4R1BA

Crystal structure of 3d7 strain plasmodium falciparum ama1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
331
structure length
282
Chain Sequence
NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIISNTTFLTPVATGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKLTDYEKIKEGFKNYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1, AMA1
publication title Structure and Dynamics of Apical Membrane Antigen 1 from Plasmodium falciparum FVO.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Cell invasion
total genus 85
structure length 282
sequence length 331
ec nomenclature
pdb deposition date 2014-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4r1bA01
2X2ZA 4IUAA 5I25A 1Z40A 5EOKA 4Z0FA 5COEA 1W81A 5CP9A 2YIPA 5CSQA 2QJ4A 5CT1A 5EODA 5CS9A 2F83A 4R19A 3HMTA 1GP9A 4R1AA 2J8JA 2K13X 1BHTA 3HMRA 4Z0DA 4APLA 2Q8AA 2HGFA 5CS1A 1GMNA 5CS5A 1HKYA 3SRIA 2QJ2A 4A5TS 3SRJA 4Z0EA 3ZWZA 5CS3A 1NK1A 2Z8WA 2LL3A 4UV6A 2Z8VA 1W8KA 2Q8BA 4R1BA 5CT2A 4DURA 3HN4A 1I8NA 2J8LA 3HMSA 4Z09A 2Y8RA 4APMA 1GMOA 3MKPA 4R1CA 2YILA 1YXEA 5CT3A 3SP8A 3ZLEA 2YIOA 2LL4M 4UAOA
chains in the Genus database with same CATH superfamily
2X2ZA 4IUAA 4YIZA 1Z40A 5EOKA 4Z0FA 5COEA 5I25A 1W81A 5CP9A 2YIPA 5CSQA 2QJ4A 5CT1A 5EODA 5CS9A 2F83A 4R19A 3HMTA 1GP9A 4R1AA 2J8JA 2K13X 1BHTA 3HMRA 4YIVA 4Z0DA 4APLA 2Q8AA 2HGFA 5CS1A 1GMNA 5CS5A 1HKYA 3SRIA 2QJ2A 4A5TS 3SRJA 4Z0EA 3ZWZA 5CS3A 1NK1A 2Z8WA 2LL3A 4UV6A 2Z8VA 1W8KA 2Q8BA 4R1BA 5CT2A 4DURA 3HN4A 1I8NA 2J8LA 3HMSA 4Z09A 2Y8RA 4APMA 1GMOA 3MKPA 4R1CA 2KL5A 1YXEA 2YILA 5CT3A 3SP8A 3ZLEA 2YIOA 2LL4M 4UAOA
chains in the Genus database with same CATH topology
2X2ZA 4IUAA 4YIZA 1Z40A 5EOKA 4Z0FA 5COEA 5I25A 1W81A 5CP9A 2YIPA 5CSQA 2QJ4A 5CT1A 5EODA 5CS9A 2F83A 4R19A 3HMTA 1GP9A 4R1AA 2J8JA 2K13X 1BHTA 3HMRA 4YIVA 4Z0DA 4APLA 2Q8AA 2HGFA 5CS1A 1GMNA 5CS5A 1HKYA 3SRIA 2QJ2A 4A5TS 3SRJA 4Z0EA 3ZWZA 5CS3A 1NK1A 2Z8WA 2LL3A 4UV6A 2Z8VA 1W8KA 2Q8BA 4R1BA 5CT2A 4DURA 3HN4A 1I8NA 2J8LA 3HMSA 4Z09A 2Y8RA 4APMA 1GMOA 3MKPA 4R1CA 2KL5A 1YXEA 2YILA 5CT3A 3SP8A 3ZLEA 2YIOA 2LL4M 4UAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2Z A;  4IUA A;  5I25 A;  1Z40 A;  5EOK A;  4Z0F A;  5COE A;  1W81 A;  5CP9 A;  2YIP A;  5CSQ A;  2QJ4 A;  5CT1 A;  5EOD A;  5CS9 A;  2F83 A;  4R19 A;  3HMT A;  1GP9 A;  4R1A A;  2J8J A;  2K13 X;  1BHT A;  3HMR A;  4Z0D A;  4APL A;  2Q8A A;  2HGF A;  5CS1 A;  1GMN A;  5CS5 A;  1HKY A;  3SRI A;  2QJ2 A;  4A5T S;  3SRJ A;  4Z0E A;  3ZWZ A;  5CS3 A;  1NK1 A;  2Z8W A;  2LL3 A;  4UV6 A;  2Z8V A;  1W8K A;  2Q8B A;  4R1B A;  5CT2 A;  4DUR A;  3HN4 A;  1I8N A;  2J8L A;  3HMS A;  4Z09 A;  2Y8R A;  4APM A;  1GMO A;  3MKP A;  4R1C A;  2YIL A;  1YXE A;  5CT3 A;  3SP8 A;  3ZLE A;  2YIO A;  2LL4 M;  4UAO A; 
#chains in the Genus database with same CATH topology
 2X2Z A;  4IUA A;  4YIZ A;  1Z40 A;  5EOK A;  4Z0F A;  5COE A;  5I25 A;  1W81 A;  5CP9 A;  2YIP A;  5CSQ A;  2QJ4 A;  5CT1 A;  5EOD A;  5CS9 A;  2F83 A;  4R19 A;  3HMT A;  1GP9 A;  4R1A A;  2J8J A;  2K13 X;  1BHT A;  3HMR A;  4YIV A;  4Z0D A;  4APL A;  2Q8A A;  2HGF A;  5CS1 A;  1GMN A;  5CS5 A;  1HKY A;  3SRI A;  2QJ2 A;  4A5T S;  3SRJ A;  4Z0E A;  3ZWZ A;  5CS3 A;  1NK1 A;  2Z8W A;  2LL3 A;  4UV6 A;  2Z8V A;  1W8K A;  2Q8B A;  4R1B A;  5CT2 A;  4DUR A;  3HN4 A;  1I8N A;  2J8L A;  3HMS A;  4Z09 A;  2Y8R A;  4APM A;  1GMO A;  3MKP A;  4R1C A;  2KL5 A;  1YXE A;  2YIL A;  5CT3 A;  3SP8 A;  3ZLE A;  2YIO A;  2LL4 M;  4UAO A; 
#chains in the Genus database with same CATH homology
 2X2Z A;  4IUA A;  4YIZ A;  1Z40 A;  5EOK A;  4Z0F A;  5COE A;  5I25 A;  1W81 A;  5CP9 A;  2YIP A;  5CSQ A;  2QJ4 A;  5CT1 A;  5EOD A;  5CS9 A;  2F83 A;  4R19 A;  3HMT A;  1GP9 A;  4R1A A;  2J8J A;  2K13 X;  1BHT A;  3HMR A;  4YIV A;  4Z0D A;  4APL A;  2Q8A A;  2HGF A;  5CS1 A;  1GMN A;  5CS5 A;  1HKY A;  3SRI A;  2QJ2 A;  4A5T S;  3SRJ A;  4Z0E A;  3ZWZ A;  5CS3 A;  1NK1 A;  2Z8W A;  2LL3 A;  4UV6 A;  2Z8V A;  1W8K A;  2Q8B A;  4R1B A;  5CT2 A;  4DUR A;  3HN4 A;  1I8N A;  2J8L A;  3HMS A;  4Z09 A;  2Y8R A;  4APM A;  1GMO A;  3MKP A;  4R1C A;  2KL5 A;  1YXE A;  2YIL A;  5CT3 A;  3SP8 A;  3ZLE A;  2YIO A;  2LL4 M;  4UAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...