4R1KA

Crystal structure of a ntf2-like protein (eubsir_01394) from eubacterium siraeum dsm 15702 at 2.56 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
GDEGNIKENAVRMMECIVNKDSEKLFDFYNKDMKDNYKDSSLDEIRQLFEYIDGAITSYNYEGKGGGQEAKNDGIICYYSCHPEFDFTTETGQEYTISFSYHYIWNEHPEYEGINMIQICKDGNWGEKLIIGRNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (EUBSIR_01394) from Eubacterium siraeum DSM 15702 at 2.56 A resolution
rcsb
source organism Eubacterium siraeum
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 34
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17117 DUF5104 Domain of unknown function (DUF5104)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r1kA00
1GY7A 2PZVA 3MG1A 4WWUC 1UUVB 3HK4A 3KSPA 4WYKA 2QIYA 2XSHB 3G16A 3K7CA 3ECFA 2R4IA 3F8HA 3NV0A 1QMAA 3EJVA 5EVHA 2CHCA 3GRDA 2HMMB 2XR8B 4WP5A 3SOAA 4HM2B 3T8NA 1DMQA 2BMQB 3K0ZA 1HKXA 1W01A 4N3VA 3EF8A 1K41A 4ORLA 3MHEA 5JPPA 4LMIA 1Z1SA 3EHCA 1TP6A 3ER7A 3DM8A 3CNMA 4HZBB 5AEUB 5AEWB 1ISKA 4XM4A 2Z77A 3IPTA 2B24B 4HM5B 1O7WB 3FLJA 3Q90A 3WMDA 4K1UA 3F7XA 3NXJA 2XRXB 1E3RA 1O7HB 4OUQA 3EN1B 3EQQB 1JKGA 2YFJB 5AIFA 5TGNA 1VZZA 5AIGA 3JUQA 1JKGB 1U5OA 3EBTA 4IIAA 1GS3A 4XBTA 1GY5A 2XSOB 1O7MB 1NDOB 2HMJB 1SJWA 1JN5B 2JQ5A 4I4KA 1O7GB 3SEDA 3OX9A 5IENA 3GZXB 1Q40A 1JB2A 1JN5A 2Z76A 3EX9A 4K1VA 3CNXA 1Q40B 4H3UA 5D83A 2I9WA 2Z7AA 4OVMA 5IG5A 3I0YA 5D81A 5STDA 1JB5A 3CU3A 4HM3B 2QGUA 3G0KA 4STDA 4HM0B 3FH1A 3VSYA 5KP4A 3KZTA 4FCJA 4MJDA 5AI1A 3OV4A 5CF2A 3FGYA 2F99A 3NHXA 4L8PA 1ULIB 2RFRA 1ZX2A 3F40A 1O7NB 2STDA 1OH0A 2HMLB 4XBXA 1OCVA 1E3VA 3FF0A 1JB4A 3B8LA 3MYTA 2INXA 2BMOB 1QJGA 3KKGA 4Q53A 1IDPA 3LZAA 3GZRA 4U13A 2A15A 5IERA 1DMMA 1GY6A 1OHOA 2CKFB 4R9KA 5DREA 3H3HA 1ULJB 3M8CA 5G2GA 4HM7B 4CDLA 4XDVA 2GXFA 1NWWA 3MKIA 3OWSA 1E97A 3G8ZA 3STDA 3B4PA 5IF6A 5KP1A 8CHOA 1NU3A 1OF5B 3JUPA 3S5CA 4L8OA 3E99A 3OWYA 2UX0A 1OF5A 3CPOA 3DXOA 4X2OA 4X2HA 3UNLA 3B7CA 5BVBA 2F98A 3B4OA 4HJLB 2HMOB 3LYGA 3KE7A 3RGRA 5CXOA 3UJMA 5CK6A 5CF1A 1BUQA 1WQLB 5IG0A 2HMNB 2YFIB 1W6YA 3SOYA 4R1KA 2GEYA 1GYBA 1ZO2A 3MSOA 3GZBA 3GWRA 4HM6B 2K54A 1O7PB 3OWUA 3F14A 1W02A 1OHPA 3F7SA 3DZLA 3GZYB 3JUMA 3A76A 3OXAA 5DRVA 1OPYA 3HZPA 5JPUA 3EC9A 3NUVA 3NM2A 5FW5A 3EBYA 2F86B 2BMRB 4HM4B 5AIIA 5IG3A 3F8XA 4KVHA 1AR0A 2GBXB 5IG4A 3NBRA 4HVNA 4XBYA 5CLKA 2OWPA 1Q42A 3HX8A 2IMJA 5BXQA 5IEOA 3ROBA 3DMCA 4HM1B 3EN8A 4LEHA 3MG2A 3RGAA 3D9RA 4J8TA 5HGRA 3NV0B 1C7HA 3FF2A 1TUHA 4LGQA 2YFLB 1STDA 3H51A 5KP3A 3T8UA 3FSDA 1DMNA 2GEXA 3JUNA 4R9LA 4XB5A 2W2CA 5IEPA 2HMKB 1EA2A 1EG9B 1OGZA 3JUOA 3BLZA 6STDA 3FZWA 4PEJA 2RCDA 4HZ9B 2B1XB 3DUKA 5D82A 1CQSA 1W00A 4XDWA 1OGXA 4HKVB 4RZMA 2BNGA 1ASKA 2RGQA 4FCMA 4L7KA 3BB9A 3F9SA 5AIHA 3FKAA 3MG3A 1S5AA 3VGNA 2GBWB 1A2KA 4HM8B 1UUWB 7STDA 4J9AA 4WYKB 1OUNA 4GB5A 1OHSA
chains in the Genus database with same CATH superfamily
3N8BA 1I8VA 1UUVB 1RCLA 2MF7A 4GSPA 3F8HA 2CHCA 1BU4A 1DMQA 2BMQB 1W01A 1K41A 1YIJ3 4LMIA 1N5HA 1TP6A 2RNTA 1QVG2 1NB5I 1UDII 2Z77A 2L1SA 4HM5B 1IQXA 1QVF2 1B3SA 2W56A 3Q90A 4K1UA 1F8NA 3F7XA 3BNDA 3NXJA 1HU9A 2XRXB 1PFPA 3EQQB 5AIFA 1BUJA 3QRDA 1BSDA 3FG3A 1JKGB 1M1XB 1U5OA 4FMDA 3UL6A 1RNBA 1FZUA 1NDOB 1UGIA 3WDGB 5IENA 2ZDJA 2GSPA 2D42A 2OOVC 3G6E3 2Z76A 3EX9A 3PXMA 1Q40B 1U8CB 4IT7A 5D83A 1AQZA 5IG5A 3KSED 5D81A 3WODG 1ROAA 4HM3B 1VQN3 1EUIC 1I2EA 3VSYA 1W4NA 1YGWA 3JVCA 5KP4A 2BHMA 4FCJA 2WOFA 3D5GA 2E2TA 2LYXA 2OQEC 1RMSA 3NHXA 4BIRA 3OW22 1BSEA 3RNTA 2RFRA 1ZX2A 2RBIA 1O7NB 1OH0A 1V58A 1OCVA 1E3VA 2JDIH 3FF0A 2F4YA 2CK3H 2ML5A 5HOHA 2FGTA 3MYTA 1DYUA 4NHFA 4R80A 3S28A 3CC73 1VQ63 3ZG0A 1IQYA 3G4S3 2P0XA 4FCZA 1GY6A 2CKFB 3O8YA 1ULJB 4FMBA 2K0MA 2GXFA 3MKIA 3STDA 1K9M4 1E97A 3X3XA 1M1K4 3B4PA 3CC43 1OF5B 1TFOA 4L8OA 2KF5A 3CPOA 4X2OA 3B7CA 3LTCA 2F98A 4HJLB 1L5GB 2CFWA 3LT9A 3SYUA 1TJDA 3KE7A 3IJEB 2W04A 3RGRA 5CF1A 2CG0A 1WQLB 4WFOA 1B2ZA 1NNVA 3S67A 1UI8A 2OQEA 1SIIA 2BU4A 2LQVA 3MSOA 4KZ1A 2FXTA 1X1YA 3F7SA 4J9AA 3GZYB 3JUMA 1OPYA 2HOHA 3HZPA 1W6GA 5JPUA 1JBRA 3GAXA 2BMRB 4TX4A 4HM4B 3BNCA 2W6JH 3A5EA 1AR0A 2OWPA 1RN7A 1US1A 3TDGA 3HX8A 2GU3A 2ML6A 1NB3I 1M904 1WMOA 3I553 3MG2A 1FW7A 1B2UA 2IY2A 3RGAA 2O3OA 4J8TA 1D6UA 3AMOA 3FF2A 4H61A 1R4CA 4LGQA 5KP3A 2GEXA 1B27A 2H0IA 4R9LA 1ROVA 1RN1A 4J5GA 2W0QA 4HZ9B 4HOHA 1W00A 1K734 1T3BA 5ELJA 1GMQA 1ASKA 1Q814 2AADA 5AIHA 1B21A 3VGNA 1UUWB 1ZGXA 3DGLA 1OHSA 4MMXB 1FUTA 1X1WA 3MG1A 3X3YA 3FG1A 3MWZA 6GSPA 2CFKA 3G16A 3ECFA 1TIJA 3PS8A 1DE3A 3V92A 4N6V0 1HKXA 1OACA 3U97A 1MWTA 4MEIA 3FG4A 4FR9A 2WO0A 4EW5A 1JBSA 1YVSA 1IVWA 4XM4A 2Q07A 3IPTA 4JF8A 1W7CA 2B24B 1BRHA 2E2UA 2K3DA 1T2IA 3CCJ3 1GD3A 1O7HB 2RSXA 1RGGA 3EN1B 2OOVA 1J2BA 5TGNA 3LTDA 2CH9A 1KD14 1GS3A 4O2HA 1GY5A 1Q824 2F56A 1SJWA 4N6UA 1JN5B 1UCKA 2FNQA 1IT7A 3BU4A 3K5TA 1AVLA 1RGFA 3GZXB 3SEDA 4IPBA 1W2B2 3DH2A 2P0MA 2I9WA 2Z7AA 1GMRA 3WOFB 1JB5A 1FGQA 4J5KA 2QGUA 4STDA 2XF3A 3FH1A 2ZA4A 1TRQA 3KZTA 4LZIA 2Z6BA 4EBGA 1T2HA 1IQ8A 1X1UA 3OV4A 5AI1A 1UW1A 2F99A 1EQKA 1FUWA 1BRSA 3N9HA 2CC3A 1Q7HA 1PU4A 2HMLB 1RGLA 2CWTA 1BNEA 4BL2A 1HZ1A 3AGOA 4EXRA 1QJGA 1QAKA 2MC8A 1IDPA 4EV2A 1GSPA 4OK0A 2A15A 1BRNL 1IVXA 1GOYA 4R9KA 4ZM8A 5G2GA 3CCM3 1Y4KA 3EE1A 3CCS3 1JZOA 1NWWA 7RNTA 3G8ZA 3ZFZA 4BTWA 2OTJ3 1N5PA 1BAOA 8CHOA 1KSIA 1NU3A 3LXUX 1TRPA 1W2ZA 3OWYA 1OF5A 2C11A 3DXOA 1LQGC 5AYRB 3D5IA 1IT8A 3NBBA 5CK6A 4K61A 1VQL3 3HI7A 1VQM3 4CPKA 1VQK3 1IVUA 4R1KA 1ZO2A 1YJW3 3GWRA 1N8R4 3F14A 1IV9A 4KT3B 3WHOA 4BU4A 3A76A 1BSAA 5DRVA 1YNVX 3D3LA 1EEJA 3EBYA 2F86B 5M1AA 4DKIA 7GSPA 4HAAA 4XBYA 1Q42A 3UB1A 5IEOA 3ROBA 4AKYA 2L4VA 1SIHA 4CJNA 1DVDA 2CG1A 5HGRA 3DY5A 1UGHI 2O9UX 1IYYA 1TUHA 1W5ZA 4O3VA 1FUSA 3SXXA 3H51A 4RNTA 3ZG5A 4EC6A 3FSDA 1DMNA 1UCLA 4HYZA 4XB5A 5IEPA 1VQQA 1OGZA 1I70A 3L0RA 1JBTA 1PYLA 1A2PA 4G1MB 4PEJA 4BTYA 1CQSA 2KF4A 2XGNA 4RZMA 2E2VA 4L7KA 1I3IA 1KWIA 1RGHA 4HM8B 1RSNA 1LOWA 2BO9B 1JRQA 4GB5A 5LC7A 2AAEA 2PZVA 1G0TA 4WWUC 4WYKA 2W03A 3KSPA 3WOEB 4AEQA 1ZS7A 1BVIA 2QIYA 2V1LA 2CX0A 3D79A 4FMCA 3KIIA 4KFDA 2Y74A 5ELUA 3EJVA 1LXEA 2J8XB 3LMLA 5EVHA 2XR8B 4WP5A 1K8A4 4HM2B 1VQ73 2IYJA 3X42A 3EF8A 3SLUA 3MHEA 3DGMA 3ER7A 1VQO3 2R41A 4HZBB 5AEUB 2F5WA 3X3ZA 3PZWA 2YX9A 2BIRA 3Q3FA 2Y73A 1DETA 1N9EA 5GSPA 3FLJA 3WMDA 3Q1CA 1Q864 1VQ53 3UNLA 1E3RA 3LTAA 1JKGA 2YFJB 2P05A 5AIGA 3JUQA 4IIAA 1VQ43 1A67A 2XSOB 1O7MB 2JQ5A 3NM7A 4I4KA 1GOVA 1I2GA 5RNTA 1JN5A 2ZHXB 4K1VA 3DGOA 4H3UA 4N6TA 3CPW2 3CCR3 1I0VA 1AV4A 1YVBI 3I0YA 1W6CA 3G0KA 1WMPA 1TU5A 4HM0B 1D6ZA 4I5QA 6RNTA 5CF2A 1FA3A 3VF1A 4O8SA 1RCKA 3S29A 1ULIB 1BRGA 2STDA 1IVVA 1DVCA 1FYSA 1D6YA 4XBXA 1JB4A 4N6MA 1FGMA 2INXA 4RNYA 1MWSA 4Q53A 1YJ93 3CCU3 3LZAA 1BRIA 2W9QA 4MMZB 1LOVA 1A2VA 1DMMA 1N9JA 5BU4A 1MWUA 4QWTA 1YJN3 1FGRA 1OHOA 3PCSA 5DREA 3UL5A 1I0XA 1WNHA 2QEX3 4HM7B 2XEPA 2QA43 3CCL3 3NX0A 3E99A 4EYCA 5BVBA 2WGQA 1AVKA 3WR2A 2OTL3 2BT3A 1VQP3 8RNTA 4BL3A 3K9MC 3T0UA 1RJOA 4JRFA 2P38A 2SARA 4N6OB 3UJMA 1YHQ3 1BUQA 3V98A 3PGBA 1JV2B 4NPBA 2GEYA 1GYBA 2K54A 1IV7A 3KFQC 3OXAA 1W02A 1GMPA 4O02B 3DGYA 5STDA 1SARA 1LVNA 3AHSA 3GSPA 5FW5A 3CCQ3 4FMAA 3DGNA 5IG3A 5EQLA 1K28A 2GBXB 4MMYB 3NBRA 5IG4A 1RDSA 2IMJA 5BXQA 1MGWA 5AYSC 3WA2X 2SBLA 3EN8A 1UCIA 3AMOB 3I563 3D9RA 3CC23 3NV0B 1S723 2KRTA 2D1WA 2YFLB 3T8UA 5EEOA 1LOXA 1EG9B 2HMKB 2CIUA 3FZWA 1N8QA 3D4AA 3PYJA 4XDWA 2KF6A 2PNCA 1OGXA 1TTOA 3F9SA 1SPUA 2XFSA 3FKAA 4AKZA 1S5AA 4LSOA 2GBWB 1OUNA 5IERA 2KAAA 1GY7A 1QAFA 1YI23 1BSCA 3HK4A 1QALA 1B2XA 1BIRA 2XSHB 3K7CA 3Q2PA 1I3FA 2R4IA 2CW9A 2KCDA 1QMAA 3NV0A 2P09A 2HMMB 3GRDA 3SVAA 2WGOA 3LTBA 3SOAA 3T8NA 5M19A 3K0ZA 2IUJA 4N3VA 5JPPA 4ORLA 3X40A 3CME3 1NJI4 1Q7Y4 1Z1SA 2ZL8A 3EHCA 2CFDA 1YGEA 3CNMA 3DM8A 5AEWB 1LNIA 1ISKA 1B2MA 2W56B 1X1XA 3AHWA 1BNFA 3CCV3 1BRJA 1O7WB 5G1LA 3HIGA 5I97A 1C54A 1GOUA 3EB8A 1EKMA 3NBJA 4OUQA 2UGIA 5D82A 4NREA 1VZZA 2KXGA 4EV5A 3EBTA 3IMAB 4KFEA 2IUKA 3AGNA 4XBTA 3G713 2HMJB 1PY3A 3CXC2 1O7GB 2OCTA 3OX9A 2CFGA 1Q40A 1BGSA 1JB2A 1CYVA 2XH9A 3CNXA 5BIRA 1YIT3 1LQMB 4K90B 1RHLA 4OVMA 3KCHA 3CU3A 3CMA3 1CH0A 1IK3A 9RNTA 1CYUA 1BNRA 3ALAA 1JNQA 1MNLA 1LRAA 4MJDA 1MOLA 3PCRA 3BIRA 1TFKA 4RBNA 1JJ22 1SQWA 1B20A 3FGYA 4L8PA 3WA3A 3RDEA 1M9GA 3F40A 4N6NB 2KF3A 1BNSA 5FGOA 3NQYA 4HBRA 5LC6A 1UI7A 3X41A 1KC84 2XGLA 2CWVA 3B8LA 1R4YA 1UUGB 4ILFA 1VQ93 3CD63 2BMOB 3HIIA 3KKGA 2W9PA 1RTUA 3GZRA 4U13A 2CWUA 1RGCA 3S27A 2H0GA 2UUGC 4CDLA 3H3HA 3M8CA 3URPA 4BTXA 4XDVA 1IU7A 1BANA 3OWSA 1CEWI 1WTHA 5IF6A 5KP1A 1UCJA 3JUPA 3S5CA 2UX0A 1BNIA 3NQZA 4X2HA 2H0HA 3B4OA 4LYLB 3LH4A 2HMOB 2IA7A 3LYGA 5CXOA 3U1WA 1AY7A 1RLSA 5IG0A 2HMNB 1I2FA 2YFIB 1W6YA 1RN4A 3V99A 3SOYA 1KQS2 2CFLA 1RNTA 3QK9A 1VQ83 3LOYA 2GU1A 2F5MA 3GZBA 1BOXA 3OWUA 1O7PB 1STFI 1V74A 4HM6B 1OHPA 3DZLA 3HOHA 1LOYA 5G1KA 1T5YA 4N6LA 3EC9A 3NUVA 3NM2A 5JBSA 5AIIA 1G96A 1RGEA 1MGRA 3F8XA 4KVHA 1RRHA 1RKYA 4HVNA 5CLKA 1RRLA 1MWRA 2XFTA 3J7Yd 2C4BA 4R4KA 3SX1A 1RGKA 1BNGA 3DMCA 4HM1B 4LEHA 1V57A 1HYFA 5IW9A 1A90A 1B2SA 1GD4A 3KN4A 1C7HA 1BRKA 3BNBA 5A0OB 1STDA 3JUNA 1FGTA 4CCVA 1FGOA 2C10A 3N54B 2W2CA 1EA2A 3JUOA 3K63A 4RNZA 4GL6A 3BLZA 6STDA 2RCDA 2B1XB 1BNJA 2CX1A 3DUKA 3FCSB 3LT8A 3MPHA 1Q9EA 1BSBA 1LNHA 2WOHA 4HKVB 2BNGA 1RGAA 4KFFA 1NO3A 2RGQA 1WMNA 4FCMA 4WHAA 3BB9A 4GHOA 5M18A 3MG3A 7STDA 1A2KA 1G02A 4WYKB 3CCE3 3BNEA 2M7OA 1JZDA
chains in the Genus database with same CATH topology
3N8BA 1UUVB 2MF7A 3F8HA 2CHCA 1DMQA 2BMQB 1W01A 1K41A 1YIJ3 4LMIA 1N5HA 1TP6A 1NB5I 1QVG2 2Z77A 4HM5B 1IQXA 1QVF2 2W56A 3Q90A 4K1UA 1F8NA 3F7XA 3BNDA 3NXJA 1HU9A 2XRXB 1PFPA 3EQQB 5AIFA 3QRDA 3FG3A 1JKGB 1M1XB 1U5OA 4FMDA 3UL6A 1NDOB 3WDGB 5IENA 2ZDJA 2D42A 2OOVC 3G6E3 2Z76A 3EX9A 3PXMA 1Q40B 1U8CB 4IT7A 5D83A 5IG5A 3KSED 5D81A 3WODG 1ROAA 4HM3B 1VQN3 3VSYA 1W4NA 3JVCA 5KP4A 2BHMA 4FCJA 2WOFA 2E2TA 2LYXA 2OQEC 3NHXA 3OW22 2RFRA 1ZX2A 1O7NB 1OH0A 1OCVA 1E3VA 2JDIH 3FF0A 2CK3H 2ML5A 3CC73 2FGTA 3MYTA 1DYUA 4NHFA 4R80A 3S28A 1VQ63 1IQYA 3G4S3 2P0XA 4FCZA 1GY6A 2CKFB 3O8YA 1ULJB 4FMBA 2K0MA 2GXFA 3MKIA 3STDA 1K9M4 1E97A 3X3XA 1M1K4 3B4PA 3CC43 1OF5B 1TFOA 4L8OA 3CPOA 4X2OA 3B7CA 3LTCA 2F98A 4HJLB 1L5GB 2CFWA 3LT9A 3KE7A 3IJEB 2W04A 3RGRA 5CF1A 2CG0A 1WQLB 4WFOA 3S67A 1UI8A 2OQEA 1SIIA 2LQVA 3MSOA 4KZ1A 2FXTA 4J9AA 3F7SA 3GZYB 3JUMA 1OPYA 3HZPA 1W6GA 5JPUA 3GAXA 2BMRB 4TX4A 4HM4B 3BNCA 2W6JH 1AR0A 2OWPA 1RN7A 1US1A 3TDGA 3HX8A 2GU3A 2ML6A 1NB3I 1M904 1WMOA 3I553 3MG2A 3RGAA 2O3OA 4J8TA 3AMOA 1D6UA 3FF2A 4H61A 1R4CA 4LGQA 5KP3A 2GEXA 4R9LA 1ROVA 2W0QA 4HZ9B 1W00A 1K734 5ELJA 1ASKA 1Q814 5AIHA 3VGNA 1UUWB 3DGLA 1OHSA 4MMXB 3MG1A 3X3YA 3FG1A 3MWZA 2CFKA 3G16A 3ECFA 1TIJA 3PS8A 3V92A 4N6V0 1HKXA 1OACA 3U97A 4MEIA 3FG4A 4FR9A 2WO0A 1IVWA 4XM4A 2Q07A 3IPTA 4JF8A 1W7CA 2B24B 2E2UA 3CCJ3 1GD3A 1O7HB 2RSXA 3EN1B 1J2BA 2OOVA 5TGNA 3LTDA 2CH9A 1KD14 1GS3A 4O2HA 1GY5A 1Q824 4N6UA 1SJWA 1JN5B 3K5TA 2FNQA 1IT7A 3SEDA 1AVLA 3GZXB 4IPBA 1W2B2 2P0MA 2I9WA 2Z7AA 3WOFB 1JB5A 1FGQA 2QGUA 4STDA 2XF3A 3FH1A 3KZTA 4LZIA 2Z6BA 4EBGA 1IQ8A 5AI1A 3OV4A 1UW1A 2F99A 1EQKA 1FUWA 3N9HA 2CC3A 1PU4A 2HMLB 2CWTA 4EXRA 1QJGA 1QAKA 2MC8A 1IDPA 4EV2A 4OK0A 2A15A 1IVXA 4R9KA 4ZM8A 5G2GA 3CCM3 1Y4KA 3EE1A 3CCS3 1NWWA 3G8ZA 4BTWA 2OTJ3 1N5PA 8CHOA 1KSIA 1NU3A 3LXUX 1W2ZA 3OWYA 1OF5A 2C11A 3DXOA 5AYRB 1IT8A 3NBBA 5CK6A 4K61A 1VQL3 3HI7A 1VQM3 1VQK3 1IVUA 4R1KA 1ZO2A 1YJW3 3GWRA 1N8R4 3F14A 1IV9A 3A76A 5DRVA 3D3LA 3EBYA 2F86B 4XBYA 1Q42A 3UB1A 5IEOA 3ROBA 4AKYA 2L4VA 1SIHA 1DVDA 2CG1A 5HGRA 3DY5A 2O9UX 1TUHA 1W5ZA 4O3VA 3SXXA 3H51A 4EC6A 3FSDA 1DMNA 4HYZA 4XB5A 5IEPA 1OGZA 3L0RA 4G1MB 4BTYA 4PEJA 1CQSA 2XGNA 4RZMA 2E2VA 4L7KA 1KWIA 4HM8B 2BO9B 1JRQA 4GB5A 5LC7A 2PZVA 4WWUC 4WYKA 2W03A 3KSPA 3WOEB 4AEQA 2QIYA 2V1LA 4FMCA 4KFDA 3KIIA 2Y74A 5ELUA 3EJVA 1LXEA 5EVHA 3LMLA 2XR8B 4WP5A 1K8A4 4HM2B 1VQ73 3X42A 3EF8A 3SLUA 3MHEA 3DGMA 3ER7A 1VQO3 5AEUB 3X3ZA 3PZWA 2YX9A 2Y73A 1N9EA 3FLJA 3WMDA 3Q1CA 1Q864 1VQ53 3UNLA 1E3RA 3LTAA 1JKGA 2YFJB 2P05A 5AIGA 3JUQA 4IIAA 1VQ43 1A67A 2XSOB 1O7MB 2JQ5A 3NM7A 4I4KA 1JN5A 4K1VA 3DGOA 4H3UA 4N6TA 3CPW2 3CCR3 1AV4A 1YVBI 3I0YA 1W6CA 3G0KA 1WMPA 1TU5A 4HM0B 1D6ZA 5CF2A 1FA3A 3VF1A 4O8SA 3S29A 1ULIB 2STDA 1IVVA 1DVCA 1D6YA 4XBXA 1JB4A 4N6MA 1FGMA 2INXA 4RNYA 1YJ93 4Q53A 3CCU3 3LZAA 2W9QA 4MMZB 1A2VA 1N9JA 1DMMA 4QWTA 1YJN3 1FGRA 1OHOA 3PCSA 5DREA 3UL5A 1WNHA 2QEX3 4HM7B 2XEPA 3CCL3 3NX0A 3E99A 4EYCA 5BVBA 2WGQA 1AVKA 2OTL3 2BT3A 1VQP3 3K9MC 3T0UA 1RJOA 4JRFA 2P38A 4N6OB 3UJMA 1YHQ3 1BUQA 3V98A 3PGBA 1JV2B 2GEYA 1GYBA 2K54A 1IV7A 3KFQC 3OXAA 1W02A 4O02B 5STDA 1LVNA 5FW5A 3CCQ3 4FMAA 3DGNA 5IG3A 5EQLA 1K28A 2GBXB 4MMYB 3NBRA 5IG4A 2IMJA 5BXQA 5AYSC 3WA2X 2SBLA 3EN8A 3AMOB 3I563 3D9RA 3CC23 3NV0B 1S723 2KRTA 2D1WA 2YFLB 3T8UA 5EEOA 1LOXA 1EG9B 2HMKB 2CIUA 3FZWA 1N8QA 3PYJA 4XDWA 2PNCA 1OGXA 3F9SA 1SPUA 2XFSA 3FKAA 4AKZA 1S5AA 4LSOA 2GBWB 1OUNA 5IERA 1GY7A 1QAFA 1YI23 3HK4A 1QALA 2XSHB 3K7CA 3Q2PA 2R4IA 2CW9A 2KCDA 1QMAA 3NV0A 2P09A 2HMMB 3GRDA 3SVAA 2WGOA 3LTBA 3SOAA 3T8NA 3K0ZA 2IUJA 4N3VA 5JPPA 4ORLA 3X40A 3CME3 1NJI4 1Z1SA 2ZL8A 3EHCA 2CFDA 1YGEA 3CNMA 3DM8A 5AEWB 1ISKA 2W56B 3CCV3 1O7WB 3HIGA 5I97A 3EB8A 1EKMA 3NBJA 4OUQA 4NREA 1VZZA 2KXGA 4EV5A 3EBTA 3IMAB 4KFEA 2IUKA 4XBTA 3G713 2HMJB 3CXC2 1O7GB 2OCTA 3OX9A 2CFGA 1Q40A 1JB2A 1CYVA 2XH9A 3CNXA 1YIT3 4K90B 4OVMA 3CU3A 3CMA3 1IK3A 1CYUA 3ALAA 1JNQA 1MNLA 4MJDA 1MOLA 3PCRA 1TFKA 4RBNA 1JJ22 1SQWA 3FGYA 4L8PA 3WA3A 3RDEA 1M9GA 3F40A 4N6NB 5FGOA 3NQYA 4HBRA 5LC6A 1UI7A 3X41A 1KC84 2XGLA 2CWVA 3B8LA 1VQ93 3CD63 2BMOB 3HIIA 3KKGA 2W9PA 4U13A 3GZRA 3S27A 2CWUA 4CDLA 3H3HA 3M8CA 4BTXA 4XDVA 1IU7A 3OWSA 1CEWI 1WTHA 5IF6A 5KP1A 3JUPA 3S5CA 2UX0A 3NQZA 4X2HA 3B4OA 3LH4A 2HMOB 2IA7A 3LYGA 5CXOA 3U1WA 2QA43 5IG0A 2HMNB 2YFIB 3V99A 1W6YA 3SOYA 1KQS2 2CFLA 3QK9A 1VQ83 3LOYA 2GU1A 3GZBA 4HM6B 3OWUA 1O7PB 1STFI 1V74A 1OHPA 3DZLA 1T5YA 4N6LA 3EC9A 3NUVA 3NM2A 5JBSA 5AIIA 1G96A 3F8XA 4KVHA 1RRHA 1RKYA 4HVNA 5CLKA 1RRLA 2XFTA 3J7Yd 4R4KA 3SX1A 3DMCA 4HM1B 4LEHA 5IW9A 1A90A 1GD4A 3KN4A 1C7HA 3BNBA 5A0OB 1STDA 3JUNA 1FGTA 4CCVA 1FGOA 2C10A 3N54B 2W2CA 1EA2A 3JUOA 3K63A 4RNZA 4GL6A 3BLZA 6STDA 2RCDA 2B1XB 3DUKA 3FCSB 3MPHA 5D82A 3LT8A 1Q7Y4 1LNHA 2WOHA 4HKVB 2BNGA 4KFFA 1NO3A 2RGQA 1WMNA 4FCMA 4WHAA 3BB9A 3MG3A 7STDA 1A2KA 4WYKB 3CCE3 3BNEA 2M7OA 4HZBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY7 A;  2PZV A;  3MG1 A;  4WWU C;  1UUV B;  3HK4 A;  3KSP A;  4WYK A;  2QIY A;  2XSH B;  3G16 A;  3K7C A;  3ECF A;  2R4I A;  3F8H A;  3NV0 A;  1QMA A;  3EJV A;  5EVH A;  2CHC A;  3GRD A;  2HMM B;  2XR8 B;  4WP5 A;  3SOA A;  4HM2 B;  3T8N A;  1DMQ A;  2BMQ B;  3K0Z A;  1HKX A;  1W01 A;  4N3V A;  3EF8 A;  1K41 A;  4ORL A;  3MHE A;  5JPP A;  4LMI A;  1Z1S A;  3EHC A;  1TP6 A;  3ER7 A;  3DM8 A;  3CNM A;  4HZB B;  5AEU B;  5AEW B;  1ISK A;  4XM4 A;  2Z77 A;  3IPT A;  2B24 B;  4HM5 B;  1O7W B;  3FLJ A;  3Q90 A;  3WMD A;  4K1U A;  3F7X A;  3NXJ A;  2XRX B;  1E3R A;  1O7H B;  4OUQ A;  3EN1 B;  3EQQ B;  1JKG A;  2YFJ B;  5AIF A;  5TGN A;  1VZZ A;  5AIG A;  3JUQ A;  1JKG B;  1U5O A;  3EBT A;  4IIA A;  1GS3 A;  4XBT A;  1GY5 A;  2XSO B;  1O7M B;  1NDO B;  2HMJ B;  1SJW A;  1JN5 B;  2JQ5 A;  4I4K A;  1O7G B;  3SED A;  3OX9 A;  5IEN A;  3GZX B;  1Q40 A;  1JB2 A;  1JN5 A;  2Z76 A;  3EX9 A;  4K1V A;  3CNX A;  1Q40 B;  4H3U A;  5D83 A;  2I9W A;  2Z7A A;  4OVM A;  5IG5 A;  3I0Y A;  5D81 A;  5STD A;  1JB5 A;  3CU3 A;  4HM3 B;  2QGU A;  3G0K A;  4STD A;  4HM0 B;  3FH1 A;  3VSY A;  5KP4 A;  3KZT A;  4FCJ A;  4MJD A;  5AI1 A;  3OV4 A;  5CF2 A;  3FGY A;  2F99 A;  3NHX A;  4L8P A;  1ULI B;  2RFR A;  1ZX2 A;  3F40 A;  1O7N B;  2STD A;  1OH0 A;  2HML B;  4XBX A;  1OCV A;  1E3V A;  3FF0 A;  1JB4 A;  3B8L A;  3MYT A;  2INX A;  2BMO B;  1QJG A;  3KKG A;  4Q53 A;  1IDP A;  3LZA A;  3GZR A;  4U13 A;  2A15 A;  5IER A;  1DMM A;  1GY6 A;  1OHO A;  2CKF B;  4R9K A;  5DRE A;  3H3H A;  1ULJ B;  3M8C A;  5G2G A;  4HM7 B;  4CDL A;  4XDV A;  2GXF A;  1NWW A;  3MKI A;  3OWS A;  1E97 A;  3G8Z A;  3STD A;  3B4P A;  5IF6 A;  5KP1 A;  8CHO A;  1NU3 A;  1OF5 B;  3JUP A;  3S5C A;  4L8O A;  3E99 A;  3OWY A;  2UX0 A;  1OF5 A;  3CPO A;  3DXO A;  4X2O A;  4X2H A;  3UNL A;  3B7C A;  5BVB A;  2F98 A;  3B4O A;  4HJL B;  2HMO B;  3LYG A;  3KE7 A;  3RGR A;  5CXO A;  3UJM A;  5CK6 A;  5CF1 A;  1BUQ A;  1WQL B;  5IG0 A;  2HMN B;  2YFI B;  1W6Y A;  3SOY A;  4R1K A;  2GEY A;  1GYB A;  1ZO2 A;  3MSO A;  3GZB A;  3GWR A;  4HM6 B;  2K54 A;  1O7P B;  3OWU A;  3F14 A;  1W02 A;  1OHP A;  3F7S A;  3DZL A;  3GZY B;  3JUM A;  3A76 A;  3OXA A;  5DRV A;  1OPY A;  3HZP A;  5JPU A;  3EC9 A;  3NUV A;  3NM2 A;  5FW5 A;  3EBY A;  2F86 B;  2BMR B;  4HM4 B;  5AII A;  5IG3 A;  3F8X A;  4KVH A;  1AR0 A;  2GBX B;  5IG4 A;  3NBR A;  4HVN A;  4XBY A;  5CLK A;  2OWP A;  1Q42 A;  3HX8 A;  2IMJ A;  5BXQ A;  5IEO A;  3ROB A;  3DMC A;  4HM1 B;  3EN8 A;  4LEH A;  3MG2 A;  3RGA A;  3D9R A;  4J8T A;  5HGR A;  3NV0 B;  1C7H A;  3FF2 A;  1TUH A;  4LGQ A;  2YFL B;  1STD A;  3H51 A;  5KP3 A;  3T8U A;  3FSD A;  1DMN A;  2GEX A;  3JUN A;  4R9L A;  4XB5 A;  2W2C A;  5IEP A;  2HMK B;  1EA2 A;  1EG9 B;  1OGZ A;  3JUO A;  3BLZ A;  6STD A;  3FZW A;  4PEJ A;  2RCD A;  4HZ9 B;  2B1X B;  3DUK A;  5D82 A;  1CQS A;  1W00 A;  4XDW A;  1OGX A;  4HKV B;  4RZM A;  2BNG A;  1ASK A;  2RGQ A;  4FCM A;  4L7K A;  3BB9 A;  3F9S A;  5AIH A;  3FKA A;  3MG3 A;  1S5A A;  3VGN A;  2GBW B;  1A2K A;  4HM8 B;  1UUW B;  7STD A;  4J9A A;  4WYK B;  1OUN A;  4GB5 A;  1OHS A; 
#chains in the Genus database with same CATH topology
 3N8B A;  1I8V A;  1UUV B;  1RCL A;  2MF7 A;  4GSP A;  3F8H A;  2CHC A;  1BU4 A;  1DMQ A;  2BMQ B;  1W01 A;  1K41 A;  1YIJ 3;  4LMI A;  1N5H A;  1TP6 A;  2RNT A;  1QVG 2;  1NB5 I;  1UDI I;  2Z77 A;  2L1S A;  4HM5 B;  1IQX A;  1QVF 2;  1B3S A;  2W56 A;  3Q90 A;  4K1U A;  1F8N A;  3F7X A;  3BND A;  3NXJ A;  1HU9 A;  2XRX B;  1PFP A;  3EQQ B;  5AIF A;  1BUJ A;  3QRD A;  1BSD A;  3FG3 A;  1JKG B;  1M1X B;  1U5O A;  4FMD A;  3UL6 A;  1RNB A;  1FZU A;  1NDO B;  1UGI A;  3WDG B;  5IEN A;  2ZDJ A;  2GSP A;  2D42 A;  2OOV C;  3G6E 3;  2Z76 A;  3EX9 A;  3PXM A;  1Q40 B;  1U8C B;  4IT7 A;  5D83 A;  1AQZ A;  5IG5 A;  3KSE D;  5D81 A;  3WOD G;  1ROA A;  4HM3 B;  1VQN 3;  1EUI C;  1I2E A;  3VSY A;  1W4N A;  1YGW A;  3JVC A;  5KP4 A;  2BHM A;  4FCJ A;  2WOF A;  3D5G A;  2E2T A;  2LYX A;  2OQE C;  1RMS A;  3NHX A;  4BIR A;  3OW2 2;  1BSE A;  3RNT A;  2RFR A;  1ZX2 A;  2RBI A;  1O7N B;  1OH0 A;  1V58 A;  1OCV A;  1E3V A;  2JDI H;  3FF0 A;  2F4Y A;  2CK3 H;  2ML5 A;  5HOH A;  2FGT A;  3MYT A;  1DYU A;  4NHF A;  4R80 A;  3S28 A;  3CC7 3;  1VQ6 3;  3ZG0 A;  1IQY A;  3G4S 3;  2P0X A;  4FCZ A;  1GY6 A;  2CKF B;  3O8Y A;  1ULJ B;  4FMB A;  2K0M A;  2GXF A;  3MKI A;  3STD A;  1K9M 4;  1E97 A;  3X3X A;  1M1K 4;  3B4P A;  3CC4 3;  1OF5 B;  1TFO A;  4L8O A;  2KF5 A;  3CPO A;  4X2O A;  3B7C A;  3LTC A;  2F98 A;  4HJL B;  1L5G B;  2CFW A;  3LT9 A;  3SYU A;  1TJD A;  3KE7 A;  3IJE B;  2W04 A;  3RGR A;  5CF1 A;  2CG0 A;  1WQL B;  4WFO A;  1B2Z A;  1NNV A;  3S67 A;  1UI8 A;  2OQE A;  1SII A;  2BU4 A;  2LQV A;  3MSO A;  4KZ1 A;  2FXT A;  1X1Y A;  3F7S A;  4J9A A;  3GZY B;  3JUM A;  1OPY A;  2HOH A;  3HZP A;  1W6G A;  5JPU A;  1JBR A;  3GAX A;  2BMR B;  4TX4 A;  4HM4 B;  3BNC A;  2W6J H;  3A5E A;  1AR0 A;  2OWP A;  1RN7 A;  1US1 A;  3TDG A;  3HX8 A;  2GU3 A;  2ML6 A;  1NB3 I;  1M90 4;  1WMO A;  3I55 3;  3MG2 A;  1FW7 A;  1B2U A;  2IY2 A;  3RGA A;  2O3O A;  4J8T A;  1D6U A;  3AMO A;  3FF2 A;  4H61 A;  1R4C A;  4LGQ A;  5KP3 A;  2GEX A;  1B27 A;  2H0I A;  4R9L A;  1ROV A;  1RN1 A;  4J5G A;  2W0Q A;  4HZ9 B;  4HOH A;  1W00 A;  1K73 4;  1T3B A;  5ELJ A;  1GMQ A;  1ASK A;  1Q81 4;  2AAD A;  5AIH A;  1B21 A;  3VGN A;  1UUW B;  1ZGX A;  3DGL A;  1OHS A;  4MMX B;  1FUT A;  1X1W A;  3MG1 A;  3X3Y A;  3FG1 A;  3MWZ A;  6GSP A;  2CFK A;  3G16 A;  3ECF A;  1TIJ A;  3PS8 A;  1DE3 A;  3V92 A;  4N6V 0;  1HKX A;  1OAC A;  3U97 A;  1MWT A;  4MEI A;  3FG4 A;  4FR9 A;  2WO0 A;  4EW5 A;  1JBS A;  1YVS A;  1IVW A;  4XM4 A;  2Q07 A;  3IPT A;  4JF8 A;  1W7C A;  2B24 B;  1BRH A;  2E2U A;  2K3D A;  1T2I A;  3CCJ 3;  1GD3 A;  1O7H B;  2RSX A;  1RGG A;  3EN1 B;  2OOV A;  1J2B A;  5TGN A;  3LTD A;  2CH9 A;  1KD1 4;  1GS3 A;  4O2H A;  1GY5 A;  1Q82 4;  2F56 A;  1SJW A;  4N6U A;  1JN5 B;  1UCK A;  2FNQ A;  1IT7 A;  3BU4 A;  3K5T A;  1AVL A;  1RGF A;  3GZX B;  3SED A;  4IPB A;  1W2B 2;  3DH2 A;  2P0M A;  2I9W A;  2Z7A A;  1GMR A;  3WOF B;  1JB5 A;  1FGQ A;  4J5K A;  2QGU A;  4STD A;  2XF3 A;  3FH1 A;  2ZA4 A;  1TRQ A;  3KZT A;  4LZI A;  2Z6B A;  4EBG A;  1T2H A;  1IQ8 A;  1X1U A;  3OV4 A;  5AI1 A;  1UW1 A;  2F99 A;  1EQK A;  1FUW A;  1BRS A;  3N9H A;  2CC3 A;  1Q7H A;  1PU4 A;  2HML B;  1RGL A;  2CWT A;  1BNE A;  4BL2 A;  1HZ1 A;  3AGO A;  4EXR A;  1QJG A;  1QAK A;  2MC8 A;  1IDP A;  4EV2 A;  1GSP A;  4OK0 A;  2A15 A;  1BRN L;  1IVX A;  1GOY A;  4R9K A;  4ZM8 A;  5G2G A;  3CCM 3;  1Y4K A;  3EE1 A;  3CCS 3;  1JZO A;  1NWW A;  7RNT A;  3G8Z A;  3ZFZ A;  4BTW A;  2OTJ 3;  1N5P A;  1BAO A;  8CHO A;  1KSI A;  1NU3 A;  3LXU X;  1TRP A;  1W2Z A;  3OWY A;  1OF5 A;  2C11 A;  3DXO A;  1LQG C;  5AYR B;  3D5I A;  1IT8 A;  3NBB A;  5CK6 A;  4K61 A;  1VQL 3;  3HI7 A;  1VQM 3;  4CPK A;  1VQK 3;  1IVU A;  4R1K A;  1ZO2 A;  1YJW 3;  3GWR A;  1N8R 4;  3F14 A;  1IV9 A;  4KT3 B;  3WHO A;  4BU4 A;  3A76 A;  1BSA A;  5DRV A;  1YNV X;  3D3L A;  1EEJ A;  3EBY A;  2F86 B;  5M1A A;  4DKI A;  7GSP A;  4HAA A;  4XBY A;  1Q42 A;  3UB1 A;  5IEO A;  3ROB A;  4AKY A;  2L4V A;  1SIH A;  4CJN A;  1DVD A;  2CG1 A;  5HGR A;  3DY5 A;  1UGH I;  2O9U X;  1IYY A;  1TUH A;  1W5Z A;  4O3V A;  1FUS A;  3SXX A;  3H51 A;  4RNT A;  3ZG5 A;  4EC6 A;  3FSD A;  1DMN A;  1UCL A;  4HYZ A;  4XB5 A;  5IEP A;  1VQQ A;  1OGZ A;  1I70 A;  3L0R A;  1JBT A;  1PYL A;  1A2P A;  4G1M B;  4PEJ A;  4BTY A;  1CQS A;  2KF4 A;  2XGN A;  4RZM A;  2E2V A;  4L7K A;  1I3I A;  1KWI A;  1RGH A;  4HM8 B;  1RSN A;  1LOW A;  2BO9 B;  1JRQ A;  4GB5 A;  5LC7 A;  2AAE A;  2PZV A;  1G0T A;  4WWU C;  4WYK A;  2W03 A;  3KSP A;  3WOE B;  4AEQ A;  1ZS7 A;  1BVI A;  2QIY A;  2V1L A;  2CX0 A;  3D79 A;  4FMC A;  3KII A;  4KFD A;  2Y74 A;  5ELU A;  3EJV A;  1LXE A;  2J8X B;  3LML A;  5EVH A;  2XR8 B;  4WP5 A;  1K8A 4;  4HM2 B;  1VQ7 3;  2IYJ A;  3X42 A;  3EF8 A;  3SLU A;  3MHE A;  3DGM A;  3ER7 A;  1VQO 3;  2R41 A;  4HZB B;  5AEU B;  2F5W A;  3X3Z A;  3PZW A;  2YX9 A;  2BIR A;  3Q3F A;  2Y73 A;  1DET A;  1N9E A;  5GSP A;  3FLJ A;  3WMD A;  3Q1C A;  1Q86 4;  1VQ5 3;  3UNL A;  1E3R A;  3LTA A;  1JKG A;  2YFJ B;  2P05 A;  5AIG A;  3JUQ A;  4IIA A;  1VQ4 3;  1A67 A;  2XSO B;  1O7M B;  2JQ5 A;  3NM7 A;  4I4K A;  1GOV A;  1I2G A;  5RNT A;  1JN5 A;  2ZHX B;  4K1V A;  3DGO A;  4H3U A;  4N6T A;  3CPW 2;  3CCR 3;  1I0V A;  1AV4 A;  1YVB I;  3I0Y A;  1W6C A;  3G0K A;  1WMP A;  1TU5 A;  4HM0 B;  1D6Z A;  4I5Q A;  6RNT A;  5CF2 A;  1FA3 A;  3VF1 A;  4O8S A;  1RCK A;  3S29 A;  1ULI B;  1BRG A;  2STD A;  1IVV A;  1DVC A;  1FYS A;  1D6Y A;  4XBX A;  1JB4 A;  4N6M A;  1FGM A;  2INX A;  4RNY A;  1MWS A;  4Q53 A;  1YJ9 3;  3CCU 3;  3LZA A;  1BRI A;  2W9Q A;  4MMZ B;  1LOV A;  1A2V A;  1DMM A;  1N9J A;  5BU4 A;  1MWU A;  4QWT A;  1YJN 3;  1FGR A;  1OHO A;  3PCS A;  5DRE A;  3UL5 A;  1I0X A;  1WNH A;  2QEX 3;  4HM7 B;  2XEP A;  2QA4 3;  3CCL 3;  3NX0 A;  3E99 A;  4EYC A;  5BVB A;  2WGQ A;  1AVK A;  3WR2 A;  2OTL 3;  2BT3 A;  1VQP 3;  8RNT A;  4BL3 A;  3K9M C;  3T0U A;  1RJO A;  4JRF A;  2P38 A;  2SAR A;  4N6O B;  3UJM A;  1YHQ 3;  1BUQ A;  3V98 A;  3PGB A;  1JV2 B;  4NPB A;  2GEY A;  1GYB A;  2K54 A;  1IV7 A;  3KFQ C;  3OXA A;  1W02 A;  1GMP A;  4O02 B;  3DGY A;  5STD A;  1SAR A;  1LVN A;  3AHS A;  3GSP A;  5FW5 A;  3CCQ 3;  4FMA A;  3DGN A;  5IG3 A;  5EQL A;  1K28 A;  2GBX B;  4MMY B;  3NBR A;  5IG4 A;  1RDS A;  2IMJ A;  5BXQ A;  1MGW A;  5AYS C;  3WA2 X;  2SBL A;  3EN8 A;  1UCI A;  3AMO B;  3I56 3;  3D9R A;  3CC2 3;  3NV0 B;  1S72 3;  2KRT A;  2D1W A;  2YFL B;  3T8U A;  5EEO A;  1LOX A;  1EG9 B;  2HMK B;  2CIU A;  3FZW A;  1N8Q A;  3D4A A;  3PYJ A;  4XDW A;  2KF6 A;  2PNC A;  1OGX A;  1TTO A;  3F9S A;  1SPU A;  2XFS A;  3FKA A;  4AKZ A;  1S5A A;  4LSO A;  2GBW B;  1OUN A;  5IER A;  2KAA A;  1GY7 A;  1QAF A;  1YI2 3;  1BSC A;  3HK4 A;  1QAL A;  1B2X A;  1BIR A;  2XSH B;  3K7C A;  3Q2P A;  1I3F A;  2R4I A;  2CW9 A;  2KCD A;  1QMA A;  3NV0 A;  2P09 A;  2HMM B;  3GRD A;  3SVA A;  2WGO A;  3LTB A;  3SOA A;  3T8N A;  5M19 A;  3K0Z A;  2IUJ A;  4N3V A;  5JPP A;  4ORL A;  3X40 A;  3CME 3;  1NJI 4;  1Q7Y 4;  1Z1S A;  2ZL8 A;  3EHC A;  2CFD A;  1YGE A;  3CNM A;  3DM8 A;  5AEW B;  1LNI A;  1ISK A;  1B2M A;  2W56 B;  1X1X A;  3AHW A;  1BNF A;  3CCV 3;  1BRJ A;  1O7W B;  5G1L A;  3HIG A;  5I97 A;  1C54 A;  1GOU A;  3EB8 A;  1EKM A;  3NBJ A;  4OUQ A;  2UGI A;  5D82 A;  4NRE A;  1VZZ A;  2KXG A;  4EV5 A;  3EBT A;  3IMA B;  4KFE A;  2IUK A;  3AGN A;  4XBT A;  3G71 3;  2HMJ B;  1PY3 A;  3CXC 2;  1O7G B;  2OCT A;  3OX9 A;  2CFG A;  1Q40 A;  1BGS A;  1JB2 A;  1CYV A;  2XH9 A;  3CNX A;  5BIR A;  1YIT 3;  1LQM B;  4K90 B;  1RHL A;  4OVM A;  3KCH A;  3CU3 A;  3CMA 3;  1CH0 A;  1IK3 A;  9RNT A;  1CYU A;  1BNR A;  3ALA A;  1JNQ A;  1MNL A;  1LRA A;  4MJD A;  1MOL A;  3PCR A;  3BIR A;  1TFK A;  4RBN A;  1JJ2 2;  1SQW A;  1B20 A;  3FGY A;  4L8P A;  3WA3 A;  3RDE A;  1M9G A;  3F40 A;  4N6N B;  2KF3 A;  1BNS A;  5FGO A;  3NQY A;  4HBR A;  5LC6 A;  1UI7 A;  3X41 A;  1KC8 4;  2XGL A;  2CWV A;  3B8L A;  1R4Y A;  1UUG B;  4ILF A;  1VQ9 3;  3CD6 3;  2BMO B;  3HII A;  3KKG A;  2W9P A;  1RTU A;  3GZR A;  4U13 A;  2CWU A;  1RGC A;  3S27 A;  2H0G A;  2UUG C;  4CDL A;  3H3H A;  3M8C A;  3URP A;  4BTX A;  4XDV A;  1IU7 A;  1BAN A;  3OWS A;  1CEW I;  1WTH A;  5IF6 A;  5KP1 A;  1UCJ A;  3JUP A;  3S5C A;  2UX0 A;  1BNI A;  3NQZ A;  4X2H A;  2H0H A;  3B4O A;  4LYL B;  3LH4 A;  2HMO B;  2IA7 A;  3LYG A;  5CXO A;  3U1W A;  1AY7 A;  1RLS A;  5IG0 A;  2HMN B;  1I2F A;  2YFI B;  1W6Y A;  1RN4 A;  3V99 A;  3SOY A;  1KQS 2;  2CFL A;  1RNT A;  3QK9 A;  1VQ8 3;  3LOY A;  2GU1 A;  2F5M A;  3GZB A;  1BOX A;  3OWU A;  1O7P B;  1STF I;  1V74 A;  4HM6 B;  1OHP A;  3DZL A;  3HOH A;  1LOY A;  5G1K A;  1T5Y A;  4N6L A;  3EC9 A;  3NUV A;  3NM2 A;  5JBS A;  5AII A;  1G96 A;  1RGE A;  1MGR A;  3F8X A;  4KVH A;  1RRH A;  1RKY A;  4HVN A;  5CLK A;  1RRL A;  1MWR A;  2XFT A;  3J7Y d;  2C4B A;  4R4K A;  3SX1 A;  1RGK A;  1BNG A;  3DMC A;  4HM1 B;  4LEH A;  1V57 A;  1HYF A;  5IW9 A;  1A90 A;  1B2S A;  1GD4 A;  3KN4 A;  1C7H A;  1BRK A;  3BNB A;  5A0O B;  1STD A;  3JUN A;  1FGT A;  4CCV A;  1FGO A;  2C10 A;  3N54 B;  2W2C A;  1EA2 A;  3JUO A;  3K63 A;  4RNZ A;  4GL6 A;  3BLZ A;  6STD A;  2RCD A;  2B1X B;  1BNJ A;  2CX1 A;  3DUK A;  3FCS B;  3LT8 A;  3MPH A;  1Q9E A;  1BSB A;  1LNH A;  2WOH A;  4HKV B;  2BNG A;  1RGA A;  4KFF A;  1NO3 A;  2RGQ A;  1WMN A;  4FCM A;  4WHA A;  3BB9 A;  4GHO A;  5M18 A;  3MG3 A;  7STD A;  1A2K A;  1G02 A;  4WYK B;  3CCE 3;  3BNE A;  2M7O A;  1JZD A; 
#chains in the Genus database with same CATH homology
 3N8B A;  1UUV B;  2MF7 A;  3F8H A;  2CHC A;  1DMQ A;  2BMQ B;  1W01 A;  1K41 A;  1YIJ 3;  4LMI A;  1N5H A;  1TP6 A;  1NB5 I;  1QVG 2;  2Z77 A;  4HM5 B;  1IQX A;  1QVF 2;  2W56 A;  3Q90 A;  4K1U A;  1F8N A;  3F7X A;  3BND A;  3NXJ A;  1HU9 A;  2XRX B;  1PFP A;  3EQQ B;  5AIF A;  3QRD A;  3FG3 A;  1JKG B;  1M1X B;  1U5O A;  4FMD A;  3UL6 A;  1NDO B;  3WDG B;  5IEN A;  2ZDJ A;  2D42 A;  2OOV C;  3G6E 3;  2Z76 A;  3EX9 A;  3PXM A;  1Q40 B;  1U8C B;  4IT7 A;  5D83 A;  5IG5 A;  3KSE D;  5D81 A;  3WOD G;  1ROA A;  4HM3 B;  1VQN 3;  3VSY A;  1W4N A;  3JVC A;  5KP4 A;  2BHM A;  4FCJ A;  2WOF A;  2E2T A;  2LYX A;  2OQE C;  3NHX A;  3OW2 2;  2RFR A;  1ZX2 A;  1O7N B;  1OH0 A;  1OCV A;  1E3V A;  2JDI H;  3FF0 A;  2CK3 H;  2ML5 A;  3CC7 3;  2FGT A;  3MYT A;  1DYU A;  4NHF A;  4R80 A;  3S28 A;  1VQ6 3;  1IQY A;  3G4S 3;  2P0X A;  4FCZ A;  1GY6 A;  2CKF B;  3O8Y A;  1ULJ B;  4FMB A;  2K0M A;  2GXF A;  3MKI A;  3STD A;  1K9M 4;  1E97 A;  3X3X A;  1M1K 4;  3B4P A;  3CC4 3;  1OF5 B;  1TFO A;  4L8O A;  3CPO A;  4X2O A;  3B7C A;  3LTC A;  2F98 A;  4HJL B;  1L5G B;  2CFW A;  3LT9 A;  3KE7 A;  3IJE B;  2W04 A;  3RGR A;  5CF1 A;  2CG0 A;  1WQL B;  4WFO A;  3S67 A;  1UI8 A;  2OQE A;  1SII A;  2LQV A;  3MSO A;  4KZ1 A;  2FXT A;  4J9A A;  3F7S A;  3GZY B;  3JUM A;  1OPY A;  3HZP A;  1W6G A;  5JPU A;  3GAX A;  2BMR B;  4TX4 A;  4HM4 B;  3BNC A;  2W6J H;  1AR0 A;  2OWP A;  1RN7 A;  1US1 A;  3TDG A;  3HX8 A;  2GU3 A;  2ML6 A;  1NB3 I;  1M90 4;  1WMO A;  3I55 3;  3MG2 A;  3RGA A;  2O3O A;  4J8T A;  3AMO A;  1D6U A;  3FF2 A;  4H61 A;  1R4C A;  4LGQ A;  5KP3 A;  2GEX A;  4R9L A;  1ROV A;  2W0Q A;  4HZ9 B;  1W00 A;  1K73 4;  5ELJ A;  1ASK A;  1Q81 4;  5AIH A;  3VGN A;  1UUW B;  3DGL A;  1OHS A;  4MMX B;  3MG1 A;  3X3Y A;  3FG1 A;  3MWZ A;  2CFK A;  3G16 A;  3ECF A;  1TIJ A;  3PS8 A;  3V92 A;  4N6V 0;  1HKX A;  1OAC A;  3U97 A;  4MEI A;  3FG4 A;  4FR9 A;  2WO0 A;  1IVW A;  4XM4 A;  2Q07 A;  3IPT A;  4JF8 A;  1W7C A;  2B24 B;  2E2U A;  3CCJ 3;  1GD3 A;  1O7H B;  2RSX A;  3EN1 B;  1J2B A;  2OOV A;  5TGN A;  3LTD A;  2CH9 A;  1KD1 4;  1GS3 A;  4O2H A;  1GY5 A;  1Q82 4;  4N6U A;  1SJW A;  1JN5 B;  3K5T A;  2FNQ A;  1IT7 A;  3SED A;  1AVL A;  3GZX B;  4IPB A;  1W2B 2;  2P0M A;  2I9W A;  2Z7A A;  3WOF B;  1JB5 A;  1FGQ A;  2QGU A;  4STD A;  2XF3 A;  3FH1 A;  3KZT A;  4LZI A;  2Z6B A;  4EBG A;  1IQ8 A;  5AI1 A;  3OV4 A;  1UW1 A;  2F99 A;  1EQK A;  1FUW A;  3N9H A;  2CC3 A;  1PU4 A;  2HML B;  2CWT A;  4EXR A;  1QJG A;  1QAK A;  2MC8 A;  1IDP A;  4EV2 A;  4OK0 A;  2A15 A;  1IVX A;  4R9K A;  4ZM8 A;  5G2G A;  3CCM 3;  1Y4K A;  3EE1 A;  3CCS 3;  1NWW A;  3G8Z A;  4BTW A;  2OTJ 3;  1N5P A;  8CHO A;  1KSI A;  1NU3 A;  3LXU X;  1W2Z A;  3OWY A;  1OF5 A;  2C11 A;  3DXO A;  5AYR B;  1IT8 A;  3NBB A;  5CK6 A;  4K61 A;  1VQL 3;  3HI7 A;  1VQM 3;  1VQK 3;  1IVU A;  4R1K A;  1ZO2 A;  1YJW 3;  3GWR A;  1N8R 4;  3F14 A;  1IV9 A;  3A76 A;  5DRV A;  3D3L A;  3EBY A;  2F86 B;  4XBY A;  1Q42 A;  3UB1 A;  5IEO A;  3ROB A;  4AKY A;  2L4V A;  1SIH A;  1DVD A;  2CG1 A;  5HGR A;  3DY5 A;  2O9U X;  1TUH A;  1W5Z A;  4O3V A;  3SXX A;  3H51 A;  4EC6 A;  3FSD A;  1DMN A;  4HYZ A;  4XB5 A;  5IEP A;  1OGZ A;  3L0R A;  4G1M B;  4BTY A;  4PEJ A;  1CQS A;  2XGN A;  4RZM A;  2E2V A;  4L7K A;  1KWI A;  4HM8 B;  2BO9 B;  1JRQ A;  4GB5 A;  5LC7 A;  2PZV A;  4WWU C;  4WYK A;  2W03 A;  3KSP A;  3WOE B;  4AEQ A;  2QIY A;  2V1L A;  4FMC A;  4KFD A;  3KII A;  2Y74 A;  5ELU A;  3EJV A;  1LXE A;  5EVH A;  3LML A;  2XR8 B;  4WP5 A;  1K8A 4;  4HM2 B;  1VQ7 3;  3X42 A;  3EF8 A;  3SLU A;  3MHE A;  3DGM A;  3ER7 A;  1VQO 3;  5AEU B;  3X3Z A;  3PZW A;  2YX9 A;  2Y73 A;  1N9E A;  3FLJ A;  3WMD A;  3Q1C A;  1Q86 4;  1VQ5 3;  3UNL A;  1E3R A;  3LTA A;  1JKG A;  2YFJ B;  2P05 A;  5AIG A;  3JUQ A;  4IIA A;  1VQ4 3;  1A67 A;  2XSO B;  1O7M B;  2JQ5 A;  3NM7 A;  4I4K A;  1JN5 A;  4K1V A;  3DGO A;  4H3U A;  4N6T A;  3CPW 2;  3CCR 3;  1AV4 A;  1YVB I;  3I0Y A;  1W6C A;  3G0K A;  1WMP A;  1TU5 A;  4HM0 B;  1D6Z A;  5CF2 A;  1FA3 A;  3VF1 A;  4O8S A;  3S29 A;  1ULI B;  2STD A;  1IVV A;  1DVC A;  1D6Y A;  4XBX A;  1JB4 A;  4N6M A;  1FGM A;  2INX A;  4RNY A;  1YJ9 3;  4Q53 A;  3CCU 3;  3LZA A;  2W9Q A;  4MMZ B;  1A2V A;  1N9J A;  1DMM A;  4QWT A;  1YJN 3;  1FGR A;  1OHO A;  3PCS A;  5DRE A;  3UL5 A;  1WNH A;  2QEX 3;  4HM7 B;  2XEP A;  3CCL 3;  3NX0 A;  3E99 A;  4EYC A;  5BVB A;  2WGQ A;  1AVK A;  2OTL 3;  2BT3 A;  1VQP 3;  3K9M C;  3T0U A;  1RJO A;  4JRF A;  2P38 A;  4N6O B;  3UJM A;  1YHQ 3;  1BUQ A;  3V98 A;  3PGB A;  1JV2 B;  2GEY A;  1GYB A;  2K54 A;  1IV7 A;  3KFQ C;  3OXA A;  1W02 A;  4O02 B;  5STD A;  1LVN A;  5FW5 A;  3CCQ 3;  4FMA A;  3DGN A;  5IG3 A;  5EQL A;  1K28 A;  2GBX B;  4MMY B;  3NBR A;  5IG4 A;  2IMJ A;  5BXQ A;  5AYS C;  3WA2 X;  2SBL A;  3EN8 A;  3AMO B;  3I56 3;  3D9R A;  3CC2 3;  3NV0 B;  1S72 3;  2KRT A;  2D1W A;  2YFL B;  3T8U A;  5EEO A;  1LOX A;  1EG9 B;  2HMK B;  2CIU A;  3FZW A;  1N8Q A;  3PYJ A;  4XDW A;  2PNC A;  1OGX A;  3F9S A;  1SPU A;  2XFS A;  3FKA A;  4AKZ A;  1S5A A;  4LSO A;  2GBW B;  1OUN A;  5IER A;  1GY7 A;  1QAF A;  1YI2 3;  3HK4 A;  1QAL A;  2XSH B;  3K7C A;  3Q2P A;  2R4I A;  2CW9 A;  2KCD A;  1QMA A;  3NV0 A;  2P09 A;  2HMM B;  3GRD A;  3SVA A;  2WGO A;  3LTB A;  3SOA A;  3T8N A;  3K0Z A;  2IUJ A;  4N3V A;  5JPP A;  4ORL A;  3X40 A;  3CME 3;  1NJI 4;  1Z1S A;  2ZL8 A;  3EHC A;  2CFD A;  1YGE A;  3CNM A;  3DM8 A;  5AEW B;  1ISK A;  2W56 B;  3CCV 3;  1O7W B;  3HIG A;  5I97 A;  3EB8 A;  1EKM A;  3NBJ A;  4OUQ A;  4NRE A;  1VZZ A;  2KXG A;  4EV5 A;  3EBT A;  3IMA B;  4KFE A;  2IUK A;  4XBT A;  3G71 3;  2HMJ B;  3CXC 2;  1O7G B;  2OCT A;  3OX9 A;  2CFG A;  1Q40 A;  1JB2 A;  1CYV A;  2XH9 A;  3CNX A;  1YIT 3;  4K90 B;  4OVM A;  3CU3 A;  3CMA 3;  1IK3 A;  1CYU A;  3ALA A;  1JNQ A;  1MNL A;  4MJD A;  1MOL A;  3PCR A;  1TFK A;  4RBN A;  1JJ2 2;  1SQW A;  3FGY A;  4L8P A;  3WA3 A;  3RDE A;  1M9G A;  3F40 A;  4N6N B;  5FGO A;  3NQY A;  4HBR A;  5LC6 A;  1UI7 A;  3X41 A;  1KC8 4;  2XGL A;  2CWV A;  3B8L A;  1VQ9 3;  3CD6 3;  2BMO B;  3HII A;  3KKG A;  2W9P A;  4U13 A;  3GZR A;  3S27 A;  2CWU A;  4CDL A;  3H3H A;  3M8C A;  4BTX A;  4XDV A;  1IU7 A;  3OWS A;  1CEW I;  1WTH A;  5IF6 A;  5KP1 A;  3JUP A;  3S5C A;  2UX0 A;  3NQZ A;  4X2H A;  3B4O A;  3LH4 A;  2HMO B;  2IA7 A;  3LYG A;  5CXO A;  3U1W A;  2QA4 3;  5IG0 A;  2HMN B;  2YFI B;  3V99 A;  1W6Y A;  3SOY A;  1KQS 2;  2CFL A;  3QK9 A;  1VQ8 3;  3LOY A;  2GU1 A;  3GZB A;  4HM6 B;  3OWU A;  1O7P B;  1STF I;  1V74 A;  1OHP A;  3DZL A;  1T5Y A;  4N6L A;  3EC9 A;  3NUV A;  3NM2 A;  5JBS A;  5AII A;  1G96 A;  3F8X A;  4KVH A;  1RRH A;  1RKY A;  4HVN A;  5CLK A;  1RRL A;  2XFT A;  3J7Y d;  4R4K A;  3SX1 A;  3DMC A;  4HM1 B;  4LEH A;  5IW9 A;  1A90 A;  1GD4 A;  3KN4 A;  1C7H A;  3BNB A;  5A0O B;  1STD A;  3JUN A;  1FGT A;  4CCV A;  1FGO A;  2C10 A;  3N54 B;  2W2C A;  1EA2 A;  3JUO A;  3K63 A;  4RNZ A;  4GL6 A;  3BLZ A;  6STD A;  2RCD A;  2B1X B;  3DUK A;  3FCS B;  3MPH A;  5D82 A;  3LT8 A;  1Q7Y 4;  1LNH A;  2WOH A;  4HKV B;  2BNG A;  4KFF A;  1NO3 A;  2RGQ A;  1WMN A;  4FCM A;  4WHA A;  3BB9 A;  3MG3 A;  7STD A;  1A2K A;  4WYK B;  3CCE 3;  3BNE A;  2M7O A;  4HZB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...