4R1CA

Crystal structure of 3d7 strain plasmodium falciparum ama1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
331
structure length
279
Chain Sequence
NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1, AMA1
publication title Structure and Dynamics of Apical Membrane Antigen 1 from Plasmodium falciparum FVO.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Cell invasion
total genus 81
structure length 279
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 4r1cA01
2X2ZA 5CS3A 5EODA 5CT3A 4Z0DA 5CP9A 2LL4M 4Z0EA 2Y8RA 5CT2A 4R1CA 2HGFA 2K13X 2Z8WA 1GMOA 2F83A 5COEA 4Z09A 3SRJA 3SRIA 3HMSA 2J8LA 3HN4A 1W81A 4IUAA 3ZLEA 1GP9A 5CS9A 1Z40A 4UAOA 4A5TS 2YILA 5CS1A 2LL3A 2Z8VA 3HMTA 4UV6A 5EOKA 2YIPA 4APLA 4Z0FA 5CT1A 4R1AA 5I25A 3SP8A 3MKPA 1GMNA 2J8JA 3HMRA 4APMA 1BHTA 1NK1A 3ZWZA 1I8NA 2Q8BA 1HKYA 1YXEA 2Q8AA 4R19A 5CS5A 2QJ4A 4DURA 4R1BA 5CSQA 2QJ2A 2YIOA 1W8KA
chains in the Genus database with same CATH superfamily
2X2ZA 5CS3A 5EODA 5CT3A 4Z0DA 5CP9A 2LL4M 4Z0EA 2Y8RA 5CT2A 4R1CA 2HGFA 2K13X 2Z8WA 1GMOA 2F83A 5COEA 4Z09A 3SRJA 3SRIA 3HMSA 2J8LA 3HN4A 1W81A 2KL5A 4IUAA 3ZLEA 1GP9A 5CS9A 1Z40A 4UAOA 4A5TS 2YILA 5CS1A 2LL3A 2Z8VA 3HMTA 4UV6A 5EOKA 2YIPA 4APLA 4Z0FA 5CT1A 4R1AA 5I25A 3SP8A 3MKPA 1GMNA 2J8JA 3HMRA 4APMA 1BHTA 1NK1A 3ZWZA 1I8NA 2Q8BA 1HKYA 1YXEA 2Q8AA 4R19A 5CS5A 2QJ4A 4YIVA 4DURA 4R1BA 5CSQA 2QJ2A 2YIOA 1W8KA 4YIZA
chains in the Genus database with same CATH topology
2X2ZA 5CS3A 5EODA 5CT3A 4Z0DA 5CP9A 2LL4M 4Z0EA 2Y8RA 5CT2A 4R1CA 2HGFA 2K13X 2Z8WA 1GMOA 2F83A 5COEA 4Z09A 3SRJA 3SRIA 3HMSA 2J8LA 3HN4A 1W81A 2KL5A 4IUAA 3ZLEA 1GP9A 5CS9A 1Z40A 4UAOA 4A5TS 2YILA 5CS1A 2LL3A 2Z8VA 3HMTA 4UV6A 5EOKA 2YIPA 4APLA 4Z0FA 5CT1A 4R1AA 5I25A 3SP8A 3MKPA 1GMNA 2J8JA 3HMRA 4APMA 1BHTA 1NK1A 3ZWZA 1I8NA 2Q8BA 1HKYA 1YXEA 2Q8AA 4R19A 5CS5A 2QJ4A 4YIVA 4DURA 4R1BA 5CSQA 2QJ2A 2YIOA 1W8KA 4YIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2Z A;  5CS3 A;  5EOD A;  5CT3 A;  4Z0D A;  5CP9 A;  2LL4 M;  4Z0E A;  2Y8R A;  5CT2 A;  4R1C A;  2HGF A;  2K13 X;  2Z8W A;  1GMO A;  2F83 A;  5COE A;  4Z09 A;  3SRJ A;  3SRI A;  3HMS A;  2J8L A;  3HN4 A;  1W81 A;  4IUA A;  3ZLE A;  1GP9 A;  5CS9 A;  1Z40 A;  4UAO A;  4A5T S;  2YIL A;  5CS1 A;  2LL3 A;  2Z8V A;  3HMT A;  4UV6 A;  5EOK A;  2YIP A;  4APL A;  4Z0F A;  5CT1 A;  4R1A A;  5I25 A;  3SP8 A;  3MKP A;  1GMN A;  2J8J A;  3HMR A;  4APM A;  1BHT A;  1NK1 A;  3ZWZ A;  1I8N A;  2Q8B A;  1HKY A;  1YXE A;  2Q8A A;  4R19 A;  5CS5 A;  2QJ4 A;  4DUR A;  4R1B A;  5CSQ A;  2QJ2 A;  2YIO A;  1W8K A; 
#chains in the Genus database with same CATH topology
 2X2Z A;  5CS3 A;  5EOD A;  5CT3 A;  4Z0D A;  5CP9 A;  2LL4 M;  4Z0E A;  2Y8R A;  5CT2 A;  4R1C A;  2HGF A;  2K13 X;  2Z8W A;  1GMO A;  2F83 A;  5COE A;  4Z09 A;  3SRJ A;  3SRI A;  3HMS A;  2J8L A;  3HN4 A;  1W81 A;  2KL5 A;  4IUA A;  3ZLE A;  1GP9 A;  5CS9 A;  1Z40 A;  4UAO A;  4A5T S;  2YIL A;  5CS1 A;  2LL3 A;  2Z8V A;  3HMT A;  4UV6 A;  5EOK A;  2YIP A;  4APL A;  4Z0F A;  5CT1 A;  4R1A A;  5I25 A;  3SP8 A;  3MKP A;  1GMN A;  2J8J A;  3HMR A;  4APM A;  1BHT A;  1NK1 A;  3ZWZ A;  1I8N A;  2Q8B A;  1HKY A;  1YXE A;  2Q8A A;  4R19 A;  5CS5 A;  2QJ4 A;  4YIV A;  4DUR A;  4R1B A;  5CSQ A;  2QJ2 A;  2YIO A;  1W8K A;  4YIZ A; 
#chains in the Genus database with same CATH homology
 2X2Z A;  5CS3 A;  5EOD A;  5CT3 A;  4Z0D A;  5CP9 A;  2LL4 M;  4Z0E A;  2Y8R A;  5CT2 A;  4R1C A;  2HGF A;  2K13 X;  2Z8W A;  1GMO A;  2F83 A;  5COE A;  4Z09 A;  3SRJ A;  3SRI A;  3HMS A;  2J8L A;  3HN4 A;  1W81 A;  2KL5 A;  4IUA A;  3ZLE A;  1GP9 A;  5CS9 A;  1Z40 A;  4UAO A;  4A5T S;  2YIL A;  5CS1 A;  2LL3 A;  2Z8V A;  3HMT A;  4UV6 A;  5EOK A;  2YIP A;  4APL A;  4Z0F A;  5CT1 A;  4R1A A;  5I25 A;  3SP8 A;  3MKP A;  1GMN A;  2J8J A;  3HMR A;  4APM A;  1BHT A;  1NK1 A;  3ZWZ A;  1I8N A;  2Q8B A;  1HKY A;  1YXE A;  2Q8A A;  4R19 A;  5CS5 A;  2QJ4 A;  4YIV A;  4DUR A;  4R1B A;  5CSQ A;  2QJ2 A;  2YIO A;  1W8K A;  4YIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...