3DMDA 4BQRA 2BBWA 3DVQX 3DMNA 1QGED 1EVKA 2IE8A 1VPTA 2VBFA 1X92A 2H92A 4LRUA 4KODA 1LDBA 3WHIA 4DSTA 4EG4A 2GPSA 1GU7A 4FSHA 3V1YA 3QJ5A 4DNXA 2CMGA 2I6FA 3B7PA 1HLFA 1GPBA 2PRZA 2XTZA 3B9PA 3F90A 2RHWA 4HNQA 4IIJB 4Y1EA 3C45A 4EPVA 3VNVA 3QE2A 1OFIA 3W0LB 1UT8A 3D64A 3A58B 4K6MA 2FKNA 5TX7A 1K86A 2OESA 3OJLA 3LF1A 4CQNA 1KHHA 1UJBA 2G9RA 2ZG6A 3AP3A 1Q0SA 1LJ8A 1M33A 1M0WA 1R10A 1GRVA 3N76A 3PTLA 4TZKA 4Y30A 5EXDA 4AK9A 4E94A 5BNFA 1I14A 1D04A 1MENA 4O25A 1ZDMA 4X41A 2G5GX 7ADHA 2M2IA 3N0VA 1CUJA 2PX6A 4PCAA 2ZIEA 3FR7A 3TRDA 1HT3A 1XKLA 2OT3B 2QUHA 1DX6A 1QVVA 3WADA 4JMPA 2WYHA 1BFDA 4F11A 2EGUA 3QVGA 1ZBQA 1WIWA 3AO0B 5IDXA 3CVYA 2JZCA 4MQMA 5J5CA 4NZYA 1QORA 5DVZA 5AI6A 3KU4A 4YMIA 1G6HA 3VSCA 3FKQA 3M1LA 5E1MA 4OLBA 3KV1A 1PDVA 4AJJA 1JDPA 1CUSA 3MMZA 3PQ5A 5ECGC 4KPUB 2B4TO 3C48A 5JVDB 3RJ5A 2KMLA 1IVYA 1OXSC 2PJDA 2XHZA 3MYRA 3PDIB 4MCIA 4P32A 4DCNA 2P6OA 1EIWA 2GT1A 3PGMA 4HAUA 1YDMA 4WESA 1QH1A 2IWRA 1JDBB 2X77A 1R3UA 1NG1A 4PRLA 3HJNA 3UFXB 2HXGA 1VTKA 2KW5A 2NGRA 3DTYA 2EBWA 3SQXA 4HWKA 5C8YA 3VZPA 4HNVA 3UJBA 3P52A 1S01A 3FM9A 3STTA 3ZS8A 3KSAC 2GRJA 4D45A 4NIMA 4JOSA 2QENA 1ZM2A 3IEKA 2B34A 2REOA 5G4KB 1WDWB 4MGKR 1GNPA 5FOQA 1T0IA 1VJGA 2RKBA 4R3WA 2HSDA 4MVYA 1HETA 4N0PA 3VH3A 2ZSEA 3IEIA 1KEPA 4ZT7A 5FUXA 3W7AA 1DV2A 4IYRA 1G21B 2QJTA 1VJDA 1N1EA 1ISFA 4BZPA 1FB5A 3WDSA 2HCTA 3NHYA 1ZEMA 4B34A 2WWTA 1Q0QA 1RMYA 2XIJA 3A1SA 3IE0A 3LXRA 5EXXA 5KSPA 3VVBA 3BGSA 5M34A 4IH4A 3F4KA 5BYAA 2HOQA 3WK8A 3DE4X 3BFXA 4O4HA 5IKMA 3WFZA 3B53X 3NONA 3HEAA 2I7XA 2IEBA 1GOTA 1L8AA 1ODSA 3O4IA 1V1JA 4HBGA 4Q34A 1HOTA 3UXHA 4D02A 2IYWA 1XLTA 4CF6A 4C2TA 4OV6B 2A92A 4I4NA 2ZOSA 3TR5A 5FOWA 1E0DA 1AUVA 1OPRA 4HJRA 4UVGA 1KEEA 1EUQA 1U0OC 2I6XA 1F20A 3VKFA 3I2IA 4KXLA 3VUFA 4ARZB 4BMOB 4TMFA 1N8NA 3BL6A 4O8ZA 3FDFA 3T3GA 4LC0A 3U16A 2PYIA 4MUEA 3FB4A 1ZD1A 4S1WA 3QE4A 2YVKA 3OWOA 1AS3A 3GWZA 2HMWA 1CJVC 2G17A 1ZNZA 5JPDA 5KC9A 4UXJA 5H4HA 4G5RA 2O1EA 3G68A 1D8AA 1RWQA 1XVUA 2QZZA 2Y77A 2ZYHA 3FDIA 3QFRA 4E2YA 4ZQCB 1XRNA 2F1KA 5BPHA 1X7YA 4ZVVA 3O4FA 5E2IA 2N0SA 4FS8A 2ID4A 5A4DA 4X65B 4K6CA 5DNWA 1YDWA 4IJMA 1L5HA 4B8WA 4CTOA 3O4HA 4EKIA 3H1TA 1CUEA 1FNBA 2QKYA 3HYNA 5IM4F 3JAKB 1PP4A 2ZYGA 4TTIA 3HE3A 4BNUA 5ITSA 3AW9A 5COBA 4OJKA 4MA5A 2EJBA 3GRUA 1P74A 3FTNA 1ULHA 5DT9A 2I1QA 1XCMA 4OK3A 1OU0A 4DLPA 4ESVA 2PA0A 4K05A 1FUIA 4W5HA 1L1FA 4G1BA 4BUJA 3V1NA 4DMRA 1X80A 3UB3A 1I7LA 3GFVA 3P0EA 4Z9FA 1EZ4A 4E13A 1DQRA 2XTNA 3RTAA 4BUCA 2QQGA 1T2NA 2WTAA 3PEFA 4LOIA 4CLDA 5K0ZA 1V47A 3LTNC 3NJ4A 4M49A 1LD3A 1NR7A 1U8EA 1U3VA 4PC6A 2OXEA 4K1LA 4R05A 5BOSA 3IPXA 1IPFA 1U3DA 1JG6A 4YAWA 1E2BA 5ISMA 1Q1EA 3K5WA 4BNVA 2PZLA 4X62B 1N5JA 2XXAA 3WYBA 2DPHA 4Q01A 4EENA 1OOEA 1VPEA 2UYYA 4IUBS 1NATA 1LWOA 2JJQA 3QIVA 1W93A 3UWOA 4NECA 1YB4A 2ZBRA 4F46A 4FD3A 3EIUA 5L3QA 2DWUA 5D7BA 1IOWA 1IHPA 2C98A 3T15A 2HIMA 4D99A 4UHHA 5BV0A 4YR9A 1M2JA 2JPDA 1R4ZA 1VE5A 2A30A 3H6KA 4FFBB 5G3ZA 5KNDD 1I2AA 1GY8A 3AVXA 1X7DA 5DM0A 1C9EA 1O6CA 2RHCA 2FPIA 3GGDA 3QUCA 4HAYA 5IDVA 3SFZA 3UJ7A 1QYVA 3E8XA 3S8EA 4GKJB 1VE9A 1HE4A 3PFNA 4MP6A 2PVPA 2BJHA 2WTNA 2AR0A 3SC3A 2YWJA 1NW7A 5KYXA 4ZI2A 4TZ6A 2VHVA 3AR2A 2JAQA 5ALNA 4ZCQA 5AKJA 3U61B 3B9RA 4MYRA 1LJLA 3THYB 1LI7A 3CF4A 2G71A 3CRNA 1VG9B 1XQ9A 3DM5A 1MH1A 1NZDA 3D6AA 3FLAA 3K8ZA 2QN8A 4QGFA 2QU7A 4QVKA 3SG0A 3NHJA 4GI2A 3AR7A 2C2HA 4ZIRB 5TMDA 5K2OA 5EUBA 3K0EA 3PRYA 1XDUA 4PRYA 2FA9A 1O6FA 3RO7A 4YHBA 1U9IC 4L7VA 5LYJA 4P2BA 1T8WA 3GZNB 3ND7A 3DG9A 4X45A 2D1YA 2FX3A 2UDPA 2VQ3A 3AKEA 3IHLA 1H5UA 1XLWA 3ZYZA 4EUFA 2PKQP 1A8PA 2BFDA 2I80A 1Z28A 4ZOAA 3R7WB 3U40A 3JQ8B 2HSZA 2CXXA 2CVHA 1Q1NA 4XB6B 1S3SA 4DVJA 5LQUA 3UMCA 1NG9A 2Z56A 4ML3A 3HPQA 3T1QA 4BZXA 4NX2A 1FBNA 5BN4A 1P77A 3GEPA 1SOVA 2HQ1A 1Z74A 1RABA 2JD2A 3ZCPA 3IEPA 4P4UA 4C4RA 1DKNA 1CRZA 5C1OA 4JXXA 4QOFA 3G89A 3C3MA 3PIRA 1XMXA 1YA4A 2ZS7A 1FYFA 4F6RA 1W9HA 2XF2A 2OPBA 3DB1A 3LGSA 2I87A 3DEHA 3PDHA 5EWMA 5L40A 1ZNXA 4LF8B 4ZD6A 2YICA 5AK0A 1TZJA 2J45A 2AJCA 2G07A 4DDMA 2GO7A 4PBTA 4LHYA 4CWAA 1UJ5A 3ANTA 4PS0A 2YMPA 3NATA 4PSCA 1R7RA 4TL9A 4RE5A 3RK1A 3NWJA 5IJ9B 2GM9A 3CLSD 3CM0A 3B1VA 1JA0A 3A4NA 4MYSA 5JJBA 3W5CA 5K3CA 1S96A 3KYDA 5JV5A 1GFWA 1HTBA 5U9CA 1E1CB 5ECDA 1ZHOA 3EZLA 4D4HA 5HA5A 3FLMA 4EZIA 1GKLA 4OM8A 3NGLA 2WFLA 4MQEB 4DTCA 2ZE5A 3JRNA 1JVBA 4P3KA 1BCSA 3CF2A 3D8HA 1ZRMA 3B7WA 1ZW6A 3DAPA 1JF8A 3PX2A 4J43A 1ZCFA 3FWNA 4NONA 2TMKA 4S1OA 4ZVKA 3CKKA 4FEGA 1ZVJA 5KAMA 1ECFA 1OR8A 3NZEA 4HRYA 3IPCA 4Y6QA 4N41A 5JFTA 3OWHA 1J0AA 2K2WA 3T0FA 5JAHA 3ZLTA 4WLNA 2IZ5A 5LN1A 2W6JA 4HGPA 3VH4A 3U2QA 5JU6A 3A3YA 1X1RA 1YR2A 3QFSA 4J0FA 3PJRA 3VKHA 3SWWA 4KBFA 1XRMA 2GFQA 2O1SA 3M8KA 1NTOA 3IBTA 4HVCA 1NVWQ 2I03A 1XZIA 5JZ9A 4EJSC 2BRUA 2CLOB 2J6IA 1UKZA 3EODA 4FYYA 4GX5A 2XPCA 1K88A 1TUEA 2VZLA 5E9QA 5EP1A 5GQSA 2QRJA 5KYUA 1Z4NA 3RTGA 2GYYA 4US2R 1PJLA 3RVQA 3W6ZA 3STWA 3RSOA 2Q0SA 2IS4A 2JGMA 3RFTA 2W43A 5ICFA 1O6ZA 2WYIA 3QKRA 5AI9A 3RUCA 4CKEB 3S1SA 1B00A 2GEFA 1JSLA 3EA5A 4GR5A 5EXPA 2FG5A 3R0ZA 3UEOA 2JBAA 1JDNA 4M3NA 5FWXA 4RK5A 4YDRA 3ICCA 3D8RA 1LCIA 4F2WA 3GAZA 4KVGA 3LSYA 3TG2A 3D6VA 3WICA 1NUHA 1QHXA 1KHTA 2EHJA 2J3DA 3H11B 1GGEA 2X23A 4RVCA 1A7JA 1MRSA 1B8VA 1Z6YA 4N01A 3M1AA 1KOLA 1YWGO 3GNQA 3U1VA 2A9RA 4HDMB 4I14A 4E46A 2Q6VA 1JXAA 1QG4A 4YMSA 1K7EB 4X92A 1U90A 1JSXA 2ZRGA 4XI9A 2QF7A 3RYHA 3KOYA 4PLGA 4A82A 3K0CC 4NJEB 5H16A 5TIIA 4WY2A 4YJ2F 2ZRDA 4LJ9A 3KOMA 2JI9A 4G0MA 3OIYA 4CL0A 4UU8A 1ZC3A 3ZWNA 2OD2A 4FE4A 2VNKA 4R51A 3TQCA 1Y8CA 4E32A 2J07A 5AVVA 2V5AA 3NTOA 5KOYA 3VR2D 2D7DA 1L4MA 3QPVA 3DMFA 3C7KA 3RSZA 3WQBA 3F73A 2O4CA 1B7GO 1IFXA 5E3IA 1U5CA 4AZWA 2FOLA 4IINA 3PR1A 4EB6B 3BS4A 3K9CA 1Y33E 2I7CA 1B26A 3SDSA 4TKVB 4RTPA 4FFMA 5LA6F 1MRNA 1Z8DA 2KBFA 1B2LA 3EPJA 3TE6A 3UYLA 1O1YA 4P0PB 3TL2A 1CUZA 1FRVA 1G8FA 3KSMA 1A9ZA 5IM4A 2BFPA 4TUYB 1V11B 2GF9A 4KE9A 1PQ4A 3N2KA 5DCWA 2DR3A 3OH8A 5BW5A 2O2HA 3EGCA 2MHCA 2JHFA 1E1MA 2W2QA 3AJAA 3AOEC 3C8UA 3DNFA 2IF2A 2OXTA 4D8TA 4W5RA 4MDEA 1PV2A 1CR6A 1NMYA 1FFHA 1SC4A 3LC2O 3F5SA 3CN7A 3WJ7A 1ARZA 4L6AA 2L19A 3A6FA 4F3KA 1E6UA 1OTYA 4CL2A 5LQRA 1M5RA 2DCMA 1RFLA 4ZTZB 2A58A 4QJ3A 2ZT6A 1QH8A 3M6AA 2PWYA 3R4CA 3L8MA 4JVSB 5K6RA 1TMYA 1CIVA 1H2BA 4EYGA 3C5HA 2OVFA 2V7GA 2WNIA 2W83A 3QVXA 2PMFA 4FFSA 4W5NA 4G9BA 1UFVA 2QE6A 4JT9A 4MIYA 3KUXA 1QPBA 4WXRA 4EHKA 3B5IA 4DNOA 2A0XA 1II8B 1AUPA 1MF7A 3JQGA 1W88A 2QMHA 3DPIA 1KFKB 1RWVA 1CQIB 1T1JA 2XNJA 3C1UA 3F2VA 4GRIA 2HUNA 2FUKA 3E4DA 4ZVLA 3VNQA 3WE7A 4KYVA 3DEYX 4DIFA 2M9MA 1JQDA 4HKTA 1XT6A 2DCUA 2Y1WA 3BWYA 3RAGA 1HDRA 4D4MA 1FFSA 4ZVMA 2ZUDA 2ECFA 1GVHA 1KE1A 3TQRA 4M8LA 3TYXA 1KAQA 3RBAA 4AS1A 1R6BX 2F8TA 3IUNA 1E2HA 5T3YA 1ZVVA 1DC5A 4BLQA 2VT3A 3NU1A 4AJKA 4AO8A 3WOVA 2XMDA 1QG6A 2ZSBA 4HMOA 3SEFA 2EP5A 3RRFA 4CW7A 2O3TA 3PEYA 1W85B 3SIWA 3HYCA 3D8BA 3MRTA 3DV0A 2JDIA 3ABIA 1KI6A 3ER6A 1TNDA 1C3LA 3QV1A 1U2DA 4WY8A 1XQWA 4GX2A 1G21E 2EX1A 1Q0UA 1VJ5A 3L6CA 3ZGZA 3G79A 2YR0A 4UJ3A 1BCRA 2EZ4A 2AH5A 2VBGA 1SCNE 2F67A 3EVFA 3ZI0A 1T2AA 2CD9A 3QNMA 3UJ8A 2XE8A 3D7NA 1PLKA 2IXDA 3IKLA 1RYBA 2C0PA 3ITKA 3M6XA 3TKLA 2J3QA 2WZCA 4REQA 1N5LA 4YFYA 2J4DA 2V5UA 3ZCRA 4F5ZA 5KUTA 4LFBB 4I5EA 3MGAA 4K9PA 2PHZA 2VRCA 5ELLA 5KDOA 2IXEA 1LQ2A 5F21A 3A05A 3UPUA 3BZBA 4KOEC 3SXUB 3HDGA 2Q7DA 4CMAA 1RJGA 5B7QA 1Q44A 1D8TA 4Q1BA 3EUEA 5ALJA 3HM2A 4OIFA 3RI3A 2Y0PA 1G55A 3ZD6A 3FSEA 3JVIA 4J7XA 3B1KA 1DAIA 3I2JA 3PU6A 4C4ZA 2H06A 3TCNA 1PX0A 5D51S 4KIJA 2PO7A 2AMYA 4OQZA 5G40A 4RS4A 3F3YA 3NTVA 3N8HA 4YECA 2GXSA 5BVGA 2YZ2A 3BUSA 3HHEA 3N0XA 4XB2A 1TU0A 4ND2A 4JJ6A 1OLUA 3EXAA 2LCQA 1AO3A 5IDWA 4JEUA 2QRKA 4D1YA 1FS6A 1Z0AA 4KXNA 2BTQB 2ZUFA 4WBNA 1E2IA 2QG4A 4NDZA 1DG1G 2V3CC 3FVWA 4G0ZA 2WTUA 5KYYB 2Q5JA 1LTHR 1I36A 2MU1A 1MJGM 2ZUSA 4QUHA 2B4QA 2HPAA 3OX3A 1L7PA 2H8GA 1YB6A 4H6VA 5KSYA 2O2EA 1KYVA 3TLGA 1P2DA 1XZCA 2PUDA 2VC2B 3HN6A 1JXMA 1TF5A 1NUSA 2GTHA 2QTBA 3GN2A 5T4FA 2NW6A 5FKJA 3MLEA 2X13A 3OPYB 5TNXA 3RJTA 3W8NA 1GAXA 1BHQ1 2GZ3A 3CLTC 2AG8A 2KE5A 2QJWA 3OZVA 4ROSA 3D1JA 4UUPA 3WLLA 3EIOA 4Z7OB 4RCYA 1BE0A 4ID9A 4D98A 3I8OA 5KQLA 1THTA 1H93A 1ZLXA 1IG3A 2NU6A 2YHBA 4RACA 5J4HA 2XYRA 4PYLA 1Z8HA 4MHTA 1Q11A 2IS2A 4WT7A 4FIDA 3BXPA 2I6UA 5NULA 2GTPA 1XUOA 1NDHA 2GBIA 1PHRA 3IQWA 3LZDA 4JLNA 2IOQA 1B41A 4PC7A 2HU8A 3Q3GE 2IUTA 3M2TA 4YCAA 4F91B 2JJMA 3BMQA 4U8GA 3SC2A 4QSMA 3P32A 3OE7D 1O3YA 1OX4A 2JAUA 3LVBA 3HLTA 5AK4A 4XWOA 3HJTA 4AB1A 1KKUA 2PCJA 3VPGA 1C1XA 3MQ2A 3L93A 4DLRA 1V43A 5C51B 2QN7A 3A3PA 1IBKB 4D82A 2DSTA 2IZ1A 4JDUA 4HH4A 2QRGA 3OHSX 1WCXA 2P9TA 3KLMX 3M6FA 4GRAA 3T3HA 2ZIFA 3EQ2A 1PL7A 3TQSA 3ZZ1A 4PHHA 4NVRA 3ROZA 4DWWA 1KO4A 4MB6A 4CDMA 1EFPA 5C5EA 1OTXA 3BGVA 5K3FB 3KKQA 1OYVA 2PEYA 3BJIC 1FFEA 3WMRA 4OQNA 3P2OA 3WGIA 4MLCA 3RRJA 1S89A 1AN9A 2VDPB 4OIMA 4IR7A 5JEDA 4DEXA 2QTLA 2V1XA 1UWLA 1K66A 3SJUA 5TB5A 5IT5A 3S70A 1PVOA 4XB1A 2ZQYA 1IQRA 3EFEA 5FL3A 5H82A 3TFQA 4QTUB 1ULBA 3KKZA 1QO0D 5CLLA 1W1IA 2DPGA 1VCIA 3NH9A 5ABPA 5C8XA 2W71A 4YJ2A 3BMOB 4PSVA 4MDYA 1X7ZB 1O5TA 1QTIA 1YMVA 1VL0A 2FMIA 2GJKA 2RFLA 3E3AA 4QOJA 5H68A 3BDIA 3U49A 5I7WA 2PJRA 2XUGA 1G20E 4Q15A 4BFLA 5FBKA 5DBFA 4D92A 3WGUA 1LS1A 1OI2A 2V1UA 2IBMA 3LK6A 1ZWKA 2WSMA 2W00A 3ICEA 1E96A 3CEJA 4CQJA 1IG0A 3E5HA 3JQBC 2B5OA 3CMMA 1GL6A 4JIGA 4PXYA 4Q3DA 2EWWA 5HFAA 4AYWA 1L7AA 5LA6A 4DQ0A 5JMWA 1A2KC 5EUMA 4GT1A 4D8YA 1G3RA 3DO5A 2I4IA 3LPCA 1ONOA 3WLKX 1F17A 5BR1A 4R2MA 1QB8A 1T9DA 3VDNB 5C80A 3OEHD 5GJWC 2XZPA 4DE5A 3I1IA 1WZCA 5AW7A 1CS4C 1FLAA 1O8CA 1F6WA 3V7NA 2OD9A 5F5XA 1RXCA 1H2FA 1ZG3A 3W5UA 3BK7A 2PX3A 3U7QB 4HATA 1XHLA 4MJ7A 2XI4A 2FPPA 2Y2VA 1M1NA 1U65A 3V42A 2ZYIA 3LJKA 2P6RA 1J9GA 2D5CA 5L4LA 3D3WB 5LD2B 5JQWA 2PXAA 2XX3A 1K97A 4Y2UA 5AK3A 1DCMA 3OX1A 4DV3B 5H7XA 4DCUA 4B3GA 2I65A 1WU8A 4AO7A 4AXBA 2I2CA 1F0NA 1IHYA 1PNTA 1M2OB 3HCEA 3KKOA 1NSTA 2D2VA 3GBPA 4MV0A 4GPAA 5DXAA 2JEYA 1E18A 4DUGD 5EAIA 4EGQA 5HTOA 1QGZA 2H57A 1KKLA 2XVXA 5JZSA 5HIKA 1ECBA 2IPMA 3AFOA 2QD1A 3M7IA 1HBJA 4M1SA 4NICA 4OQQA 2Q3EA 2ZRKA 3ETGA 2CHVA 1DKQA 2YX1A 3HPRA 4HN4B 4WLEA 4AY3A 3H04A 1GPMA 2PO5A 4EG6A 1GVNB 2FWAA 2PGOA 2Y9MB 4D3SA 1EVLA 1ZI8A 3LPLA 1MO5A 4JYAB 5GVSA 2AZDA 3C4VA 4M2LA 2Q4EA 2NVWA 4I08A 1JTVA 3HWX1 3L1KA 1X38A 2DHRA 3F5QA 3NFRA 4P8RA 4DLNA 1C4WA 2P2NA 3GMSA 4BEWA 1N3YA 1E3EA 3LUJA 2AG6A 3D0OA 4MX8A 3FCEA 4P35A 4X54A 4FR2A 2HW8A 3PD1A 4GYKA 2PWPA 4DDKA 2QR2A 3OICA 1QK5A 1T4MA 1HMYA 2DPLA 4ZYZA 5A5FA 1KAEA 3KRTA 1TLTA 3DEJA 2Z9BA 5KTYA 4BS9A 3UMJA 2FRDA 1ZUNB 3FNRA 1NXTA 2Y1KA 1ISSA 5GM1A 4K6OA 4YRJA 3WK9A 3FX2A 3ZDAA 3WNZA 5MN6A 1XWWA 2VH2A 4FC7A 2UYCA 4EMBA 1FJXA 4LC1A 3V34A 2F3TA 4AS2A 2EJTA 2YNMC 3QWBA 3WGHA 2IPLA 2HA0A 2XLBA 3AJDA 3O3MB 4N47A 3SE0A 1D2NA 1TM4E 2J3IA 4BO1A 4ER5A 2JFNA 1GGMA 3EG9A 3AETB 2LWIA 3H1AA 3IVRA 4GLLA 2G4LA 2DWCA 3SF8B 2IY9A 4WVLA 3S8MA 4EFDA 5HM6A 1NQAO 1YFLA 1GRNA 1FP2A 3VHRA 4LW8A 4RH0A 1RJWA 1QWSA 2BKEA 3V1TC 1PJQA 3UXYA 3S2YA 5F2NA 4L2IA 5AI4A 3GQVA 3NPMA 3KQPA 3H5LA 5GAJA 3RSGA 4EKEA 1TOAA 4AM8A 1B43A 3GLGB 2ADOA 2B7LA 1T0BA 3ELWA 4UVDA 4Z0PA 2EQBA 1CDOA 4Z3OA 1Z0FA 4H7JA 4ND7A 2ZDQA 3AINA 4QXRA 1ZVQA 3AP2A 4WBXC 2UYHA 1S9HA 4GMHA 4OH7A 5JH7A 3QYPA 2QL5A 1ODIA 2WYWA 3L7NA 3PJGA 5CX1A 3O93A 5AUPB 3ONWA 3IBGA 1GADO 2ZAIA 3IRVA 4YRKA 4C9BA 2H2HA 3R0IA 5BN5A 2BF4A 4H7KA 1BFUA 3NAMA 3RFUA 4X8HA 4WZAB 4KQHA 4HLCA 4KO1S 1JEYB 3A2NA 1SKBA 3PDCA 1ZGZA 3H2SA 4Q39A 3ZVRA 1PLJA 1A04A 2AG5A 2R7KA 3E5MA 1Z5VA 2AKAB 2FXVA 3J7TA 3MIZA 4YCCA 1H2YA 2Z4TA 1KSHA 3LT1A 2D5LA 1A7UA 2QX9A 1G6Q1 2XYPA 5BNWA 3X2FA 3KTAB 2JL1A 3IP1A 4I0WB 1GITA 1U2TA 2QLJA 5CFOA 2FSHA 4NG5A 3P96A 2JJ2A 4QECA 5K0NA 4IMIB 2R1UA 2R1VA 3JARB 2P5UA 3FY4A 1CC1S 4CLHA 4W5OA 4LYGA 1DAMA 3L06A 4XPIA 3QYFA 4RXUA 3MWGA 3RLFA 3MMSA 1E2JA 4TWAA 5AUOB 3FPKA 3T9AA 5KX5F 1QJCA 3FFBA 3KJGA 5FAXA 3SFTA 1MOZA 3LF2A 1JX6A 3R9XA 1KAGA 1R9NA 4LOKA 3FSJX 1UDRA 2JGDA 3CCFA 4ENTA 2POCA 2IITA 4CEHA 1U0NA 1DKPA 4G2NA 5TDHA 3UMSA 1NMZA 5JG7A 1OV4A 1DJLA 2YJ6A 3OY7A 4ZC8A 2V0GA 4Y2YA 3UWMA 3CNHA 3TE7A 2W2KB 4MKHA 3OY2A 1RPTA 1UOEA 2QWXA 5HQJA 2H48A 5AXAA 2QXYA 4MWOA 4ETWA 3V8QA 3S55A 1N36B 2QV0A 3IAFA 4L08A 5IABA 4FCCA 2H5EA 2HPVA 4UUMA 3QYJA 3AY7A 4FOTA 3T52A 2DWOA 2ZQZA 3P5BA 1CEXA 1K3UB 1TM2A 2Q4OA 3CG0A 3LG2A 4KAFA 5E6RA 4JQYA 2CLHB 4S1NA 4LC9A 3KFVA 1OB2A 4EKGA 4AZTA 2E5FA 3OZSA 4HZUB 1GNLA 1C8KA 3A6HA 3KJXA 3KQLA 3PPVA 2IEAA 2Y9PB 4HNHA 4WA7A 1L5GB 3H65A 4IM7A 1P1KA 5JD4A 5JJKA 4YCJA 4B8ZA 5CAEA 3F1KA 3UC9A 3PWKA 4RE6A 3OFND 1YDHA 1VYVA 3AFNA 2XOKD 3GUZA 1SBZA 1Y3AA 5HX7A 2O20A 1ZL0A 2GEKA 1K89A 2PMEA 2GWRA 5LBTA 5TQ2B 3ACBA 3UUFA 2RB4A 5KSWB 2IKSA 1U9IA 1YIOA 1P75A 2IYRA 3A6EA 1EE9A 3HV0A 4Q9AA 2VUIB 2MCFA 1JILA 4KR7A 3JAMA 4GEGA 4ZJPA 3JZFA 1KAHA 1VC2A 4PZEA 2P78A 2XMSA 2NTVA 2BH9A 5A2GA 4PGGA 3P2KA 3NBAA 2CVQA 2TSYB 3ZCQA 5CVTA 3DOOA 2WE7A 4TXHA 2X5NA 4W5WA 3LBIA 4WXEA 4Y2HA 3WGOA 2WQZA 4R68A 4PX5A 3AEKA 2ODEA 1HGXA 1Q6ZA 1E8NA 1NASA 5SY4A 3DKPA 1G6OA 3FHJA 5TPWA 2GCIA 1X0XA 1XMIA 4D56A 3GY0A 3PLNA 3H84A 1T8TA 2C84A 2R11A 4DPKA 4RTOA 1GLNA 3D5QA 1Y5MA 2MT9A 1TCUA 4JT2A 5THQA 5JROA 5MN4A 4J7UA 1UPAA 1OBFO 1KEZA 1FXWF 4XQEA 2CXOA 3SLGA 5IH7A 4Q00A 1SBHA 3AI2A 4C08A 3LVFO 3L8YA 3W5JA 5TV2A 3ZBUA 3KD2A 3GOQA 2ZRJA 3UH0A 1V4VA 3WNVA 4DC9A 4QTZA 2Q3DA 1M6YA 4UM9D 4AY6A 2BFMA 3O92A 3HK2A 1IEQA 3AUKA 4PRKA 4YUVA 1E5XA 4ALNA 1QP0A 3OZCA 1NR1A 4XX0B 1BH6A 1TAQA 4JB8A 1K1EA 4PCVA 1A7KA 1WR8A 4C4AA 4B4WA 3L46A 3M9XA 4KLRA 3BXHA 1I5EA 4CM1A 4YCMA 3ZZTA 1NF8A 3BREA 4GOJA 1DTWA 2RARA 3F1LA 3FPAA 3S99A 3QHPA 1S2GA 1DZIA 4Q7QA 4RHTA 4WKNA 1S7GA 3BSWA 4LN1A 2CZQA 4IAOA 2OGWA 3OT1A 1QANA 4X0EA 3UHAA 4BP1A 2CE2X 3DLAA 4ZN6A 5GIPE 2XE4A 2X9LA 3CLHA 1U5BB 1BGXT 1JJBA 1WF3A 4Z5XA 4DIBA 3MOSA 1TW3A 2KB0A 3GF4A 2FZVA 4I6EA 4EJSA 3M9WA 4JI5B 2LKDA 2G08A 4MS1B 4NDNE 5T4BA 1NQOA 3BWCA 3UCFA 1AVTA 4F96A 2ZSKA 1JHAA 3HU5A 4LBZA 5LLSA 4X1IA 4EJ2A 4O2BB 3SJBA 3E5NA 4Y2RA 4QJBA 2BBOA 4Q1FA 3R6LA 3IDAA 1QQTA 4GSLA 5L8VA 1T5TA 1WZUA 1D4OA 3LWDA 1K6IA 4MTLA 3UMGA 2Y4OA 1BEUB 3CBGA 3LXMA 3HR4A 4GG1A 2J7KA 3BIXA 4EVQA 3UK2A 5ALMA 1JQ3A 4XGKA 3RC3A 4P6VF 1WMAA 2P90A 4GBJA 1XXHB 3RYCA 4FC6A 2Y05A 3SPXA 1FOEB 2RAUA 2WAYA 3AU8A 4IIBA 2NSYA 2H5LA 1EAYA 4ZKEA 4BMDA 4POAA 4TWIA 2DEUA 3WMFA 3WYFA 3MFQA 4AX4A 1FU4A 3LYHA 1TUBB 2IIVA 1PZGA 1OWNA 1QRRA 2X8AA 3O95A 3P0IA 2P2DA 2F7SA 3K0CA 1A2QA 3PNVA 4MCAA 4YR7A 4FDAA 1GWNA 3PVCA 4ETIA 4IDNA 3A4YA 3M0EA 4OY3A 3RCBA 5LZ4A 2UUOA 2CXSA 3PRKE 2H2GA 3MVEA 1BWQA 2EZ9A 2P1RA 3MN1A 4KXUA 3U3MA 4MO9A 3H2GA 3V1LA 1UBTS 4LQCA 4O4LF 4UMDA 2DKFA 2ZI9A 1U1IA 3Q41A 4JAVC 4NEQA 3RTCA 3H05A 5JNVA 2FSVC 1FW8A 4BMVA 1RC1A 1WY7A 2FX2A 4XXHA 4YAOA 2CV1A 1V5WA 4L3VA 5AJTA 4MR7B 5KWIA 3T7JA 1RWBA 3KXKA 1CEEA 2KS6A 1QZZA 3Q4GA 1NJ6A 1VLMA 2X19A 1DWOA 3N2IA 1VI5A 2EARA 2ZB8A 3ITNA 4MPJA 4BWGA 1BRTA 3HWWA 2A4KA 2VJPA 1X74A 3CH4B 3E9QA 4MR8B 2PSSA 1DAPA 4DDHA 4DDWA 4YXWD 3FZGA 1JZSA 2DFLA 2RHGB 2ECQA 1L2TA 2I6TA 1TAHA 3TN7A 3O2SB 1BU8A 5LBIA 1S8OA 1L1RA 1LRLA 2CC2A 2ZIXB 3G02A 5EKXA 1A1VA 3T7SA 3PC2A 2L17A 2XRFA 5KTRA 1IB0A 3E9NA 2Q1WA 4JUFA 2BI4A 4Y2GA 4E5YA 5KX5A 4Z1OA 3W7VA 1ZJ6A 4Q3OA 5EJ7A 1V8DA 3OJEA 1E4VA 1CJUC 1UOOA 1T6YA 2Z8YA 1BOOA 1ZN7A 3I1YA 3OCXA 2NO7A 4N5LA 3P9IA 3EQ7A 1KK0A 2PRIA 4WDQA 4PN7A 4MZDA 1KJJA 4IIJF 2EIHA 3QHAA 3OJOA 3W5VA 3NDIA 5DHPA 1UC4B 3WB0A 4DZZA 2UUBB 4A6DA 1UBJS 4BAGA 3LGAA 1EWQA 1D1TA 1ND6A 3REOA 5LQJA 1VHDA 2ONYA 1X8KA 4JLBA 3ND8A 2PWZA 4NZOA 4KFSA 3OEEA 5C1IA 1AT1A 3Q7SA 5IJAA 4R69A 3FCSB 5B6PA 4LXYA 5ALIA 2AE1A 3KS9A 4WFKA 1THZA 1C1HA 2O2YA 1FX0A 1HYQA 4L02A 4EJMA 4QBTA 1RI3A 2N1MA 2V4MA 2E6KA 4JROA 1TQDA 4P54A 3TUZC 3R09A 4D9IA 1ODKA 3ILVA 1MBZA 1GV0A 2NMVA 1YDGA 3NBMA 1MVNA 3AF3A 3O83A 4BLOA 3DZJA 2QGZA 3DOJA 1IXSB 3JD0A 1Z08A 4B3IA 3FDJA 5A4MS 5JVDF 3IVGA 3KLNA 3DVAB 3H7AA 3QRWA 4CF5A 3R74A 2GYWA 5TR9A 4W7HA 3PFKA 4AFNA 2C95A 5FBRB 4INZA 4Q7JB 3KQQA 4C1BA 821PA 2ZAMA 5FF9A 1R88A 4H6WA 2ZBDA 1YC5A 3JV7A 5EP4A 4BNHA 4J1QA 1E4YA 2OP0A 3E1KA 1Z33A 4OHZA 2ZSDA 4KHZA 2Q5HA 4KX3A 4DQUA 4EZBA 1G2QA 4IXNA 3I76A 2WKPA 3PHGA 4NHEA 4ZMBA 3GLGE 4NYJQ 2C82A 4LY6A 3QVUA 4MYUA 3TZHA 2IYPA 3HSKA 3PR2B 2EZUA 3LIIA 4Q03A 4P3YA 1TCBA 4UMFA 1CWUA 5ALPA 4A92A 4WFJA 3HL4A 1CZOA 5DYTA 4NRDA 1PHPA 2HSJA 2M1XA 3K2BA 3ZBQA 4G0YA 1QK4A 2PZEA 2XNKA 3V8MA 2HBYA 1P44A 1D0SA 1QS0B 4OAQA 2DXIA 3B1WA 1I6WA 1L8XA 3EUFA 4E4RA 1WE2A 3QKSB 3U80A 3WB1A 4Z9YA 2YW9A 3EXFB 3REQB 3IXQA 1L0BA 4LE2A 1D5WA 2X6QA 2RHLA 2C97A 1RRFA 3JRXA 1KI2A 4PO1A 1YJXA 4MW2A 4EMUA 4Q3EA 5LU8A 1HKHA 1JNYA 2A9OA 3KKEA 5FX2A 3S81A 2V3VA 4NBSA 2DP4E 3WNDA 1DUSA 4XFDA 3LL4A 2P1DA 4OXIA 3KE9A 2WJHA 2AW5A 1PT9A 4OCZA 2AK3A 5GMOA 4BX3A 1C1DA 1RWWA 1SVIA 3K0HA 3LL7A 2R85A 3N53A 4JUIA 2ZSJA 5IC5A 4RL4A 3QEAZ 2C20A 4AUNA 4JJ8A 2QNIA 1R6TA 2WPNA 4J3NA 1PR3A 1KDRA 1NBMD 2EKZA 4I4IA 3VAYA 2BGWA 1K98A 5DBHX 1Q74A 3RVKA 4EG7A 2OECA 1P0QA 4CN9A 4FYXA 3IL2A 2V8OA 3ZE2B 5MFPA 3ZZUA 3ZHRA 4U9UA 4BNTA 2ZGVA 5IBCA 4LY0A 3V7WA 2P9JA 3AIKA 2AOTB 3RNLA 1TPYA 1VDMA 4WFQA 2YQ4A 3LOUA 1AV6A 4X5OA 3MTGA 5YASA 2XBUA 4M0FA 4PFQA 2VWHA 4WZZA 4G84A 1WX1A 3WWOA 2FF5A 2VS1A 1V71A 5G1OA 2C2OA 2Q5QA 4JB3A 4ZXFA 4MTCA 1TYDE 3JD2A 4KXVA 3WK4A 3QFTA 2QSJA 3H2HA 5ECYA 3SHWA 4RDXA 2JLVA 4DEYA 5JJIA 5DSXA 2PBFA 1E1YA 2Q1TA 4QULA 2JEZA 2X9VA 2FF7A 1JQLB 2H65A 4G81A 4DADA 5I8PA 2VF7A 2WVHA 4HUJA 4C7VA 1SU7A 3KEGA 4QQFA 4YAIA 5K01A 3RSHA 2DGDA 4MITA 3T6KA 3IDQA 3U26A 4R98A 3MJCA 2Y1CA 4Y1RA 4HH0A 2FUCA 4IHJA 1M2VA 3OZWA 3MUNA 4WWHA 4CM9D 1UDAA 6PFKA 4OQLA 4IDHA 3KELA 1EZ1A 1EDEA 1DQNA 1VHWA 1H9AA 2XITA 3LQ4A 4NZZA 1IMOA 1KVRA 3DMTC 5HUHA 3U7FB 1T5OA 3UAVA 4BZZA 5J2TB 2E4ZA 3F6BX 4BRUA 4AY2A 1EHIA 1ZZEA 1U4OA 3LCUA 2BH2A 4X8MA 1TIPA 3WGZA 3BICA 3NHWA 3TDKA 4E5PA 1KI1A 1ZJYA 4D26A 5I7HA 2IYNA 4R0NA 6NULA 3A9WA 1OGIA 1N2CB 2EFDB 5LWHA 2OGSA 1C7IA 1QZTA 4R31A 4PSAA 5F2EA 2ETXA 3BQ9A 4LVUA 1I4TD 4CMKA 2W7TA 1VI6A 1XCJA 3GV0A 1HNWB 2FDXA 2KWIA 2BHLA 4JN6B 4NK5A 4TRJA 5ALRA 2JVKA 4UUAA 1DFIA 1E4EB 1E2EA 1E9CA 1TXGA 3A11A 4DA7A 4O4LA 2XMPA 1O96B 3GLVA 1UIRA 4DSNA 1X9IA 4UFPA 5CCBA 1BMFA 2B99A 3QFFA 3VOBA 1K8XB 2VO1A 4G01B 3RSFA 2PZGA 3T5DA 1NXOA 1MN6A 4XM0A 3VVMA 5B30A 5BQ3A 4HN9A 3EX7C 2OHOA 3TJMA 2FR1A 3I2YX 4CIYA 1VP3A 4F5DA 3OKCA 5EQTA 1CP3A 4B17A 1KR5A 1R37A 3ICWA 1TL7C 1XYVA 4II3A 2YRXA 2R6JA 2WJYA 1V45E 3CBQA 2LDXA 4C5AA 1E9FA 1UEJA 2F3UA 3PYXA 2EJCA 1GSHA 3MT9A 2HLDA 2X3YA 4HMQA 1NUAA 5K0TA 1JJIA 4GYWA 4Y18A 2K87A 4N3NA 3ZGNA 3GPBA 4K5QA 3P9KA 2WJZB 3LC0A 4ZYTA 1Q14A 4PPNA 4HADA 3A9CA 4F21A 1GG2A 2FZGA 1M7HA 1VGVA 2C42A 3LQ1A 1NVKA 1JG4A 1F0KA 2C59A 1U7ZA 3T9EA 3K0KA 3NDRA 3OQIA 1ZK1A 3ORFA 2B83A 1ETUA 3VFDA 3I58A 3H5OA 1M54A 1C7EA 2BP7A 2PJZA 3HZZA 1C41A 3BRWA 1C5KA 4IIDA 5CBKA 2XXBA 3WYAA 4L15A 1TK2A 2ZTHA 3MQFA 1EFCA 1QPGA 1R0BA 1G4AE 1OH8A 3EPHA 2IFTA 3FSGD 3KHTA 4RMHA 3WIUA 4YV7A 3JD3A 3F97A 3DZDA 1N9GB 3HNOA 2RGCA 3OKAA 3S6JA 3WZMA 4RFSB 5E0KB 2H85A 4IWNA 2JBHA 3PXBA 4B7ZA 4LRTB 4KL8S 4D5GA 3ZDQA 1NKTA 1J07A 4L5JA 5GJBA 3GBSA 1UKAA 2ADMA 3UMBA 1V4NA 2K6GA 1JYSA 1HE8B 1JLRA 1LSSA 1XD9A 4CEIA 3A6PC 2C5FA 2ORWA 4DLZA 2QG6A 1HT0A 1QX3A 3RS8A 4RTNA 4PHGA 4D9EA 4B3SB 1FP4B 3C24A 4YJKA 4NBVA 2VSNA 4PW0A 5KKCA 1DDGA 6YASA 3UHPA 4LYJA 1XLVA 1CNEA 3FMOB 4JHXA 3M1YA 2GETA 4B80A 2NT4A 2NZ2A 1GQRA 1NVMB 3ZHYA 3A7EA 4XJTA 4UMVA 2CB0A 3KPUA 5JVDA 2X86A 4TS3A 3ZR4B 2ZIGA 2V0NA 5AVRA 4AY5A 2PEZA 4MUXA 3UXMA 3R5XA 3GVHA 5E1OA 1MHTA 1R4NA 3FKSA 9ATCA 4LG1A 2IC5A 3GA5A 3C1OA 5U4XA 1AY0A 2R8BA 2G36A 3A3KA 3JSAA 4GL2A 3NYRA 4FINA 1BAPA 4Z4GA 1ECCA 3RVDA 4KQ6A 5HRCA 1SD1A 2WTEA 1ZGBA 1D09A 1M75A 3VI3B 3BF7A 2VDUE 4UE3S 4QUJA 1O9GA 3MD0A 3DJFA 1U7OA 4ZAXA 1JALA 2J5BA 3OOHA 2CJFA 5C4IA 1SQFA 3GFTA 1TGVA 5K8TA 3Q85A 2GZHA 421PA 3GLRA 4B4OA 3N05A 1AZWA 3WMWA 2QBYA 3H8WA 4HNAB 5LSAA 1I94B 2BVNA 1WHSA 4KGVA 3N28A 4TMTA 1V6SA 4AXXA 4XOIA 2I67A 3VC1A 4EYSA 5C35A 5JLJA 1ZJZA 1XGKA 3F6CA 1E3TA 1NQWA 4P81A 5DYYA 5LOVA 2ZRMA 1BHSA 3L7BA 3O91A 4UVIA 4DV5B 3HM9A 1MO6A 2IIBA 2QW8A 1Z47A 2HXSA 1D6NA 4PS1A 3DSRA 3MTQA 4RHFA 1MA3A 2FFRA 4HC4A 1FFXB 4E12A 3C7DB 1L1EA 2DBYA 1Y0BA 1A8QA 4H0FA 2HJHA 2W11A 2PXHA 1OTHA 3D7MA 4OMCA 4V2UA 1JB1A 1PDOA 2QRVB 3USCS 3KVNA 5FT9A 3TNLA 4JX9A 2C9MA 4ARZA 4MI9A 3CNNA 2PUVA 3COPA 3GELA 4GZ3A 1ZEJA 4P4SB 1P19A 4G36A 5K8LA 2VL7A 4C0WA 2H1HA 3RADC 1E9VA 1ZSVA 2ZJZA 2V5VA 4TV8B 4QGSA 2NUBA 2Z43A 2WWYA 1M2WA 2GRUA 3B2EA 2I29A 2R6GA 4OLFA 4P31A 1NQTA 1KY3A 3HCWA 3PCXA 4LECA 4QDOA 1DI0A 2Z6QA 2M1ZA 2H63A 1JLHA 2O2DA 1RWOA 2ZR8A 2Y6VA 3DTVD 3JQCA 4MRSA 4RIFA 4BZWA 2HNAA 5C8DA 1PG0A 4GVXA 4Q3LA 3KQSA 4EVSA 1H3EA 1CW2B 4TUYF 3PXGA 3JQAB 3CKMA 3C3WA 3B85A 3K96A 5AM1A 4DT1B 1TEZA 2AFIB 3DFZA 3JQ9C 1SUFA 1PDWA 5CVJA 2ONJA 2VTEA 1ZSYA 5E7IA 1XTQA 5GVRA 4BE4A 4IICA 4L57A 3FPGA 1ZL2A 4N6OA 4S24A 5EINA 2IV7A 1K68A 1C0LA 3TVDA 1KC1A 3IAEA 3IT1A 2R8PA 4JCCA 4K1XA 1JBKA 2BUCA 2C07A 1C4OA 3MWEB 4RVOA 3T5BA 4XE5A 3GJ0A 1Y82A 2BI7A 2BEUA 3N2YA 4E09A 5CLJA 1G5QA 2DR2A 1MG0A 1NNSA 3RYIA 2PUCA 4BLUA 3BKXA 4IIFA 1D4ZA 3CX6A 4XJXA 1V16B 2BPOA 2EP8A 3QVJA 3LPAA 5F5LA 1DQPA 3WZLA 4BFCA 4E03A 2BFBA 3HS3A 3WGVA 3KB8A 4JBXA 3QIAA 4MWBA 1SUAA 3DAHA 1G291 2XF8A 2EYUA 5FPPA 5H1YA 2QP9X 4L3OA 4KI7A 5FJJA 4QNRA 5KWJA 1HLPA 3C7TA 3GEIA 3G1UA 2QAJA 1NLZA 3K1JA 1ZMBA 4O5AA 3FLBA 3INTA 4HAXA 5JCXA 4BOYA 4LF5B 1W52X 3MBOA 5IN4A 3MT0A 2JCYA 4RJIA 5FTKA 3UK0A 1CY0A 2Q3CA 3DAGA 2C2YA 2WUWE 3VO9A 4FP9A 5LUBA 2LIVA 3EZ9A 3I72A 2EW2A 2NUTA 3MTDA 5EIWA 4G9EA 1GSOA 3ENVA 3LHKA 4JD5A 4MW4A 5CP8A 3OURA 3ROGA 1KQGA 1LLCA 3DT6A 3SIPA 3SZOA 1U3GA 1N6PA 3UT6A 2FEAA 4LGMA 4DAOA 1QIDA 1VKRA 1MDFA 1XTRA 5KYKA 1W8IA 1EUDA 1LC3A 1JAZA 3GR6A 4FHEA 4O3MA 3I5XA 1TMKA 3PA8A 3EIQA 4EHFA 3NEPX 3CSSA 4FDTA 3W8FA 3TLBA 3GT0A 4J0EA 5AVJA 3RREA 5B3JC 4AJ9A 3JYHA 3HFJA 4IOLA 2VDQB 4HLUC 3DW3X 1E2PA 2Q4BA 2QVLA 3VR5A 3E18A 2A3RA 2EJUA 4OQEA 2HO5A 3ICPA 4JEHA 4LE0A 2C58A 3GZNA 3OEYA 5DH9A 4ZVQA 4A8PA 4XWYA 3SS8A 4PU0A 1C9MA 2CL0X 5IJ0A 4AF8A 4BE9A 4DR3B 3ORHA 2CVFA 3SBDA 3OE5A 4E2FA 2GDZA 4JYPA 3SLKA 1MEEA 4JI4B 3RUIA 4NU6A 1RKBA 4PR3A 2D1SA 3L18A 2R1ZA 3RT7A 4XD2A 1ZH8A 1IUNA 1YMQA 4NYJR 3WLQA 3RNOA 4GGOA 3A26A 4O1HA 1Z2DA 1PGQA 2R8XA 5DHRA 2ZUEA 2ZYRA 2HFJA 3FZNA 4RVHA 1M6VB 5FOSA 2PV7A 2WWFA 3WK7A 5BSUA 2I6QA 4UD6A 4DR4B 1DBQA 1UDBA 4AWXA 1NBAA 1QAQA 1C8LA 3FFTA 3GU3A 4MHSA 2DLNA 3CUSA 4UAVA 4UU1A 1OH5A 3D8NA 3N2NA 1S5PA 4AF7A 1GQQA 1H4QA 1SCAA 3L92A 4LQ4A 1OH7A 1YB5A 1YHNA 3H9JA 3CT6A 3KPWA 2UVPA 3KPYA 4BGEA 2XMGA 2CVPA 3RYFA 3PGKA 2YRFA 4L4XA 1N0HA 1G8JA 3KHKA 4CDRA 5JIBA 1A5ZA 1MQ8B 4Y9TA 3MA0A 3HSSA 4F7WA 1K9VF 3W6PA 1CQZA 1GL9B 3PCTA 3L8CA 3PPWA 4JUDX 4W63A 5C2JB 2VUSA 3RIHA 4JB0A 2WWRA 1FTWA 4JP5A 5CCDA 1KNXA 1QHEA 1XAGA 2D6FA 3B8HA 3AV0B 3LT0A 3W3AA 3DONA 1CJCA 2ON6A 3KD3A 3BN3A 4J29A 3AC0A 5DPMA 5GV7A 1ZICA 4PFSA 5JARA 4ZOBA 3RU7A 4CV1A 4EO7A 2CBGA 4WGGA 4R3UC 2F9MA 2OENG 4IFIA 1KBZA 1T6BY 4AZ0B 4CF3A 2CXHA 3MBIA 3T7KA 1W2HA 4HNUA 4D80A 2ZCVA 3HYLA 1EQ2A 3ECSA 2EJVA 1W1WA 3DCJA 3BRCA 2WF8A 3FE2A 4QUGA 3SYLA 3VO8A 4BKPA 5ENDA 5CPFA 2QXUA 1GFZA 3P2MA 3AUFA 4A73A 4JVNA 2AXEA 3BPSA 1G16A 4IDEA 5SY6A 1Z38A 1U3CA 3KPVA 2OE2A 1N2CE 4B5LA 2ZBVA 3D6JA 3TRIA 3BWEA 2YZMA 2WJVA 4XASA 2VPIA 4L8FA 4CYMA 1QKIA 2C99A 3D2CA 3FNBA 1S8AA 3QF4B 1WB5A 4CJXA 4ZYWA 2O6LA 3AG5A 4JITA 3GUYA 3PQ3A 3SYTA 2VTBA 3G1WA 3AONB 2PBZA 1YDFA 3CRW1 1NKVA 2RHRA 1ZKDA 3FVVA 1OXBB 4TKMA 4HQFA 3VJMA 1J99A 3KQTA 1XFAA 2W2PA 4H3KB 2FSVA 3OU6A 1U1DA 1PBNA 2UZ3A 4FLFA 5GJCA 3ZNOA 3GEHA 4HDMA 1N8KA 3VO1A 2OK8A 1Y6RA 2GILA 3EEYA 3MSXA 1RCFA 3TPZA 3KB2A 2P6UA 4EQ6A 4DFDA 1CS0B 4AIIA 2N9UA 4G4JA 2JGNA 4MEJA 4OFWA 3K5HA 4PYJA 3LBYA 4RD2A 3L6EA 2BHSA 2LNDA 3JAWA 2DU8A 4FQ5A 3QSYA 1P1CA 1EBFA 1LW7A 3F6EX 3RHFA 4BQNA 4AD8A 3BRQA 4OGFA 2BSQA 3ESXA 5EQJB 4NCHA 4H35A 4DWVA 2O7QA 5JMOA 1ZMXA 3Q7PA 2BGNA 4YPFA 3ZCVA 4I4CA 2VAVA 3SR0A 4QLOA 2GSDA 3AVOA 521PA 2V7XA 3RHTA 3DNPA 2QVZX 3MLAA 2GYUA 2HMTA 1XVAA 1QFMA 1M6EX 2XD4A 3IAXA 3QLVC 1RP7A 4DQVA 2PU5A 4DYDA 4TKVA 4Y6GB 4GPD1 1D3AA 2OCYC 4LWZA 2ZAYA 3AI1A 4IGAA 2Y76A 1TQ8A 4GC9A 1HA3A 3GLHA 3NT2A 3OP1A 4TUYA 3VPHA 4L9RA 3RJMA 4BC0A 1EXDA 1MXFA 1TTQB 2XQVA 4EB0A 4FEAA 4N0MA 1KYTA 1P6UA 3AF4A 1DS6A 1JKJB 2VCEA 3A2MA 1JWLA 5D3MB 1OZ0A 3IUQA 4O29A 5BUZA 1NX9A 4D3XA 5FCDA 6CHYA 1MV5A 1RTTA 1IXKA 1P61B 1U2PA 2Q1UA 4FN5A 2E89A 3N6XA 4GAEA 3WIBA 2PVCA 4ENUA 1MUUA 1XQ1A 4FS3A 1W9MA 3X1ZA 4EI9A 5JOQA 2G0AA 4XYLA 1BW9B 5FUBA 5GP1A 5T7BA 5KYWB 2VP3A 3I9LA 3Q7TA 3T94A 4ALJA 1V1MB 5DXJA 4BVLA 3CTMA 4UBNA 3ROEA 3QE0A 1II8A 2OO5C 3GJZA 4YALA 4CGYA 2OQRA 2EF0A 2FZ4A 4J0CA 4Y7CA 5JO9A 5TJ9A 1J5XA 1QIFA 1ZFNA 3G5MA 4OTZA 1ZCBA 4B3JA 3HCRA 4BGIA 1KE2A 2CFSA 1SKYE 1Q0TA 3R5TA 1W1UA 3G2JA 3P9CA 5FQOA 1YCFA 1TT5A 3CE9A 3QUQA 3KO8A 4O08A 4QQNA 4Q19A 3N3BC 5SYMA 2DAPA 3E9EA 3LLVA 4JGGA 5I7UA 5HOQA 5C52B 2INGX 3ZQ6A 3BHMA 5FUWA 3TLCA 4P4LA 2O0KA 5E4JA 1GM5A 4XQGA 3Q3JB 2VJMA 4Z8XA 2V9CA 2XZTA 4FMCB 3WGMA 1AMNA 3EPKA 2CLCX 4J94A 3GW8A 3CISA 3ZVLA 2QT0A 2YNMD 3K1TA 4FR5A 3NOXA 2LXNA 5B3LA 4UOZA 4WMLA 1OREA 3PUVA 1L5SA 3QX9A 3QY0A 1OXUA 3K4QA 1TF2A 1QH0A 3ROTA 2ZTMA 4EJ6A 3L7KA 2XH8A 4W1SA 1A8SA 3TI7A 2OXFA 3GARA 3SLRA 1A5SB 2QRUA 3U09A 3JATB 3AEUB 2D2XA 2CCJA 3KU1A 5DYWA 4TLEA 4ASUD 4YROA 1SD5A 1ZK3A 3E58A 1NXPA 4JZKA 4TT3D 5KDLA 5AVWA 1ADCA 1SEPA 1CP2A 5ALEA 5AWFC 4H7PA 3SZLA 1UZLA 5EPEA 2I8CA 1VBMA 3ZWBA 3E7XA 3SBEA 1GGVA 1HRKA 4MGYR 3TW0A 4Z7NB 3MJ4A 5DE3A 2BDTA 1G17A 3B60A 4OHYA 1JR3E 3K3PA 1XQ6A 4I81A 4IH1A 4J7CA 1KU0A 4DB4A 5EERA 4PG5A 2PMCA 5CA1B 2X0RA 3KLBA 4B9AA 3CYFA 4K9MA 3AY3A 3K0SA 1GA1A 3BDAA 3HU3A 5T5QA 5BORA 7ABPA 4L5BA 1ZZGA 5A6SA 2XCTB 4KMRA 3IIJA 3TXXA 4D42A 4YRSA 1OGJA 3HC7A 2HU5A 5K1ZA 1RLJA 1KIFA 3DO6A 5ILQA 2XWJI 4H7FA 4XR9A 2A59A 1X8LA 3HADA 3W05A 3DEKA 5G3YA 1ICIA 1MABA 3VPDA 4FD2A 1P33A 2FSSA 3WSTA 2WIGA 4QELA 1DIGA 1Y4ZA 4JP2A 1WOYA 5THKA 3VU3A 2HHLA 3STVA 1XU9A 4KFTA 3MWKA 4TZ0A 3KBOA 2ZRPA 1NP6A 3GFFA 5LXTB 5K8CA 2TYSB 1P91A 3JYNA 3DA8A 1TQ2A 1GPLA 2DYKA 4RD6A 1SC6A 1O08A 1PN3A 2OFPA 3B3QA 1XTBA 3MINA 4B7AA 4YC7A 1IATA 2VWQA