4R1CA

Crystal structure of 3d7 strain plasmodium falciparum ama1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
331
structure length
279
Chain Sequence
b'NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1, AMA1
publication title Structure and Dynamics of Apical Membrane Antigen 1 from Plasmodium falciparum FVO.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Cell invasion
total genus 81
structure length 279
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4r1cA01
4DURA 4R1CA 3ZLEA 1W8KA 2LL3A 4UV6A 1BHTA 4Z0FA 2Z8WA 2J8JA 5EODA 5EOKA 5I25A 3SRIA 3SRJA 4R19A 5CS3A 1W81A 3SP8A 2YIPA 4APMA 5CT1A 5COEA 4A5TS 4R1BA 2Z8VA 1GMNA 4UAOA 5CS9A 5CSQA 4R1AA 4Z09A 1Z40A 1HKYA 2Y8RA 4Z0EA 5CT2A 3ZWZA 1GP9A 3HMSA 2LL4M 5CS1A 2QJ2A 1YXEA 1NK1A 2YIOA 3HN4A 2HGFA 1GMOA 2Q8AA 2Q8BA 3HMRA 2F83A 4APLA 2QJ4A 2X2ZA 3HMTA 3MKPA 4IUAA 2YILA 5CP9A 1I8NA 5CS5A 5CT3A 4Z0DA 2K13X 2J8LA
chains in the Genus database with same CATH superfamily
4DURA 4R1CA 3ZLEA 1W8KA 2LL3A 4UV6A 1BHTA 4Z0FA 2Z8WA 2J8JA 5EODA 5EOKA 5I25A 3SRIA 3SRJA 4R19A 5CS3A 1W81A 3SP8A 2YIPA 4APMA 5CT1A 5COEA 4A5TS 4R1BA 4YIZA 2Z8VA 1GMNA 4UAOA 5CS9A 5CSQA 4R1AA 4Z09A 4YIVA 1Z40A 1HKYA 2Y8RA 2KL5A 5CT2A 4Z0EA 3ZWZA 1GP9A 3HMSA 2LL4M 5CS1A 2QJ2A 1YXEA 1NK1A 2YIOA 3HN4A 2HGFA 1GMOA 2Q8AA 2Q8BA 3HMRA 2F83A 4APLA 2QJ4A 2X2ZA 3HMTA 3MKPA 4IUAA 2YILA 5CP9A 1I8NA 5CS5A 5CT3A 4Z0DA 2K13X 2J8LA
chains in the Genus database with same CATH topology
4DURA 4R1CA 3ZLEA 1W8KA 2LL3A 4UV6A 1BHTA 4Z0FA 2Z8WA 2J8JA 5EODA 5EOKA 5I25A 3SRIA 3SRJA 4R19A 5CS3A 1W81A 3SP8A 2YIPA 4APMA 5CT1A 5COEA 4A5TS 4R1BA 4YIZA 2Z8VA 1GMNA 4UAOA 5CS9A 5CSQA 4R1AA 4Z09A 4YIVA 1Z40A 1HKYA 2Y8RA 2KL5A 5CT2A 4Z0EA 3ZWZA 1GP9A 3HMSA 2LL4M 5CS1A 2QJ2A 1YXEA 1NK1A 2YIOA 3HN4A 2HGFA 1GMOA 2Q8AA 2Q8BA 3HMRA 2F83A 4APLA 2QJ4A 2X2ZA 3HMTA 3MKPA 4IUAA 2YILA 5CP9A 1I8NA 5CS5A 5CT3A 4Z0DA 2K13X 2J8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUR A;  4R1C A;  3ZLE A;  1W8K A;  2LL3 A;  4UV6 A;  1BHT A;  4Z0F A;  2Z8W A;  2J8J A;  5EOD A;  5EOK A;  5I25 A;  3SRI A;  3SRJ A;  4R19 A;  5CS3 A;  1W81 A;  3SP8 A;  2YIP A;  4APM A;  5CT1 A;  5COE A;  4A5T S;  4R1B A;  2Z8V A;  1GMN A;  4UAO A;  5CS9 A;  5CSQ A;  4R1A A;  4Z09 A;  1Z40 A;  1HKY A;  2Y8R A;  4Z0E A;  5CT2 A;  3ZWZ A;  1GP9 A;  3HMS A;  2LL4 M;  5CS1 A;  2QJ2 A;  1YXE A;  1NK1 A;  2YIO A;  3HN4 A;  2HGF A;  1GMO A;  2Q8A A;  2Q8B A;  3HMR A;  2F83 A;  4APL A;  2QJ4 A;  2X2Z A;  3HMT A;  3MKP A;  4IUA A;  2YIL A;  5CP9 A;  1I8N A;  5CS5 A;  5CT3 A;  4Z0D A;  2K13 X;  2J8L A; 
#chains in the Genus database with same CATH topology
 4DUR A;  4R1C A;  3ZLE A;  1W8K A;  2LL3 A;  4UV6 A;  1BHT A;  4Z0F A;  2Z8W A;  2J8J A;  5EOD A;  5EOK A;  5I25 A;  3SRI A;  3SRJ A;  4R19 A;  5CS3 A;  1W81 A;  3SP8 A;  2YIP A;  4APM A;  5CT1 A;  5COE A;  4A5T S;  4R1B A;  4YIZ A;  2Z8V A;  1GMN A;  4UAO A;  5CS9 A;  5CSQ A;  4R1A A;  4Z09 A;  4YIV A;  1Z40 A;  1HKY A;  2Y8R A;  2KL5 A;  5CT2 A;  4Z0E A;  3ZWZ A;  1GP9 A;  3HMS A;  2LL4 M;  5CS1 A;  2QJ2 A;  1YXE A;  1NK1 A;  2YIO A;  3HN4 A;  2HGF A;  1GMO A;  2Q8A A;  2Q8B A;  3HMR A;  2F83 A;  4APL A;  2QJ4 A;  2X2Z A;  3HMT A;  3MKP A;  4IUA A;  2YIL A;  5CP9 A;  1I8N A;  5CS5 A;  5CT3 A;  4Z0D A;  2K13 X;  2J8L A; 
#chains in the Genus database with same CATH homology
 4DUR A;  4R1C A;  3ZLE A;  1W8K A;  2LL3 A;  4UV6 A;  1BHT A;  4Z0F A;  2Z8W A;  2J8J A;  5EOD A;  5EOK A;  5I25 A;  3SRI A;  3SRJ A;  4R19 A;  5CS3 A;  1W81 A;  3SP8 A;  2YIP A;  4APM A;  5CT1 A;  5COE A;  4A5T S;  4R1B A;  4YIZ A;  2Z8V A;  1GMN A;  4UAO A;  5CS9 A;  5CSQ A;  4R1A A;  4Z09 A;  4YIV A;  1Z40 A;  1HKY A;  2Y8R A;  2KL5 A;  5CT2 A;  4Z0E A;  3ZWZ A;  1GP9 A;  3HMS A;  2LL4 M;  5CS1 A;  2QJ2 A;  1YXE A;  1NK1 A;  2YIO A;  3HN4 A;  2HGF A;  1GMO A;  2Q8A A;  2Q8B A;  3HMR A;  2F83 A;  4APL A;  2QJ4 A;  2X2Z A;  3HMT A;  3MKP A;  4IUA A;  2YIL A;  5CP9 A;  1I8N A;  5CS5 A;  5CT3 A;  4Z0D A;  2K13 X;  2J8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...