4R19A

Crystal structure of 3d7 strain plasmodium falciparum ama1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
335
structure length
321
Chain Sequence
NYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1, AMA1
publication title Structure and Dynamics of Apical Membrane Antigen 1 from Plasmodium falciparum FVO.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Cell invasion
total genus 93
structure length 321
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4r19A01
4R19A 5CSQA 4APMA 2LL4M 5CT1A 2X2ZA 4Z09A 4UV6A 3HMSA 5CS1A 1Z40A 2YIOA 4R1AA 5CS9A 1HKYA 2K13X 5CT2A 2J8LA 4R1CA 3HN4A 3SRJA 4APLA 4UAOA 3MKPA 1I8NA 1NK1A 2Z8VA 1GMNA 1W81A 5EODA 4Z0EA 3ZLEA 5EOKA 4Z0FA 2LL3A 3SRIA 2HGFA 2Z8WA 5I25A 4R1BA 3HMRA 1GP9A 2Q8BA 3ZWZA 2YIPA 1YXEA 1GMOA 5CT3A 1BHTA 2QJ4A 4IUAA 4A5TS 2Y8RA 2Q8AA 4Z0DA 3SP8A 5CS5A 5CS3A 2QJ2A 1W8KA 5COEA 4DURA 3HMTA 2J8JA 5CP9A 2F83A 2YILA
chains in the Genus database with same CATH superfamily
4R19A 5CSQA 4APMA 2LL4M 5CT1A 2X2ZA 4Z09A 4UV6A 3HMSA 5CS1A 1Z40A 2YIOA 4R1AA 5CS9A 1HKYA 2K13X 5CT2A 2J8LA 4R1CA 2KL5A 3HN4A 4YIVA 3SRJA 4APLA 4UAOA 3MKPA 1I8NA 1NK1A 2Z8VA 1GMNA 1W81A 5EODA 4Z0EA 3ZLEA 4YIZA 5EOKA 4Z0FA 2LL3A 3SRIA 2HGFA 2Z8WA 5I25A 4R1BA 3HMRA 1GP9A 2Q8BA 3ZWZA 2YIPA 1YXEA 1GMOA 5CT3A 1BHTA 2QJ4A 4IUAA 4A5TS 2Y8RA 2Q8AA 4Z0DA 3SP8A 5CS5A 5CS3A 2QJ2A 1W8KA 5COEA 4DURA 3HMTA 2J8JA 5CP9A 2F83A 2YILA
chains in the Genus database with same CATH topology
4R19A 5CSQA 4APMA 2LL4M 5CT1A 2X2ZA 4Z09A 4UV6A 3HMSA 5CS1A 1Z40A 2YIOA 4R1AA 5CS9A 1HKYA 2K13X 5CT2A 2J8LA 4R1CA 2KL5A 3HN4A 4YIVA 3SRJA 4APLA 4UAOA 3MKPA 1I8NA 1NK1A 2Z8VA 1GMNA 1W81A 5EODA 4Z0EA 3ZLEA 4YIZA 5EOKA 4Z0FA 2LL3A 3SRIA 2HGFA 2Z8WA 5I25A 4R1BA 3HMRA 1GP9A 2Q8BA 3ZWZA 2YIPA 1YXEA 1GMOA 5CT3A 1BHTA 2QJ4A 4IUAA 4A5TS 2Y8RA 2Q8AA 4Z0DA 3SP8A 5CS5A 5CS3A 2QJ2A 1W8KA 5COEA 4DURA 3HMTA 2J8JA 5CP9A 2F83A 2YILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R19 A;  5CSQ A;  4APM A;  2LL4 M;  5CT1 A;  2X2Z A;  4Z09 A;  4UV6 A;  3HMS A;  5CS1 A;  1Z40 A;  2YIO A;  4R1A A;  5CS9 A;  1HKY A;  2K13 X;  5CT2 A;  2J8L A;  4R1C A;  3HN4 A;  3SRJ A;  4APL A;  4UAO A;  3MKP A;  1I8N A;  1NK1 A;  2Z8V A;  1GMN A;  1W81 A;  5EOD A;  4Z0E A;  3ZLE A;  5EOK A;  4Z0F A;  2LL3 A;  3SRI A;  2HGF A;  2Z8W A;  5I25 A;  4R1B A;  3HMR A;  1GP9 A;  2Q8B A;  3ZWZ A;  2YIP A;  1YXE A;  1GMO A;  5CT3 A;  1BHT A;  2QJ4 A;  4IUA A;  4A5T S;  2Y8R A;  2Q8A A;  4Z0D A;  3SP8 A;  5CS5 A;  5CS3 A;  2QJ2 A;  1W8K A;  5COE A;  4DUR A;  3HMT A;  2J8J A;  5CP9 A;  2F83 A;  2YIL A; 
#chains in the Genus database with same CATH topology
 4R19 A;  5CSQ A;  4APM A;  2LL4 M;  5CT1 A;  2X2Z A;  4Z09 A;  4UV6 A;  3HMS A;  5CS1 A;  1Z40 A;  2YIO A;  4R1A A;  5CS9 A;  1HKY A;  2K13 X;  5CT2 A;  2J8L A;  4R1C A;  2KL5 A;  3HN4 A;  4YIV A;  3SRJ A;  4APL A;  4UAO A;  3MKP A;  1I8N A;  1NK1 A;  2Z8V A;  1GMN A;  1W81 A;  5EOD A;  4Z0E A;  3ZLE A;  4YIZ A;  5EOK A;  4Z0F A;  2LL3 A;  3SRI A;  2HGF A;  2Z8W A;  5I25 A;  4R1B A;  3HMR A;  1GP9 A;  2Q8B A;  3ZWZ A;  2YIP A;  1YXE A;  1GMO A;  5CT3 A;  1BHT A;  2QJ4 A;  4IUA A;  4A5T S;  2Y8R A;  2Q8A A;  4Z0D A;  3SP8 A;  5CS5 A;  5CS3 A;  2QJ2 A;  1W8K A;  5COE A;  4DUR A;  3HMT A;  2J8J A;  5CP9 A;  2F83 A;  2YIL A; 
#chains in the Genus database with same CATH homology
 4R19 A;  5CSQ A;  4APM A;  2LL4 M;  5CT1 A;  2X2Z A;  4Z09 A;  4UV6 A;  3HMS A;  5CS1 A;  1Z40 A;  2YIO A;  4R1A A;  5CS9 A;  1HKY A;  2K13 X;  5CT2 A;  2J8L A;  4R1C A;  2KL5 A;  3HN4 A;  4YIV A;  3SRJ A;  4APL A;  4UAO A;  3MKP A;  1I8N A;  1NK1 A;  2Z8V A;  1GMN A;  1W81 A;  5EOD A;  4Z0E A;  3ZLE A;  4YIZ A;  5EOK A;  4Z0F A;  2LL3 A;  3SRI A;  2HGF A;  2Z8W A;  5I25 A;  4R1B A;  3HMR A;  1GP9 A;  2Q8B A;  3ZWZ A;  2YIP A;  1YXE A;  1GMO A;  5CT3 A;  1BHT A;  2QJ4 A;  4IUA A;  4A5T S;  2Y8R A;  2Q8A A;  4Z0D A;  3SP8 A;  5CS5 A;  5CS3 A;  2QJ2 A;  1W8K A;  5COE A;  4DUR A;  3HMT A;  2J8J A;  5CP9 A;  2F83 A;  2YIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...