4R1BA

Crystal structure of 3d7 strain plasmodium falciparum ama1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
331
structure length
282
Chain Sequence
b'NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIISNTTFLTPVATGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKLTDYEKIKEGFKNYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1, AMA1
publication title Structure and Dynamics of Apical Membrane Antigen 1 from Plasmodium falciparum FVO.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Cell invasion
total genus 85
structure length 282
sequence length 331
ec nomenclature
pdb deposition date 2014-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4r1bA01
4A5TS 4APLA 2Q8BA 4APMA 3ZWZA 2K13X 2QJ2A 2X2ZA 4Z09A 3HMSA 5I25A 1HKYA 3HMTA 5CS3A 4UAOA 3ZLEA 4R1CA 1W8KA 2Z8WA 4IUAA 4R19A 3HMRA 4Z0FA 3HN4A 5CT2A 1YXEA 4UV6A 5CSQA 1GMOA 5CS1A 1I8NA 2Z8VA 1GMNA 3SRJA 4R1BA 2QJ4A 2Y8RA 3SRIA 1GP9A 4DURA 2HGFA 4R1AA 1W81A 3MKPA 2F83A 5COEA 5EOKA 2J8LA 2J8JA 5CS9A 1Z40A 5CS5A 5EODA 5CT1A 1BHTA 2LL3A 2YIOA 2YIPA 5CT3A 4Z0DA 4Z0EA 2Q8AA 1NK1A 3SP8A 2LL4M 2YILA 5CP9A
chains in the Genus database with same CATH superfamily
4A5TS 4APLA 2Q8BA 4APMA 3ZWZA 2K13X 2QJ2A 2X2ZA 4Z09A 3HMSA 5I25A 1HKYA 3HMTA 2KL5A 5CS3A 4UAOA 3ZLEA 4YIZA 4R1CA 1W8KA 2Z8WA 4IUAA 4R19A 3HMRA 4Z0FA 3HN4A 5CT2A 1YXEA 4UV6A 5CSQA 1GMOA 5CS1A 4YIVA 1I8NA 2Z8VA 1GMNA 3SRJA 4R1BA 2QJ4A 2Y8RA 3SRIA 1GP9A 4DURA 2HGFA 4R1AA 1W81A 3MKPA 2F83A 5COEA 5EOKA 2J8LA 2J8JA 5CS9A 1Z40A 5CS5A 5EODA 5CT1A 1BHTA 2LL3A 2YIOA 2YIPA 5CT3A 4Z0DA 4Z0EA 2Q8AA 1NK1A 3SP8A 2LL4M 2YILA 5CP9A
chains in the Genus database with same CATH topology
4A5TS 4APLA 2Q8BA 4APMA 3ZWZA 2K13X 2QJ2A 2X2ZA 4Z09A 3HMSA 5I25A 1HKYA 3HMTA 2KL5A 5CS3A 4UAOA 3ZLEA 4YIZA 4R1CA 1W8KA 2Z8WA 4IUAA 4R19A 3HMRA 4Z0FA 3HN4A 5CT2A 1YXEA 4UV6A 5CSQA 1GMOA 5CS1A 4YIVA 1I8NA 2Z8VA 1GMNA 3SRJA 4R1BA 2QJ4A 2Y8RA 3SRIA 1GP9A 4DURA 2HGFA 4R1AA 1W81A 3MKPA 2F83A 5COEA 5EOKA 2J8LA 2J8JA 5CS9A 1Z40A 5CS5A 5EODA 5CT1A 1BHTA 2LL3A 2YIOA 2YIPA 5CT3A 4Z0DA 4Z0EA 2Q8AA 1NK1A 3SP8A 2LL4M 2YILA 5CP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5T S;  4APL A;  2Q8B A;  4APM A;  3ZWZ A;  2K13 X;  2QJ2 A;  2X2Z A;  4Z09 A;  3HMS A;  5I25 A;  1HKY A;  3HMT A;  5CS3 A;  4UAO A;  3ZLE A;  4R1C A;  1W8K A;  2Z8W A;  4IUA A;  4R19 A;  3HMR A;  4Z0F A;  3HN4 A;  5CT2 A;  1YXE A;  4UV6 A;  5CSQ A;  1GMO A;  5CS1 A;  1I8N A;  2Z8V A;  1GMN A;  3SRJ A;  4R1B A;  2QJ4 A;  2Y8R A;  3SRI A;  1GP9 A;  4DUR A;  2HGF A;  4R1A A;  1W81 A;  3MKP A;  2F83 A;  5COE A;  5EOK A;  2J8L A;  2J8J A;  5CS9 A;  1Z40 A;  5CS5 A;  5EOD A;  5CT1 A;  1BHT A;  2LL3 A;  2YIO A;  2YIP A;  5CT3 A;  4Z0D A;  4Z0E A;  2Q8A A;  1NK1 A;  3SP8 A;  2LL4 M;  2YIL A;  5CP9 A; 
#chains in the Genus database with same CATH topology
 4A5T S;  4APL A;  2Q8B A;  4APM A;  3ZWZ A;  2K13 X;  2QJ2 A;  2X2Z A;  4Z09 A;  3HMS A;  5I25 A;  1HKY A;  3HMT A;  2KL5 A;  5CS3 A;  4UAO A;  3ZLE A;  4YIZ A;  4R1C A;  1W8K A;  2Z8W A;  4IUA A;  4R19 A;  3HMR A;  4Z0F A;  3HN4 A;  5CT2 A;  1YXE A;  4UV6 A;  5CSQ A;  1GMO A;  5CS1 A;  4YIV A;  1I8N A;  2Z8V A;  1GMN A;  3SRJ A;  4R1B A;  2QJ4 A;  2Y8R A;  3SRI A;  1GP9 A;  4DUR A;  2HGF A;  4R1A A;  1W81 A;  3MKP A;  2F83 A;  5COE A;  5EOK A;  2J8L A;  2J8J A;  5CS9 A;  1Z40 A;  5CS5 A;  5EOD A;  5CT1 A;  1BHT A;  2LL3 A;  2YIO A;  2YIP A;  5CT3 A;  4Z0D A;  4Z0E A;  2Q8A A;  1NK1 A;  3SP8 A;  2LL4 M;  2YIL A;  5CP9 A; 
#chains in the Genus database with same CATH homology
 4A5T S;  4APL A;  2Q8B A;  4APM A;  3ZWZ A;  2K13 X;  2QJ2 A;  2X2Z A;  4Z09 A;  3HMS A;  5I25 A;  1HKY A;  3HMT A;  2KL5 A;  5CS3 A;  4UAO A;  3ZLE A;  4YIZ A;  4R1C A;  1W8K A;  2Z8W A;  4IUA A;  4R19 A;  3HMR A;  4Z0F A;  3HN4 A;  5CT2 A;  1YXE A;  4UV6 A;  5CSQ A;  1GMO A;  5CS1 A;  4YIV A;  1I8N A;  2Z8V A;  1GMN A;  3SRJ A;  4R1B A;  2QJ4 A;  2Y8R A;  3SRI A;  1GP9 A;  4DUR A;  2HGF A;  4R1A A;  1W81 A;  3MKP A;  2F83 A;  5COE A;  5EOK A;  2J8L A;  2J8J A;  5CS9 A;  1Z40 A;  5CS5 A;  5EOD A;  5CT1 A;  1BHT A;  2LL3 A;  2YIO A;  2YIP A;  5CT3 A;  4Z0D A;  4Z0E A;  2Q8A A;  1NK1 A;  3SP8 A;  2LL4 M;  2YIL A;  5CP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...