4R1HA

Gntr family transcriptional regulator from listeria monocytogenes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
FDDSKPIYKQIVHYIHTEIVTGTYEAGDKLLSVRELATKLEVNPTTIQRAYAELEETEIIYTVRGTGKYLTEDKRRIEQLENDIAKQLTENFISEMSKLGINKEKIIAWVKKVEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GntR family transcriptional regulator from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
molecule keywords Lmo0741 protein
total genus 41
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4r1hA01
2A3SA 2RN7A 2YX4A 2D1HA 5AONA 2EA2A 2ZKZA 1R1VA 3H3ZA 1R7JA 2JSCA 1IZ1A 4N9HA 5FFXA 1D8KA 4IHTA 2DTRA 1HW2A 4A12A 4KIBA 1BI0A 1S3JA 4BH9A 1B6AA 1HQCA 2DK5A 3PQKA 1P4AA 3WTYC 1S6LA 1IUYA 3DP7A 4RS8A 4HW0A 3IL2A 3FWEA 1KU3A 2NYXA 4L9VA 1VTNC 1FY7A 4EM1A 1JGSA 1O7LA 1ZG1A 3O3KA 4HF2A 2Y0MA 1P2FA 5L3GA 4HOBA 4OU0A 2EFWA 1IN7A 4Z2YA 3HSRA 3EYYA 2M87A 1ZN2A 4HBLA 3V4GA 1HSJA 2MH9A 1FNNA 3I59A 1XMAA 3Q9VA 2HOEA 1REPC 2YPRA 2ZNYA 2IP2A 2PN6A 1J75A 2GZWA 3GFLA 4YFNF 1FYMA 1J5YA 2FBIA 4U0YA 1YO5C 4LK1F 3ABTA 3WTTC 3JTHA 2STTA 4XLPF 4UNOA 2XGXA 4B09A 1WI9A 3RTRA 2A61A 5E8GA 5DEQA 1P4XA 1U5TA 2X4HA 3I71A 5FD5A 5K5RA 2VT3A 4FX0A 3HOTA 2KRFA 1QO0D 3T0YA 3KEOA 3HSEA 3O2PE 4YFKF 3ECOA 4GCVA 4M72A 1RNLA 4YFXF 5LEJA 3KEQA 5AIPA 5A2QK 2PMHA 2XAJA 4S05A 1TW2A 3VODA 2AS5F 3RPQA 3ZQ7A 3F72A 2HYGD 2IJLA 1XMKA 2GAUA 2Q2EA 4KA4A 3KLNA 1YYVA 2ZCWA 4I7HA 1Q1HA 1WRJA 1KU2A 4MQVA 1IAWA 1OKRA 1XGMA 2BE5F 4MTDA 5LGUA 1U78A 1R5GA 3DPTA 2XKPA 3S2WA 1IW7F 2K4BA 1K78A 5K1YA 1SD6A 1RUNA 1ON1A 2M1BA 1V4RA 1HKTA 3WE2A 3TKYA 1RUOA 4UV9A 2Z99A 3GWZA 1STZA 1JHFA 1TNTA 4LGWA 4OIRF 5D4RA 4GYGA 4BQAA 3JSOA 2BYVE 1XGSA 1O3QA 4MHGA 2Z9OA 3QPHA 1G3TA 2ISYA 5DCMB 1S8NA 1LQ1A 4A6EA 4G6DA 1FT9A 3G3ZA 2WWYA 5TRDA 3BDDA 4L9NA 4WF2A 1YG2A 5HDNA 4OIOF 3I5UA 1LDKB 2ESNA 3Q9SA 2OBPA 1TW3A 3KETA 1KQ0A 1KGSA 4FHTA 1I27A 2COMA 1DDNA 2AXLA 1BM9A 2LDUA 2RNJA 2A69F 3VEPA 1BI2A 2ZNZA 4KICA 4D0PA 1Z6TA 3BY6A 3M1EA 4M74A 1XCBA 1R1TA 1IRGA 4EV0A 3KP6A 1L0OC 5CYVA 3WTWC 3FM3A 4LD5A 1SMYF 2BV6A 3NRVA 5HDGA 1QGPA 2RGVA 1IXRC 1O57A 4ZZDA 1PUEE 1TQIA 2EWNA 2LKPA 3CO7C 1ZAOA 4HF0A 3QP6A 3J7AO 3R0JA 4KN7X 1GHCA 1Z05A 1DUXC 1B59A 1SD7A 3KCCA 5CVIA 5BPDA 2CO5A 4EGZA 2QM3A 3OOPA 2W57A 4Y17A 4NHJA 5ILVA 4IVNA 3L9FA 3SZPA 1TLHB 4ZZLA 2KJCA 5BPIA 4ENJA 3TGNA 3J81K 3Q5FA 3CUQB 5D5WB 4M9XA 2F5FA 2PEXA 2HQNA 3TO7A 2DO7A 1YIOA 5FD6A 3K1PA 4RAYA 2PG4A 1XSVA 5JR3A 1U6GA 1QPMA 2CFXA 5HLIA 5LBQA 4GGGA 1T6SA 1CGPA 4EM0B 1Z91A 4ESBA 5D8KB 1XN7A 4ZH4F 2XAQA 2L01A 5FLXZ 4R79A 3BJOA 4G8XA 1O3TA 1F5TA 4KIFA 2LF7A 1LEAA 3HIFA 3CUQA 4HV6A 3MZYA 2QWWA 4JBAA 1YW7A 4HYEA 2OQRA 5DCMA 2FRHA 2O3FA 4HDVA 2HTSA 4HX8A 1DPUA 1YW8A 2IVMA 1ON2A 4R8HA 4A6DA 4G94A 3RDIA 2QBYB 2DK8A 1IN5A 5ERIA 1TQPA 5HOOA 3U1DA 2ACJA 2PI0A 1Z6RA 2D2WA 3I59B 4WWCA 4WXHA 3R0AA 4L9JA 3FXUA 4L0YB 3TO9A 2HDCA 4HDUA 3KP3A 2EV0A 2GQQA 3COAC 4PCQA 2FOKA 4G7HF 4CO8A 3V8KA 3FXQA 1S7AA 3LFKA 2MLGA 5LRRA 3K1NA 3I64A 2M8EA 4XLNF 5CJ9A 2ZO4A 1LDJA 4OMYA 4UV8A 2YU3A 1V3FA 2IPQX 2L02A 2QQAA 5HS8A 3CLOA 4LLNA 3LA3A 3DKWA 3K0LA 3H3UA 3DQVC 1GVJA 1ONVA 2FBHA 2F2EA 1R58A 1CF7B 1PP7U 3QP5A 3E5XA 2E7XA 2K7LA 2O03A 2DPDA 1YLFA 3F8NA 1SFEA 4GYIA 2GXGA 4QWQA 3FXRA 4ENNA 2KIFA 3L09A 3RPUA 2P5KA 4KYWA 1BOAA 4P9UA 5DDGA 4CYDA 3FMQA 2VT2A 2E1NA 2DI3A 2VOPA 5F6FA 2OQGA 1IN8A 2HR3A 1X3UA 2NNYA 1EH6A 4LB5A 1F9NA 2HKOA 2YX7A 4MQ9F 5D5XB 4ENMA 2L3DA 1AWCA 1XDSA 3CUOA 3P9KA 3KE2A 2FF4A 3T5XA 4F7ZA 4U7BA 3E6BA 1O3RA 3K1MA 1LNWA 1ZGJA 2OU2A 3BOQA 3TQNA 4L0ZB 1HBXG 2FBKA 1B9MA 2A6HF 1QBJA 2P8TA 2V1UA 2QQBA 4A2UA 2ESHA 2FE3A 2RDPA 5K5OA 4RGXA 5ICGA 3M9AA 4NB5A 4HV5A 1I5ZA 5HVQC 4UVAA 3BJAA 3F22A 3ABUA 2L54A 2O0YA 3BROA 4KMUX 1I1GA 1WWXA 3NQOA 4GO1A 4I01A 3BZ6A 4P55A 3V8LA 3WGHA 5CVVA 3E6CC 4QLCU 3F6VA 5HS7A 3HTUA 4M9ZA 1BIAA 1BI1A 2VBXA 2VODA 2P7VB 5DD4A 3R61A 1Y0UA 4HA8A 4EMSA 1ZG3A 3SFZA 5LHHA 1L3LA 1OYWA 2CG4A 4ASNA 4L18B 1ZRDA 4BHBA 3I54A 2V6CA 3IWFA 4HQMA 2JT1A 5JHUA 1HXDA 4I98B 4HX4A 1SD4A 4BHCA 4LLGF 2ETHA 5DUKA 1USSA 2ELHA 3AAFA 4A0XA 3GW2A 1LB2A 3FZVA 2P6TA 1RI7A 1W7PB 2GA1A 1S29A 3E97A 5HDKA 2JPCA 1UHWA 4BYYA 4CZZA 1U5TB 4Q4ZF 4XSZF 1J9IA 5BMZA 3BPXA 1A04A 4G6QA 1TQMA 2CGPA 1O3SA 1TBXA 2M30A 2EV6A 2DLLA 2NRAC 2O8XA 3IHUA 4H0EA 4KFCA 5DYMA 3IRRA 1TNSA 4O5VA 1FBQA 1YW9A 4M9SA 2FNPA 4IRHA 2F5DA 2DU9A 3H92A 3V7RA 1F1ZA 2WV0A 4N0BA 2NNNA 1ZG5A 2EJRA 1T98A 3HSFA 1PDNC 2HQRA 4RAZA 1FBUA 5IT9K 3LQRA 3ZMSA 2FSWA 4UUVA 2XRNA 1WSUA 3V7CA 1HW1A 1K78B 4LG0B 3K2ZA 3SZTA 1FP1D 4EJVA 1FSEA 4JQFA 1U5TC 2QLZA 3DF8A 2MA3A 2GXBA 1XD7A 4MEXF 4WXCA 2BBYA 2FMYA 2LF8A 4I2OA 1XDUA 4HLXA 1QZZA 4UVBA 4BXUA 1R36A 4GXOA 3FF5A 1ZYRF 3K69A 2DQRA 3DPLC 2WC2A 3RKWA 2Y75A 2JTVA 3CJNA 3WG9A 3WTSC 3L7WA 1R22A 2HKXA 1W5SA 3QAHA 3B02A 4IJAA 3HYIA 4LMYA 4L5JA 1KU7A 5E8IA 2EK5A 5FLXK 4ETSA 2ZFWA 1P92A 5D5VB 2BEOA 1K79A 2JPBA 1Z1DA 2Z33A 3EQLF 4UXNA 2QVOA 2EFOA 1ZH5A 3F8FA 2H27A 3I0TA 3DFGA 2RKHA 1KU9A 2KJBA 4KT5C 3EYIA 3P9IA 3LWFA 2HEOA 1U2WA 3E5UA 3ERED 3D0SA 3I4PA 4KN4X 3E3VA 1FYLA 4MNUA 4HAMA 1QNTA 3FMSA 2ZXJA 4I09A 2ZJ2A 3WODF 1LEBA 1ODDA 2PMUA 3MQ0A 1XGNA 1C0WA 3TDUC 3ZN1A 4U0VA 5HS9A 1J0RA 3KZZA 4IF4A 3GFJA 3TO6A 1T39A 3M7GA 3U9GA 3WTVC 2O61A 3JW4A 4L9TA 5ICEA 5E1ZB 2EV5A 2IA2A 2A6EF 3L00A 1IF1A 4RB3C 4ZYEA 4RB2C 4OINF 4LB6B 1W7PD 4HQEA 3QOPA 3G73A 2VE9A 5CVJA 4L5IA 3KZYA 2QUFA 1G6NA 2OZUA 2K27A 4EJUA 3RKYA 3QPTA 4A5MA 4BHPA 4IPAA 3WGGA 1B1BA 2PLYA 1G3WA 2QENA 2D1VA 1R1UA 4KMFA 1R5HA 5D6EA 2CW0F 3TDZC 2H09A 3KP2A 2X0LA 4XBFA 5IT3A 2HFHA 4YIFA 4ZYDA 2PBIA 1BIBA 1EH7A 5LHIA 3RYRA 3GUDA 4FT8A 1D8JA 4XSXF 3BPVA 3WGIA 4RGUA 1IXCA 4IRIA 1JHHA 2IW5A 4CDGA 3JTGA 2V79A 3C1DA 2P6SA 2A68F 2MC3A 4YIIA 3ZMZA 1W5TA 1F4KA 3GF2A 1CF7A 3DEUA 5J6XA 3IC7A 1WQ2A 4A0ZA 4U0WA 3LSTA 3REOA 2XASA 2CWEA 2A07F 4RGSA 2ZBKA 4LJZF 3PFIA 1MDMA 1FP2A 4K2EA 3MWMA 3ZP5A 4A5NA 4P9FA 2NS0A 3BP8A 1ULYA 3NEUA 2OA4A 1W7PA 1FYKA 5LEKA 3IKTA 4I0BA 2H6CA 2DBBA 4N9IA 4MGRA 2RC4A 3CDHA 2J5PA 3TOAA 1H9TA 3IKVA 1E17A 4G9YA 1H0MA 1HW5A 2JRTA 2HS5A 2HGCA 3C7JA 3VFZA 2QZ8A 1T0FA 3GX4X 3GO5A 1T38A 3HUGA 2OZ6A 2EFPA 3B73A 1IXSB 1KYWA 5L3EA 4ESFA 1UFMA 1P4WA 3FM5A 1MKMA 1AOYA 4A0YA 1TTYA 2IA0A 3KFWX 3N97A 3F3XA 5J8CA 2PFBA 3HRSA 2MLKA 1W4MA 2VBZA 2V1XA 1G4DA 3F8MA 1FOKA 3IWZA 5KK1A 5EEHA 2ISZA 1BJAA 1BC7C 4WX9A 3D5LA 3W6JB 2D45A 2WTEA 5L3BA 2ADUA 2QYOA 2KIUA 1U3EM 5JVTA 2K4JA 2XHKA 2O6GE 4PGGA 4DNCA 3I58A 1OYIA 4UHTA 4Q48A 2R7DA 4EQQA 1ZLKA 5ICCA 4LK0F 1OR7A 3KP7A 2EFNA 1SMTA 5DD8A 4S04A 4KDPA 3DV8A 2UXNA 2Y48A 4LFUA 1EH8A 2W24A 2XAGA 1OYYA 1S7OA 3U2RA 3LA2A 5CVRA 2HZTA 3HTSB 3ML6A 5H6RA 3N4MA 2FQ3A 2Q0OA 3F8CA 3EETA 1OMIA 2VONA 3LAPA 1ZLJA 2M45A 2K86A 3EDPA 1QQIA 5FB2A 5L3DA 2L4MA 3GZ5A 2QQ9A 2H94A 4CICA 2MH2A 1B9NA 3KLOA 5F64A 3SHFA 3FMRA 1MD0A 2MD5A 2V9VA 3GFMA 1LJ9A 2R7FA 4OIPF 3O6BB 2FMLA 2RQPA 2Q8KA 3F8BA 4E70A 2M5WA 3WTZA 4G7ZF 3T8TA 1R23A 1J2XA 3ROUA 1SD5A 1MJAA 4RGRA 2VC1A 2VC0A 3R60A 1DP7P 3F23A 1XB4A 1MJBA 3RYPA 3WTUC 1D3YA 4IRGA 3GLXA 2UWMA 4EJOA 1RZ4A 3RJPA 1EV7A 2G7UA 4IHSA 3ZPLA 4U7DA 3FHZA 4EVIA 4PDKA 1FSHA 2VN2A 2RV8A 3GVAA 5JI6A 1Z7UA 2XV4S 2FEZA 4LG0A 2FU4A 1HKSA 4M6XA 3V8JA 4KUMA 5FGMA 5E20A 1H9GA 3ZMVA 3MAJA 2J5OA 1YTYA 1G3SA 2BGCA 1LDDA 5D6FA 3MEXA 5LLQA 1FLIA 3WU1B 2W85A 2CQKA 5TJJA 1O7FA 1J59A 5A2QZ 4EGYA 3CO6C 2P5VA 4JK1X 3JAMK 1USTA 2UZKA 3J81Z 1ZHFA 5LGNA 5ILUA 2VBWA 1FC3A 3ZN0A 4O6JA 3IRQA 4P5OA 4KNYA 3WTXC 4EM2A 4MEYF 2TDXA 4G7OF 4CHUA 4OOIA 2DFIA 4O3MA 2GWRA 5HLHA 5ICFA 3QU3A 2GIVA 1B4AA 5BS6A 3V7SA 4WK8F 3R6SA 4Q47A 3OV8A 4RB1A 1ZRCA 4AVPA 1Z9CA 3J80Z 1KA8A 5F1RA 4CXFA 1HKQA 1UCRA 1K7AA 1FBSA 1UHMA 1XCVA 2IA1A 4WXDA 2YR2A 4HX7A 1YQAA 1GXQA 2LNBA 1QZYA 5D4SA 2FXAA 1JXSA 3BWGA 1U8RA 1MZBA 3E6MA 2L4AA 4AIHA 5DV5A 3LAJA 2OAZA 2G7HA 4AIJA 3CTAA 2QBYA 1I6XA 3T1BA 5HLGA 1KQ8A 1BN5A 2R3SA 2XIGA 2EA4A 2GA2A 4ZYHA 4UVCA 2IT0A 3HHGA 4ESJA 3MZHA 1FZPB 3HOSA 3RI4A 2CSOA 3P9CA 5LRSA 4RB0A 1XSDA 3E6DA 3JSPA 3GFIA 2UXXA 2EB7A 4R1HA 1FWZA 5BQTA 3CUQC 2Z3YA 2STWA 4BNCA 3T8RA 1BI3A 1I1SA 1D5VA 1MJ9A 1WKMA 2KKOA 2YSRA 2OD5A 4WCGA 5AIQA 2H6BA 3SQNA 2RVCA 2XKOA 2XROA 1ZRFA 4HZFA 1J7KA 2FNAA 2V1DA 2XAFA 4OMZA 5KVRA 3TOBA 3ZMDA 1PP8F 3ZMUA 2E7WA 2MBFA 3HRTA 4M71A 4U88A 5FFZA 4AIKA 4B8XA 2EFQA 2JZYA 3VB2A 4BAYA 5D5UB 3LA7A 4Y13A 2K02A 4MTEA 2DT5A 5D8LB 5H20A 4CGZA 4Y15A 1SAXA 1FX7A 2VE8A 1RIOH 2CYYA 1XSXA 4PGHA 3C3WA 2G9WA 3GEZA 4Q5SF 5DCFA 5L3FA 1YS7A 2A5YB 4DQ2A 3W6KB 4FX4A 5J8FA 3EUHA 2P7CB 3C18A 1SFXA 1YFHA 3GXOA 2ZMEB 3VOEA 3M8FA 3QU6A 3MFKA 2FA5A 1ZARA 3K9TA 3GZ6A 5E1WA 3KP5A 5ED4A 4AWXB 2VOOA 4EJTA 5DUIA 4I02A 1MGTA 1P6RA 3ECHA 1ZGAA 4LLLA 2E1CA 2HTJA 1IRFA 2VBYA 1K6OA 6PAXA 2LSOA 5ILSA 1T2KA 2Z5UA 2HWVA 2P5LC 2VXZA 4I0AA 3WE3A 1FPQA 3WU0A 4NQWA 4YG2F 3J80K 3R4KA 3GYHX 2PJPA 5H6QA 1ZREA 5EEGA 1YS6A 1KQ9A 5K5QA 4HLYA 1BBYA 1GXPA 3ELKA 3QRFF 4P96A 4M6YA 5LGTA 2PQ8A 3SXYA 3PQJA 2B0LA 5IT9Z 2NAZA 5E17F 4EJWA 2KIMA 3HRUA 4IXAA 3E5QA 2F5EA 2XUBA 5CLSA 3MCZA 2DPUA 1LVAA 1XGOA 3HRMA 4PZJA 3LQQA 1OPCA 1G3YA 1KYZA 3RKXA 1IN6A 5JFRA 1UB9A 3I53A 3P7NA 5E1XA 3RIRA 4TV7A 2IRFG 1DPRA 4XRFA 2W84A 4AD9A 4ON0A 2XAHA 4HF1A 1BC8C 1R00A 2F5CA 5CVUA 2C6YA 2DW4A 1IN4A 3ZMTA 4KIGA 2DAOA 5E18F 3F21A 1NHAA 3F6OA 3L2CA 4OIQF 1SFUA 2P4WA 3KP4A 5FO5A 5LHGA 2HYFA 1HSTA 5L3CA 3DXJF 4ZYGA 2DQLA 2ZMEA 4ENKA 1JE8A 2XVCA 3BJ6A 3ULQB 3FX3A 5BOXA 1MDMB 3HHHA 3JAMZ 4M73A 1E2XA 3ISPA 3M8EA 2W25A
chains in the Genus database with same CATH superfamily
2A3SA 2B9SA 2RN7A 2YX4A 2D1HA 2X51A 1BJZA 5AONA 2Y31A 1HCRA 5F0FA 5HNHA 2EA2A 2ZKZA 1R1VA 2K3PA 3H3ZA 1R7JA 2Q2EB 1OCOH 1UELB 3GLLA 1MSEC 2JSCA 3LSJA 1IZ1A 3ZQCA 4N9HA 3AG3H 5FFXA 2LY2A 4UY8I 1D8KA 4IHTA 2DTRA 1HW2A 4A12A 2IS2A 4KIBA 1BI0A 1S3JA 2VUMJ 2CQ7A 4BH9A 2V9PA 3IP4B 1B6AA 1HQCA 2DK5A 4FASD 3PQKA 1P4AA 3WTYC 1S6LA 1IUYA 3DP7A 1DQUA 4RS8A 5EG0A 4HW0A 1S72I 4IO9F 2M34A 3IL2A 3FWEA 1KU3A 2NYXA 4L9VA 5E3OA 1YJWI 1VTNC 1FY7A 1JUPA 2LR8A 4EM1A 2LKXA 1JGSA 2LOOA 1O7LA 2V7FA 1ZG1A 3O3KA 3BT9A 3HC7A 4HF2A 2Y0MA 1P2FA 3RKQA 5L3GA 5DM6F 4HOBA 1SFOJ 4OU0A 1V5FA 2EFWA 1IN7A 4Z2YA 2LKSA 2AO9A 1D5YA 3HSRA 3EYYA 5M5WJ 2M87A 4XNFA 1ZN2A 3PNTA 4HBLA 4ANJA 3V4GA 3HOUJ 1HSJA 2MH9A 1FNNA 3I59A 1XMAA 2VIXA 1VQMI 4RDUA 3Q9VA 2MD0A 2HOEA 1REPC 1XX5A 2KQRA 2ZFUA 1FJLA 2YPRA 1MMNA 2ZNYA 5LD2C 2IP2A 2DOFA 2PN6A 2GOMA 2BY0A 3BC8A 2LC2A 3QYEA 5FLMJ 1J75A 2GZWA 3GFLA 2OUMA 4ZDPA 4G12A 2CFOA 4YFNF 1TT5B 1FYMA 3H9QA 1WHUA 2NOJB 1J5YA 2FBIA 3C2BA 4U0YA 4AM3A 1YO5C 3KIOA 4LK1F 3ABTA 3WTTC 4Z6YA 2IXSA 4BY1J 2OPTA 1X1DA 4B48A 3DBHB 2XF6A 3JTHA 3G2BA 2STTA 2KDOA 4OAYA 4XLPF 1MIJA 3M4OJ 5K7HA 4HRIA 4UNOA 3BR5A 2XGXA 4B09A 4PJJA 1WI9A 3RTRA 2VKVA 5IPAA 1JJ8C 2A61A 3K2AA 5E8GA 5DEQA 4B3AA 1ZK8A 1P4XA 4MFEA 1U5TA 1NK3P 2X4HA 3S17J 3I71A 5FD5A 5K5RA 3ABLH 2KMUA 2VT3A 4FX0A 3HOTA 1JUMA 1XTAA 3RCOA 2DJIA 4HG2A 2KRFA 1QO0D 3X2QH 3T0YA 3KEOA 4V2GA 2O7OA 3HSEA 3O2PE 4XK4A 4YFKF 3ECOA 4GCVA 4M72A 1RNLA 3KYLA 4YFXF 5B5EC 1K4TA 1HF0A 5LEJA 4BE2A 3KEQA 5AIPA 5A2QK 2PMHA 2XAJA 1JKRC 2LLKA 4S05A 1TW2A 2VKEA 3VODA 2AS5F 4IKFA 3RPQA 3ZQ7A 3F72A 4J19A 4N4OB 2HYGD 1U8BA 2IJLA 3G6EI 1XMKA 2GAUA 2Q2EA 4KA4A 3KLNA 4RLQA 1YYVA 3GZNB 2ZCWA 4B47A 4I7HA 1RR8C 3VYSB 1KZHA 1WPKA 5CQGA 1N25A 1Q1HA 1WRJA 4ITVA 2KRHA 5GAGJ 2R5ZB 1VQ5I 2DA2A 2RQQA 1KU2A 1SAUA 3W3CA 4MQVA 1IAWA 1OKRA 1VQNI 1XGMA 2K9NA 2BE5F 3DTIA 2MGQA 4RLFA 4MTDA 5LGUA 3H3VK 3HZJA 3K4CA 2JA8J 1U78A 5C4JJ 1R5GA 3DPTA 3L2UA 2DMPA 4RA2A 4HSRA 2XKPA 3S2WA 1IW7F 2K4BA 1K78A 3G1OA 5K1YA 4QIWN 1SD6A 1RUNA 2E1OA 3FXLA 2R7VA 2E36A 1ON1A 2M1BA 2F6CA 2M0CA 1V4RA 1HKTA 3WE2A 1FMWA 3TKYA 3CZ6A 1RUOA 1IV8A 1VNDA 2DA1A 4UV9A 2Z99A 3GWZA 2EIMH 1UJ8A 3W2VA 1MBJA 1STZA 1UMQA 1UZCA 3TW7A 2HU9A 3VYUB 1JHFA 3S1QJ 3OS0A 3CP2A 1ZGWA 1TNTA 1BR1A 3CQZJ 4LGWA 4OIRF 5D4RA 4GYGA 4BQAA 4KJZA 3JSOA 3MKYB 2BYVE 3RPUD 2JSPA 3FBNB 4B43A 3H5RA 4YIRX 1XGSA 1O3QA 4MHGA 2Z9OA 3QPHA 1G3TA 3MN2A 2JJ7A 1FTTA 2ISYA 5DCMB 1S8NA 4C3JJ 1LQ1A 2BY1A 4A6EA 4G6DA 1FT9A 4A3GJ 4BEHA 3DBRB 3G3ZA 2WWYA 2LREA 5TRDA 3BDDA 4L9NA 4WF2A 1YG2A 5HDNA 4OIOF 2M2EA 3I5UA 4Y4RA 1T0FC 1LDKB 3U21A 2ESNA 3Q9SA 2OBPA 1W5CC 4PJ0C 1PVEA 2HQAA 1TW3A 1JKPC 3KETA 1KQ0A 1KGSA 2VQCA 3DEEA 4FHTA 5GPAA 3HG9A 1I27A 2COMA 1DDNA 2VXDA 2AXLA 1W36C 2CV1A 1BM9A 2LDUA 2RNJA 4BE1A 2ZJPF 2A69F 3VEPA 3S2HJ 1BI2A 2ZNZA 3S93A 3PL8A 3PO3J 4KICA 3HB9A 4D0PA 4E4HA 5HNFA 1B8IA 2ELJA 1Z6TA 4E7ZA 3TP0A 3BY6A 3S3MA 3CMMA 3M1EA 3H1CA 4M74A 1XCBA 1R1TA 4XKCA 2CW7A 1IRGA 4EV0A 3KP6A 4IOAF 1ERDA 2ZXHA 1L0OC 1FEXA 4D7NA 3QODA 5CYVA 3WTWC 3FM3A 4LD5A 1RESA 1SMYF 2BV6A 3NRVA 5HDGA 1QGPA 2RGVA 1IXRC 1O57A 2HVSA 1G59A 1MMAA 4ZZDA 1X1CA 1PUEE 3ZCOA 1TQIA 2EWNA 2LKPA 4B4CA 3ONQA 1V5EA 3CO7C 5B66C 1ZAOA 2L9RA 1H8AC 3OR1C 4HF0A 3QP6A 3J7AO 3R0JA 4FCYA 2Z2SB 4KN7X 3JRAA 3OYGA 4G6TB 4RM2A 1GHCA 1Z05A 1DUXC 1BW5A 2WBMA 1B59A 3O8GA 2B63J 1SD7A 3KCCA 4CCLA 5CVIA 5BPDA 2CO5A 4EGZA 3RQ4A 1OISA 3AG1H 5IOYA 2QM3A 3OOPA 2IS6A 2W57A 4Y17A 4XOTA 2IGMA 4FE4A 1K4SA 4NHJA 5ILVA 3FISA 1SEUA 2GBYA 2BW3B 4IVNA 4RAFA 3L9FA 3SZPA 2JA6J 1TLHB 2YU9J 2KFDA 1ETQA 4ZZLA 2KJCA 5BPIA 2AQFA 4A3KJ 4ENJA 3TGNA 3GTMJ 3J81K 4FETA 2DXIA 3Q5FA 2H8WA 1SFKA 2WAQA 3SYTA 3FK6A 5GAHJ 2BHYA 2R7UA 1IGNA 3CUQB 5D5WB 1X2MA 3O8HA 4M9XA 2F5FA 3OYLA 3JRGA 3PO2J 3I9V2 1XS9A 1G8XA 3OR2C 3DTKA 4JOMA 2PEXA 3CDIA 2HQNA 3TO7A 5HLTA 3QYBA 2DO7A 1YIOA 5FD6A 3K1PA 4RAYA 2PG4A 1IRXA 1F43A 2ZXIA 1LFBA 3QOEA 1XSVA 5JR3A 1U6GA 1Y1VJ 1QPMA 1Y8QB 2VPLA 3D5SC 2CFXA 5HLIA 4II2A 2E1MB 1X1AA 1E3OC 5LBQA 4GGGA 1T6SA 3AL0B 1CGPA 4EM0B 1MH4A 5E3LA 1Z91A 2MABA 1J09A 2Y0SN 4ESBA 3K4NA 3UKGA 4XLAA 5D8KB 5E3MA 3CCEI 1XN7A 4ZH4F 3A0HC 3S1MJ 1ZKGA 2XAQA 2DMUA 1Y6IA 2L01A 5FLXZ 4R79A 4XOPA 3BJOA 4G8XA 1O3TA 1F5TA 4KIFA 2LF7A 4E7KA 1LEAA 3HIFA 3CUQA 4M6VA 4X6AJ 4E7HA 4HV6A 3MZYA 4YEJA 2QWWA 4AYBN 4JBAA 3OY9A 1YW7A 4HYEA 2OQRA 5FKOA 5DCMA 2FRHA 2O3FA 2HZDA 4HDVA 3HPHA 2HTSA 3NWTA 4HX8A 1DPUA 1YW8A 2IVMA 1ON2A 3K10A 4R8HA 4NQWB 4A6DA 1A6QA 2HNHA 3EUHC 4G94A 3RDIA 1Z0XA 2QBYB 1IG7A 2DK8A 1IN5A 4OAZA 1HOMA 5ERIA 1TQPA 2BY2A 5HOOA 3M07A 3JRCA 4ZTJA 4IQ4A 3U1DA 4UB8C 2ACJA 5F0CA 3AKZA 2PI0A 2L7MP 2R7ZJ 2WB1N 3S32A 2QA4I 1Z6RA 2D2WA 3I59B 4WWCA 1S9HA 4WXHA 3R0AA 4L9JA 4GFBA 3FXUA 4L0YB 3LSHA 3L1PA 3CCVI 1TP4A 3K70D 1X4OA 1LE8A 5H2FC 3TO9A 1R4NB 2DYSH 2HDCA 2QEXI 4HDUA 3KP3A 2EV0A 2GQQA 2E1MC 3OYKA 4ZC3A 3HKZN 3COAC 3AL0C 4F52A 4PCQA 1F36A 2FOKA 4G7HF 3OOUA 1PUFB 3M3YJ 3OYFA 4CO8A 3V8KA 3FXQA 3H35A 1HDPA 1S7AA 3LFKA 2MLGA 5LRRA 3AFHA 1ETYA 3K1NA 5FKLA 3I64A 2M8EA 2EZHA 4XLNF 5CJ9A 3K70C 1T95A 1OCPA 2DFFA 4Y7NJ 2ZO4A 3GTJJ 1ETVA 2X1EA 3HKZA 1LDJA 2F4IA 4OMYA 3BTCA 4UV8A 2YU3A 2KL4A 3A03A 1V3FA 1R4MB 2IPQX 2L02A 2QQAA 3CLOA 3H0GJ 5HS8A 2YS9A 3LA3A 4LLNA 3DKWA 3K0LA 3H3UA 1NK2P 2KZGA 3DQVC 1GVJA 3OYJA 1ONVA 1M1EB 4IHYA 2FBHA 2F2EA 1R58A 3GTOJ 1CF7B 1PP7U 1TWGJ 2D5VA 1EJ9A 2WAEA 3OL4A 1P7IA 3E5XA 3QP5A 2E7XA 2KHMA 1Z67A 2K7LA 3J7ZI 2O03A 1ZQ3P 3H9GA 3KPHA 2DPDA 1YLFA 3F8NA 3G1LA 4CUGA 1SFEA 4GYIA 4F92B 2GXGA 4QWQA 2DJNA 2HYJA 3FXRA 4ENNA 2KIFA 2OV7A 3L09A 3RPUA 2P5KA 4KYWA 4MLOA 1BOAA 5GTIC 4P9UA 5DDGA 4CYDA 3FMQA 3P5JA 4V2FA 1R9TJ 2VT2A 5C44J 2E1NA 2DI3A 2F4OB 2W1OA 2E5ZA 2VOPA 3CDLA 5F6FA 2OQGA 1D1CA 3DPUA 2M4KA 1IN8A 2HR3A 2LY1A 1X3UA 1SANA 3SDBA 2L9SA 1WJEA 1EH6A 2NNYA 4LB5A 1F9NA 1PYVA 2HKOA 2YX7A 4MQ9F 1VQ9I 1GLNA 9ANTA 3K4KA 2KISA 3CC7I 2EH3A 5D5XB 1X19A 4BJ5C 4ENMA 2L3DA 1AWCA 1XDSA 1MSFC 3CUOA 3P9KA 3KE2A 3Q3SA 2FF4A 2V9KA 3Q0UA 3HGYA 3T5XA 4F7ZA 4U7BA 3CCMI 3E6BA 3SFIA 1O3RA 2DCEA 3K1MA 4DJAA 4XR6A 3CMAI 1LNWA 1ZGJA 2OU2A 3BOQA 3TQNA 4L0ZB 1YHQI 1HBXG 3BCBA 2FBKA 1B9MA 2L5QA 1HLVA 2A6HF 1QBJA 1ETWA 2P8TA 2V1UA 3SEZA 2CMPA 2QQBA 1XPXA 1ZELA 2HDWA 3JCUC 1TC3C 4A2UA 1IV6A 5F27A 2JVGA 2ESHA 2FE3A 3K7AJ 2RDPA 3MD2A 5K5OA 3HOVJ 3JR9A 4DBQA 4RGXA 5ICGA 3M9AA 3OYNA 1VQPI 4NB5A 4FE7A 4HV5A 3JRFA 1Y56A 1TWAJ 4PK4A 1I5ZA 3GTPJ 5HVQC 4UVAA 4DIQA 3BJAA 4A69C 4AU7A 2R0QC 3F22A 3ABUA 2ME6A 1OCZH 2L54A 2MG4A 3DKYA 4AC0A 1IDZA 2O0YA 3BROA 4KMUX 4XN3A 1I1GA 3TP3A 1WWXA 3DBLB 4BJ6C 3NQOA 5EG0B 2R7TA 1YX3A 4GO1A 4I01A 3TBIA 1B8IB 3BZ6A 4P55A 2R92J 3V8LA 2EBIA 5CVVA 3WGHA 4D5FA 3E6CC 4QLCU 3F6VA 5HS7A 3HTUA 4M9ZA 1BIAA 1BI1A 2VBXA 1OQYA 5E3NA 4JX4A 2VODA 3DTEA 1VI0A 2P7VB 3MZ8A 4X0GA 5DD4A 1HC8A 3R61A 4UUSB 2BY3A 1Y0UA 4HA8A 4EMSA 2E71A 1ZG3A 3SFZA 5LHHA 1L3LA 1OYWA 2OC6A 2CG4A 4ASNA 4L18B 1ZRDA 4HSTA 4BHBA 3I54A 2V6CA 5IP9J 3OYIA 4XONA 1DGRM 3K6GA 1VQ8I 2XPUA 3IWFA 1BOBA 1ORKA 2DDBA 4HQMA 1DU6A 2JT1A 2R4GA 5JHUA 2BXZA 2JQ7A 2E2HJ 1HXDA 4I98B 4D5CA 4HX4A 2KRCA 3HEFA 1SD4A 3WHBA 2JWTA 4BHCA 4D9JA 4LLGF 2ETHA 1EA3A 1X2NA 3W2WA 5DUKA 1USSA 2ELHA 4D1QA 4Y3OA 1GT0C 3AAFA 4A0XA 2K9SA 3GW2A 1LB2A 2R7XA 3FZVA 2P6TA 1LPQA 1RI7A 1W7PB 2JMWA 3CCSI 2GA1A 1S29A 3E97A 2FX0A 2WAFA 2F4MB 5HDKA 1RETA 1MBHA 2KIQA 2VJIA 2JPCA 2MW8A 1UHWA 4BYYA 4CZZA 1U5TB 2CW8A 1X58A 1I39A 4Q4ZF 3B6AA 1QU3A 2IBDA 2M0MA 2LBFB 4XSZF 1J9IA 5BMZA 1B72B 3BG7A 3BPXA 1A04A 4EATA 3CCLI 4G6QA 1TQMA 2CGPA 5EGOA 4A3IJ 1I6HJ 2P81A 2VKHA 1O3SA 1V5GA 1TBXA 2HI3A 5JHFA 2M30A 2NVYJ 4M3GA 1IUFA 2EV6A 2DLLA 4BDYA 2NRAC 2EZKA 5EF6A 2O8XA 3Q0WA 2CQXA 2DA3A 5KNLA 3OYEA 3IHUA 4H0EA 1GV2A 5DYMA 3IRRA 4KFCA 3ASOH 1TNSA 2R5ZA 4XMYA 2L7FP 4O5VA 1FBQA 3LSKA 3CF2A 1YW9A 3DWLE 4M9SA 2FNPA 4IRHA 2F5DA 2DU9A 1ITYA 3H92A 3V7RA 1F1ZA 4GDFA 3CJQB 2WV0A 4A3CJ 4N0BA 2NNNA 1ZG5A 2EJRA 1T98A 2CS3A 5GTHC 3HSFA 1PDNC 2HQRA 4RAZA 1FBUA 5IT9K 2JK3A 3LQRA 2M3AA 2WA0A 2L7ZA 3CCYA 3ZMSA 3HOYJ 1R6RA 3LOCA 2ELKA 2FSWA 3HJEA 5C3EJ 4UUVA 2VB6A 1B72A 2IGOA 2R7SA 3OMYA 2XRNA 4XIDA 3IV5A 1UAAA 1WSUA 5CPRB 3ZR8X 3V7CA 3BLYA 1X1BA 3BTIA 4XLHA 5IY5H 2ZJRF 1HW1A 1K78B 4LG0B 5GP9A 3K2ZA 3SZTA 1WI3A 1FP1D 2VI6A 4EJVA 1FSEA 1AU7A 4JQFA 1SVLA 1U5TC 1LE8B 1LUJB 5KAFC 1WJAA 3TL4X 3CESA 2A05A 1ACIA 3FBIB 2QLZA 3DF8A 1QVUA 2KP6A 2MA3A 2GXBA 1XD7A 3NWSA 4WXCA 2BBYA 4MEXF 2FMYA 2LF8A 5GADJ 4I2OA 2KDZA 1XDUA 1JTXA 2BOLA 1OJLA 4HLXA 1QZZA 4UVBA 3SEQA 2LY9A 3HOWJ 1T56A 4NUBA 4BXUA 3JRIA 1R49A 1QHGA 1R36A 2K9MA 4GXOA 2HOTA 3FF5A 1ZYRF 2W4SA 4A3DJ 4M3EA 3K69A 2DOAA 2DQRA 3DPLC 2WC2A 3RKWA 2Y75A 3LSIA 2JTVA 3CJNA 3WG9A 2XGDA 1JKOC 4XLFA 3WTSC 3CF5F 3L7WA 1R22A 2HKXA 1W5SA 3QAHA 3B02A 2K3FA 3ASNH 3HYIA 4IJAA 4LMYA 4L5JA 5FKNA 1KU7A 3BCAA 3PSFA 5E8IA 2EK5A 5FLXK 1WJBA 4ETSA 2OCCH 2ZFWA 5M5YJ 1P92A 3F9KA 2K5CA 2NXNB 2M7BA 3FXOA 2NVUB 4HNVA 5D5VB 1Z7LA 2CU7A 2BEOA 2LTPA 1WFXA 1K79A 1WZ2A 2JPBA 1Z1DA 2Z33A 4PFPA 3EQLF 4UXNA 3OYCA 2QVOA 2EFOA 3GMEA 3ZGKA 4ABZA 1ZH5A 4XRSA 3F8FA 4LG3A 4RMNA 2JA5J 2H27A 3I0TA 4DGWB 3DFGA 2TRTA 2RKHA 1H89C 3GTGJ 3H0DA 2M4GA 1KU9A 3I56I 2FQ4A 2KJBA 2HPIA 2Y30A 4KT5C 3EYIA 3P9IA 5E79C 1YJNI 3L2VA 1ZTRA 2X6YA 1VQOI 2X1CA 2XSDC 3S2DJ 2CQNA 2N8GA 1X3WB 3LWFA 2AXTC 2HEOA 1U2WA 2XC7A 3E5UA 3HDDA 2BHZA 5IYBJ 1MBGA 3U1KA 3BR2A 3ERED 5C4XJ 4CCKA 3D0SA 2R93J 1NG6A 5M3MJ 3VYRB 3I4PA 5EYRA 3MVPA 4KT6A 2X6OA 2JVHA 3CP8A 2RAEA 4KN4X 3E3VA 1FYLA 3A01A 4HNTA 4MNUA 4HAMA 4MO7A 3IH4A 4LIVA 5KCMA 4CCJA 4Y52J 1Z3XA 1QNTA 1Y39A 3FMSA 1MNMC 2ZXJA 4C3HJ 4I09A 2R5YA 2ZJ2A 3WODF 1LEBA 1ODDA 2PMUA 2BW3A 2K9LA 3DKXA 1GUUA 3MQ0A 2Y69H 4I76A 4BXFA 1YE9A 1XGNA 4IEJA 3TDUC 4CSWA 1C0WA 4BUPA 3ZN1A 1JKQC 4MFDA 4PJNA 4U0VA 5HS9A 1AHDP 1J0RA 3KZZA 4IF4A 4XQFA 1Z3YA 3BR1A 3GFJA 4C3IJ 3TO6A 1T39A 3OYHA 1FOXA 2ID3A 3M7GA 3U9GA 3WTVC 2AHQA 3JW4A 4L9TA 2HXOA 4NBQA 2O61A 4A3LJ 5ICEA 5E1ZB 1OCCH 2EV5A 2Z16A 3BG5A 1LFUP 2IA2A 2A6EF 1WJFA 3L00A 1IF1A 4E6KG 3PJRA 4RB3C 4ZYEA 4RB2C 2W82A 4OINF 4LB6B 2GXAA 1W7PD 4KISA 2PJRA 2XAUA 3OIQA 5EZHA 4HQEA 2X9DA 3QOPA 3G73A 3BZKA 2VE9A 5CVJA 3IH3A 1APLC 4L5IA 2OCEA 3KZYA 2QUFA 2FUG2 1G6NA 2OZUA 2K27A 4EJUA 3RKYA 4IHVA 3QPTA 4A5MA 4BHPA 4IPAA 3WGGA 2JRMA 2VQGA 1B1BA 2LVSA 4BQNA 2PLYA 4LITA 2DA5A 1G3WA 2QENA 5GAEJ 2R7WA 2NS7A 2QSGX 2D1VA 1R1UA 3LSRA 1PJRA 5J1YA 4KMFA 4F3QA 1R5HA 2DOEA 5IOZA 3RQIA 4BKXA 2WB1A 5D6EA 1YOVB 5DS9A 2CW0F 2VASA 2H09A 3TDZC 4IZZA 1TT0A 3CD6I 1X3ZB 3KP2A 2NVXJ 1S5LC 2X0LA 4BJTA 4XBFA 5IT3A 3S15J 3HM5A 1YIJI 2EPFA 2HFHA 4YIFA 3VWBA 4XORA 4PFOA 2PBIA 4ZYDA 2IS1A 1BIBA 2LG4A 2Z1DA 1EH7A 1RR7A 5LHIA 3MKWB 2BVLA 1UHSA 1AKHA 3RYRA 3GUDA 3ABMH 4FT8A 1D8JA 1Y1WJ 4XSXF 3BPVA 3WGIA 4RGUA 1IXCA 2KT0A 3CCUI 4IRIA 4YELA 1JHHA 1V54H 3H5AA 2IW5A 4CDGA 4BACA 2NOGA 2UV1A 3JTGA 2HDDA 3OYBA 5JLXA 2WADA 2V79A 3C1DA 1GVDA 2P6SA 2A68F 4NC6A 2DFEA 2MC3A 3A2KA 4YIIA 4AIDA 5FRNA 3ZMZA 4RM3A 2WY7Q 1W5TA 1F4KA 2L7KA 1YRNB 2LFBA 4I99C 3GF2A 1CF7A 1QPIA 2FOWA 2E5NA 2UUZA 3DEUA 4BEHB 4B44A 5J6XA 2LYCA 1WQ2A 3IC7A 4A0ZA 5EDNA 4U0WA 1TL8A 4IL6C 3LSTA 2E2IJ 3REOA 1MH3A 1MBEA 4J01A 2XASA 2CWEA 1E3HA 2A07F 1MNEA 1BR2A 3M8JA 4RGSA 2ZBKA 4LJZF 3PFIA 1MDMA 1FP2A 4K2EA 3MWMA 3ZP5A 4A5NA 4P9FA 2ECBA 3OS1A 2JA2A 2NS0A 2MYSA 3BP8A 5KHDA 1ULYA 2BVMA 3NEUA 2OA4A 5FKKA 2V6EA 4A3BJ 1MMGA 1W7PA 1FYKA 3A01B 5EGOB 5LEKA 1TWFJ 3IKTA 4I0BA 3LSPA 1ETKA 2QF7A 2H6CA 2DBBA 3E7LA 3GTQJ 4D7MA 4N9IA 4MGRA 3UNGC 4X1EA 2RC4A 1T8IA 3CDHA 2E34A 3IUOA 2J5PA 3FIWA 3H36A 4RBOA 3TOAA 1FOWA 3ZQLA 1E0EA 1D1BA 3OWTA 1U9OA 3DU6A 1H9TA 3IKVA 1E17A 3FHNA 4G9YA 3VYTB 1RRJA 1H0MA 2ZSHB 1HW5A 5TGTA 3S3OA 2JRTA 2HS5A 2HGCA 3C7JA 1OCTC 4KITB 4PUSA 2CH0A 3IH2A 3IAS2 3VFZA 2QZ8A 1T0FA 1JTYA 3GX4X 4HEA2 3GO5A 2BXYA 3LL7A 1T38A 3OL3A 2YUSA 3HBLA 3K4MA 1FIPA 3FXJA 4ZYAA 4NC8A 3FKIJ 3HUGA 3HPGA 4PJLA 2OZ6A 4ZDLA 2EFPA 3HOZJ 2ME0A 3B73A 1IXSB 4AYBA 1KYWA 5L3EA 3BTJA 4ESFA 1UFMA 1MBFA 3ZQIA 2ZSIB 1VQ7I 1CQTA 1TWCJ 5K7ZA 1GDTA 1P4WA 2R7OA 4PJMA 3FM5A 1MKMA 1AOYA 3PUBA 3ESWB 2B7EA 1RKWA 4A0YA 1TTYA 2DT6A 2IA0A 3KFWX 3N97A 3F3XA 4XKWA 3PSIA 2PFBA 5J8CA 3HRSA 2O5RA 3OSFA 2DYRH 3K4LA 2EZLA 3CJTB 2MLKA 1W4MA 3E1SA 2VBZA 2H1LA 2MC4A 2V4JC 2V1XA 4AUXA 4BU2A 3H9JA 2XDVA 4A93J 3TW6A 1G4DA 4QPQA 4C2UA 3F8MA 1FOKA 2XF7A 3IWZA 5KK1A 5EEHA 3JRHA 1K61A 2ISZA 1BJAA 4JYKA 1BC7C 4WX9A 3D5LA 3W6JB 2WY8Q 2CUJA 2D45A 2WTEA 5L3BA 2DA7A 3I4NJ 2HXIA 4UB6C 2GM4A 2ADUA 2QYOA 1ZR4A 3J7AY 2KIUA 1U3EM 5JVTA 2XHKA 2K4JA 1S7EA 4A3EJ 2O6GE 2CUZA 1MW7A 1BA5A 4PGGA 1FIAA 2CJJA 3EUKL 4DNCA 2A6TA 3I58A 1MNDA 2VQLA 1OYIA 4UHTA 4PSXA 2R7DA 4Q48A 4EQQA 1ZLKA 1YITI 5ICCA 4LK0F 1OR7A 2F5VA 2M7AA 4IX7A 3KP7A 1A5JA 2EFNA 1R5ID 2E2JJ 1SMTA 2QKMB 4F91B 5DD8A 2A5WA 4S04A 3QPLA 4KDPA 3DV8A 2UXNA 1YX5A 2Y48A 2W00A 4XLCA 2HVRA 4IOCF 4LFUA 1EH8A 3LMMA 4FTHA 1W1WE 2W24A 4QTRA 2R7QA 2XAGA 1OYYA 4XRSG 5DM7F 1S7OA 3U2RA 1D0ZA 3LA2A 5CVRA 2HZTA 2MSYA 1YJ9I 3RSNA 3HTSB 3ML6A 5H6RA 2NS8A 3N4MA 2FQ3A 2Q0OA 3I4MJ 3F8CA 3OIOA 3EETA 1OMIA 2LBFA 2VONA 2RREA 3LAPA 1ZLJA 1X1PA 5JVGF 2M45A 1OLTA 2K86A 3EDPA 2K85A 4BDZA 4V19K 5EJCA 2KZVA 3S16J 1QQIA 2XGCA 5FB2A 5L3DA 2XB5A 2R5YB 5FROA 2L4MA 1D1AA 2H8RA 3GZ5A 2QQ9A 5EEAA 2H1KA 3BG3A 1WJ5A 2QGUA 2H94A 4CICA 3DLLF 1T08B 1D0XA 5FLVA 2MH2A 1B9NA 2G0EA 4XM3A 3ZQFA 1WH5A 3KLOA 5F64A 3SHFA 2Y9ZA 2E60A 3FMRA 4W97A 4IHWA 1LKXA 2CQQA 4B3XA 2HOAA 1MD0A 2MD5A 2V9VA 2Y9YA 3GFMA 1LJ9A 2EZIA 3SZGA 2LMDA 2R7FA 2JA7J 4CH7A 3I55I 4PSWA 2IEKA 1Z77A 2KPMA 4OIPF 3O6BB 2FMLA 2CUEA 2RQPA 2Q8KA 3F8BA 5IYDJ 4E70A 2M5WA 2V1NA 3WTZA 2DDAA 1GV5A 1Q1VA 5IP6A 4E7JA 4G7ZF 3T8TA 1XC5A 4NDLA 1G2HA 4F93B 1R23A 2QCOA 2PX9A 1J2XA 3ROUA 3OYMA 4ZTFA 2GLOA 1SD5A 1MJAA 4RGRA 2VLAA 3TMOA 4LOCA 4NC7A 1U0JA 2VC1A 3A0BC 4DZJA 3ABKH 2VC0A 3R60A 4DOZA 1DP7P 3F23A 2DT7B 5FJ8J 1WH7A 1XB4A 2I8DA 1MJBA 3RYPA 3WTUC 3HXLA 3KX2A 1D3YA 4IRGA 3GLXA 1A35A 3JRDA 3KYDB 1VZ0A 1AA7A 4EJOA 4QPOA 4C30A 2UWMA 1RZ4A 4OWRB 3RJPA 4A3MJ 1EV7A 1SVOA 2G7UA 4IHSA 2ZXWH 3G1MA 3ZPLA 4U7DA 3FHZA 1R71A 4EVIA 4PDKA 1FSHA 5F08A 3DU5A 5FKMA 2VN2A 1WCMJ 3PUFA 2RV8A 1WGXA 3GVAA 5JI6A 1Z7UA 3WHCA 3CMYA 1OFCX 3F0CA 2XV4S 2FEZA 3B6CA 2DA4A 5IYCJ 1ETXA 3C2GA 4LG0A 1ETOA 1POGA 2FU4A 3TEDA 1HKSA 1EKEA 4M6XA 3V8JA 3GCMA 1V55H 4KUMA 5E20A 5FGMA 1H9GA 3DCFA 3N05A 3ZMVA 3MAJA 3RZDJ 2FJ1A 5B3SH 4M3DA 1QA6A 1XG1A 4F55A 1E3PA 2J5OA 3L2QA 3AG4H 3DEWA 1YTYA 3BR3A 1G3SA 2BGCA 3ZOBA 2O8KA 1LDDA 5D6FA 1IRZA 3MEXA 5LLQA 1I3QJ 1FLIA 1MMSA 4P1WA 3WU1B 3AG2H 5FRMA 3CC2I 2DMQA 2W85A 2CQKA 5TJJA 4HNUA 1N77A 3ERMA 1O7FA 1J59A 5F1JA 5A2QZ 4EGYA 1JUSA 1EF4A 3CO6C 2P5VA 2CRGA 2DA6A 4JK1X 5DTDA 3JAMK 1YI2I 2I10A 4BBSJ 2AQEA 1USTA 2EINH 3D1NI 4Y33A 4CYCA 2UZKA 3J81Z 1ZHFA 5LGNA 4XN0A 2QSHX 2Q1ZB 5ILUA 1W0TA 2VBWA 3FXKA 1FC3A 2TCTA 3ZN0A 4O6JA 3VSLA 3IRQA 4P5OA 4KNYA 3G71I 3WTXC 4EM2A 2L9NA 4UUTA 5GPCA 4MEYF 4JP0A 3JRBA 3ZRGA 1RC9A 4DW6A 2TDXA 5M5XJ 3VDXA 4CHUA 4G7OF 4OOIA 2DFIA 4O3MA 2GWRA 1I3AA 5ICFA 3BG9A 3QU3A 3I3LA 3ZQQA 2QQ8A 5HLHA 1UG0A 2DFHA 3KEYA 2OJED 2DMTA 2GIVA 2GOXB 3QQAA 1B4AA 5BS6A 3V7SA 2O9LA 4WK8F 3R6SA 4Q47A 3OV8A 3EUAA 4RB1A 3BZCA 4E7LA 1ZRCA 2XGEA 4AVPA 5HODA 2VL8A 1Z9CA 3WG7H 3J80Z 3A4CA 2HQ5A 2EIJH 1KA8A 4YRVA 5F1RA 1VQKI 4IQJA 4CXFA 1UCRA 1HKQA 2ICWG 4FQGA 1FBSA 1UHMA 1XCVA 1K7AA 1FMVA 1SVMA 2IA1A 4WXDA 2LD5A 2YR2A 4HX7A 2JUGA 1VQ6I 4NNJA 1YQAA 2WAQN 1TZLA 1GXQA 2LNBA 1QZYA 5D4SA 3LFUA 2FXAA 3BR0A 3BWGA 1JXSA 1U8RA 4U87A 3S8PA 2V26A 3FXMA 4M3FA 1MZBA 3E6MA 2PMZA 2L4AA 2HVQA 3IAM2 4AIHA 1Z21A 5DV5A 3LAJA 3S1RJ 2OAZA 3OSGA 2G7HA 2ZB9A 4DYQA 1NTCA 4AIJA 3CTAA 2XRLA 2DMNA 3CC4I 2QBYA 1I6XA 3T1BA 5HLGA 3LNQA 1KQ8A 5M3FJ 3W6VA 3JREA 2ECCA 4BS9A 2I5UA 4QSHA 3E0JB 5LFAA 2NVQJ 1BN5A 2R3SA 2Y0SA 2XIGA 2K40A 2EA4A 4E7SA 2X48A 1X4PA 2GA2A 4ZYHA 1W36D 2XB0X 4UVCA 2IT0A 3HHGA 4ESJA 1VF9A 3LSMA 3H5NA 3MZHA 1FZPB 3HOSA 3RI4A 1I50J 1P9QC 2MFZA 2R7RA 5K7FA 2CSOA 3P9CA 5LRSA 3BTLA 4JX6A 3K4BA 1PUFA 2OTJI 4RB0A 2VJ4A 1XSDA 3E6DA 3JSPA 3GFIA 2PJRB 2FD5A 3J7YJ 1UG2A 2UXXA 2EB7A 4R1HA 1FWZA 1U9NA 3D5RC 5BQTA 3HOXJ 3CUQC 2Z3YA 3NARA 2Y2ZA 4B1RA 1H88C 2STWA 4BNCA 3T8RA 1BI3A 1I1SA 3QWLA 3Q0VA 1D5VA 5IP7J 1MJ9A 3K4JA 1WKMA 2KKOA 2YSRA 2IGNA 2OD5A 2VPRA 3BG6A 4CCMA 4C2MJ 3PM1A 4WCGA 3OYDA 5AIQA 4E7IA 2XPWA 2H6BA 2HPMA 3SQNA 2ID6A 4W1UA 2F48A 1WVRA 2ZMEC 2IGKA 2RVCA 2XKOA 2CUFA 3CLQA 2X1DA 2XROA 1ZRFA 2OTLI 4HZFA 1JI8A 4BGDA 1DP3A 1J7KA 1FOYA 1BR4A 2FNAA 2DN0A 1K83J 2V1DA 2XAFA 4A3FJ 3S14J 3M1CA 4OMZA 5KVRA 3TOBA 3ZMDA 5J4YA 1PP8F 3ZMUA 3ZQHA 2E7WA 4S0HB 1FTZA 4AVZA 2MBFA 2IAIA 3HRTA 3W2AA 2X85A 2OF7A 4XICA 3PNYA 4XKVA 4DYCA 1JGGA 2NVTJ 4XLEA 1DU0A 4M71A 1N75A 3QYFA 4U88A 5FFZA 3OIPA 3MKLA 4AIKA 1TWHJ 4B8XA 2K9QA 4GRIA 2EFQA 2LP0A 4J00A 1P7JA 3CCRI 2JZYA 3VB2A 3VSKA 4BAYA 2X6WA 2KLOA 5D5UB 5B1BH 3LA7A 4Y13A 2K02A 5TISC 4MTEA 2E19A 2DT5A 5D8LB 1QVTA 5H20A 2VJJA 4CGZA 4IHXA 2HOSA 4Y15A 3UR3C 1SAXA 1FX7A 2VE8A 4CCNA 1RIOH 2CYYA 1XSXA 4M3BA 4PGHA 3C3WA 2G9WA 3GEZA 2BZTA 4Q5SF 5DCFA 2PMZN 1QZEA 1YS7A 5L3FA 2A5YB 2XF5A 4DQ2A 3W6KB 2EIKH 3BQYA 4XRMA 1NH3A 2M9HA 4FX4A 4BL0B 2W7NA 1JJ6C 5J8FA 3EUHA 2P7CB 4A3JJ 3C18A 1SFXA 1OCRH 1YFHA 3GXOA 3HUGB 2ZMEB 3VOEA 3KYCB 1VQ4I 2QKLB 2L2OA 4C2TA 3FDYA 4L5EA 1OR7C 1JT0A 4DBRA 3M8FA 3QU6A 3MFKA 2DODA 2EQRA 1A6IA 1ZARA 2FA5A 3A1YA 3K9TA 3V42A 5E1WA 4CCOA 3GZ6A 3PIPF 2QSFX 1IDYA 3KP5A 1WJCA 2P0WA 2XSJC 4AWXB 5ED4A 2VOOA 2VKDA 1Y0NA 4EJTA 5DUIA 3GTLJ 4I02A 2EILH 1MGTA 1P6RA 1LVKA 3ECHA 4CA0A 5B1AH 3CCJI 1IC8A 1ZGAA 5J1RA 3FKJA 4LLLA 2E1CA 2HTJA 4HPQA 3KZIC 1IRFA 2VBYA 1K6OA 3G4SI 5J4VA 4H4KC 1HA8A 6PAXA 4ZDOA 2LSOA 5ILSA 1T2KA 4I6ZA 2Z5UA 3CMEI 3ZQGA 2JUCA 2HWVA 2P5LC 3CCQI 3DLAA 1WJDA 2VXZA 1SC7A 4I0AA 2L0KA 2DTZA 3WE3A 1FPQA 3MMYB 4JX5A 3WU0A 4ZJZA 4NQWA 4YG2F 3J80K 3R4KA 1ENHA 3GYHX 3C2HA 4DZPA 2PJPA 5H6QA 1ZREA 3ZXSA 2RNGA 2M8GX 5EEGA 2W48A 4C9YA 4UUSA 1YS6A 2WV1A 1KQ9A 5K5QA 4HLYA 1BBYA 1GXPA 3ELKA 1HDDC 2L9VA 1DGWY 3QRFF 3CJRB 4P96A 4BY7J 4BQQA 5BNGA 4M6YA 3L2WA 1A31A 5LGTA 2PQ8A 4BBRJ 3SXYA 3PQJA 1QHHD 1IO2A 1JT6A 2B0LA 5J47A 3MKZA 1T33A 5IT9Z 2NAZA 5E17F 4EJWA 2KIMA 4XKBA 1XMXA 3HRUA 4IXAA 4LIUA 3E5QA 4CZCA 2JN6A 2F5EA 2XUBA 4RAGA 3HL2A 3RZOJ 5CLSA 3MCZA 5F04A 5KAIC 1Y8RB 4DYRA 3OYAA 1AKHB 1K6YA 2DPUA 1LVAA 4CYCB 1XGOA 1VQLI 3HRMA 1NG7A 4PZJA 1KONA 3LQQA 1LFPA 1OPCA 3SJMA 2GIZA 2X6XA 3GBGA 3OS2A 2XPVA 1W0UA 2LK2A 1G3YA 1KYZA 3RKXA 1IN6A 5JFRA 1UB9A 3I53A 3VPRA 2VJ5A 2LH9A 3P7NA 3HGGA 5E1XA 3RIRA 2CV0A 3GTKJ 4TV7A 2IRFG 3PNVA 4EEFG 1DPRA 4XRFA 2W84A 2CV2A 3A02A 4AD9A 1D0YA 2LRDA 4ON0A 5EZGA 3S3NA 2XAHA 1YRNA 4HF1A 1BC8C 1R00A 2F5CA 1A36A 5CVUA 2C6YA 1RPWA 2DW4A 3FK7A 1IN4A 1QRYA 3BR6A 3ZMTA 4MIMA 1MMDA 2COBA 4KIGA 5J1UA 2DAOA 5E18F 3F21A 1NHAA 3F6OA 3L2CA 4OIQF 2VQHA 1RKTA 3WU2C 3S1NJ 1BW6A 1SFUA 2P4WA 3KP4A 5FO5A 4FISA 5LHGA 2HYFA 4BQOA 1HSTA 4XL9A 2ZC2A 5L3CA 1VFCA 5F0HA 1BL0A 2IS4A 3DXJF 5J3LA 4ZYGA 4BE0A 3QPSA 2DQLA 2ZMEA 4ENKA 3PIOF 1JE8A 5JLWA 1ZR2A 3L2RA 5CQEA 4II3A 2XVCA 3BJ6A 5J40A 3ULQB 3FX3A 2ZJQF 5BOXA 1MDMB 2E35A 3HHHA 3BQZA 3JAMZ 4M73A 1O4XA 3EPZA 3LSGA 3NAUA 1E2XA 5CKTA 1MBKA 1IJWC 3ISPA 3PFYA 4N4NB 1N78A 3M8EA 4BXXJ 3SDGA 2W25A
chains in the Genus database with same CATH topology
2A3SA 2RN7A 2YX4A 2D1HA 5AONA 2EA2A 2ZKZA 1R1VA 3H3ZA 1R7JA 2JSCA 1IZ1A 4N9HA 5FFXA 1D8KA 4IHTA 2DTRA 1HW2A 4A12A 4KIBA 1BI0A 1S3JA 4BH9A 1B6AA 1HQCA 2DK5A 3PQKA 1P4AA 3WTYC 1S6LA 1IUYA 3DP7A 4RS8A 4HW0A 3IL2A 3FWEA 1KU3A 2NYXA 4L9VA 1VTNC 1FY7A 4EM1A 1JGSA 1O7LA 1ZG1A 3O3KA 4HF2A 2Y0MA 1P2FA 5L3GA 4HOBA 4OU0A 2EFWA 1IN7A 4Z2YA 3HSRA 3EYYA 2M87A 1ZN2A 4HBLA 3V4GA 1HSJA 2MH9A 1FNNA 3I59A 1XMAA 3Q9VA 2HOEA 1REPC 2YPRA 2ZNYA 2IP2A 2PN6A 1J75A 2GZWA 3GFLA 4YFNF 1FYMA 1J5YA 2FBIA 4U0YA 1YO5C 4LK1F 3ABTA 3WTTC 3JTHA 2STTA 4XLPF 4UNOA 2XGXA 4B09A 1WI9A 3RTRA 2A61A 5E8GA 5DEQA 1P4XA 1U5TA 2X4HA 3I71A 5FD5A 5K5RA 2VT3A 4FX0A 3HOTA 2KRFA 1QO0D 3T0YA 3KEOA 3HSEA 3O2PE 4YFKF 3ECOA 4GCVA 4M72A 1RNLA 4YFXF 5LEJA 3KEQA 5AIPA 5A2QK 2PMHA 2XAJA 4S05A 1TW2A 3VODA 2AS5F 3RPQA 3ZQ7A 3F72A 2HYGD 2IJLA 1XMKA 2GAUA 2Q2EA 4KA4A 3KLNA 1YYVA 2ZCWA 4I7HA 1Q1HA 1WRJA 1KU2A 4MQVA 1IAWA 1OKRA 1XGMA 2BE5F 4MTDA 5LGUA 1U78A 1R5GA 3DPTA 2XKPA 3S2WA 1IW7F 2K4BA 1K78A 5K1YA 1SD6A 1RUNA 1ON1A 2M1BA 1V4RA 1HKTA 3WE2A 3TKYA 1RUOA 4UV9A 2Z99A 3GWZA 1STZA 1JHFA 1TNTA 4LGWA 4OIRF 5D4RA 4GYGA 4BQAA 3JSOA 2BYVE 1XGSA 1O3QA 4MHGA 2Z9OA 3QPHA 1G3TA 2ISYA 5DCMB 1S8NA 1LQ1A 4A6EA 4G6DA 1FT9A 3G3ZA 2WWYA 5TRDA 3BDDA 4L9NA 4WF2A 1YG2A 5HDNA 4OIOF 3I5UA 1LDKB 2ESNA 3Q9SA 2OBPA 1TW3A 3KETA 1KQ0A 1KGSA 4FHTA 1I27A 2COMA 1DDNA 2AXLA 1BM9A 2LDUA 2RNJA 2A69F 3VEPA 1BI2A 2ZNZA 4KICA 4D0PA 1Z6TA 3BY6A 3M1EA 4M74A 1XCBA 1R1TA 1IRGA 4EV0A 3KP6A 1L0OC 5CYVA 3WTWC 3FM3A 4LD5A 1SMYF 2BV6A 3NRVA 5HDGA 1QGPA 2RGVA 1IXRC 1O57A 4ZZDA 1PUEE 1TQIA 2EWNA 2LKPA 3CO7C 1ZAOA 4HF0A 3QP6A 3J7AO 3R0JA 4KN7X 1GHCA 1Z05A 1DUXC 1B59A 1SD7A 3KCCA 5CVIA 5BPDA 2CO5A 4EGZA 2QM3A 3OOPA 2W57A 4Y17A 4NHJA 5ILVA 4IVNA 3L9FA 3SZPA 1TLHB 4ZZLA 2KJCA 5BPIA 4ENJA 3TGNA 3J81K 3Q5FA 3CUQB 5D5WB 4M9XA 2F5FA 2PEXA 2HQNA 3TO7A 2DO7A 1YIOA 5FD6A 3K1PA 4RAYA 2PG4A 1XSVA 5JR3A 1U6GA 1QPMA 2CFXA 5HLIA 5LBQA 4GGGA 1T6SA 1CGPA 4EM0B 1Z91A 4ESBA 5D8KB 1XN7A 4ZH4F 2XAQA 2L01A 5FLXZ 4R79A 3BJOA 4G8XA 1O3TA 1F5TA 4KIFA 2LF7A 1LEAA 3HIFA 3CUQA 4HV6A 3MZYA 2QWWA 4JBAA 1YW7A 4HYEA 2OQRA 5DCMA 2FRHA 2O3FA 4HDVA 2HTSA 4HX8A 1DPUA 1YW8A 2IVMA 1ON2A 4R8HA 4A6DA 4G94A 3RDIA 2QBYB 2DK8A 1IN5A 5ERIA 1TQPA 5HOOA 3U1DA 2ACJA 2PI0A 1Z6RA 2D2WA 3I59B 4WWCA 4WXHA 3R0AA 4L9JA 3FXUA 4L0YB 3TO9A 2HDCA 4HDUA 3KP3A 2EV0A 2GQQA 3COAC 4PCQA 2FOKA 4G7HF 4CO8A 3V8KA 3FXQA 1S7AA 3LFKA 2MLGA 5LRRA 3K1NA 3I64A 2M8EA 4XLNF 5CJ9A 2ZO4A 1LDJA 4OMYA 4UV8A 2YU3A 1V3FA 2IPQX 2L02A 2QQAA 5HS8A 3CLOA 4LLNA 3LA3A 3DKWA 3K0LA 3H3UA 3DQVC 1GVJA 1ONVA 2FBHA 2F2EA 1R58A 1CF7B 1PP7U 3QP5A 3E5XA 2E7XA 2K7LA 2O03A 2DPDA 1YLFA 3F8NA 1SFEA 4GYIA 2GXGA 4QWQA 3FXRA 4ENNA 2KIFA 3L09A 3RPUA 2P5KA 4KYWA 1BOAA 4P9UA 5DDGA 4CYDA 3FMQA 2VT2A 2E1NA 2DI3A 2VOPA 5F6FA 2OQGA 1IN8A 2HR3A 1X3UA 2NNYA 1EH6A 4LB5A 1F9NA 2HKOA 2YX7A 4MQ9F 5D5XB 4ENMA 2L3DA 1AWCA 1XDSA 3CUOA 3P9KA 3KE2A 2FF4A 3T5XA 4F7ZA 4U7BA 3E6BA 1O3RA 3K1MA 1LNWA 1ZGJA 2OU2A 3BOQA 3TQNA 4L0ZB 1HBXG 2FBKA 1B9MA 2A6HF 1QBJA 2P8TA 2V1UA 2QQBA 4A2UA 2ESHA 2FE3A 2RDPA 5K5OA 4RGXA 5ICGA 3M9AA 4NB5A 4HV5A 1I5ZA 5HVQC 4UVAA 3BJAA 3F22A 3ABUA 2L54A 2O0YA 3BROA 4KMUX 1I1GA 1WWXA 3NQOA 4GO1A 4I01A 3BZ6A 4P55A 3V8LA 3WGHA 5CVVA 3E6CC 4QLCU 3F6VA 5HS7A 3HTUA 4M9ZA 1BIAA 1BI1A 2VBXA 2VODA 2P7VB 5DD4A 3R61A 1Y0UA 4HA8A 4EMSA 1ZG3A 3SFZA 5LHHA 1L3LA 1OYWA 2CG4A 4ASNA 4L18B 1ZRDA 4BHBA 3I54A 2V6CA 3IWFA 4HQMA 2JT1A 5JHUA 1HXDA 4I98B 4HX4A 1SD4A 4BHCA 4LLGF 2ETHA 5DUKA 1USSA 2ELHA 3AAFA 4A0XA 3GW2A 1LB2A 3FZVA 2P6TA 1RI7A 1W7PB 2GA1A 1S29A 3E97A 5HDKA 2JPCA 1UHWA 4BYYA 4CZZA 1U5TB 4Q4ZF 4XSZF 1J9IA 5BMZA 3BPXA 1A04A 4G6QA 1TQMA 2CGPA 1O3SA 1TBXA 2M30A 2EV6A 2DLLA 2NRAC 2O8XA 3IHUA 4H0EA 4KFCA 5DYMA 3IRRA 1TNSA 4O5VA 1FBQA 1YW9A 4M9SA 2FNPA 4IRHA 2F5DA 2DU9A 3H92A 3V7RA 1F1ZA 2WV0A 4N0BA 2NNNA 1ZG5A 2EJRA 1T98A 3HSFA 1PDNC 2HQRA 4RAZA 1FBUA 5IT9K 3LQRA 3ZMSA 2FSWA 4UUVA 2XRNA 1WSUA 3V7CA 1HW1A 1K78B 4LG0B 3K2ZA 3SZTA 1FP1D 4EJVA 1FSEA 4JQFA 1U5TC 2QLZA 3DF8A 2MA3A 2GXBA 1XD7A 4MEXF 4WXCA 2BBYA 2FMYA 2LF8A 4I2OA 1XDUA 4HLXA 1QZZA 4UVBA 4BXUA 1R36A 4GXOA 3FF5A 1ZYRF 3K69A 2DQRA 3DPLC 2WC2A 3RKWA 2Y75A 2JTVA 3CJNA 3WG9A 3WTSC 3L7WA 1R22A 2HKXA 1W5SA 3QAHA 3B02A 4IJAA 3HYIA 4LMYA 4L5JA 1KU7A 5E8IA 2EK5A 5FLXK 4ETSA 2ZFWA 1P92A 5D5VB 2BEOA 1K79A 2JPBA 1Z1DA 2Z33A 3EQLF 4UXNA 2QVOA 2EFOA 1ZH5A 3F8FA 2H27A 3I0TA 3DFGA 2RKHA 1KU9A 2KJBA 4KT5C 3EYIA 3P9IA 3LWFA 2HEOA 1U2WA 3E5UA 3ERED 3D0SA 3I4PA 4KN4X 3E3VA 1FYLA 4MNUA 4HAMA 1QNTA 3FMSA 2ZXJA 4I09A 2ZJ2A 3WODF 1LEBA 1ODDA 2PMUA 3MQ0A 1XGNA 1C0WA 3TDUC 3ZN1A 4U0VA 5HS9A 1J0RA 3KZZA 4IF4A 3GFJA 3TO6A 1T39A 3M7GA 3U9GA 3WTVC 2O61A 3JW4A 4L9TA 5ICEA 5E1ZB 2EV5A 2IA2A 2A6EF 3L00A 1IF1A 4RB3C 4ZYEA 4RB2C 4OINF 4LB6B 1W7PD 4HQEA 3QOPA 3G73A 2VE9A 5CVJA 4L5IA 3KZYA 2QUFA 1G6NA 2OZUA 2K27A 4EJUA 3RKYA 3QPTA 4A5MA 4BHPA 4IPAA 3WGGA 1B1BA 2PLYA 1G3WA 2QENA 2D1VA 1R1UA 4KMFA 1R5HA 5D6EA 2CW0F 3TDZC 2H09A 3KP2A 2X0LA 4XBFA 5IT3A 2HFHA 4YIFA 4ZYDA 2PBIA 1BIBA 1EH7A 5LHIA 3RYRA 3GUDA 4FT8A 1D8JA 4XSXF 3BPVA 3WGIA 4RGUA 1IXCA 4IRIA 1JHHA 2IW5A 4CDGA 3JTGA 2V79A 3C1DA 2P6SA 2A68F 2MC3A 4YIIA 3ZMZA 1W5TA 1F4KA 3GF2A 1CF7A 3DEUA 5J6XA 3IC7A 1WQ2A 4A0ZA 4U0WA 3LSTA 3REOA 2XASA 2CWEA 2A07F 4RGSA 2ZBKA 4LJZF 3PFIA 1MDMA 1FP2A 4K2EA 3MWMA 3ZP5A 4A5NA 4P9FA 2NS0A 3BP8A 1ULYA 3NEUA 2OA4A 1W7PA 1FYKA 5LEKA 3IKTA 4I0BA 2H6CA 2DBBA 4N9IA 4MGRA 2RC4A 3CDHA 2J5PA 3TOAA 1H9TA 3IKVA 1E17A 4G9YA 1H0MA 1HW5A 2JRTA 2HS5A 2HGCA 3C7JA 3VFZA 2QZ8A 1T0FA 3GX4X 3GO5A 1T38A 3HUGA 2OZ6A 2EFPA 3B73A 1IXSB 1KYWA 5L3EA 4ESFA 1UFMA 1P4WA 3FM5A 1MKMA 1AOYA 4A0YA 1TTYA 2IA0A 3KFWX 3N97A 3F3XA 5J8CA 2PFBA 3HRSA 2MLKA 1W4MA 2VBZA 2V1XA 1G4DA 3F8MA 1FOKA 3IWZA 5KK1A 5EEHA 2ISZA 1BJAA 1BC7C 4WX9A 3D5LA 3W6JB 2D45A 2WTEA 5L3BA 2ADUA 2QYOA 2KIUA 1U3EM 5JVTA 2K4JA 2XHKA 2O6GE 4PGGA 4DNCA 3I58A 1OYIA 4UHTA 4Q48A 2R7DA 4EQQA 1ZLKA 5ICCA 4LK0F 1OR7A 3KP7A 2EFNA 1SMTA 5DD8A 4S04A 4KDPA 3DV8A 2UXNA 2Y48A 4LFUA 1EH8A 2W24A 2XAGA 1OYYA 1S7OA 3U2RA 3LA2A 5CVRA 2HZTA 3HTSB 3ML6A 5H6RA 3N4MA 2FQ3A 2Q0OA 3F8CA 3EETA 1OMIA 2VONA 3LAPA 1ZLJA 2M45A 2K86A 3EDPA 1QQIA 5FB2A 5L3DA 2L4MA 3GZ5A 2QQ9A 2H94A 4CICA 2MH2A 1B9NA 3KLOA 5F64A 3SHFA 3FMRA 1MD0A 2MD5A 2V9VA 3GFMA 1LJ9A 2R7FA 4OIPF 3O6BB 2FMLA 2RQPA 2Q8KA 3F8BA 4E70A 2M5WA 3WTZA 4G7ZF 3T8TA 1R23A 1J2XA 3ROUA 1SD5A 1MJAA 4RGRA 2VC1A 2VC0A 3R60A 1DP7P 3F23A 1XB4A 1MJBA 3RYPA 3WTUC 1D3YA 4IRGA 3GLXA 2UWMA 4EJOA 1RZ4A 3RJPA 1EV7A 2G7UA 4IHSA 3ZPLA 4U7DA 3FHZA 4EVIA 4PDKA 1FSHA 2VN2A 2RV8A 3GVAA 5JI6A 1Z7UA 2XV4S 2FEZA 4LG0A 2FU4A 1HKSA 4M6XA 3V8JA 4KUMA 5FGMA 5E20A 1H9GA 3ZMVA 3MAJA 2J5OA 1YTYA 1G3SA 2BGCA 1LDDA 5D6FA 3MEXA 5LLQA 1FLIA 3WU1B 2W85A 2CQKA 5TJJA 1O7FA 1J59A 5A2QZ 4EGYA 3CO6C 2P5VA 4JK1X 3JAMK 1USTA 2UZKA 3J81Z 1ZHFA 5LGNA 5ILUA 2VBWA 1FC3A 3ZN0A 4O6JA 3IRQA 4P5OA 4KNYA 3WTXC 4EM2A 4MEYF 2TDXA 4G7OF 4CHUA 4OOIA 2DFIA 4O3MA 2GWRA 5HLHA 5ICFA 3QU3A 2GIVA 1B4AA 5BS6A 3V7SA 4WK8F 3R6SA 4Q47A 3OV8A 4RB1A 1ZRCA 4AVPA 1Z9CA 3J80Z 1KA8A 5F1RA 4CXFA 1HKQA 1UCRA 1K7AA 1FBSA 1UHMA 1XCVA 2IA1A 4WXDA 2YR2A 4HX7A 1YQAA 1GXQA 2LNBA 1QZYA 5D4SA 2FXAA 1JXSA 3BWGA 1U8RA 1MZBA 3E6MA 2L4AA 4AIHA 5DV5A 3LAJA 2OAZA 2G7HA 4AIJA 3CTAA 2QBYA 1I6XA 3T1BA 5HLGA 1KQ8A 1BN5A 2R3SA 2XIGA 2EA4A 2GA2A 4ZYHA 4UVCA 2IT0A 3HHGA 4ESJA 3MZHA 1FZPB 3HOSA 3RI4A 2CSOA 3P9CA 5LRSA 4RB0A 1XSDA 3E6DA 3JSPA 3GFIA 2UXXA 2EB7A 4R1HA 1FWZA 5BQTA 3CUQC 2Z3YA 2STWA 4BNCA 3T8RA 1BI3A 1I1SA 1D5VA 1MJ9A 1WKMA 2KKOA 2YSRA 2OD5A 4WCGA 5AIQA 2H6BA 3SQNA 2RVCA 2XKOA 2XROA 1ZRFA 4HZFA 1J7KA 2FNAA 2V1DA 2XAFA 4OMZA 5KVRA 3TOBA 3ZMDA 1PP8F 3ZMUA 2E7WA 2MBFA 3HRTA 4M71A 4U88A 5FFZA 4AIKA 4B8XA 2EFQA 2JZYA 3VB2A 4BAYA 5D5UB 3LA7A 4Y13A 2K02A 4MTEA 2DT5A 5D8LB 5H20A 4CGZA 4Y15A 1SAXA 1FX7A 2VE8A 1RIOH 2CYYA 1XSXA 4PGHA 3C3WA 2G9WA 3GEZA 4Q5SF 5DCFA 5L3FA 1YS7A 2A5YB 4DQ2A 3W6KB 4FX4A 5J8FA 3EUHA 2P7CB 3C18A 1SFXA 1YFHA 3GXOA 2ZMEB 3VOEA 3M8FA 3QU6A 3MFKA 2FA5A 1ZARA 3K9TA 3GZ6A 5E1WA 3KP5A 5ED4A 4AWXB 2VOOA 4EJTA 5DUIA 4I02A 1MGTA 1P6RA 3ECHA 1ZGAA 4LLLA 2E1CA 2HTJA 1IRFA 2VBYA 1K6OA 6PAXA 2LSOA 5ILSA 1T2KA 2Z5UA 2HWVA 2P5LC 2VXZA 4I0AA 3WE3A 1FPQA 3WU0A 4NQWA 4YG2F 3J80K 3R4KA 3GYHX 2PJPA 5H6QA 1ZREA 5EEGA 1YS6A 1KQ9A 5K5QA 4HLYA 1BBYA 1GXPA 3ELKA 3QRFF 4P96A 4M6YA 5LGTA 2PQ8A 3SXYA 3PQJA 2B0LA 5IT9Z 2NAZA 5E17F 4EJWA 2KIMA 3HRUA 4IXAA 3E5QA 2F5EA 2XUBA 5CLSA 3MCZA 2DPUA 1LVAA 1XGOA 3HRMA 4PZJA 3LQQA 1OPCA 1G3YA 1KYZA 3RKXA 1IN6A 5JFRA 1UB9A 3I53A 3P7NA 5E1XA 3RIRA 4TV7A 2IRFG 1DPRA 4XRFA 2W84A 4AD9A 4ON0A 2XAHA 4HF1A 1BC8C 1R00A 2F5CA 5CVUA 2C6YA 2DW4A 1IN4A 3ZMTA 4KIGA 2DAOA 5E18F 3F21A 1NHAA 3F6OA 3L2CA 4OIQF 1SFUA 2P4WA 3KP4A 5FO5A 5LHGA 2HYFA 1HSTA 5L3CA 3DXJF 4ZYGA 2DQLA 2ZMEA 4ENKA 1JE8A 2XVCA 3BJ6A 3ULQB 3FX3A 5BOXA 1MDMB 3HHHA 3JAMZ 4M73A 1E2XA 3ISPA 3M8EA 2W25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3S A;  2RN7 A;  2YX4 A;  2D1H A;  5AON A;  2EA2 A;  2ZKZ A;  1R1V A;  3H3Z A;  1R7J A;  2JSC A;  1IZ1 A;  4N9H A;  5FFX A;  1D8K A;  4IHT A;  2DTR A;  1HW2 A;  4A12 A;  4KIB A;  1BI0 A;  1S3J A;  4BH9 A;  1B6A A;  1HQC A;  2DK5 A;  3PQK A;  1P4A A;  3WTY C;  1S6L A;  1IUY A;  3DP7 A;  4RS8 A;  4HW0 A;  3IL2 A;  3FWE A;  1KU3 A;  2NYX A;  4L9V A;  1VTN C;  1FY7 A;  4EM1 A;  1JGS A;  1O7L A;  1ZG1 A;  3O3K A;  4HF2 A;  2Y0M A;  1P2F A;  5L3G A;  4HOB A;  4OU0 A;  2EFW A;  1IN7 A;  4Z2Y A;  3HSR A;  3EYY A;  2M87 A;  1ZN2 A;  4HBL A;  3V4G A;  1HSJ A;  2MH9 A;  1FNN A;  3I59 A;  1XMA A;  3Q9V A;  2HOE A;  1REP C;  2YPR A;  2ZNY A;  2IP2 A;  2PN6 A;  1J75 A;  2GZW A;  3GFL A;  4YFN F;  1FYM A;  1J5Y A;  2FBI A;  4U0Y A;  1YO5 C;  4LK1 F;  3ABT A;  3WTT C;  3JTH A;  2STT A;  4XLP F;  4UNO A;  2XGX A;  4B09 A;  1WI9 A;  3RTR A;  2A61 A;  5E8G A;  5DEQ A;  1P4X A;  1U5T A;  2X4H A;  3I71 A;  5FD5 A;  5K5R A;  2VT3 A;  4FX0 A;  3HOT A;  2KRF A;  1QO0 D;  3T0Y A;  3KEO A;  3HSE A;  3O2P E;  4YFK F;  3ECO A;  4GCV A;  4M72 A;  1RNL A;  4YFX F;  5LEJ A;  3KEQ A;  5AIP A;  5A2Q K;  2PMH A;  2XAJ A;  4S05 A;  1TW2 A;  3VOD A;  2AS5 F;  3RPQ A;  3ZQ7 A;  3F72 A;  2HYG D;  2IJL A;  1XMK A;  2GAU A;  2Q2E A;  4KA4 A;  3KLN A;  1YYV A;  2ZCW A;  4I7H A;  1Q1H A;  1WRJ A;  1KU2 A;  4MQV A;  1IAW A;  1OKR A;  1XGM A;  2BE5 F;  4MTD A;  5LGU A;  1U78 A;  1R5G A;  3DPT A;  2XKP A;  3S2W A;  1IW7 F;  2K4B A;  1K78 A;  5K1Y A;  1SD6 A;  1RUN A;  1ON1 A;  2M1B A;  1V4R A;  1HKT A;  3WE2 A;  3TKY A;  1RUO A;  4UV9 A;  2Z99 A;  3GWZ A;  1STZ A;  1JHF A;  1TNT A;  4LGW A;  4OIR F;  5D4R A;  4GYG A;  4BQA A;  3JSO A;  2BYV E;  1XGS A;  1O3Q A;  4MHG A;  2Z9O A;  3QPH A;  1G3T A;  2ISY A;  5DCM B;  1S8N A;  1LQ1 A;  4A6E A;  4G6D A;  1FT9 A;  3G3Z A;  2WWY A;  5TRD A;  3BDD A;  4L9N A;  4WF2 A;  1YG2 A;  5HDN A;  4OIO F;  3I5U A;  1LDK B;  2ESN A;  3Q9S A;  2OBP A;  1TW3 A;  3KET A;  1KQ0 A;  1KGS A;  4FHT A;  1I27 A;  2COM A;  1DDN A;  2AXL A;  1BM9 A;  2LDU A;  2RNJ A;  2A69 F;  3VEP A;  1BI2 A;  2ZNZ A;  4KIC A;  4D0P A;  1Z6T A;  3BY6 A;  3M1E A;  4M74 A;  1XCB A;  1R1T A;  1IRG A;  4EV0 A;  3KP6 A;  1L0O C;  5CYV A;  3WTW C;  3FM3 A;  4LD5 A;  1SMY F;  2BV6 A;  3NRV A;  5HDG A;  1QGP A;  2RGV A;  1IXR C;  1O57 A;  4ZZD A;  1PUE E;  1TQI A;  2EWN A;  2LKP A;  3CO7 C;  1ZAO A;  4HF0 A;  3QP6 A;  3J7A O;  3R0J A;  4KN7 X;  1GHC A;  1Z05 A;  1DUX C;  1B59 A;  1SD7 A;  3KCC A;  5CVI A;  5BPD A;  2CO5 A;  4EGZ A;  2QM3 A;  3OOP A;  2W57 A;  4Y17 A;  4NHJ A;  5ILV A;  4IVN A;  3L9F A;  3SZP A;  1TLH B;  4ZZL A;  2KJC A;  5BPI A;  4ENJ A;  3TGN A;  3J81 K;  3Q5F A;  3CUQ B;  5D5W B;  4M9X A;  2F5F A;  2PEX A;  2HQN A;  3TO7 A;  2DO7 A;  1YIO A;  5FD6 A;  3K1P A;  4RAY A;  2PG4 A;  1XSV A;  5JR3 A;  1U6G A;  1QPM A;  2CFX A;  5HLI A;  5LBQ A;  4GGG A;  1T6S A;  1CGP A;  4EM0 B;  1Z91 A;  4ESB A;  5D8K B;  1XN7 A;  4ZH4 F;  2XAQ A;  2L01 A;  5FLX Z;  4R79 A;  3BJO A;  4G8X A;  1O3T A;  1F5T A;  4KIF A;  2LF7 A;  1LEA A;  3HIF A;  3CUQ A;  4HV6 A;  3MZY A;  2QWW A;  4JBA A;  1YW7 A;  4HYE A;  2OQR A;  5DCM A;  2FRH A;  2O3F A;  4HDV A;  2HTS A;  4HX8 A;  1DPU A;  1YW8 A;  2IVM A;  1ON2 A;  4R8H A;  4A6D A;  4G94 A;  3RDI A;  2QBY B;  2DK8 A;  1IN5 A;  5ERI A;  1TQP A;  5HOO A;  3U1D A;  2ACJ A;  2PI0 A;  1Z6R A;  2D2W A;  3I59 B;  4WWC A;  4WXH A;  3R0A A;  4L9J A;  3FXU A;  4L0Y B;  3TO9 A;  2HDC A;  4HDU A;  3KP3 A;  2EV0 A;  2GQQ A;  3COA C;  4PCQ A;  2FOK A;  4G7H F;  4CO8 A;  3V8K A;  3FXQ A;  1S7A A;  3LFK A;  2MLG A;  5LRR A;  3K1N A;  3I64 A;  2M8E A;  4XLN F;  5CJ9 A;  2ZO4 A;  1LDJ A;  4OMY A;  4UV8 A;  2YU3 A;  1V3F A;  2IPQ X;  2L02 A;  2QQA A;  5HS8 A;  3CLO A;  4LLN A;  3LA3 A;  3DKW A;  3K0L A;  3H3U A;  3DQV C;  1GVJ A;  1ONV A;  2FBH A;  2F2E A;  1R58 A;  1CF7 B;  1PP7 U;  3QP5 A;  3E5X A;  2E7X A;  2K7L A;  2O03 A;  2DPD A;  1YLF A;  3F8N A;  1SFE A;  4GYI A;  2GXG A;  4QWQ A;  3FXR A;  4ENN A;  2KIF A;  3L09 A;  3RPU A;  2P5K A;  4KYW A;  1BOA A;  4P9U A;  5DDG A;  4CYD A;  3FMQ A;  2VT2 A;  2E1N A;  2DI3 A;  2VOP A;  5F6F A;  2OQG A;  1IN8 A;  2HR3 A;  1X3U A;  2NNY A;  1EH6 A;  4LB5 A;  1F9N A;  2HKO A;  2YX7 A;  4MQ9 F;  5D5X B;  4ENM A;  2L3D A;  1AWC A;  1XDS A;  3CUO A;  3P9K A;  3KE2 A;  2FF4 A;  3T5X A;  4F7Z A;  4U7B A;  3E6B A;  1O3R A;  3K1M A;  1LNW A;  1ZGJ A;  2OU2 A;  3BOQ A;  3TQN A;  4L0Z B;  1HBX G;  2FBK A;  1B9M A;  2A6H F;  1QBJ A;  2P8T A;  2V1U A;  2QQB A;  4A2U A;  2ESH A;  2FE3 A;  2RDP A;  5K5O A;  4RGX A;  5ICG A;  3M9A A;  4NB5 A;  4HV5 A;  1I5Z A;  5HVQ C;  4UVA A;  3BJA A;  3F22 A;  3ABU A;  2L54 A;  2O0Y A;  3BRO A;  4KMU X;  1I1G A;  1WWX A;  3NQO A;  4GO1 A;  4I01 A;  3BZ6 A;  4P55 A;  3V8L A;  3WGH A;  5CVV A;  3E6C C;  4QLC U;  3F6V A;  5HS7 A;  3HTU A;  4M9Z A;  1BIA A;  1BI1 A;  2VBX A;  2VOD A;  2P7V B;  5DD4 A;  3R61 A;  1Y0U A;  4HA8 A;  4EMS A;  1ZG3 A;  3SFZ A;  5LHH A;  1L3L A;  1OYW A;  2CG4 A;  4ASN A;  4L18 B;  1ZRD A;  4BHB A;  3I54 A;  2V6C A;  3IWF A;  4HQM A;  2JT1 A;  5JHU A;  1HXD A;  4I98 B;  4HX4 A;  1SD4 A;  4BHC A;  4LLG F;  2ETH A;  5DUK A;  1USS A;  2ELH A;  3AAF A;  4A0X A;  3GW2 A;  1LB2 A;  3FZV A;  2P6T A;  1RI7 A;  1W7P B;  2GA1 A;  1S29 A;  3E97 A;  5HDK A;  2JPC A;  1UHW A;  4BYY A;  4CZZ A;  1U5T B;  4Q4Z F;  4XSZ F;  1J9I A;  5BMZ A;  3BPX A;  1A04 A;  4G6Q A;  1TQM A;  2CGP A;  1O3S A;  1TBX A;  2M30 A;  2EV6 A;  2DLL A;  2NRA C;  2O8X A;  3IHU A;  4H0E A;  4KFC A;  5DYM A;  3IRR A;  1TNS A;  4O5V A;  1FBQ A;  1YW9 A;  4M9S A;  2FNP A;  4IRH A;  2F5D A;  2DU9 A;  3H92 A;  3V7R A;  1F1Z A;  2WV0 A;  4N0B A;  2NNN A;  1ZG5 A;  2EJR A;  1T98 A;  3HSF A;  1PDN C;  2HQR A;  4RAZ A;  1FBU A;  5IT9 K;  3LQR A;  3ZMS A;  2FSW A;  4UUV A;  2XRN A;  1WSU A;  3V7C A;  1HW1 A;  1K78 B;  4LG0 B;  3K2Z A;  3SZT A;  1FP1 D;  4EJV A;  1FSE A;  4JQF A;  1U5T C;  2QLZ A;  3DF8 A;  2MA3 A;  2GXB A;  1XD7 A;  4MEX F;  4WXC A;  2BBY A;  2FMY A;  2LF8 A;  4I2O A;  1XDU A;  4HLX A;  1QZZ A;  4UVB A;  4BXU A;  1R36 A;  4GXO A;  3FF5 A;  1ZYR F;  3K69 A;  2DQR A;  3DPL C;  2WC2 A;  3RKW A;  2Y75 A;  2JTV A;  3CJN A;  3WG9 A;  3WTS C;  3L7W A;  1R22 A;  2HKX A;  1W5S A;  3QAH A;  3B02 A;  4IJA A;  3HYI A;  4LMY A;  4L5J A;  1KU7 A;  5E8I A;  2EK5 A;  5FLX K;  4ETS A;  2ZFW A;  1P92 A;  5D5V B;  2BEO A;  1K79 A;  2JPB A;  1Z1D A;  2Z33 A;  3EQL F;  4UXN A;  2QVO A;  2EFO A;  1ZH5 A;  3F8F A;  2H27 A;  3I0T A;  3DFG A;  2RKH A;  1KU9 A;  2KJB A;  4KT5 C;  3EYI A;  3P9I A;  3LWF A;  2HEO A;  1U2W A;  3E5U A;  3ERE D;  3D0S A;  3I4P A;  4KN4 X;  3E3V A;  1FYL A;  4MNU A;  4HAM A;  1QNT A;  3FMS A;  2ZXJ A;  4I09 A;  2ZJ2 A;  3WOD F;  1LEB A;  1ODD A;  2PMU A;  3MQ0 A;  1XGN A;  1C0W A;  3TDU C;  3ZN1 A;  4U0V A;  5HS9 A;  1J0R A;  3KZZ A;  4IF4 A;  3GFJ A;  3TO6 A;  1T39 A;  3M7G A;  3U9G A;  3WTV C;  2O61 A;  3JW4 A;  4L9T A;  5ICE A;  5E1Z B;  2EV5 A;  2IA2 A;  2A6E F;  3L00 A;  1IF1 A;  4RB3 C;  4ZYE A;  4RB2 C;  4OIN F;  4LB6 B;  1W7P D;  4HQE A;  3QOP A;  3G73 A;  2VE9 A;  5CVJ A;  4L5I A;  3KZY A;  2QUF A;  1G6N A;  2OZU A;  2K27 A;  4EJU A;  3RKY A;  3QPT A;  4A5M A;  4BHP A;  4IPA A;  3WGG A;  1B1B A;  2PLY A;  1G3W A;  2QEN A;  2D1V A;  1R1U A;  4KMF A;  1R5H A;  5D6E A;  2CW0 F;  3TDZ C;  2H09 A;  3KP2 A;  2X0L A;  4XBF A;  5IT3 A;  2HFH A;  4YIF A;  4ZYD A;  2PBI A;  1BIB A;  1EH7 A;  5LHI A;  3RYR A;  3GUD A;  4FT8 A;  1D8J A;  4XSX F;  3BPV A;  3WGI A;  4RGU A;  1IXC A;  4IRI A;  1JHH A;  2IW5 A;  4CDG A;  3JTG A;  2V79 A;  3C1D A;  2P6S A;  2A68 F;  2MC3 A;  4YII A;  3ZMZ A;  1W5T A;  1F4K A;  3GF2 A;  1CF7 A;  3DEU A;  5J6X A;  3IC7 A;  1WQ2 A;  4A0Z A;  4U0W A;  3LST A;  3REO A;  2XAS A;  2CWE A;  2A07 F;  4RGS A;  2ZBK A;  4LJZ F;  3PFI A;  1MDM A;  1FP2 A;  4K2E A;  3MWM A;  3ZP5 A;  4A5N A;  4P9F A;  2NS0 A;  3BP8 A;  1ULY A;  3NEU A;  2OA4 A;  1W7P A;  1FYK A;  5LEK A;  3IKT A;  4I0B A;  2H6C A;  2DBB A;  4N9I A;  4MGR A;  2RC4 A;  3CDH A;  2J5P A;  3TOA A;  1H9T A;  3IKV A;  1E17 A;  4G9Y A;  1H0M A;  1HW5 A;  2JRT A;  2HS5 A;  2HGC A;  3C7J A;  3VFZ A;  2QZ8 A;  1T0F A;  3GX4 X;  3GO5 A;  1T38 A;  3HUG A;  2OZ6 A;  2EFP A;  3B73 A;  1IXS B;  1KYW A;  5L3E A;  4ESF A;  1UFM A;  1P4W A;  3FM5 A;  1MKM A;  1AOY A;  4A0Y A;  1TTY A;  2IA0 A;  3KFW X;  3N97 A;  3F3X A;  5J8C A;  2PFB A;  3HRS A;  2MLK A;  1W4M A;  2VBZ A;  2V1X A;  1G4D A;  3F8M A;  1FOK A;  3IWZ A;  5KK1 A;  5EEH A;  2ISZ A;  1BJA A;  1BC7 C;  4WX9 A;  3D5L A;  3W6J B;  2D45 A;  2WTE A;  5L3B A;  2ADU A;  2QYO A;  2KIU A;  1U3E M;  5JVT A;  2K4J A;  2XHK A;  2O6G E;  4PGG A;  4DNC A;  3I58 A;  1OYI A;  4UHT A;  4Q48 A;  2R7D A;  4EQQ A;  1ZLK A;  5ICC A;  4LK0 F;  1OR7 A;  3KP7 A;  2EFN A;  1SMT A;  5DD8 A;  4S04 A;  4KDP A;  3DV8 A;  2UXN A;  2Y48 A;  4LFU A;  1EH8 A;  2W24 A;  2XAG A;  1OYY A;  1S7O A;  3U2R A;  3LA2 A;  5CVR A;  2HZT A;  3HTS B;  3ML6 A;  5H6R A;  3N4M A;  2FQ3 A;  2Q0O A;  3F8C A;  3EET A;  1OMI A;  2VON A;  3LAP A;  1ZLJ A;  2M45 A;  2K86 A;  3EDP A;  1QQI A;  5FB2 A;  5L3D A;  2L4M A;  3GZ5 A;  2QQ9 A;  2H94 A;  4CIC A;  2MH2 A;  1B9N A;  3KLO A;  5F64 A;  3SHF A;  3FMR A;  1MD0 A;  2MD5 A;  2V9V A;  3GFM A;  1LJ9 A;  2R7F A;  4OIP F;  3O6B B;  2FML A;  2RQP A;  2Q8K A;  3F8B A;  4E70 A;  2M5W A;  3WTZ A;  4G7Z F;  3T8T A;  1R23 A;  1J2X A;  3ROU A;  1SD5 A;  1MJA A;  4RGR A;  2VC1 A;  2VC0 A;  3R60 A;  1DP7 P;  3F23 A;  1XB4 A;  1MJB A;  3RYP A;  3WTU C;  1D3Y A;  4IRG A;  3GLX A;  2UWM A;  4EJO A;  1RZ4 A;  3RJP A;  1EV7 A;  2G7U A;  4IHS A;  3ZPL A;  4U7D A;  3FHZ A;  4EVI A;  4PDK A;  1FSH A;  2VN2 A;  2RV8 A;  3GVA A;  5JI6 A;  1Z7U A;  2XV4 S;  2FEZ A;  4LG0 A;  2FU4 A;  1HKS A;  4M6X A;  3V8J A;  4KUM A;  5FGM A;  5E20 A;  1H9G A;  3ZMV A;  3MAJ A;  2J5O A;  1YTY A;  1G3S A;  2BGC A;  1LDD A;  5D6F A;  3MEX A;  5LLQ A;  1FLI A;  3WU1 B;  2W85 A;  2CQK A;  5TJJ A;  1O7F A;  1J59 A;  5A2Q Z;  4EGY A;  3CO6 C;  2P5V A;  4JK1 X;  3JAM K;  1UST A;  2UZK A;  3J81 Z;  1ZHF A;  5LGN A;  5ILU A;  2VBW A;  1FC3 A;  3ZN0 A;  4O6J A;  3IRQ A;  4P5O A;  4KNY A;  3WTX C;  4EM2 A;  4MEY F;  2TDX A;  4G7O F;  4CHU A;  4OOI A;  2DFI A;  4O3M A;  2GWR A;  5HLH A;  5ICF A;  3QU3 A;  2GIV A;  1B4A A;  5BS6 A;  3V7S A;  4WK8 F;  3R6S A;  4Q47 A;  3OV8 A;  4RB1 A;  1ZRC A;  4AVP A;  1Z9C A;  3J80 Z;  1KA8 A;  5F1R A;  4CXF A;  1HKQ A;  1UCR A;  1K7A A;  1FBS A;  1UHM A;  1XCV A;  2IA1 A;  4WXD A;  2YR2 A;  4HX7 A;  1YQA A;  1GXQ A;  2LNB A;  1QZY A;  5D4S A;  2FXA A;  1JXS A;  3BWG A;  1U8R A;  1MZB A;  3E6M A;  2L4A A;  4AIH A;  5DV5 A;  3LAJ A;  2OAZ A;  2G7H A;  4AIJ A;  3CTA A;  2QBY A;  1I6X A;  3T1B A;  5HLG A;  1KQ8 A;  1BN5 A;  2R3S A;  2XIG A;  2EA4 A;  2GA2 A;  4ZYH A;  4UVC A;  2IT0 A;  3HHG A;  4ESJ A;  3MZH A;  1FZP B;  3HOS A;  3RI4 A;  2CSO A;  3P9C A;  5LRS A;  4RB0 A;  1XSD A;  3E6D A;  3JSP A;  3GFI A;  2UXX A;  2EB7 A;  4R1H A;  1FWZ A;  5BQT A;  3CUQ C;  2Z3Y A;  2STW A;  4BNC A;  3T8R A;  1BI3 A;  1I1S A;  1D5V A;  1MJ9 A;  1WKM A;  2KKO A;  2YSR A;  2OD5 A;  4WCG A;  5AIQ A;  2H6B A;  3SQN A;  2RVC A;  2XKO A;  2XRO A;  1ZRF A;  4HZF A;  1J7K A;  2FNA A;  2V1D A;  2XAF A;  4OMZ A;  5KVR A;  3TOB A;  3ZMD A;  1PP8 F;  3ZMU A;  2E7W A;  2MBF A;  3HRT A;  4M71 A;  4U88 A;  5FFZ A;  4AIK A;  4B8X A;  2EFQ A;  2JZY A;  3VB2 A;  4BAY A;  5D5U B;  3LA7 A;  4Y13 A;  2K02 A;  4MTE A;  2DT5 A;  5D8L B;  5H20 A;  4CGZ A;  4Y15 A;  1SAX A;  1FX7 A;  2VE8 A;  1RIO H;  2CYY A;  1XSX A;  4PGH A;  3C3W A;  2G9W A;  3GEZ A;  4Q5S F;  5DCF A;  5L3F A;  1YS7 A;  2A5Y B;  4DQ2 A;  3W6K B;  4FX4 A;  5J8F A;  3EUH A;  2P7C B;  3C18 A;  1SFX A;  1YFH A;  3GXO A;  2ZME B;  3VOE A;  3M8F A;  3QU6 A;  3MFK A;  2FA5 A;  1ZAR A;  3K9T A;  3GZ6 A;  5E1W A;  3KP5 A;  5ED4 A;  4AWX B;  2VOO A;  4EJT A;  5DUI A;  4I02 A;  1MGT A;  1P6R A;  3ECH A;  1ZGA A;  4LLL A;  2E1C A;  2HTJ A;  1IRF A;  2VBY A;  1K6O A;  6PAX A;  2LSO A;  5ILS A;  1T2K A;  2Z5U A;  2HWV A;  2P5L C;  2VXZ A;  4I0A A;  3WE3 A;  1FPQ A;  3WU0 A;  4NQW A;  4YG2 F;  3J80 K;  3R4K A;  3GYH X;  2PJP A;  5H6Q A;  1ZRE A;  5EEG A;  1YS6 A;  1KQ9 A;  5K5Q A;  4HLY A;  1BBY A;  1GXP A;  3ELK A;  3QRF F;  4P96 A;  4M6Y A;  5LGT A;  2PQ8 A;  3SXY A;  3PQJ A;  2B0L A;  5IT9 Z;  2NAZ A;  5E17 F;  4EJW A;  2KIM A;  3HRU A;  4IXA A;  3E5Q A;  2F5E A;  2XUB A;  5CLS A;  3MCZ A;  2DPU A;  1LVA A;  1XGO A;  3HRM A;  4PZJ A;  3LQQ A;  1OPC A;  1G3Y A;  1KYZ A;  3RKX A;  1IN6 A;  5JFR A;  1UB9 A;  3I53 A;  3P7N A;  5E1X A;  3RIR A;  4TV7 A;  2IRF G;  1DPR A;  4XRF A;  2W84 A;  4AD9 A;  4ON0 A;  2XAH A;  4HF1 A;  1BC8 C;  1R00 A;  2F5C A;  5CVU A;  2C6Y A;  2DW4 A;  1IN4 A;  3ZMT A;  4KIG A;  2DAO A;  5E18 F;  3F21 A;  1NHA A;  3F6O A;  3L2C A;  4OIQ F;  1SFU A;  2P4W A;  3KP4 A;  5FO5 A;  5LHG A;  2HYF A;  1HST A;  5L3C A;  3DXJ F;  4ZYG A;  2DQL A;  2ZME A;  4ENK A;  1JE8 A;  2XVC A;  3BJ6 A;  3ULQ B;  3FX3 A;  5BOX A;  1MDM B;  3HHH A;  3JAM Z;  4M73 A;  1E2X A;  3ISP A;  3M8E A;  2W25 A; 
#chains in the Genus database with same CATH topology
 2A3S A;  2B9S A;  2RN7 A;  2YX4 A;  2D1H A;  2X51 A;  1BJZ A;  5AON A;  2Y31 A;  1HCR A;  5F0F A;  5HNH A;  2EA2 A;  2ZKZ A;  1R1V A;  2K3P A;  3H3Z A;  1R7J A;  2Q2E B;  1OCO H;  1UEL B;  3GLL A;  1MSE C;  2JSC A;  3LSJ A;  1IZ1 A;  3ZQC A;  4N9H A;  3AG3 H;  5FFX A;  2LY2 A;  4UY8 I;  1D8K A;  4IHT A;  2DTR A;  1HW2 A;  4A12 A;  2IS2 A;  4KIB A;  1BI0 A;  1S3J A;  2VUM J;  2CQ7 A;  4BH9 A;  2V9P A;  3IP4 B;  1B6A A;  1HQC A;  2DK5 A;  4FAS D;  3PQK A;  1P4A A;  3WTY C;  1S6L A;  1IUY A;  3DP7 A;  1DQU A;  4RS8 A;  5EG0 A;  4HW0 A;  1S72 I;  4IO9 F;  2M34 A;  3IL2 A;  3FWE A;  1KU3 A;  2NYX A;  4L9V A;  5E3O A;  1YJW I;  1VTN C;  1FY7 A;  1JUP A;  2LR8 A;  4EM1 A;  2LKX A;  1JGS A;  2LOO A;  1O7L A;  2V7F A;  1ZG1 A;  3O3K A;  3BT9 A;  3HC7 A;  4HF2 A;  2Y0M A;  1P2F A;  3RKQ A;  5L3G A;  5DM6 F;  4HOB A;  1SFO J;  4OU0 A;  1V5F A;  2EFW A;  1IN7 A;  4Z2Y A;  2LKS A;  2AO9 A;  1D5Y A;  3HSR A;  3EYY A;  5M5W J;  2M87 A;  4XNF A;  1ZN2 A;  3PNT A;  4HBL A;  4ANJ A;  3V4G A;  3HOU J;  1HSJ A;  2MH9 A;  1FNN A;  3I59 A;  1XMA A;  2VIX A;  1VQM I;  4RDU A;  3Q9V A;  2MD0 A;  2HOE A;  1REP C;  1XX5 A;  2KQR A;  2ZFU A;  1FJL A;  2YPR A;  1MMN A;  2ZNY A;  5LD2 C;  2IP2 A;  2DOF A;  2PN6 A;  2GOM A;  2BY0 A;  3BC8 A;  2LC2 A;  3QYE A;  5FLM J;  1J75 A;  2GZW A;  3GFL A;  2OUM A;  4ZDP A;  4G12 A;  2CFO A;  4YFN F;  1TT5 B;  1FYM A;  3H9Q A;  1WHU A;  2NOJ B;  1J5Y A;  2FBI A;  3C2B A;  4U0Y A;  4AM3 A;  1YO5 C;  3KIO A;  4LK1 F;  3ABT A;  3WTT C;  4Z6Y A;  2IXS A;  4BY1 J;  2OPT A;  1X1D A;  4B48 A;  3DBH B;  2XF6 A;  3JTH A;  3G2B A;  2STT A;  2KDO A;  4OAY A;  4XLP F;  1MIJ A;  3M4O J;  5K7H A;  4HRI A;  4UNO A;  3BR5 A;  2XGX A;  4B09 A;  4PJJ A;  1WI9 A;  3RTR A;  2VKV A;  5IPA A;  1JJ8 C;  2A61 A;  3K2A A;  5E8G A;  5DEQ A;  4B3A A;  1ZK8 A;  1P4X A;  4MFE A;  1U5T A;  1NK3 P;  2X4H A;  3S17 J;  3I71 A;  5FD5 A;  5K5R A;  3ABL H;  2KMU A;  2VT3 A;  4FX0 A;  3HOT A;  1JUM A;  1XTA A;  3RCO A;  2DJI A;  4HG2 A;  2KRF A;  1QO0 D;  3X2Q H;  3T0Y A;  3KEO A;  4V2G A;  2O7O A;  3HSE A;  3O2P E;  4XK4 A;  4YFK F;  3ECO A;  4GCV A;  4M72 A;  1RNL A;  3KYL A;  4YFX F;  5B5E C;  1K4T A;  1HF0 A;  5LEJ A;  4BE2 A;  3KEQ A;  5AIP A;  5A2Q K;  2PMH A;  2XAJ A;  1JKR C;  2LLK A;  4S05 A;  1TW2 A;  2VKE A;  3VOD A;  2AS5 F;  4IKF A;  3RPQ A;  3ZQ7 A;  3F72 A;  4J19 A;  4N4O B;  2HYG D;  1U8B A;  2IJL A;  3G6E I;  1XMK A;  2GAU A;  2Q2E A;  4KA4 A;  3KLN A;  4RLQ A;  1YYV A;  3GZN B;  2ZCW A;  4B47 A;  4I7H A;  1RR8 C;  3VYS B;  1KZH A;  1WPK A;  5CQG A;  1N25 A;  1Q1H A;  1WRJ A;  4ITV A;  2KRH A;  5GAG J;  2R5Z B;  1VQ5 I;  2DA2 A;  2RQQ A;  1KU2 A;  1SAU A;  3W3C A;  4MQV A;  1IAW A;  1OKR A;  1VQN I;  1XGM A;  2K9N A;  2BE5 F;  3DTI A;  2MGQ A;  4RLF A;  4MTD A;  5LGU A;  3H3V K;  3HZJ A;  3K4C A;  2JA8 J;  1U78 A;  5C4J J;  1R5G A;  3DPT A;  3L2U A;  2DMP A;  4RA2 A;  4HSR A;  2XKP A;  3S2W A;  1IW7 F;  2K4B A;  1K78 A;  3G1O A;  5K1Y A;  4QIW N;  1SD6 A;  1RUN A;  2E1O A;  3FXL A;  2R7V A;  2E36 A;  1ON1 A;  2M1B A;  2F6C A;  2M0C A;  1V4R A;  1HKT A;  3WE2 A;  1FMW A;  3TKY A;  3CZ6 A;  1RUO A;  1IV8 A;  1VND A;  2DA1 A;  4UV9 A;  2Z99 A;  3GWZ A;  2EIM H;  1UJ8 A;  3W2V A;  1MBJ A;  1STZ A;  1UMQ A;  1UZC A;  3TW7 A;  2HU9 A;  3VYU B;  1JHF A;  3S1Q J;  3OS0 A;  3CP2 A;  1ZGW A;  1TNT A;  1BR1 A;  3CQZ J;  4LGW A;  4OIR F;  5D4R A;  4GYG A;  4BQA A;  4KJZ A;  3JSO A;  3MKY B;  2BYV E;  3RPU D;  2JSP A;  3FBN B;  4B43 A;  3H5R A;  4YIR X;  1XGS A;  1O3Q A;  4MHG A;  2Z9O A;  3QPH A;  1G3T A;  3MN2 A;  2JJ7 A;  1FTT A;  2ISY A;  5DCM B;  1S8N A;  4C3J J;  1LQ1 A;  2BY1 A;  4A6E A;  4G6D A;  1FT9 A;  4A3G J;  4BEH A;  3DBR B;  3G3Z A;  2WWY A;  2LRE A;  5TRD A;  3BDD A;  4L9N A;  4WF2 A;  1YG2 A;  5HDN A;  4OIO F;  2M2E A;  3I5U A;  4Y4R A;  1T0F C;  1LDK B;  3U21 A;  2ESN A;  3Q9S A;  2OBP A;  1W5C C;  4PJ0 C;  1PVE A;  2HQA A;  1TW3 A;  1JKP C;  3KET A;  1KQ0 A;  1KGS A;  2VQC A;  3DEE A;  4FHT A;  5GPA A;  3HG9 A;  1I27 A;  2COM A;  1DDN A;  2VXD A;  2AXL A;  1W36 C;  2CV1 A;  1BM9 A;  2LDU A;  2RNJ A;  4BE1 A;  2ZJP F;  2A69 F;  3VEP A;  3S2H J;  1BI2 A;  2ZNZ A;  3S93 A;  3PL8 A;  3PO3 J;  4KIC A;  3HB9 A;  4D0P A;  4E4H A;  5HNF A;  1B8I A;  2ELJ A;  1Z6T A;  4E7Z A;  3TP0 A;  3BY6 A;  3S3M A;  3CMM A;  3M1E A;  3H1C A;  4M74 A;  1XCB A;  1R1T A;  4XKC A;  2CW7 A;  1IRG A;  4EV0 A;  3KP6 A;  4IOA F;  1ERD A;  2ZXH A;  1L0O C;  1FEX A;  4D7N A;  3QOD A;  5CYV A;  3WTW C;  3FM3 A;  4LD5 A;  1RES A;  1SMY F;  2BV6 A;  3NRV A;  5HDG A;  1QGP A;  2RGV A;  1IXR C;  1O57 A;  2HVS A;  1G59 A;  1MMA A;  4ZZD A;  1X1C A;  1PUE E;  3ZCO A;  1TQI A;  2EWN A;  2LKP A;  4B4C A;  3ONQ A;  1V5E A;  3CO7 C;  5B66 C;  1ZAO A;  2L9R A;  1H8A C;  3OR1 C;  4HF0 A;  3QP6 A;  3J7A O;  3R0J A;  4FCY A;  2Z2S B;  4KN7 X;  3JRA A;  3OYG A;  4G6T B;  4RM2 A;  1GHC A;  1Z05 A;  1DUX C;  1BW5 A;  2WBM A;  1B59 A;  3O8G A;  2B63 J;  1SD7 A;  3KCC A;  4CCL A;  5CVI A;  5BPD A;  2CO5 A;  4EGZ A;  3RQ4 A;  1OIS A;  3AG1 H;  5IOY A;  2QM3 A;  3OOP A;  2IS6 A;  2W57 A;  4Y17 A;  4XOT A;  2IGM A;  4FE4 A;  1K4S A;  4NHJ A;  5ILV A;  3FIS A;  1SEU A;  2GBY A;  2BW3 B;  4IVN A;  4RAF A;  3L9F A;  3SZP A;  2JA6 J;  1TLH B;  2YU9 J;  2KFD A;  1ETQ A;  4ZZL A;  2KJC A;  5BPI A;  2AQF A;  4A3K J;  4ENJ A;  3TGN A;  3GTM J;  3J81 K;  4FET A;  2DXI A;  3Q5F A;  2H8W A;  1SFK A;  2WAQ A;  3SYT A;  3FK6 A;  5GAH J;  2BHY A;  2R7U A;  1IGN A;  3CUQ B;  5D5W B;  1X2M A;  3O8H A;  4M9X A;  2F5F A;  3OYL A;  3JRG A;  3PO2 J;  3I9V 2;  1XS9 A;  1G8X A;  3OR2 C;  3DTK A;  4JOM A;  2PEX A;  3CDI A;  2HQN A;  3TO7 A;  5HLT A;  3QYB A;  2DO7 A;  1YIO A;  5FD6 A;  3K1P A;  4RAY A;  2PG4 A;  1IRX A;  1F43 A;  2ZXI A;  1LFB A;  3QOE A;  1XSV A;  5JR3 A;  1U6G A;  1Y1V J;  1QPM A;  1Y8Q B;  2VPL A;  3D5S C;  2CFX A;  5HLI A;  4II2 A;  2E1M B;  1X1A A;  1E3O C;  5LBQ A;  4GGG A;  1T6S A;  3AL0 B;  1CGP A;  4EM0 B;  1MH4 A;  5E3L A;  1Z91 A;  2MAB A;  1J09 A;  2Y0S N;  4ESB A;  3K4N A;  3UKG A;  4XLA A;  5D8K B;  5E3M A;  3CCE I;  1XN7 A;  4ZH4 F;  3A0H C;  3S1M J;  1ZKG A;  2XAQ A;  2DMU A;  1Y6I A;  2L01 A;  5FLX Z;  4R79 A;  4XOP A;  3BJO A;  4G8X A;  1O3T A;  1F5T A;  4KIF A;  2LF7 A;  4E7K A;  1LEA A;  3HIF A;  3CUQ A;  4M6V A;  4X6A J;  4E7H A;  4HV6 A;  3MZY A;  4YEJ A;  2QWW A;  4AYB N;  4JBA A;  3OY9 A;  1YW7 A;  4HYE A;  2OQR A;  5FKO A;  5DCM A;  2FRH A;  2O3F A;  2HZD A;  4HDV A;  3HPH A;  2HTS A;  3NWT A;  4HX8 A;  1DPU A;  1YW8 A;  2IVM A;  1ON2 A;  3K10 A;  4R8H A;  4NQW B;  4A6D A;  1A6Q A;  2HNH A;  3EUH C;  4G94 A;  3RDI A;  1Z0X A;  2QBY B;  1IG7 A;  2DK8 A;  1IN5 A;  4OAZ A;  1HOM A;  5ERI A;  1TQP A;  2BY2 A;  5HOO A;  3M07 A;  3JRC A;  4ZTJ A;  4IQ4 A;  3U1D A;  4UB8 C;  2ACJ A;  5F0C A;  3AKZ A;  2PI0 A;  2L7M P;  2R7Z J;  2WB1 N;  3S32 A;  2QA4 I;  1Z6R A;  2D2W A;  3I59 B;  4WWC A;  1S9H A;  4WXH A;  3R0A A;  4L9J A;  4GFB A;  3FXU A;  4L0Y B;  3LSH A;  3L1P A;  3CCV I;  1TP4 A;  3K70 D;  1X4O A;  1LE8 A;  5H2F C;  3TO9 A;  1R4N B;  2DYS H;  2HDC A;  2QEX I;  4HDU A;  3KP3 A;  2EV0 A;  2GQQ A;  2E1M C;  3OYK A;  4ZC3 A;  3HKZ N;  3COA C;  3AL0 C;  4F52 A;  4PCQ A;  1F36 A;  2FOK A;  4G7H F;  3OOU A;  1PUF B;  3M3Y J;  3OYF A;  4CO8 A;  3V8K A;  3FXQ A;  3H35 A;  1HDP A;  1S7A A;  3LFK A;  2MLG A;  5LRR A;  3AFH A;  1ETY A;  3K1N A;  5FKL A;  3I64 A;  2M8E A;  2EZH A;  4XLN F;  5CJ9 A;  3K70 C;  1T95 A;  1OCP A;  2DFF A;  4Y7N J;  2ZO4 A;  3GTJ J;  1ETV A;  2X1E A;  3HKZ A;  1LDJ A;  2F4I A;  4OMY A;  3BTC A;  4UV8 A;  2YU3 A;  2KL4 A;  3A03 A;  1V3F A;  1R4M B;  2IPQ X;  2L02 A;  2QQA A;  3CLO A;  3H0G J;  5HS8 A;  2YS9 A;  3LA3 A;  4LLN A;  3DKW A;  3K0L A;  3H3U A;  1NK2 P;  2KZG A;  3DQV C;  1GVJ A;  3OYJ A;  1ONV A;  1M1E B;  4IHY A;  2FBH A;  2F2E A;  1R58 A;  3GTO J;  1CF7 B;  1PP7 U;  1TWG J;  2D5V A;  1EJ9 A;  2WAE A;  3OL4 A;  1P7I A;  3E5X A;  3QP5 A;  2E7X A;  2KHM A;  1Z67 A;  2K7L A;  3J7Z I;  2O03 A;  1ZQ3 P;  3H9G A;  3KPH A;  2DPD A;  1YLF A;  3F8N A;  3G1L A;  4CUG A;  1SFE A;  4GYI A;  4F92 B;  2GXG A;  4QWQ A;  2DJN A;  2HYJ A;  3FXR A;  4ENN A;  2KIF A;  2OV7 A;  3L09 A;  3RPU A;  2P5K A;  4KYW A;  4MLO A;  1BOA A;  5GTI C;  4P9U A;  5DDG A;  4CYD A;  3FMQ A;  3P5J A;  4V2F A;  1R9T J;  2VT2 A;  5C44 J;  2E1N A;  2DI3 A;  2F4O B;  2W1O A;  2E5Z A;  2VOP A;  3CDL A;  5F6F A;  2OQG A;  1D1C A;  3DPU A;  2M4K A;  1IN8 A;  2HR3 A;  2LY1 A;  1X3U A;  1SAN A;  3SDB A;  2L9S A;  1WJE A;  1EH6 A;  2NNY A;  4LB5 A;  1F9N A;  1PYV A;  2HKO A;  2YX7 A;  4MQ9 F;  1VQ9 I;  1GLN A;  9ANT A;  3K4K A;  2KIS A;  3CC7 I;  2EH3 A;  5D5X B;  1X19 A;  4BJ5 C;  4ENM A;  2L3D A;  1AWC A;  1XDS A;  1MSF C;  3CUO A;  3P9K A;  3KE2 A;  3Q3S A;  2FF4 A;  2V9K A;  3Q0U A;  3HGY A;  3T5X A;  4F7Z A;  4U7B A;  3CCM I;  3E6B A;  3SFI A;  1O3R A;  2DCE A;  3K1M A;  4DJA A;  4XR6 A;  3CMA I;  1LNW A;  1ZGJ A;  2OU2 A;  3BOQ A;  3TQN A;  4L0Z B;  1YHQ I;  1HBX G;  3BCB A;  2FBK A;  1B9M A;  2L5Q A;  1HLV A;  2A6H F;  1QBJ A;  1ETW A;  2P8T A;  2V1U A;  3SEZ A;  2CMP A;  2QQB A;  1XPX A;  1ZEL A;  2HDW A;  3JCU C;  1TC3 C;  4A2U A;  1IV6 A;  5F27 A;  2JVG A;  2ESH A;  2FE3 A;  3K7A J;  2RDP A;  3MD2 A;  5K5O A;  3HOV J;  3JR9 A;  4DBQ A;  4RGX A;  5ICG A;  3M9A A;  3OYN A;  1VQP I;  4NB5 A;  4FE7 A;  4HV5 A;  3JRF A;  1Y56 A;  1TWA J;  4PK4 A;  1I5Z A;  3GTP J;  5HVQ C;  4UVA A;  4DIQ A;  3BJA A;  4A69 C;  4AU7 A;  2R0Q C;  3F22 A;  3ABU A;  2ME6 A;  1OCZ H;  2L54 A;  2MG4 A;  3DKY A;  4AC0 A;  1IDZ A;  2O0Y A;  3BRO A;  4KMU X;  4XN3 A;  1I1G A;  3TP3 A;  1WWX A;  3DBL B;  4BJ6 C;  3NQO A;  5EG0 B;  2R7T A;  1YX3 A;  4GO1 A;  4I01 A;  3TBI A;  1B8I B;  3BZ6 A;  4P55 A;  2R92 J;  3V8L A;  2EBI A;  5CVV A;  3WGH A;  4D5F A;  3E6C C;  4QLC U;  3F6V A;  5HS7 A;  3HTU A;  4M9Z A;  1BIA A;  1BI1 A;  2VBX A;  1OQY A;  5E3N A;  4JX4 A;  2VOD A;  3DTE A;  1VI0 A;  2P7V B;  3MZ8 A;  4X0G A;  5DD4 A;  1HC8 A;  3R61 A;  4UUS B;  2BY3 A;  1Y0U A;  4HA8 A;  4EMS A;  2E71 A;  1ZG3 A;  3SFZ A;  5LHH A;  1L3L A;  1OYW A;  2OC6 A;  2CG4 A;  4ASN A;  4L18 B;  1ZRD A;  4HST A;  4BHB A;  3I54 A;  2V6C A;  5IP9 J;  3OYI A;  4XON A;  1DGR M;  3K6G A;  1VQ8 I;  2XPU A;  3IWF A;  1BOB A;  1ORK A;  2DDB A;  4HQM A;  1DU6 A;  2JT1 A;  2R4G A;  5JHU A;  2BXZ A;  2JQ7 A;  2E2H J;  1HXD A;  4I98 B;  4D5C A;  4HX4 A;  2KRC A;  3HEF A;  1SD4 A;  3WHB A;  2JWT A;  4BHC A;  4D9J A;  4LLG F;  2ETH A;  1EA3 A;  1X2N A;  3W2W A;  5DUK A;  1USS A;  2ELH A;  4D1Q A;  4Y3O A;  1GT0 C;  3AAF A;  4A0X A;  2K9S A;  3GW2 A;  1LB2 A;  2R7X A;  3FZV A;  2P6T A;  1LPQ A;  1RI7 A;  1W7P B;  2JMW A;  3CCS I;  2GA1 A;  1S29 A;  3E97 A;  2FX0 A;  2WAF A;  2F4M B;  5HDK A;  1RET A;  1MBH A;  2KIQ A;  2VJI A;  2JPC A;  2MW8 A;  1UHW A;  4BYY A;  4CZZ A;  1U5T B;  2CW8 A;  1X58 A;  1I39 A;  4Q4Z F;  3B6A A;  1QU3 A;  2IBD A;  2M0M A;  2LBF B;  4XSZ F;  1J9I A;  5BMZ A;  1B72 B;  3BG7 A;  3BPX A;  1A04 A;  4EAT A;  3CCL I;  4G6Q A;  1TQM A;  2CGP A;  5EGO A;  4A3I J;  1I6H J;  2P81 A;  2VKH A;  1O3S A;  1V5G A;  1TBX A;  2HI3 A;  5JHF A;  2M30 A;  2NVY J;  4M3G A;  1IUF A;  2EV6 A;  2DLL A;  4BDY A;  2NRA C;  2EZK A;  5EF6 A;  2O8X A;  3Q0W A;  2CQX A;  2DA3 A;  5KNL A;  3OYE A;  3IHU A;  4H0E A;  1GV2 A;  5DYM A;  3IRR A;  4KFC A;  3ASO H;  1TNS A;  2R5Z A;  4XMY A;  2L7F P;  4O5V A;  1FBQ A;  3LSK A;  3CF2 A;  1YW9 A;  3DWL E;  4M9S A;  2FNP A;  4IRH A;  2F5D A;  2DU9 A;  1ITY A;  3H92 A;  3V7R A;  1F1Z A;  4GDF A;  3CJQ B;  2WV0 A;  4A3C J;  4N0B A;  2NNN A;  1ZG5 A;  2EJR A;  1T98 A;  2CS3 A;  5GTH C;  3HSF A;  1PDN C;  2HQR A;  4RAZ A;  1FBU A;  5IT9 K;  2JK3 A;  3LQR A;  2M3A A;  2WA0 A;  2L7Z A;  3CCY A;  3ZMS A;  3HOY J;  1R6R A;  3LOC A;  2ELK A;  2FSW A;  3HJE A;  5C3E J;  4UUV A;  2VB6 A;  1B72 A;  2IGO A;  2R7S A;  3OMY A;  2XRN A;  4XID A;  3IV5 A;  1UAA A;  1WSU A;  5CPR B;  3ZR8 X;  3V7C A;  3BLY A;  1X1B A;  3BTI A;  4XLH A;  5IY5 H;  2ZJR F;  1HW1 A;  1K78 B;  4LG0 B;  5GP9 A;  3K2Z A;  3SZT A;  1WI3 A;  1FP1 D;  2VI6 A;  4EJV A;  1FSE A;  1AU7 A;  4JQF A;  1SVL A;  1U5T C;  1LE8 B;  1LUJ B;  5KAF C;  1WJA A;  3TL4 X;  3CES A;  2A05 A;  1ACI A;  3FBI B;  2QLZ A;  3DF8 A;  1QVU A;  2KP6 A;  2MA3 A;  2GXB A;  1XD7 A;  3NWS A;  4WXC A;  2BBY A;  4MEX F;  2FMY A;  2LF8 A;  5GAD J;  4I2O A;  2KDZ A;  1XDU A;  1JTX A;  2BOL A;  1OJL A;  4HLX A;  1QZZ A;  4UVB A;  3SEQ A;  2LY9 A;  3HOW J;  1T56 A;  4NUB A;  4BXU A;  3JRI A;  1R49 A;  1QHG A;  1R36 A;  2K9M A;  4GXO A;  2HOT A;  3FF5 A;  1ZYR F;  2W4S A;  4A3D J;  4M3E A;  3K69 A;  2DOA A;  2DQR A;  3DPL C;  2WC2 A;  3RKW A;  2Y75 A;  3LSI A;  2JTV A;  3CJN A;  3WG9 A;  2XGD A;  1JKO C;  4XLF A;  3WTS C;  3CF5 F;  3L7W A;  1R22 A;  2HKX A;  1W5S A;  3QAH A;  3B02 A;  2K3F A;  3ASN H;  3HYI A;  4IJA A;  4LMY A;  4L5J A;  5FKN A;  1KU7 A;  3BCA A;  3PSF A;  5E8I A;  2EK5 A;  5FLX K;  1WJB A;  4ETS A;  2OCC H;  2ZFW A;  5M5Y J;  1P92 A;  3F9K A;  2K5C A;  2NXN B;  2M7B A;  3FXO A;  2NVU B;  4HNV A;  5D5V B;  1Z7L A;  2CU7 A;  2BEO A;  2LTP A;  1WFX A;  1K79 A;  1WZ2 A;  2JPB A;  1Z1D A;  2Z33 A;  4PFP A;  3EQL F;  4UXN A;  3OYC A;  2QVO A;  2EFO A;  3GME A;  3ZGK A;  4ABZ A;  1ZH5 A;  4XRS A;  3F8F A;  4LG3 A;  4RMN A;  2JA5 J;  2H27 A;  3I0T A;  4DGW B;  3DFG A;  2TRT A;  2RKH A;  1H89 C;  3GTG J;  3H0D A;  2M4G A;  1KU9 A;  3I56 I;  2FQ4 A;  2KJB A;  2HPI A;  2Y30 A;  4KT5 C;  3EYI A;  3P9I A;  5E79 C;  1YJN I;  3L2V A;  1ZTR A;  2X6Y A;  1VQO I;  2X1C A;  2XSD C;  3S2D J;  2CQN A;  2N8G A;  1X3W B;  3LWF A;  2AXT C;  2HEO A;  1U2W A;  2XC7 A;  3E5U A;  3HDD A;  2BHZ A;  5IYB J;  1MBG A;  3U1K A;  3BR2 A;  3ERE D;  5C4X J;  4CCK A;  3D0S A;  2R93 J;  1NG6 A;  5M3M J;  3VYR B;  3I4P A;  5EYR A;  3MVP A;  4KT6 A;  2X6O A;  2JVH A;  3CP8 A;  2RAE A;  4KN4 X;  3E3V A;  1FYL A;  3A01 A;  4HNT A;  4MNU A;  4HAM A;  4MO7 A;  3IH4 A;  4LIV A;  5KCM A;  4CCJ A;  4Y52 J;  1Z3X A;  1QNT A;  1Y39 A;  3FMS A;  1MNM C;  2ZXJ A;  4C3H J;  4I09 A;  2R5Y A;  2ZJ2 A;  3WOD F;  1LEB A;  1ODD A;  2PMU A;  2BW3 A;  2K9L A;  3DKX A;  1GUU A;  3MQ0 A;  2Y69 H;  4I76 A;  4BXF A;  1YE9 A;  1XGN A;  4IEJ A;  3TDU C;  4CSW A;  1C0W A;  4BUP A;  3ZN1 A;  1JKQ C;  4MFD A;  4PJN A;  4U0V A;  5HS9 A;  1AHD P;  1J0R A;  3KZZ A;  4IF4 A;  4XQF A;  1Z3Y A;  3BR1 A;  3GFJ A;  4C3I J;  3TO6 A;  1T39 A;  3OYH A;  1FOX A;  2ID3 A;  3M7G A;  3U9G A;  3WTV C;  2AHQ A;  3JW4 A;  4L9T A;  2HXO A;  4NBQ A;  2O61 A;  4A3L J;  5ICE A;  5E1Z B;  1OCC H;  2EV5 A;  2Z16 A;  3BG5 A;  1LFU P;  2IA2 A;  2A6E F;  1WJF A;  3L00 A;  1IF1 A;  4E6K G;  3PJR A;  4RB3 C;  4ZYE A;  4RB2 C;  2W82 A;  4OIN F;  4LB6 B;  2GXA A;  1W7P D;  4KIS A;  2PJR A;  2XAU A;  3OIQ A;  5EZH A;  4HQE A;  2X9D A;  3QOP A;  3G73 A;  3BZK A;  2VE9 A;  5CVJ A;  3IH3 A;  1APL C;  4L5I A;  2OCE A;  3KZY A;  2QUF A;  2FUG 2;  1G6N A;  2OZU A;  2K27 A;  4EJU A;  3RKY A;  4IHV A;  3QPT A;  4A5M A;  4BHP A;  4IPA A;  3WGG A;  2JRM A;  2VQG A;  1B1B A;  2LVS A;  4BQN A;  2PLY A;  4LIT A;  2DA5 A;  1G3W A;  2QEN A;  5GAE J;  2R7W A;  2NS7 A;  2QSG X;  2D1V A;  1R1U A;  3LSR A;  1PJR A;  5J1Y A;  4KMF A;  4F3Q A;  1R5H A;  2DOE A;  5IOZ A;  3RQI A;  4BKX A;  2WB1 A;  5D6E A;  1YOV B;  5DS9 A;  2CW0 F;  2VAS A;  2H09 A;  3TDZ C;  4IZZ A;  1TT0 A;  3CD6 I;  1X3Z B;  3KP2 A;  2NVX J;  1S5L C;  2X0L A;  4BJT A;  4XBF A;  5IT3 A;  3S15 J;  3HM5 A;  1YIJ I;  2EPF A;  2HFH A;  4YIF A;  3VWB A;  4XOR A;  4PFO A;  2PBI A;  4ZYD A;  2IS1 A;  1BIB A;  2LG4 A;  2Z1D A;  1EH7 A;  1RR7 A;  5LHI A;  3MKW B;  2BVL A;  1UHS A;  1AKH A;  3RYR A;  3GUD A;  3ABM H;  4FT8 A;  1D8J A;  1Y1W J;  4XSX F;  3BPV A;  3WGI A;  4RGU A;  1IXC A;  2KT0 A;  3CCU I;  4IRI A;  4YEL A;  1JHH A;  1V54 H;  3H5A A;  2IW5 A;  4CDG A;  4BAC A;  2NOG A;  2UV1 A;  3JTG A;  2HDD A;  3OYB A;  5JLX A;  2WAD A;  2V79 A;  3C1D A;  1GVD A;  2P6S A;  2A68 F;  4NC6 A;  2DFE A;  2MC3 A;  3A2K A;  4YII A;  4AID A;  5FRN A;  3ZMZ A;  4RM3 A;  2WY7 Q;  1W5T A;  1F4K A;  2L7K A;  1YRN B;  2LFB A;  4I99 C;  3GF2 A;  1CF7 A;  1QPI A;  2FOW A;  2E5N A;  2UUZ A;  3DEU A;  4BEH B;  4B44 A;  5J6X A;  2LYC A;  1WQ2 A;  3IC7 A;  4A0Z A;  5EDN A;  4U0W A;  1TL8 A;  4IL6 C;  3LST A;  2E2I J;  3REO A;  1MH3 A;  1MBE A;  4J01 A;  2XAS A;  2CWE A;  1E3H A;  2A07 F;  1MNE A;  1BR2 A;  3M8J A;  4RGS A;  2ZBK A;  4LJZ F;  3PFI A;  1MDM A;  1FP2 A;  4K2E A;  3MWM A;  3ZP5 A;  4A5N A;  4P9F A;  2ECB A;  3OS1 A;  2JA2 A;  2NS0 A;  2MYS A;  3BP8 A;  5KHD A;  1ULY A;  2BVM A;  3NEU A;  2OA4 A;  5FKK A;  2V6E A;  4A3B J;  1MMG A;  1W7P A;  1FYK A;  3A01 B;  5EGO B;  5LEK A;  1TWF J;  3IKT A;  4I0B A;  3LSP A;  1ETK A;  2QF7 A;  2H6C A;  2DBB A;  3E7L A;  3GTQ J;  4D7M A;  4N9I A;  4MGR A;  3UNG C;  4X1E A;  2RC4 A;  1T8I A;  3CDH A;  2E34 A;  3IUO A;  2J5P A;  3FIW A;  3H36 A;  4RBO A;  3TOA A;  1FOW A;  3ZQL A;  1E0E A;  1D1B A;  3OWT A;  1U9O A;  3DU6 A;  1H9T A;  3IKV A;  1E17 A;  3FHN A;  4G9Y A;  3VYT B;  1RRJ A;  1H0M A;  2ZSH B;  1HW5 A;  5TGT A;  3S3O A;  2JRT A;  2HS5 A;  2HGC A;  3C7J A;  1OCT C;  4KIT B;  4PUS A;  2CH0 A;  3IH2 A;  3IAS 2;  3VFZ A;  2QZ8 A;  1T0F A;  1JTY A;  3GX4 X;  4HEA 2;  3GO5 A;  2BXY A;  3LL7 A;  1T38 A;  3OL3 A;  2YUS A;  3HBL A;  3K4M A;  1FIP A;  3FXJ A;  4ZYA A;  4NC8 A;  3FKI J;  3HUG A;  3HPG A;  4PJL A;  2OZ6 A;  4ZDL A;  2EFP A;  3HOZ J;  2ME0 A;  3B73 A;  1IXS B;  4AYB A;  1KYW A;  5L3E A;  3BTJ A;  4ESF A;  1UFM A;  1MBF A;  3ZQI A;  2ZSI B;  1VQ7 I;  1CQT A;  1TWC J;  5K7Z A;  1GDT A;  1P4W A;  2R7O A;  4PJM A;  3FM5 A;  1MKM A;  1AOY A;  3PUB A;  3ESW B;  2B7E A;  1RKW A;  4A0Y A;  1TTY A;  2DT6 A;  2IA0 A;  3KFW X;  3N97 A;  3F3X A;  4XKW A;  3PSI A;  2PFB A;  5J8C A;  3HRS A;  2O5R A;  3OSF A;  2DYR H;  3K4L A;  2EZL A;  3CJT B;  2MLK A;  1W4M A;  3E1S A;  2VBZ A;  2H1L A;  2MC4 A;  2V4J C;  2V1X A;  4AUX A;  4BU2 A;  3H9J A;  2XDV A;  4A93 J;  3TW6 A;  1G4D A;  4QPQ A;  4C2U A;  3F8M A;  1FOK A;  2XF7 A;  3IWZ A;  5KK1 A;  5EEH A;  3JRH A;  1K61 A;  2ISZ A;  1BJA A;  4JYK A;  1BC7 C;  4WX9 A;  3D5L A;  3W6J B;  2WY8 Q;  2CUJ A;  2D45 A;  2WTE A;  5L3B A;  2DA7 A;  3I4N J;  2HXI A;  4UB6 C;  2GM4 A;  2ADU A;  2QYO A;  1ZR4 A;  3J7A Y;  2KIU A;  1U3E M;  5JVT A;  2XHK A;  2K4J A;  1S7E A;  4A3E J;  2O6G E;  2CUZ A;  1MW7 A;  1BA5 A;  4PGG A;  1FIA A;  2CJJ A;  3EUK L;  4DNC A;  2A6T A;  3I58 A;  1MND A;  2VQL A;  1OYI A;  4UHT A;  4PSX A;  2R7D A;  4Q48 A;  4EQQ A;  1ZLK A;  1YIT I;  5ICC A;  4LK0 F;  1OR7 A;  2F5V A;  2M7A A;  4IX7 A;  3KP7 A;  1A5J A;  2EFN A;  1R5I D;  2E2J J;  1SMT A;  2QKM B;  4F91 B;  5DD8 A;  2A5W A;  4S04 A;  3QPL A;  4KDP A;  3DV8 A;  2UXN A;  1YX5 A;  2Y48 A;  2W00 A;  4XLC A;  2HVR A;  4IOC F;  4LFU A;  1EH8 A;  3LMM A;  4FTH A;  1W1W E;  2W24 A;  4QTR A;  2R7Q A;  2XAG A;  1OYY A;  4XRS G;  5DM7 F;  1S7O A;  3U2R A;  1D0Z A;  3LA2 A;  5CVR A;  2HZT A;  2MSY A;  1YJ9 I;  3RSN A;  3HTS B;  3ML6 A;  5H6R A;  2NS8 A;  3N4M A;  2FQ3 A;  2Q0O A;  3I4M J;  3F8C A;  3OIO A;  3EET A;  1OMI A;  2LBF A;  2VON A;  2RRE A;  3LAP A;  1ZLJ A;  1X1P A;  5JVG F;  2M45 A;  1OLT A;  2K86 A;  3EDP A;  2K85 A;  4BDZ A;  4V19 K;  5EJC A;  2KZV A;  3S16 J;  1QQI A;  2XGC A;  5FB2 A;  5L3D A;  2XB5 A;  2R5Y B;  5FRO A;  2L4M A;  1D1A A;  2H8R A;  3GZ5 A;  2QQ9 A;  5EEA A;  2H1K A;  3BG3 A;  1WJ5 A;  2QGU A;  2H94 A;  4CIC A;  3DLL F;  1T08 B;  1D0X A;  5FLV A;  2MH2 A;  1B9N A;  2G0E A;  4XM3 A;  3ZQF A;  1WH5 A;  3KLO A;  5F64 A;  3SHF A;  2Y9Z A;  2E60 A;  3FMR A;  4W97 A;  4IHW A;  1LKX A;  2CQQ A;  4B3X A;  2HOA A;  1MD0 A;  2MD5 A;  2V9V A;  2Y9Y A;  3GFM A;  1LJ9 A;  2EZI A;  3SZG A;  2LMD A;  2R7F A;  2JA7 J;  4CH7 A;  3I55 I;  4PSW A;  2IEK A;  1Z77 A;  2KPM A;  4OIP F;  3O6B B;  2FML A;  2CUE A;  2RQP A;  2Q8K A;  3F8B A;  5IYD J;  4E70 A;  2M5W A;  2V1N A;  3WTZ A;  2DDA A;  1GV5 A;  1Q1V A;  5IP6 A;  4E7J A;  4G7Z F;  3T8T A;  1XC5 A;  4NDL A;  1G2H A;  4F93 B;  1R23 A;  2QCO A;  2PX9 A;  1J2X A;  3ROU A;  3OYM A;  4ZTF A;  2GLO A;  1SD5 A;  1MJA A;  4RGR A;  2VLA A;  3TMO A;  4LOC A;  4NC7 A;  1U0J A;  2VC1 A;  3A0B C;  4DZJ A;  3ABK H;  2VC0 A;  3R60 A;  4DOZ A;  1DP7 P;  3F23 A;  2DT7 B;  5FJ8 J;  1WH7 A;  1XB4 A;  2I8D A;  1MJB A;  3RYP A;  3WTU C;  3HXL A;  3KX2 A;  1D3Y A;  4IRG A;  3GLX A;  1A35 A;  3JRD A;  3KYD B;  1VZ0 A;  1AA7 A;  4EJO A;  4QPO A;  4C30 A;  2UWM A;  1RZ4 A;  4OWR B;  3RJP A;  4A3M J;  1EV7 A;  1SVO A;  2G7U A;  4IHS A;  2ZXW H;  3G1M A;  3ZPL A;  4U7D A;  3FHZ A;  1R71 A;  4EVI A;  4PDK A;  1FSH A;  5F08 A;  3DU5 A;  5FKM A;  2VN2 A;  1WCM J;  3PUF A;  2RV8 A;  1WGX A;  3GVA A;  5JI6 A;  1Z7U A;  3WHC A;  3CMY A;  1OFC X;  3F0C A;  2XV4 S;  2FEZ A;  3B6C A;  2DA4 A;  5IYC J;  1ETX A;  3C2G A;  4LG0 A;  1ETO A;  1POG A;  2FU4 A;  3TED A;  1HKS A;  1EKE A;  4M6X A;  3V8J A;  3GCM A;  1V55 H;  4KUM A;  5E20 A;  5FGM A;  1H9G A;  3DCF A;  3N05 A;  3ZMV A;  3MAJ A;  3RZD J;  2FJ1 A;  5B3S H;  4M3D A;  1QA6 A;  1XG1 A;  4F55 A;  1E3P A;  2J5O A;  3L2Q A;  3AG4 H;  3DEW A;  1YTY A;  3BR3 A;  1G3S A;  2BGC A;  3ZOB A;  2O8K A;  1LDD A;  5D6F A;  1IRZ A;  3MEX A;  5LLQ A;  1I3Q J;  1FLI A;  1MMS A;  4P1W A;  3WU1 B;  3AG2 H;  5FRM A;  3CC2 I;  2DMQ A;  2W85 A;  2CQK A;  5TJJ A;  4HNU A;  1N77 A;  3ERM A;  1O7F A;  1J59 A;  5F1J A;  5A2Q Z;  4EGY A;  1JUS A;  1EF4 A;  3CO6 C;  2P5V A;  2CRG A;  2DA6 A;  4JK1 X;  5DTD A;  3JAM K;  1YI2 I;  2I10 A;  4BBS J;  2AQE A;  1UST A;  2EIN H;  3D1N I;  4Y33 A;  4CYC A;  2UZK A;  3J81 Z;  1ZHF A;  5LGN A;  4XN0 A;  2QSH X;  2Q1Z B;  5ILU A;  1W0T A;  2VBW A;  3FXK A;  1FC3 A;  2TCT A;  3ZN0 A;  4O6J A;  3VSL A;  3IRQ A;  4P5O A;  4KNY A;  3G71 I;  3WTX C;  4EM2 A;  2L9N A;  4UUT A;  5GPC A;  4MEY F;  4JP0 A;  3JRB A;  3ZRG A;  1RC9 A;  4DW6 A;  2TDX A;  5M5X J;  3VDX A;  4CHU A;  4G7O F;  4OOI A;  2DFI A;  4O3M A;  2GWR A;  1I3A A;  5ICF A;  3BG9 A;  3QU3 A;  3I3L A;  3ZQQ A;  2QQ8 A;  5HLH A;  1UG0 A;  2DFH A;  3KEY A;  2OJE D;  2DMT A;  2GIV A;  2GOX B;  3QQA A;  1B4A A;  5BS6 A;  3V7S A;  2O9L A;  4WK8 F;  3R6S A;  4Q47 A;  3OV8 A;  3EUA A;  4RB1 A;  3BZC A;  4E7L A;  1ZRC A;  2XGE A;  4AVP A;  5HOD A;  2VL8 A;  1Z9C A;  3WG7 H;  3J80 Z;  3A4C A;  2HQ5 A;  2EIJ H;  1KA8 A;  4YRV A;  5F1R A;  1VQK I;  4IQJ A;  4CXF A;  1UCR A;  1HKQ A;  2ICW G;  4FQG A;  1FBS A;  1UHM A;  1XCV A;  1K7A A;  1FMV A;  1SVM A;  2IA1 A;  4WXD A;  2LD5 A;  2YR2 A;  4HX7 A;  2JUG A;  1VQ6 I;  4NNJ A;  1YQA A;  2WAQ N;  1TZL A;  1GXQ A;  2LNB A;  1QZY A;  5D4S A;  3LFU A;  2FXA A;  3BR0 A;  3BWG A;  1JXS A;  1U8R A;  4U87 A;  3S8P A;  2V26 A;  3FXM A;  4M3F A;  1MZB A;  3E6M A;  2PMZ A;  2L4A A;  2HVQ A;  3IAM 2;  4AIH A;  1Z21 A;  5DV5 A;  3LAJ A;  3S1R J;  2OAZ A;  3OSG A;  2G7H A;  2ZB9 A;  4DYQ A;  1NTC A;  4AIJ A;  3CTA A;  2XRL A;  2DMN A;  3CC4 I;  2QBY A;  1I6X A;  3T1B A;  5HLG A;  3LNQ A;  1KQ8 A;  5M3F J;  3W6V A;  3JRE A;  2ECC A;  4BS9 A;  2I5U A;  4QSH A;  3E0J B;  5LFA A;  2NVQ J;  1BN5 A;  2R3S A;  2Y0S A;  2XIG A;  2K40 A;  2EA4 A;  4E7S A;  2X48 A;  1X4P A;  2GA2 A;  4ZYH A;  1W36 D;  2XB0 X;  4UVC A;  2IT0 A;  3HHG A;  4ESJ A;  1VF9 A;  3LSM A;  3H5N A;  3MZH A;  1FZP B;  3HOS A;  3RI4 A;  1I50 J;  1P9Q C;  2MFZ A;  2R7R A;  5K7F A;  2CSO A;  3P9C A;  5LRS A;  3BTL A;  4JX6 A;  3K4B A;  1PUF A;  2OTJ I;  4RB0 A;  2VJ4 A;  1XSD A;  3E6D A;  3JSP A;  3GFI A;  2PJR B;  2FD5 A;  3J7Y J;  1UG2 A;  2UXX A;  2EB7 A;  4R1H A;  1FWZ A;  1U9N A;  3D5R C;  5BQT A;  3HOX J;  3CUQ C;  2Z3Y A;  3NAR A;  2Y2Z A;  4B1R A;  1H88 C;  2STW A;  4BNC A;  3T8R A;  1BI3 A;  1I1S A;  3QWL A;  3Q0V A;  1D5V A;  5IP7 J;  1MJ9 A;  3K4J A;  1WKM A;  2KKO A;  2YSR A;  2IGN A;  2OD5 A;  2VPR A;  3BG6 A;  4CCM A;  4C2M J;  3PM1 A;  4WCG A;  3OYD A;  5AIQ A;  4E7I A;  2XPW A;  2H6B A;  2HPM A;  3SQN A;  2ID6 A;  4W1U A;  2F48 A;  1WVR A;  2ZME C;  2IGK A;  2RVC A;  2XKO A;  2CUF A;  3CLQ A;  2X1D A;  2XRO A;  1ZRF A;  2OTL I;  4HZF A;  1JI8 A;  4BGD A;  1DP3 A;  1J7K A;  1FOY A;  1BR4 A;  2FNA A;  2DN0 A;  1K83 J;  2V1D A;  2XAF A;  4A3F J;  3S14 J;  3M1C A;  4OMZ A;  5KVR A;  3TOB A;  3ZMD A;  5J4Y A;  1PP8 F;  3ZMU A;  3ZQH A;  2E7W A;  4S0H B;  1FTZ A;  4AVZ A;  2MBF A;  2IAI A;  3HRT A;  3W2A A;  2X85 A;  2OF7 A;  4XIC A;  3PNY A;  4XKV A;  4DYC A;  1JGG A;  2NVT J;  4XLE A;  1DU0 A;  4M71 A;  1N75 A;  3QYF A;  4U88 A;  5FFZ A;  3OIP A;  3MKL A;  4AIK A;  1TWH J;  4B8X A;  2K9Q A;  4GRI A;  2EFQ A;  2LP0 A;  4J00 A;  1P7J A;  3CCR I;  2JZY A;  3VB2 A;  3VSK A;  4BAY A;  2X6W A;  2KLO A;  5D5U B;  5B1B H;  3LA7 A;  4Y13 A;  2K02 A;  5TIS C;  4MTE A;  2E19 A;  2DT5 A;  5D8L B;  1QVT A;  5H20 A;  2VJJ A;  4CGZ A;  4IHX A;  2HOS A;  4Y15 A;  3UR3 C;  1SAX A;  1FX7 A;  2VE8 A;  4CCN A;  1RIO H;  2CYY A;  1XSX A;  4M3B A;  4PGH A;  3C3W A;  2G9W A;  3GEZ A;  2BZT A;  4Q5S F;  5DCF A;  2PMZ N;  1QZE A;  1YS7 A;  5L3F A;  2A5Y B;  2XF5 A;  4DQ2 A;  3W6K B;  2EIK H;  3BQY A;  4XRM A;  1NH3 A;  2M9H A;  4FX4 A;  4BL0 B;  2W7N A;  1JJ6 C;  5J8F A;  3EUH A;  2P7C B;  4A3J J;  3C18 A;  1SFX A;  1OCR H;  1YFH A;  3GXO A;  3HUG B;  2ZME B;  3VOE A;  3KYC B;  1VQ4 I;  2QKL B;  2L2O A;  4C2T A;  3FDY A;  4L5E A;  1OR7 C;  1JT0 A;  4DBR A;  3M8F A;  3QU6 A;  3MFK A;  2DOD A;  2EQR A;  1A6I A;  1ZAR A;  2FA5 A;  3A1Y A;  3K9T A;  3V42 A;  5E1W A;  4CCO A;  3GZ6 A;  3PIP F;  2QSF X;  1IDY A;  3KP5 A;  1WJC A;  2P0W A;  2XSJ C;  4AWX B;  5ED4 A;  2VOO A;  2VKD A;  1Y0N A;  4EJT A;  5DUI A;  3GTL J;  4I02 A;  2EIL H;  1MGT A;  1P6R A;  1LVK A;  3ECH A;  4CA0 A;  5B1A H;  3CCJ I;  1IC8 A;  1ZGA A;  5J1R A;  3FKJ A;  4LLL A;  2E1C A;  2HTJ A;  4HPQ A;  3KZI C;  1IRF A;  2VBY A;  1K6O A;  3G4S I;  5J4V A;  4H4K C;  1HA8 A;  6PAX A;  4ZDO A;  2LSO A;  5ILS A;  1T2K A;  4I6Z A;  2Z5U A;  3CME I;  3ZQG A;  2JUC A;  2HWV A;  2P5L C;  3CCQ I;  3DLA A;  1WJD A;  2VXZ A;  1SC7 A;  4I0A A;  2L0K A;  2DTZ A;  3WE3 A;  1FPQ A;  3MMY B;  4JX5 A;  3WU0 A;  4ZJZ A;  4NQW A;  4YG2 F;  3J80 K;  3R4K A;  1ENH A;  3GYH X;  3C2H A;  4DZP A;  2PJP A;  5H6Q A;  1ZRE A;  3ZXS A;  2RNG A;  2M8G X;  5EEG A;  2W48 A;  4C9Y A;  4UUS A;  1YS6 A;  2WV1 A;  1KQ9 A;  5K5Q A;  4HLY A;  1BBY A;  1GXP A;  3ELK A;  1HDD C;  2L9V A;  1DGW Y;  3QRF F;  3CJR B;  4P96 A;  4BY7 J;  4BQQ A;  5BNG A;  4M6Y A;  3L2W A;  1A31 A;  5LGT A;  2PQ8 A;  4BBR J;  3SXY A;  3PQJ A;  1QHH D;  1IO2 A;  1JT6 A;  2B0L A;  5J47 A;  3MKZ A;  1T33 A;  5IT9 Z;  2NAZ A;  5E17 F;  4EJW A;  2KIM A;  4XKB A;  1XMX A;  3HRU A;  4IXA A;  4LIU A;  3E5Q A;  4CZC A;  2JN6 A;  2F5E A;  2XUB A;  4RAG A;  3HL2 A;  3RZO J;  5CLS A;  3MCZ A;  5F04 A;  5KAI C;  1Y8R B;  4DYR A;  3OYA A;  1AKH B;  1K6Y A;  2DPU A;  1LVA A;  4CYC B;  1XGO A;  1VQL I;  3HRM A;  1NG7 A;  4PZJ A;  1KON A;  3LQQ A;  1LFP A;  1OPC A;  3SJM A;  2GIZ A;  2X6X A;  3GBG A;  3OS2 A;  2XPV A;  1W0U A;  2LK2 A;  1G3Y A;  1KYZ A;  3RKX A;  1IN6 A;  5JFR A;  1UB9 A;  3I53 A;  3VPR A;  2VJ5 A;  2LH9 A;  3P7N A;  3HGG A;  5E1X A;  3RIR A;  2CV0 A;  3GTK J;  4TV7 A;  2IRF G;  3PNV A;  4EEF G;  1DPR A;  4XRF A;  2W84 A;  2CV2 A;  3A02 A;  4AD9 A;  1D0Y A;  2LRD A;  4ON0 A;  5EZG A;  3S3N A;  2XAH A;  1YRN A;  4HF1 A;  1BC8 C;  1R00 A;  2F5C A;  1A36 A;  5CVU A;  2C6Y A;  1RPW A;  2DW4 A;  3FK7 A;  1IN4 A;  1QRY A;  3BR6 A;  3ZMT A;  4MIM A;  1MMD A;  2COB A;  4KIG A;  5J1U A;  2DAO A;  5E18 F;  3F21 A;  1NHA A;  3F6O A;  3L2C A;  4OIQ F;  2VQH A;  1RKT A;  3WU2 C;  3S1N J;  1BW6 A;  1SFU A;  2P4W A;  3KP4 A;  5FO5 A;  4FIS A;  5LHG A;  2HYF A;  4BQO A;  1HST A;  4XL9 A;  2ZC2 A;  5L3C A;  1VFC A;  5F0H A;  1BL0 A;  2IS4 A;  3DXJ F;  5J3L A;  4ZYG A;  4BE0 A;  3QPS A;  2DQL A;  2ZME A;  4ENK A;  3PIO F;  1JE8 A;  5JLW A;  1ZR2 A;  3L2R A;  5CQE A;  4II3 A;  2XVC A;  3BJ6 A;  5J40 A;  3ULQ B;  3FX3 A;  2ZJQ F;  5BOX A;  1MDM B;  2E35 A;  3HHH A;  3BQZ A;  3JAM Z;  4M73 A;  1O4X A;  3EPZ A;  3LSG A;  3NAU A;  1E2X A;  5CKT A;  1MBK A;  1IJW C;  3ISP A;  3PFY A;  4N4N B;  1N78 A;  3M8E A;  4BXX J;  3SDG A;  2W25 A; 
#chains in the Genus database with same CATH homology
 2A3S A;  2RN7 A;  2YX4 A;  2D1H A;  5AON A;  2EA2 A;  2ZKZ A;  1R1V A;  3H3Z A;  1R7J A;  2JSC A;  1IZ1 A;  4N9H A;  5FFX A;  1D8K A;  4IHT A;  2DTR A;  1HW2 A;  4A12 A;  4KIB A;  1BI0 A;  1S3J A;  4BH9 A;  1B6A A;  1HQC A;  2DK5 A;  3PQK A;  1P4A A;  3WTY C;  1S6L A;  1IUY A;  3DP7 A;  4RS8 A;  4HW0 A;  3IL2 A;  3FWE A;  1KU3 A;  2NYX A;  4L9V A;  1VTN C;  1FY7 A;  4EM1 A;  1JGS A;  1O7L A;  1ZG1 A;  3O3K A;  4HF2 A;  2Y0M A;  1P2F A;  5L3G A;  4HOB A;  4OU0 A;  2EFW A;  1IN7 A;  4Z2Y A;  3HSR A;  3EYY A;  2M87 A;  1ZN2 A;  4HBL A;  3V4G A;  1HSJ A;  2MH9 A;  1FNN A;  3I59 A;  1XMA A;  3Q9V A;  2HOE A;  1REP C;  2YPR A;  2ZNY A;  2IP2 A;  2PN6 A;  1J75 A;  2GZW A;  3GFL A;  4YFN F;  1FYM A;  1J5Y A;  2FBI A;  4U0Y A;  1YO5 C;  4LK1 F;  3ABT A;  3WTT C;  3JTH A;  2STT A;  4XLP F;  4UNO A;  2XGX A;  4B09 A;  1WI9 A;  3RTR A;  2A61 A;  5E8G A;  5DEQ A;  1P4X A;  1U5T A;  2X4H A;  3I71 A;  5FD5 A;  5K5R A;  2VT3 A;  4FX0 A;  3HOT A;  2KRF A;  1QO0 D;  3T0Y A;  3KEO A;  3HSE A;  3O2P E;  4YFK F;  3ECO A;  4GCV A;  4M72 A;  1RNL A;  4YFX F;  5LEJ A;  3KEQ A;  5AIP A;  5A2Q K;  2PMH A;  2XAJ A;  4S05 A;  1TW2 A;  3VOD A;  2AS5 F;  3RPQ A;  3ZQ7 A;  3F72 A;  2HYG D;  2IJL A;  1XMK A;  2GAU A;  2Q2E A;  4KA4 A;  3KLN A;  1YYV A;  2ZCW A;  4I7H A;  1Q1H A;  1WRJ A;  1KU2 A;  4MQV A;  1IAW A;  1OKR A;  1XGM A;  2BE5 F;  4MTD A;  5LGU A;  1U78 A;  1R5G A;  3DPT A;  2XKP A;  3S2W A;  1IW7 F;  2K4B A;  1K78 A;  5K1Y A;  1SD6 A;  1RUN A;  1ON1 A;  2M1B A;  1V4R A;  1HKT A;  3WE2 A;  3TKY A;  1RUO A;  4UV9 A;  2Z99 A;  3GWZ A;  1STZ A;  1JHF A;  1TNT A;  4LGW A;  4OIR F;  5D4R A;  4GYG A;  4BQA A;  3JSO A;  2BYV E;  1XGS A;  1O3Q A;  4MHG A;  2Z9O A;  3QPH A;  1G3T A;  2ISY A;  5DCM B;  1S8N A;  1LQ1 A;  4A6E A;  4G6D A;  1FT9 A;  3G3Z A;  2WWY A;  5TRD A;  3BDD A;  4L9N A;  4WF2 A;  1YG2 A;  5HDN A;  4OIO F;  3I5U A;  1LDK B;  2ESN A;  3Q9S A;  2OBP A;  1TW3 A;  3KET A;  1KQ0 A;  1KGS A;  4FHT A;  1I27 A;  2COM A;  1DDN A;  2AXL A;  1BM9 A;  2LDU A;  2RNJ A;  2A69 F;  3VEP A;  1BI2 A;  2ZNZ A;  4KIC A;  4D0P A;  1Z6T A;  3BY6 A;  3M1E A;  4M74 A;  1XCB A;  1R1T A;  1IRG A;  4EV0 A;  3KP6 A;  1L0O C;  5CYV A;  3WTW C;  3FM3 A;  4LD5 A;  1SMY F;  2BV6 A;  3NRV A;  5HDG A;  1QGP A;  2RGV A;  1IXR C;  1O57 A;  4ZZD A;  1PUE E;  1TQI A;  2EWN A;  2LKP A;  3CO7 C;  1ZAO A;  4HF0 A;  3QP6 A;  3J7A O;  3R0J A;  4KN7 X;  1GHC A;  1Z05 A;  1DUX C;  1B59 A;  1SD7 A;  3KCC A;  5CVI A;  5BPD A;  2CO5 A;  4EGZ A;  2QM3 A;  3OOP A;  2W57 A;  4Y17 A;  4NHJ A;  5ILV A;  4IVN A;  3L9F A;  3SZP A;  1TLH B;  4ZZL A;  2KJC A;  5BPI A;  4ENJ A;  3TGN A;  3J81 K;  3Q5F A;  3CUQ B;  5D5W B;  4M9X A;  2F5F A;  2PEX A;  2HQN A;  3TO7 A;  2DO7 A;  1YIO A;  5FD6 A;  3K1P A;  4RAY A;  2PG4 A;  1XSV A;  5JR3 A;  1U6G A;  1QPM A;  2CFX A;  5HLI A;  5LBQ A;  4GGG A;  1T6S A;  1CGP A;  4EM0 B;  1Z91 A;  4ESB A;  5D8K B;  1XN7 A;  4ZH4 F;  2XAQ A;  2L01 A;  5FLX Z;  4R79 A;  3BJO A;  4G8X A;  1O3T A;  1F5T A;  4KIF A;  2LF7 A;  1LEA A;  3HIF A;  3CUQ A;  4HV6 A;  3MZY A;  2QWW A;  4JBA A;  1YW7 A;  4HYE A;  2OQR A;  5DCM A;  2FRH A;  2O3F A;  4HDV A;  2HTS A;  4HX8 A;  1DPU A;  1YW8 A;  2IVM A;  1ON2 A;  4R8H A;  4A6D A;  4G94 A;  3RDI A;  2QBY B;  2DK8 A;  1IN5 A;  5ERI A;  1TQP A;  5HOO A;  3U1D A;  2ACJ A;  2PI0 A;  1Z6R A;  2D2W A;  3I59 B;  4WWC A;  4WXH A;  3R0A A;  4L9J A;  3FXU A;  4L0Y B;  3TO9 A;  2HDC A;  4HDU A;  3KP3 A;  2EV0 A;  2GQQ A;  3COA C;  4PCQ A;  2FOK A;  4G7H F;  4CO8 A;  3V8K A;  3FXQ A;  1S7A A;  3LFK A;  2MLG A;  5LRR A;  3K1N A;  3I64 A;  2M8E A;  4XLN F;  5CJ9 A;  2ZO4 A;  1LDJ A;  4OMY A;  4UV8 A;  2YU3 A;  1V3F A;  2IPQ X;  2L02 A;  2QQA A;  5HS8 A;  3CLO A;  4LLN A;  3LA3 A;  3DKW A;  3K0L A;  3H3U A;  3DQV C;  1GVJ A;  1ONV A;  2FBH A;  2F2E A;  1R58 A;  1CF7 B;  1PP7 U;  3QP5 A;  3E5X A;  2E7X A;  2K7L A;  2O03 A;  2DPD A;  1YLF A;  3F8N A;  1SFE A;  4GYI A;  2GXG A;  4QWQ A;  3FXR A;  4ENN A;  2KIF A;  3L09 A;  3RPU A;  2P5K A;  4KYW A;  1BOA A;  4P9U A;  5DDG A;  4CYD A;  3FMQ A;  2VT2 A;  2E1N A;  2DI3 A;  2VOP A;  5F6F A;  2OQG A;  1IN8 A;  2HR3 A;  1X3U A;  2NNY A;  1EH6 A;  4LB5 A;  1F9N A;  2HKO A;  2YX7 A;  4MQ9 F;  5D5X B;  4ENM A;  2L3D A;  1AWC A;  1XDS A;  3CUO A;  3P9K A;  3KE2 A;  2FF4 A;  3T5X A;  4F7Z A;  4U7B A;  3E6B A;  1O3R A;  3K1M A;  1LNW A;  1ZGJ A;  2OU2 A;  3BOQ A;  3TQN A;  4L0Z B;  1HBX G;  2FBK A;  1B9M A;  2A6H F;  1QBJ A;  2P8T A;  2V1U A;  2QQB A;  4A2U A;  2ESH A;  2FE3 A;  2RDP A;  5K5O A;  4RGX A;  5ICG A;  3M9A A;  4NB5 A;  4HV5 A;  1I5Z A;  5HVQ C;  4UVA A;  3BJA A;  3F22 A;  3ABU A;  2L54 A;  2O0Y A;  3BRO A;  4KMU X;  1I1G A;  1WWX A;  3NQO A;  4GO1 A;  4I01 A;  3BZ6 A;  4P55 A;  3V8L A;  3WGH A;  5CVV A;  3E6C C;  4QLC U;  3F6V A;  5HS7 A;  3HTU A;  4M9Z A;  1BIA A;  1BI1 A;  2VBX A;  2VOD A;  2P7V B;  5DD4 A;  3R61 A;  1Y0U A;  4HA8 A;  4EMS A;  1ZG3 A;  3SFZ A;  5LHH A;  1L3L A;  1OYW A;  2CG4 A;  4ASN A;  4L18 B;  1ZRD A;  4BHB A;  3I54 A;  2V6C A;  3IWF A;  4HQM A;  2JT1 A;  5JHU A;  1HXD A;  4I98 B;  4HX4 A;  1SD4 A;  4BHC A;  4LLG F;  2ETH A;  5DUK A;  1USS A;  2ELH A;  3AAF A;  4A0X A;  3GW2 A;  1LB2 A;  3FZV A;  2P6T A;  1RI7 A;  1W7P B;  2GA1 A;  1S29 A;  3E97 A;  5HDK A;  2JPC A;  1UHW A;  4BYY A;  4CZZ A;  1U5T B;  4Q4Z F;  4XSZ F;  1J9I A;  5BMZ A;  3BPX A;  1A04 A;  4G6Q A;  1TQM A;  2CGP A;  1O3S A;  1TBX A;  2M30 A;  2EV6 A;  2DLL A;  2NRA C;  2O8X A;  3IHU A;  4H0E A;  4KFC A;  5DYM A;  3IRR A;  1TNS A;  4O5V A;  1FBQ A;  1YW9 A;  4M9S A;  2FNP A;  4IRH A;  2F5D A;  2DU9 A;  3H92 A;  3V7R A;  1F1Z A;  2WV0 A;  4N0B A;  2NNN A;  1ZG5 A;  2EJR A;  1T98 A;  3HSF A;  1PDN C;  2HQR A;  4RAZ A;  1FBU A;  5IT9 K;  3LQR A;  3ZMS A;  2FSW A;  4UUV A;  2XRN A;  1WSU A;  3V7C A;  1HW1 A;  1K78 B;  4LG0 B;  3K2Z A;  3SZT A;  1FP1 D;  4EJV A;  1FSE A;  4JQF A;  1U5T C;  2QLZ A;  3DF8 A;  2MA3 A;  2GXB A;  1XD7 A;  4MEX F;  4WXC A;  2BBY A;  2FMY A;  2LF8 A;  4I2O A;  1XDU A;  4HLX A;  1QZZ A;  4UVB A;  4BXU A;  1R36 A;  4GXO A;  3FF5 A;  1ZYR F;  3K69 A;  2DQR A;  3DPL C;  2WC2 A;  3RKW A;  2Y75 A;  2JTV A;  3CJN A;  3WG9 A;  3WTS C;  3L7W A;  1R22 A;  2HKX A;  1W5S A;  3QAH A;  3B02 A;  4IJA A;  3HYI A;  4LMY A;  4L5J A;  1KU7 A;  5E8I A;  2EK5 A;  5FLX K;  4ETS A;  2ZFW A;  1P92 A;  5D5V B;  2BEO A;  1K79 A;  2JPB A;  1Z1D A;  2Z33 A;  3EQL F;  4UXN A;  2QVO A;  2EFO A;  1ZH5 A;  3F8F A;  2H27 A;  3I0T A;  3DFG A;  2RKH A;  1KU9 A;  2KJB A;  4KT5 C;  3EYI A;  3P9I A;  3LWF A;  2HEO A;  1U2W A;  3E5U A;  3ERE D;  3D0S A;  3I4P A;  4KN4 X;  3E3V A;  1FYL A;  4MNU A;  4HAM A;  1QNT A;  3FMS A;  2ZXJ A;  4I09 A;  2ZJ2 A;  3WOD F;  1LEB A;  1ODD A;  2PMU A;  3MQ0 A;  1XGN A;  1C0W A;  3TDU C;  3ZN1 A;  4U0V A;  5HS9 A;  1J0R A;  3KZZ A;  4IF4 A;  3GFJ A;  3TO6 A;  1T39 A;  3M7G A;  3U9G A;  3WTV C;  2O61 A;  3JW4 A;  4L9T A;  5ICE A;  5E1Z B;  2EV5 A;  2IA2 A;  2A6E F;  3L00 A;  1IF1 A;  4RB3 C;  4ZYE A;  4RB2 C;  4OIN F;  4LB6 B;  1W7P D;  4HQE A;  3QOP A;  3G73 A;  2VE9 A;  5CVJ A;  4L5I A;  3KZY A;  2QUF A;  1G6N A;  2OZU A;  2K27 A;  4EJU A;  3RKY A;  3QPT A;  4A5M A;  4BHP A;  4IPA A;  3WGG A;  1B1B A;  2PLY A;  1G3W A;  2QEN A;  2D1V A;  1R1U A;  4KMF A;  1R5H A;  5D6E A;  2CW0 F;  3TDZ C;  2H09 A;  3KP2 A;  2X0L A;  4XBF A;  5IT3 A;  2HFH A;  4YIF A;  4ZYD A;  2PBI A;  1BIB A;  1EH7 A;  5LHI A;  3RYR A;  3GUD A;  4FT8 A;  1D8J A;  4XSX F;  3BPV A;  3WGI A;  4RGU A;  1IXC A;  4IRI A;  1JHH A;  2IW5 A;  4CDG A;  3JTG A;  2V79 A;  3C1D A;  2P6S A;  2A68 F;  2MC3 A;  4YII A;  3ZMZ A;  1W5T A;  1F4K A;  3GF2 A;  1CF7 A;  3DEU A;  5J6X A;  3IC7 A;  1WQ2 A;  4A0Z A;  4U0W A;  3LST A;  3REO A;  2XAS A;  2CWE A;  2A07 F;  4RGS A;  2ZBK A;  4LJZ F;  3PFI A;  1MDM A;  1FP2 A;  4K2E A;  3MWM A;  3ZP5 A;  4A5N A;  4P9F A;  2NS0 A;  3BP8 A;  1ULY A;  3NEU A;  2OA4 A;  1W7P A;  1FYK A;  5LEK A;  3IKT A;  4I0B A;  2H6C A;  2DBB A;  4N9I A;  4MGR A;  2RC4 A;  3CDH A;  2J5P A;  3TOA A;  1H9T A;  3IKV A;  1E17 A;  4G9Y A;  1H0M A;  1HW5 A;  2JRT A;  2HS5 A;  2HGC A;  3C7J A;  3VFZ A;  2QZ8 A;  1T0F A;  3GX4 X;  3GO5 A;  1T38 A;  3HUG A;  2OZ6 A;  2EFP A;  3B73 A;  1IXS B;  1KYW A;  5L3E A;  4ESF A;  1UFM A;  1P4W A;  3FM5 A;  1MKM A;  1AOY A;  4A0Y A;  1TTY A;  2IA0 A;  3KFW X;  3N97 A;  3F3X A;  5J8C A;  2PFB A;  3HRS A;  2MLK A;  1W4M A;  2VBZ A;  2V1X A;  1G4D A;  3F8M A;  1FOK A;  3IWZ A;  5KK1 A;  5EEH A;  2ISZ A;  1BJA A;  1BC7 C;  4WX9 A;  3D5L A;  3W6J B;  2D45 A;  2WTE A;  5L3B A;  2ADU A;  2QYO A;  2KIU A;  1U3E M;  5JVT A;  2K4J A;  2XHK A;  2O6G E;  4PGG A;  4DNC A;  3I58 A;  1OYI A;  4UHT A;  4Q48 A;  2R7D A;  4EQQ A;  1ZLK A;  5ICC A;  4LK0 F;  1OR7 A;  3KP7 A;  2EFN A;  1SMT A;  5DD8 A;  4S04 A;  4KDP A;  3DV8 A;  2UXN A;  2Y48 A;  4LFU A;  1EH8 A;  2W24 A;  2XAG A;  1OYY A;  1S7O A;  3U2R A;  3LA2 A;  5CVR A;  2HZT A;  3HTS B;  3ML6 A;  5H6R A;  3N4M A;  2FQ3 A;  2Q0O A;  3F8C A;  3EET A;  1OMI A;  2VON A;  3LAP A;  1ZLJ A;  2M45 A;  2K86 A;  3EDP A;  1QQI A;  5FB2 A;  5L3D A;  2L4M A;  3GZ5 A;  2QQ9 A;  2H94 A;  4CIC A;  2MH2 A;  1B9N A;  3KLO A;  5F64 A;  3SHF A;  3FMR A;  1MD0 A;  2MD5 A;  2V9V A;  3GFM A;  1LJ9 A;  2R7F A;  4OIP F;  3O6B B;  2FML A;  2RQP A;  2Q8K A;  3F8B A;  4E70 A;  2M5W A;  3WTZ A;  4G7Z F;  3T8T A;  1R23 A;  1J2X A;  3ROU A;  1SD5 A;  1MJA A;  4RGR A;  2VC1 A;  2VC0 A;  3R60 A;  1DP7 P;  3F23 A;  1XB4 A;  1MJB A;  3RYP A;  3WTU C;  1D3Y A;  4IRG A;  3GLX A;  2UWM A;  4EJO A;  1RZ4 A;  3RJP A;  1EV7 A;  2G7U A;  4IHS A;  3ZPL A;  4U7D A;  3FHZ A;  4EVI A;  4PDK A;  1FSH A;  2VN2 A;  2RV8 A;  3GVA A;  5JI6 A;  1Z7U A;  2XV4 S;  2FEZ A;  4LG0 A;  2FU4 A;  1HKS A;  4M6X A;  3V8J A;  4KUM A;  5FGM A;  5E20 A;  1H9G A;  3ZMV A;  3MAJ A;  2J5O A;  1YTY A;  1G3S A;  2BGC A;  1LDD A;  5D6F A;  3MEX A;  5LLQ A;  1FLI A;  3WU1 B;  2W85 A;  2CQK A;  5TJJ A;  1O7F A;  1J59 A;  5A2Q Z;  4EGY A;  3CO6 C;  2P5V A;  4JK1 X;  3JAM K;  1UST A;  2UZK A;  3J81 Z;  1ZHF A;  5LGN A;  5ILU A;  2VBW A;  1FC3 A;  3ZN0 A;  4O6J A;  3IRQ A;  4P5O A;  4KNY A;  3WTX C;  4EM2 A;  4MEY F;  2TDX A;  4G7O F;  4CHU A;  4OOI A;  2DFI A;  4O3M A;  2GWR A;  5HLH A;  5ICF A;  3QU3 A;  2GIV A;  1B4A A;  5BS6 A;  3V7S A;  4WK8 F;  3R6S A;  4Q47 A;  3OV8 A;  4RB1 A;  1ZRC A;  4AVP A;  1Z9C A;  3J80 Z;  1KA8 A;  5F1R A;  4CXF A;  1HKQ A;  1UCR A;  1K7A A;  1FBS A;  1UHM A;  1XCV A;  2IA1 A;  4WXD A;  2YR2 A;  4HX7 A;  1YQA A;  1GXQ A;  2LNB A;  1QZY A;  5D4S A;  2FXA A;  1JXS A;  3BWG A;  1U8R A;  1MZB A;  3E6M A;  2L4A A;  4AIH A;  5DV5 A;  3LAJ A;  2OAZ A;  2G7H A;  4AIJ A;  3CTA A;  2QBY A;  1I6X A;  3T1B A;  5HLG A;  1KQ8 A;  1BN5 A;  2R3S A;  2XIG A;  2EA4 A;  2GA2 A;  4ZYH A;  4UVC A;  2IT0 A;  3HHG A;  4ESJ A;  3MZH A;  1FZP B;  3HOS A;  3RI4 A;  2CSO A;  3P9C A;  5LRS A;  4RB0 A;  1XSD A;  3E6D A;  3JSP A;  3GFI A;  2UXX A;  2EB7 A;  4R1H A;  1FWZ A;  5BQT A;  3CUQ C;  2Z3Y A;  2STW A;  4BNC A;  3T8R A;  1BI3 A;  1I1S A;  1D5V A;  1MJ9 A;  1WKM A;  2KKO A;  2YSR A;  2OD5 A;  4WCG A;  5AIQ A;  2H6B A;  3SQN A;  2RVC A;  2XKO A;  2XRO A;  1ZRF A;  4HZF A;  1J7K A;  2FNA A;  2V1D A;  2XAF A;  4OMZ A;  5KVR A;  3TOB A;  3ZMD A;  1PP8 F;  3ZMU A;  2E7W A;  2MBF A;  3HRT A;  4M71 A;  4U88 A;  5FFZ A;  4AIK A;  4B8X A;  2EFQ A;  2JZY A;  3VB2 A;  4BAY A;  5D5U B;  3LA7 A;  4Y13 A;  2K02 A;  4MTE A;  2DT5 A;  5D8L B;  5H20 A;  4CGZ A;  4Y15 A;  1SAX A;  1FX7 A;  2VE8 A;  1RIO H;  2CYY A;  1XSX A;  4PGH A;  3C3W A;  2G9W A;  3GEZ A;  4Q5S F;  5DCF A;  5L3F A;  1YS7 A;  2A5Y B;  4DQ2 A;  3W6K B;  4FX4 A;  5J8F A;  3EUH A;  2P7C B;  3C18 A;  1SFX A;  1YFH A;  3GXO A;  2ZME B;  3VOE A;  3M8F A;  3QU6 A;  3MFK A;  2FA5 A;  1ZAR A;  3K9T A;  3GZ6 A;  5E1W A;  3KP5 A;  5ED4 A;  4AWX B;  2VOO A;  4EJT A;  5DUI A;  4I02 A;  1MGT A;  1P6R A;  3ECH A;  1ZGA A;  4LLL A;  2E1C A;  2HTJ A;  1IRF A;  2VBY A;  1K6O A;  6PAX A;  2LSO A;  5ILS A;  1T2K A;  2Z5U A;  2HWV A;  2P5L C;  2VXZ A;  4I0A A;  3WE3 A;  1FPQ A;  3WU0 A;  4NQW A;  4YG2 F;  3J80 K;  3R4K A;  3GYH X;  2PJP A;  5H6Q A;  1ZRE A;  5EEG A;  1YS6 A;  1KQ9 A;  5K5Q A;  4HLY A;  1BBY A;  1GXP A;  3ELK A;  3QRF F;  4P96 A;  4M6Y A;  5LGT A;  2PQ8 A;  3SXY A;  3PQJ A;  2B0L A;  5IT9 Z;  2NAZ A;  5E17 F;  4EJW A;  2KIM A;  3HRU A;  4IXA A;  3E5Q A;  2F5E A;  2XUB A;  5CLS A;  3MCZ A;  2DPU A;  1LVA A;  1XGO A;  3HRM A;  4PZJ A;  3LQQ A;  1OPC A;  1G3Y A;  1KYZ A;  3RKX A;  1IN6 A;  5JFR A;  1UB9 A;  3I53 A;  3P7N A;  5E1X A;  3RIR A;  4TV7 A;  2IRF G;  1DPR A;  4XRF A;  2W84 A;  4AD9 A;  4ON0 A;  2XAH A;  4HF1 A;  1BC8 C;  1R00 A;  2F5C A;  5CVU A;  2C6Y A;  2DW4 A;  1IN4 A;  3ZMT A;  4KIG A;  2DAO A;  5E18 F;  3F21 A;  1NHA A;  3F6O A;  3L2C A;  4OIQ F;  1SFU A;  2P4W A;  3KP4 A;  5FO5 A;  5LHG A;  2HYF A;  1HST A;  5L3C A;  3DXJ F;  4ZYG A;  2DQL A;  2ZME A;  4ENK A;  1JE8 A;  2XVC A;  3BJ6 A;  3ULQ B;  3FX3 A;  5BOX A;  1MDM B;  3HHH A;  3JAM Z;  4M73 A;  1E2X A;  3ISP A;  3M8E A;  2W25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...