4R1NA

Crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
282
structure length
282
Chain Sequence
MKKVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEADKEEILSRISGTTDMKLAADCDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSLSITEVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEVAEAPGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPMGPLALGDLIGLDVCLAIMDVLYNETGDTKYRASSLLRKYVRAGWLGRKTGKGFYDYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase from Clostridium butyricum and its mutations that enhance reaction kinetics
pubmed doi rcsb
source organism Clostridium butyricum e4 str. bont e bl5262
molecule tags Oxidoreductase
molecule keywords 3-hydroxybutyryl-CoA dehydrogenase
total genus 115
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.157: 3-hydroxybutyryl-CoA dehydrogenase.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4r1nA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r1nA01
3L4BC 3UCXA 1NASA 4ZGWA 4L8VA 2I9PA 4E3ZA 3I23A 2QX7A 3WMWA 4B3HA 4Q3NA 4QO7A 4E32A 4OYRA 4JP3A 2AXQA 1DFGA 2BELA 1A9YA 4R1TA 3DBVO 4BGIA 3TPCA 3BMOB 1NPYA 2PGJA 5G4LA 4YXFA 1UP6A 3K8ZA 4YQZA 4MVJA 3OQ6A 4RF2A 5A9TA 4YAIA 1QR6A 1O8CA 1NX6A 1UDCA 2CVOA 4NK5A 4IJWA 1FJHA 1B2LA 1OMOA 4FSHA 1PIWA 4J9VA 5DCYA 1LDBA 4OAQA 4DTIA 1DC4A 2DUUA 1WDKA 4NBRA 2E48A 5KJCA 3FBTA 4H16A 1UXJA 1T1SA 5AXAA 3AUTA 1J49A 2X0RA 4TMFA 4IBOA 3WJAA 1PX0A 1V6AA 2NM0A 4BNXA 2B37A 3GDGA 3MEQA 5DBGA 4N54A 4FC6A 4Z6KA 4AJEA 1E7RA 4J0EA 3HJAA 4D3SA 1O9BA 4TRRA 3LLVA 4YT5A 1R4MA 3AOEA 4J1SA 2X9VA 4ZVVA 4GLLA 4N5MA 3D3WA 3IUSA 4OKNA 2IZ1A 5DOZA 3NDRA 4HFNA 2ZATA 1GYPA 4WLVA 1K89A 3F5SA 3DHNA 4MVJD 4QX6A 4BNJA 5GZ3A 1D7OA 4WPGA 3R6DA 4YPOA 3ZNPA 4AJNA 1A4IA 3WGHA 5BSHA 3I9MA 3WDSA 3GRPA 1ZZEA 3VKVA 1R16A 1Q0LA 2NWQA 4NBWA 5A06A 1K6XA 1P74A 4B8ZA 4CQMD 2GASA 1E1KA 5BNTA 4XGNA 4HXYA 3TZQA 1LQUA 1ONOA 3GFBA 1EMDA 1UXIA 1NFQA 3JQCA 4YEDA 5A4DA 4XGIA 5DT9A 5F5LA 4I9HA 4MVJM 1ZW1A 4KQXA 1BG6A 5HS6A 1C0PA 1M67A 2D0IA 5LDGA 3U4HA 1Z7BA 2NVUB 2DBQA 5CG1A 3OJLA 4FFPA 1MB4A 4WLEA 3DAFA 4YDRA 4DBZA 4JK3A 5ILOA 1HL3A 1GCOA 4FFRA 2BH9A 1T2EA 1H93A 2GNAA 3ON5A 5A3JA 3JQFA 1VSUA 1HDZA 1YVEI 2XXJA 3JQAD 3O26A 3PGXA 3V1UA 3WOHA 3QSGA 2Y1FA 2EGGA 1RM0A 2CZCA 4NJMB 3G0OA 3T7CA 4XJSA 1L7DA 3CINA 2DTEA 3EZLA 1B7GO 1HDCA 1NPTO 3H65A 1EVZA 4ZICA 2CD9A 3C1OA 3I5MA 3UGKA 5JDIA 4BMVA 3NTQA 1IHXA 2VYND 3TDKA 3WGIA 5KJFA 1LSSA 4GGOA 5J23A 3PRJA 1O0SA 1PSDA 3IJRA 3DC2A 4XEHA 2GR9A 3GVHA 2EIHA 3FD8A 2NADA 3JQGA 3K6JA 5JSFA 2CF6A 4PRLA 4NK4A 2DPHA 2FR8A 5AYVA 5IN5A 4E2ZA 3C1AA 3F1LA 4E5KA 1ZJYA 1D8AA 4XB2A 1E7SA 1PJQA 2VZ8A 2Q1UA 5KKAA 1ADGA 3ITKA 1E3WB 3AM3A 4KP7A 4BO5A 4K6CA 4P4LA 5JPIA 1QYXA 2VT2A 4ALJA 3BA1A 1T4BA 2EP7A 1ZK2A 5KJ1A 4TRJA 1VL8A 2Q49A 2D1YA 1NQOA 2Y93A 1GYRA 1U5CA 4GX5A 3RU7A 3I4FA 3EAGA 5TX7A 5JXWA 2BGKA 1LDNA 3WGTA 4YRBA 4NQZA 2J5KA 3GZ4A 4D3FA 1NPDA 1VL6A 2EG9A 1D1SA 2HLPA 3AY6A 3IKTA 3JQBC 1BHSA 2H6EA 4OSOA 2Q45A 2PKQP 3ZWPA 2VUSA 1IY8A 3RC1A 4U0JA 2X5JO 1Y8QB 2DT5A 3SC4A 2NVBA 4CMCA 3DZFA 4O63O 3W8EA 4ZRNA 1EQ2A 5IDXA 2O2YA 3OICA 1H6AA 1HYGA 3U5TA 3ENNA 5JW6A 3ZNOA 2D3TA 1EDOA 1P33A 1Z7EA 2PK3A 3OQBA 3DOJA 4EITA 1IOLA 1LLDA 1UAGA 3WFIA 1BXGB 3KM0A 1SCUA 4P8RA 4AJ4A 5I7SA 4OL9A 1UP7A 2BFMA 3H5RA 3WWYA 1C14A 2OBNA 4GMFA 4YB8A 3QQPA 3G79A 3QWHA 2FN7A 4IQ8A 1JTVA 5FYDA 2XF8A 3GRKA 1TA4A 3I9NA 3ANNA 4JNKA 4QEDA 4BB5A 1PS8A 1JWBB 1ZVMA 4YA6A 5B4TA 2CUKA 4E13A 1U3TA 1MC4A 2B36A 1Y8RB 1ZFNA 2O4CA 1LRJA 2IODA 3TWOA 1U7HA 5KJ6A 2DLDA 3P2OA 4WGGA 3LF2A 3C7DB 5JDCA 3BTUA 1WZIA 1R0LA 5K6AC 1HTBA 4MVJF 1M66A 2J3KA 4FS3A 4O5OA 4OO3A 1M6WA 1YRLA 3S2FA 2O3SA 2O23A 4BKRA 4D0SA 3I3OA 4YJFA 4BKOA 4CQLA 3CIFA 5ITWA 2V6GA 1ADBA 4XRRA 4LSMA 3UVEA 3GG2A 3FBGA 5L4NA 1R4NA 5JAMA 1YE3A 2QQ5A 3BMNA 1AXEA 3GNQA 2G76A 1CQIA 4WNCA 1BDBA 1FDWA 4A5OA 5IXYA 3V8BA 4BO3A 3RSHA 3ZGYA 4H15A 4GX0A 4K6FA 4UUNA 3Q1LA 3VOSA 3CPSA 1QSGA 1GZ3A 1YBMA 2DBZA 2P9GA 2Q2VA 1NFFA 2YDXA 3HG7A 1TT7A 1MXFA 2C5AA 2PWZA 1KEVA 4IGFA 1T24A 1ZIDA 2AQHA 1PJ2A 3ZW8A 5CEEA 1YH3A 3RFVA 4DWVA 1IL0A 3ZV5A 1G0NA 3NYWA 3IJPA 3GEDA 1W0CA 5A9RA 3HB5X 3JQFC 4J7UA 2DPGA 1BW9A 1PJCA 2BRUA 3KLMX 4H3VA 1KY4A 1K2WA 2BGMA 3U3XA 2EJVA 3K92A 4JBGA 4D46A 4J43A 4UEJA 1QYWA 5JDIC 3MJCA 3AOEC 3VPXA 1FXSA 1DB3A 4OIMA 4WEOA 1AXGA 1LBEA 2A94A 4GVXA 4NBUA 3SLGA 3W4IA 3WLFA 1HDOA 1N8KA 1YL5A 3SVTA 4PLYA 2W8ZA 4TKMA 4B4OA 3NJ8A 1A7KA 5L7TA 3JQ9C 3PZRA 1PQPA 4PZDA 2Q50A 4WOKA 2YZ7A 2P9CA 1ISHA 1DLIA 3LYLA 2WSBA 4CL8A 3ZWVA 3C8MA 2VNAA 3DO5A 4FFOA 3K2EA 3GVCA 3MJ4A 5G0WA 1TLTA 4W99A 1HYHA 2JAHA 4IINA 2H63A 5F5NA 3EW7A 2B4RO 4TVOA 5JAQA 4D79A 5JCJA 1PZHA 2Y0DA 1AHIA 3H9JA 1OFGA 4QTZA 4TWRA 1LI4A 1UZLA 5DP1A 4M89A 4D41A 5C37A 4MIEA 1P1IA 1UH5A 1IB6A 4YT2A 2A35A 2EWMA 3H3FA 3KB6A 4GAEA 3GK3A 3GNTA 4BKQA 2Z1NA 4XD2A 1SMKA 4J6FA 1YL7A 4XYLA 2IZZA 4JN6B 3GHHA 2PZLA 2WEKA 4FGWA 4Q3EA 4WLNA 5CDYA 3PYLA 3GC6A 1HDRA 3RUFA 3WMXA 2HJSA 5C5IA 3GPIA 4XYEA 3B1KA 1KC1A 1P45A 2AHRA 1TI7A 1PJSA 2ZCUA 1E0DA 2GN9A 1AHHA 1E7MA 1DJNA 1I10A 3ITDA 3PQEA 2RAFA 3TZ6A 4EYEA 3JYLA 5DULA 3F4BA 2DAPA 2QZ9A 4P4GA 1E7WA 1PL7A 1JAYA 4K1LA 3F3SA 3RCBA 1ZK1A 5FI5A 2WYUA 3ORFA 4RLHA 2EW2A 4R4JA 3BHIA 1U5AA 3QWAA 1YDEA 3HDYA 1UXHA 4KDFA 4WE3A 1X0VA 3JYPA 1PQWA 1FK8A 3OSUA 3C85A 4MOWA 4NPCA 4GMGA 1LDEA 5THQA 5BQFA 2NTVA 5T67A 3RJ9A 3PK0A 3M1AA 4BNKA 1P44A 4RQUA 3RASA 4QSMA 1RM4A 1PZEA 4GQAA 4QFCA 1I32A 1WPQA 2NNLD 4GGPA 3LZ6A 3ANLA 1XWFA 5AOVA 4XYGA 3OA0A 4JIGA 1OBFO 1BTOA 3L6DA 2EF1A 3BMQA 5F1PA 5AXCA 1PEDA 1JVSA 3TQHA 3SC6A 3EZYA 1GUYA 3RBZA 4Q39A 4ND4A 3PZBA 3QWBA 4ESOA 3ZDFA 4Q9NA 5F3RA 2LDBA 5T8KA 1A5ZA 3PTZA 4AJJA 2VWGA 2QYSA 5JMWA 4RVFA 5FEUA 2CVQA 3HZZA 1GQYA 1NM5A 5EERA 3GG9A 4BUCA 3RKRA 3GA0A 5L40A 2FWMX 4WUVA 3CMMA 3KYDB 2WD7A 5H81A 2IYPA 4RZIA 2W4QA 2GSDA 1PGOA 1ZNQO 3PLNA 1LSJA 3CXRA 1VLLA 3WGOA 2PKQO 3TL3A 5IDQA 2FP4A 2J3HA 5A9SA 3UF0A 2O3JA 1P1HA 4CM1A 1LA2A 2FR1A 1A27A 3C3XA 1I3NA 2WWRA 1C1DB 1NR1A 1JKJA 1F06A 2O4UX 2VWQA 4PLVA 3A4VA 1EVJA 3DXFA 1P1JA 1CYDA 1EDZA 3WSVA 4DIBA 4RPJA 1K5HA 4PLPA 1YONA 4YWJA 4R68A 2VUUA 4JROA 3DTYA 3Q9NA 5B37A 4DRYA 5F1OA 5TC4A 5TJ9A 3INGA 2O2SA 4W9NA 1ZUD1 3IL2A 2HDHA 1HSZA 3E9NA 3DONA 2FHSA 5L9AA 3INTA 3R3SA 2PZJA 3ICPA 3HSKA 1D1TA 1F8FA 1IZ9A 2GN4A 2X9GA 3VPGA 2PA3A 3RKUA 1BVRA 4R1NA 3VPFA 5CFZA 3VPSA 1HZJA 1TEHA 2Y1DA 1DC5A 4J1NA 1NBOA 3QE3A 5I7FA 3U09A 2I66A 2WDZA 2V65A 1KVRA 5KNLA 3WQSB 1P1RA 3DHYA 4IMPA 1IPFA 3NGXA 3O4RA 5ES3A 2BFPA 3AM5A 3IQDB 4YYZA 4NBTA 2W90A 4IPTA 5JFOA 1K6JA 5IJZA 3CTVA 3KYBA 2B4QA 2Q4BA 1QYCA 2YV2A 2B0JA 3WTCA 4N7RA 4DUPA 1TVEA 1E6WA 2P91A 3I1JA 2PZMA 1Q7GA 3GDFA 1EEHA 1QG6A 1A4UA 3PHIA 3SJUA 5K6AA 1E3JA 3TN7A 3VVBA 3K9QO 3JD2A 1H9AA 4WOJA 4F45A 4LVUA 4CM4A 1PR9A 4ND3A 2EXXA 1KVTA 1LX6A 3PJEA 3UHAA 3OA2A 5K9ZA 1PL8A 4XA8A 1MUUA 4UEOA 1LQTA 1O95A 3LC2O 4II3A 5DF1A 3TFQA 4Z3KA 1D4FA 2BHLA 1Q7CA 4TRNA 3BTSA 4K28A 3H3JA 5B4UA 4FW8A 3LT1A 3ZW9A 3WFJA 2CVZA 1GU7A 5BT9A 4OXNA 2EGHA 5JY6A 3OM9A 5ENDA 2DC1A 3DBLB 1YO6A 4A73A 2BD0A 1P9LA 3GVPA 5EMHA 3NDIA 3PFWO 3EDMA 4CV0A 1E6UA 1UR5A 1GADO 1GV1A 4ROSA 4BNFA 5IZCC 1NR7A 3KVOA 4PN3A 3VC7A 4U6SA 5EQFA 1BW9B 1HDXA 4BO8A 4PLTA 2C29D 5L51A 2CNBA 5JY1A 2FZWA 2BI7A 5JO9A 2VRCD 1J6UA 4BKPA 2I6TA 1ONPA 2V6BA 3W8DA 5KJEA 3SLKA 1VRWA 1G6KA 1Y8RA 1CIVA 3A28A 2J5QA 2Z5LA 3KYCB 1GPJA 3B1JA 4R3NA 4CMGA 5KOIA 4ND2A 4C4OA 5CPBA 4INAA 5EESA 4DREA 4XGKA 3I9OA 3ZU5A 4EUHA 3IUPA 4MKRA 3DOCA 5T5QA 1YQDA 5CDSA 4BMNA 4N18A 4IDFA 1U28A 5T8KC 1H0KA 4OH1A 3RFTA 1MFZA 4EW6A 1YDWA 1YBVA 2YYYA 3NAQA 4CLOB 4JLWA 4CM6A 1V9LA 2YW9A 3DZIA 1L1FA 1WAMA 2WM3A 4AJIA 3ANMA 1XQ6A 4MKXA 3TZHA 4FCCA 3AI1A 4KTVE 2JCVA 4KWIA 4NDNE 1LUAA 2WTBA 4D42A 4UUPA 4I08A 3JYNA 3ST7A 1GQQA 1XYGA 2OBYA 3CUKA 5T57A 2JHGA 3GQVA 3DZJA 4ZQFA 4LK3A 3PI7A 5COQA 3QA9A 3VDQA 5C7LO 5AXBA 1C0LA 4RVSA 1Y5RA 3R1IA 3VH1A 1WP4A 3ZNQA 3K73O 5BNFA 5KIAA 4J90A 4NFYA 1EZ4A 4FJ0A 5EQDA 1U4SA 1AE1A 4XDZA 2C7VA 2X0NA 1B8UA 4O1MA 1DRUA 1CERA 1EBFA 4MVJP 1EE9A 3RBXA 2NLOA 2Q1SA 3C24A 4EBFA 1PJ3A 2X4GA 1DIBA 4ZA2A 4XB1A 5IZ4A 3AWDA 3DEYX 4G81A 4XZ3A 3WLEA 4HBGA 4BGVA 1LRLA 1LU9A 1DO8A 1I2CA 2NU8A 3OIGA 3FNEA 1GEGA 4BKUA 1GZ6A 1YBAA 5MGBA 3L0DA 1TXGA 5CDUA 4L4XA 1PTJA 1YQGA 1M75A 4XJTA 2OXIA 1YQXA 2A9FA 4Q3CA 3ZN2A 1CJCA 1QXSA 3AU8A 1ISMA 1NWCA 4A26A 4HNGA 3JQAA 3GVIA 1LC3A 2B5WA 2IXBA 1I3KA 4J9UE 4RGBA 1QLHA 3HQ4O 3JTMA 1X13A 4DA9A 3Q3CA 4QO8A 2P2SA 3EC7A 2DFDA 4PVDA 4Y6PA 2VRBA 3ZV3A 1DIAA 3DDNA 4GH5A 1X15A 3JYOA 4ALIA 1UP4A 1RKXA 3TFOA 3ULKA 3QP9A 3GH3A 1DAOA 4CM9D 3V2HA 3HUDA 4J16A 3HWRA 4LISA 2O48X 4MP8A 4CMHA 1P1KA 2VUTA 5U4QA 1U3VA 2EEZA 4XR9A 3ADPA 1Q0HA 1WWKA 1PGQA 1SZJG 4AFNA 4CLXA 2VYVD 4MVJI 2XOXA 3OEWA 3GMSA 3LT0A 4AICA 5A1TA 4G5HA 4BO0A 4IIUA 4TKLA 3S55A 5IF3A 3VH4A 2X8LA 1IZ0A 3H2SA 2GPTA 3DBLA 3U0BA 2Y67A 5JS6A 3MJEA 3OECA 2A4KA 4ZQBA 5DNAA 2JD0A 2RHRA 5LCXA 1E5LA 3COSA 5KVVA 1YS4A 3KBOA 1KEPA 4BO2A 4LMPA 1ZCJA 5JAIA 1A7AA 4ZJUA 3ZNNA 4XQCA 1EUDA 1CQJA 2NU6A 4IDEA 5DOVA 1EK6A 1B3BA 3DL2A 5G0VA 4XR4A 4L74A 1ISFA 1ZEJA 3Q2IA 3VZSA 4GVLA 5A02A 2JL1A 2JFFA 2AMFA 3G1UA 1Y7TA 3JQDA 1ULUA 1XELA 3U49A 3I52A 2D59A 4D44A 1GEEA 5BR7A 1HF3A 2HCTA 2WMDA 2Y1EA 3PGJA 1U1IA 5HRUA 3FPLA 1SNYA 4LMRA 4CMIB 3PHGA 2PH3A 2GZ1A 1ID1A 2UAGA 3QY9A 4YR9A 3KO8A 3JD0A 3SXPA 4DC0A 2PZKA 1PR3A 2GZ2A 2D8AA 4RVDA 4DQUA 1NXQA 1A71A 2J3JA 5DCWA 3DZGA 4QT0A 3GGOA 3IDSA 1HE3A 3QVWA 1Z73A 4MKZA 1PWZA 4U8GA 1GDHA 4PG8A 1MV8A 2NTNA 1XDWA 4M1QA 3K31A 4R5HA 4CMIA 5CDGA 2IZ0A 1UJMA 3VPHA 5TJHA 4D45A 1H94A 3FWZA 4GI2A 4YTEA 2WD8A 2BI8A 4OOEA 4AJPA 1R4MB 4Q3BA 3A9WA 2PGLA 2FZEA 4RV9A 4ALNA 2Y1CA 1MG0A 2H9IA 4RDHA 3RIHA 1X0XA 3JQAB 1QMGA 1XQ1A 3H5NA 3OMLA 3L9XA 1F8GA 4BO6A 1IPEA 4IDAA 4RQTA 5TNXA 1YJQA 2X58A 5A3VA 4XYBA 5JBIA 4H7PA 1Q1NA 4Q3AA 1T1RA 1V0JA 4RVHA 3TL2A 3NJ4A 1HSOA 1JU9A 4G2NA 2DU8A 5ADHA 3Q0EA 4F6LA 5U9CA 4NBVA 4UVGA 3RROA 4D7AA 4YT8A 7ADHA 1X14A 2D5AA 2ZB7A 3FNHA 1WVGA 3U62A 3UOGA 1VSVA 4A10A 4YAGA 4FD3A 5DZSA 1C1DA 3ROQA 2Y1GA 3O38A 1XLTA 3Q6IA 4OXYA 5LC1A 5IDWA 3W1VA 5GZ6A 9LDBA 4PLFA 1I30A 4EEZA 5CG2A 3PIIA 3FR7A 1LTHR 1ZK3A 2O3TA 3ZI0A 1E3EA 1PJLA 1JWAB 1IULA 4LCEA 3ONFA 1ZMOA 4R5MA 4AG3A 2X7HA 3CKYA 4YRDA 2HMWA 3AM4A 3IS3A 1VC2A 1TB4A 1KYQA 2GD1O 4XKJA 4J1TA 5G4KB 4P4NA 3FF4A 3LDHA 2XAAA 4NNJA 2POQX 4WCFB 1OAAA 4XQGA 3HFSA 3C1TA 1ENZA 4KWHA 1C3VA 3ADOA 4PG5A 2HMUA 1GYQA 1UXKA 2NVUA 1DIGA 3QIVA 1DXYA 4FR5A 1A72A 4N5LA 2AE1A 5ER6A 2FR0A 3AY3A 4FOOA 3MWDB 1OC4A 3F1KA 3AW9A 4RO0A 2PNFA 2SCUA 4WKGA 4ZQHA 3KETA 3WXBA 1C1XB 1H6BA 1L7EA 1E3WA 1RM5A 1H2BA 5CAEA 2UVDA 4OMUA 3WNQA 2JCYA 2JFGA 1O94A 4DPMA 1T2CA 1PZFA 3IMFA 4L75A 3X2FA 4XIYA 1LDMA 1EVIA 3KEOA 5I8ZA 3WB9A 3V1TC 1CF2O 1GV0A 1NAHA 1YKFA 3MJTA 3PYXA 1S7CA 1P1FA 2YHUA 2LDXA 1ML3A 2O7SA 4A03A 1EQUA 5A9SB 2I99A 4WNIA 2ZTMA 2E37A 1MFPA 5IG2A 2PKRA 1I24A 1C0IA 1Q2XA 5H83A 4EJ6A 4PGFA 1M76A 4K9DA 3TOXA 4PG6A 5JMPA 3OJEA 4O59O 4RDIA 4AJOA 1T2DA 3DB2A 4MVJH 3TF5A 3M2TA 4FJ2A 4BOYA 5EL0A 1LLUA 4W4TA 3S1LA 3PEFA 1PS0A 3OJOA 2WJPA 2FRDA 4IDBA 1DPGA 2WYVA 1U4OA 4OGWA 4HFRA 4ZN6A 5EN4A 1YB5A 2GUGA 1V8BA 4BQRA 3LT4A 2AW5A 2HRBA 2ZTVA 4EZBA 3F47A 3FNFA 3DZBA 3QJ5A 4NJOA 1C0KA 4LVCA 1VPDA 4E5YA 2DTDA 4E12A 4J0FA 4DYDA 2GDZA 2NQTA 3T4XA 4E5NA 3H4VA 3UUWA 3EYWA 1JVBA 3ZWAA 5L7YA 2VWHA 6LDHA 4PFJA 3WICA 3WNVA 3R0IA 3ZWCA 3WS7A 3WGQA 4B4WA 2ZB8A 1DSSG 2NTJA 5HBRA 2PLAA 2XPCA 5JO0A 2D4AA 2OFPA 3IIEA 4IZIA 2E4AA 4KZPA 1WMAA 1EVYA 2PFGA 4HUJA 3U4IA 1MP0A 4BMSA 1PS9A 4QECA 1F0YA 3ROMA 5B4VA 3O8QB 2VYNA 1ZK0A 4PLGA 3EY4A 2GN8A 2FSVA 3RJ5A 3VTFA 3E8XA 3QV1A 1DRWA 1GAEO 3ZWNA 5B12A 2QHXA 3ZCXA 2FPIA 3GLQA 4R1UA 3LQFA 5TLSA 2OP0A 4RCVA 2GCGA 1NNUA 3QVXA 2HU2A 1LSUA 5EIOA 1VKNA 3JQ7B 4CM8A 4DL9A 4GWKA 4IJVA 2I3AA 2PD3A 3AI3A 3BIOA 1QKIA 1Y81A 5G0UA 3RI3A 3UCEA 2EHDA 3EK2A 4J4HA 2AQKA 2VOJA 4BO4A 5L53A 1ZO8A 3K30A 2YUTA 2BGLA 1LNQA 1R0SA 2JD2A 1B14A 3GMDA 1BWSA 1MA0A 3E9QA 1LLQA 4CJXA 1RYEA 4JBIA 1P0CA 2JKVA 1PL6A 3HHPA 2ZIZA 1DFIA 4MVJG 5CDTA 2VCYA 3STHA 5IFLA 1XGKA 2Z1MA 5IXSA 4FDAA 3O9ZA 4I5FA 4PIVA 1F12A 2JCXA 4E5MA 3U4DA 1LC0A 2PTGA 1YGYA 3K5PA 2NACA 5TT0A 1BXGA 5ENVA 4BGEA 4LN1A 3AUAA 1W6UA 3E1KA 3FWNA 1SC6A 5ITVA 1ENYA 1QYDA 2YHIB 4RF5A 2OGUA 1B8VA 1X1TA 4YJGA 3GN2A 3HNPA 3ZV6A 4JQCA 5AQ1A 1ZSVA 5TRTA 2X9NA 4UUOA 4GX2A 3KYDA 3VZPA 3S2EA 4CV1A 1DC6A 2PD6A 3ZWYA 4GWGA 3W6ZA 1MC5A 4LSWA 1CETA 3QVOA 4CMBA 2X22A 1ZEMA 1U8FO 3NDJA 4IJKA 4BNLA 1HE5A 4MP6A 4IGEA 3DFUA 4P38A 1XCBA 4M87A 1KS9A 4Z9YA 3G49A 4YT4A 4MIOA 3S2GA 1O5IA 1KVSA 1DIHA 4IJUA 4NFSA 5JYDA 4MDHA 5TS3A 4B7XA 3WBBA 3I83A 5HS4A 4U5QA 2OORA 2QIOA 4TSKA 1IHYA 3SX2A 2G1UA 3KOUA 3QLJA 4J7XA 3KSDO 4LCJA 5I9MA 4UVIA 3JD4A 1I01A 4ZD6A 1CDOA 1NYTA 3GY0A 4BV9A 4HY3A 3HDHA 3GEMA 3DZHA 2EW8A 1ARZA 3BMCB 4ALLA 5I7VA 2P5UA 1JA9A 1R4NB 4YJGB 1QV7A 1PJ4A 5G0TA 2C5EA 4BNWA 1VI2A 1HE2A 4MINA 5G0SA 3PVZA 5EJ2A 1B8PA 1E77A 1AN9A 1JKFA 1DRVA 2GF2A 3GNSA 1DJQA 3GEGA 4WECA 3UW3A 3QHAA 5GMOA 4AL4A 4P22A 3ROKA 3M1LA 3NKLA 5CPFA 4MP3A 2O3RA 4C7KA 3L07A 2E49A 1E5QA 4U7WA 4XIJA 3AUUA 4OHUA 4IDGA 2B5VA 4BGUA 1PZGA 2RBEA 9LDTA 4A7PA 2C20A 5L45A 3PP8A 4JGBA 4CQLB 3RD5A 3DHEA 3E6AA 4J49A 3M2PA 2NSDA 5FFFA 4LRSB 3HB4X 1WZEA 3P7MA 3TSCA 1XSEA 2HQ1A 2QYTA 2X86A 1AUPA 4IIVA 5JE8A 3LLSA 2HJRA 1GQ2A 2C54A 3L4BA 3B70A 1KERA 1Y6JA 4AJ2A 4BB6A 3DQPA 5COAA 2YQ4A 5I9NA 3OJ0A 3F9IA 2PGDA 3W4KA 1VKOA 2V6FA 3ZWOA 2P68A 3OJFA 2J6IA 4ZU3A 3R3JA 2J5RA 3CMCO 3BTVA 3FTNA 5HA5A 4YAEA 1WLYA 4KUEA 4IDDA 2JHFA 5L4LA 5BNIA 1LDGA 5JC1A 4TZKA 1ZXLA 3LC7O 2Q1WA 2CMDA 2UV8A 1YOVB 1I36A 4WLOA 4ND1A 3AFNA 1KOLA 4Y98A 2C2YA 4I5GA 5JC8A 1BXZA 1N92A 3CE6A 4DC1A 1SOVA 4BNTA 1B3RA 4E33A 3WYBA 4L4RA 5TIIA 1UAYA 3RC9A 4AVYA 5TF4A 1QLJA 1OOEA 4YBZA 4JXKA 4Z9XA 1U2DA 1XA0A 3JD1A 3DMYA 5BSEA 1VJ0A 4GL4A 3ONDA 3E5MA 3WX0A 4HKTA 2I3GA 3GGPA 3JD3A 4NU5A 1EFLA 1SOWA 2ZCVA 3M6IA 2Q2QA 3F46A 1UDAA 2NVWA 4WCDA 5T64A 4DMLA 2C2XA 2GERA 3BZUA 1J0XO 1HLDA 3HN7A 4QQRA 3WWZA 1KC3A 4CLRA 2QW8A 1EBUA 1XIVA 5JNLA 3D4PA 2R6JA 2GO1A 3VHRA 3ZHBA 4B7UA 1N9GA 2VN8A 2X6TA 5I7EA 1KY5A 5MDHA 1U7TA 3E5RA 2IXAA 4FJ1A 3PHHA 3L4SO 1LRKA 1GY8A 1GCUA 1Z6ZA 1TT5B 3FCOA 2W98A 4R1SA 4YVFA 2Y0CA 1KBZA 3TZCA 1SO8A 3GVXA 2ET6A 3C7CB 2IE0A 4Y9DA 4W6ZA 2OO5A 2CDAA 3ONEA 3WSWA 3NTRA 5JDCC 1U9JA 5TQVA 3OHSX 1BRMA 2Y1OA 3TNLA 3ETEA 4RJTA 4FOSA 5A5EA 4G65A 4UVHA 1I33A 2HO5A 1EUZA 2C59A 3KHUA 3S8MA 1XU7A 4OXKA 4R9SA 1B0AA 2VZ9A 1QRRA 4YJFB 4DMMA 5CEJA 2GLXA 1SB9A 1JN0A 2AEFA 5AXDA 3ASVA 5BSGA 4YQYA 3BMQB 2VHVA 2JAPA 3RVDA 3CSDA 1ENPA 2X0IA 1HXHA 2AA3A 3TOZA 1IE3A 1LJ8A 1E92A 4F3YA 3GZNA 1E3LA 3FN4A 1GUZA 3WGZA 2GN6A 4M49A 4DQXA 3B20A 1R66A 8ADHA 3G1TA 1I3LA 3PXXA 4PCVA 3UN1A 3OEYA 3WTBA 4Z0HO 5TT1A 1DFHA 2VYVA 3VH2A 2RHCA 3DMTA 3I6IA 2HKIA 2IDZA 1ONNA 3NUGA 3OFSA 3P5SA 3VH3A 1GR0A 2YFHA 3OP4A 2P9EA 1J4AA 4R69A 3PDJA 4IS3A 4LRTB 3RQSA 3E82A 3LVFO 3JV7A 2HMSA 2Q46A 4L9RA 1AGNA 4M8SA 3RC7A 4C7JA 1XR3A 3WQRA 4EI2A 2P4HX 4CV3A 2I65A 4IQ0A 3ZWWA 2DM6A 2Y99A 5EINA 3DWFA 4RPHA 1U3WA 4BNIA 1DIRA 4FN4A 5DBFA 4L76A 1BGVA 2Y0EA 1XKQA 3E48A 4CUZA 5L3ZA 4B3IA 4CMEA 4KOAA 2FMUA 2J8ZA 4OSPA 4J91A 2EP5A 4PZCA 3Q9UA 4ND5A 4BNHA 4QXMA 1DAPA 1NQAO 2D2IA 1FDTA 3JQBA 3NT2A 3MJVA 1K6IA 2VQ3A 3GOHA 3MTJA 4WCFC 4B4UA 1I3MA 4GPD1 1WW8A 3CZMA 4XX0A 4CLRB 4OM8A 2EERA 1ISGA 1RM3A 1E1MA 2D5CA 4JJGA 4PZEA 1V3TA 5U1PA 4AJHA 4BO1A 5I9LA 1UUFA 1ISJA 3MZ0A 3HE3A 2RH4A 4YAKA 3PJFA 2VHYA 5HWSA 3F4LA 3WGGA 4CMAA 4RVGA 2C7GA 2IRWA 3MOIA 4OQYA 4CM8B 1UZNA 2ZQYA 4DQVA 3UAGA 2Q2WA 3I6QA 4PLCA 5FI3A 4CR8A 4HX5A 2IEBA 3D64A 2DBVO 3BTOA 1YJ8A 1UXGA 4IY1A 3GT0A 3RFXA 1E7YA 1JW9B 1LEHA 5TGDA 2B4TO 4CMKA 3NT4A 4E4YA 1O89A 4D43A 2HRZA 3IAHA 1YL6A 3E03A 4GSKA 5IN4A 2VTDA 3PHLA 1X7DA 1DBVO 1ZBQA 3GFGA 3IP3A 2DFVA 1E6EA 1I5RA 3N74A 3QWIA 1PJTA 2J3IA 1ZSYA 1Q0QA 1RWBA 3LK7A 4CODB 3PJDA 2C82A 3H2ZA 4NJMA 3UFXA 4I9UA 4ZQEA 2UDPA 3H8VA 2QRLA 4J2HA 4W7IA 3NT5A 4CR7A 4D0RA 4IQGA 1N5DA 2DKNA 5HM8A 3B1FA 5COBA 3VZRA 4KUHA 3P2YA 1DEHA 4B8WA 3LC1O 1QV6A 5A5FA 1HLPA 2VHXA 4WASA 1MLDA 4RPGA 3L77A 2HMVA 3W8FA 2YJZA 4NR0A 4BVAA 1ZXBA 1BVUA 3K2BA 2JJYA 3D3EA 1QYVA 3V2GA 4B4VA 1HYEA 3AUSA 3IKVA 2DBRA 3NX4A 4UVEA 1IYZA 2VZ0A 1DOHA 1RJWA 1GL3A 2O50A 1W73A 2R00A 2O3UA 1HT0A 3WJ7A 2PY6A 2YV3A 4YJHB 5GZ1A 1HDYA 4M55A 4MVJE 3SJ7A 3OIDA 2QRJA 2F1KA 3RUHA 1YOVA 3KLPX 2EV9A 1N7HA 4IDCA 5ER9A 3EMKA 2NU9A 2VOEA 4ZHSA 4BS9A 2HK9A 1X1EA 1GFSA 1T4DA 2E82A 2UYYA 4TQGA 2VTEA 4PLHA 1SB8A 3JQ8B 4UVDA 5DP2A 3KYCA 3WG9A 2BLLA 2AG8A 4BO9A 1VE9A 3BYZA 4LW8A 1Z45A 5CP8A 2R2GA 3FSRA 2YQ5A 4IS2A 1ADFA 5CHEA 5THKA 3UH1A 3W6UA 4A2CA 4CQMA 1JLLA 1U8XX 2CF5A 3DBRA 4R54A 1XG5A 3V2UA 3RWBA 3DZKA 3QVTA 3N7UA 4I5EA 1T2AA 1HKUA 5IAAA 4CLHA 1I8TA 3JQGB 1R0KA 4I5DA 4YRAA 4CLEA 4FFNA 3X2EA 5C7IO 4E2XA 2VRCA 2GGSA 3Q2KA 4CM3A 2HMTA 1LSOA 3H5AA 2I76A 2VT3A 3L6OO 5G4KA 2ZYDA 4KDEA 4YAJA 4CMJA 1FDUA 5L7WA 4CLDA 3PFFA 4JCOA 1X7GA 3CZRA 2VHWA 3GR6A 1WDLA 4R41A 4RPLA 4I9NA 4OQZA 1JQBA 3PQDA 1W8DA 2RCYA 1F17A 1EK5A 2I67A 2X1HA 2QG4A 4RL6A 5A05A 1PWXA 3GAFA 3WGYA 3WYCA 8LDHA 4XQEA 3VAZA 3PLRA 3OETA 4N5NA 4F46A 3RBVA 3ZHZA 1QORA 3WIEA 2Q3EA 4BIIA 1H5QA 1NQTA 1I2ZA 3PQFA 4UAGA 5DN9A 3HDJA 3Q11A 4WEQA 3GDOA 5DCUA 3MTGA 5DDIP 2PD4A 1ZSNA 4Q3DA 3GAZA 4DVJA 4ONEA 4DPLA 2P4QA 1WNTA 4W7HA 4AJKA 2TMGA 3ENKA 3FR8A 1X7HA 4DIFA 1G0OA 1U3UA 3GUCA 2ZTLA 5TSDA 2PR2A 1FDSA 3OF2A 4Z0PA 2ILTA 1NP3A 4IXTA 4HWKA 1Y9AA 4CR6A 1N1EA 1C1XA 1GUFA 2UUOA 2W2LD 1NHGA 4NG5A 2WE7A 1Z75A 1E1NA 4U0KA 1CRWG 2EKPA 4IMRA 3H9UA 4PG4A 4GBJA 3D7LA 4NH4A 5KCZA 3OQ1A 1SBYA 3RUAA 1DDOA 4ALKA 2H1SA 4E2YA 4F6CA 3BMNB 4R01A 2W2KA 1MG5A 1S6YA 5K0ZA 4YJHA 3PWKA 2OUIA 1GTMA 1LXCA 3KTDA 3HDQA 2NV6A 2JFHA 3AJRA 1ADCA 3MCVA 3NGLA 2F00A 4CLOA 1Y1PA 1YB1A 5B1YA 2E6UX 2WYWA 4II2A 1NVTA 1JDJA 1NHWA 1V3UA 1VJTA 2BF7A 3H7AA 4FB5A 4J4BA 1N1GA 3QRWA 2A92A 1UDBA 4CPDA 1OC2A 3DFZA 3WIDA 3KV3O 3F5QA 4YJDA 4XQ9A 1R12A 3NRCA 3ZWXA 2YFQA 3VKUA 3INRA 3KUXA 2NU7A 1TT5A 4DBVO 3HFGA 4S1VA 5F1KA 4DLLA 5H82A 5EPOA 4K26A 1PQUA 5A03A 2P5YA 2H5LA 1EUCA 4FBGA 2O7QA 4FFLA 2GRAA 2ZJ0A 3RAJA 3RC2A 4D3DA 1R37A 2DVMA 2W2LA 1CWUA 4U6QA 4CQMB 1D3AA 4YACA 2CFCA 2HK7A 3G17A 4WLUA 3BHMA 2B69A 1HETA 3ASUA 1ZJZA 3PIDA 1LDYA 2OMEA 3I9KA 1PGJA 2OOSA 4MJLA 2FY8A 4X54A 3EUWA 2AE2A 3GUYA 3GHYA 3DOOA 3T4EA 4KUGA 3D0OA 1V35A 3SBOA 1KVQA 1T26A 2RH8A 4XYMA 1HWYA 1Y8QA 2Q4EA 3A14A 4HNHA 4KTTE 5ILGA 3H9GA 4OOFA 1T25A 3V5NA 2CDBA 3JQ7A 4HV4A 1B26A 2Y05A 1NVGA 2OP1A 1P3DA 1WMBA 2Y66A 4CM9A 4FPXA 2GZ3A 4TVBA 4R16A 1UZMA 1PJBA 4J2OA 4R3WA 2DTXA 2AQ8A 4GLOA 4B3JA 3CH6A 3ICCA 1E3IA 1MXHA 3FHLA 3OIFA 3VVCA 4BNGA 4E2WA 1VM6A 4BNUA 3O8QA 4JBHA 3DBRB 4DLAA 1ZKMA 3FPCA 4RF4A 2ZYAA 5F21A 3QW2A 1ZH8A 4E0BA 3JCZA 5JAZA 1H6DA 3CTMA 4NZ9A 3RU9A 4BNVA 4NMHA 1WDMA 1R6DA 2ZB3A 4ILKA 5GY7A 2R00C 5HTOA 3UKOA 3D4NA 3DMTC 3ZHYA 3JSAA 2AG5A 3ETDA 2CSUA 4B79A 3KXDA 4PRKA 2VNSA 2BMAA 2C0CA 3KSZO 3GPDG 3BMCA 3NTOA 4NI5A 4UEKA 3IC5A 4Z3DA 4QUKA 5JCJD 5L95A 3ZWBA 1J5PA 5CEFA 1FF9A 2HSDA 1HEUA 1Z82A 4DLBA 1H6CA 4FIZA 4O6VA 1YXMA 5DBIA 4B7CA 4I8XA 4URFA 1F14A 3IP1A 4MO2A 5T6BA 3RUCA 1EE2A 2FPPA 5KKCA 1PGNA 3ZZNA 3NV9A 4Z9FA 4DXHA 1H9BA 3C7AA 3L9WA 1T2FA 5JYEA 4Y67A 1OI7A 3FI9A 4CM4B 5I8WA 3A06A 1GD1O 3OH8A 1E3SA 5FWNA 4R9RA 3ABIA 4E5PA 4Y8VA 3B6ZA 1DHRA 1M6HA 4EEXA 4IM7A 2FSSA 4GKBA 4BL5A 4TROA 1E7QA 5LDHA 3VDRA 2EKQA 4XRGA 3KSUA 5KVQA 3EVTA 4A0SA 3H9EO 4WLFA 4J4TA 4NFHA 4TRMA 4PVCA 4GSLA 4RVUA 5A04A 3WR5A 6ADHA 2CDCA 4EJ0A 2X0JA 1V3VA 2DQ4A 3JQ8A 1A9ZA 4CV2A 4GX1A 3RUDA 3UICA 1E1LA 1PU2A 1HZZA 2BKAA 3DBHB 3LU1A 2JD1A 5KWEA 1NAIA 3F6YA 1MGOA 3KEQA 3DAGA 4J7CA 1YWGO 3ZWMA 4A27A 1GZ4A 4YCAA 3OBBA 2C07A 1RPNA 1K3TA 2TMDA 2G17A 2VHZA 3BAZA 3U9LA 3D5TA 1HDGO 1B15A 4RLSA 4BNYA 4M54A 4DIOA 4EUEA 2WD7B 3CEAA 1N7GA 3P19A 4EDFA 4BO7A 1HE4A 3LF1A 3KRTA 1KEUA 5KVSA 1O6ZA 2B83A 1W4ZA 3BHJA 2NUAA 1KIFA 4QFDA 1BMDA 3PJGA 3ZU2A 1YB4A 3MWEB 3DTTA 2ZTUA 3ZHXA 3TJRA 3JYQA 2HAEA 2I5PO 4EGFA 3UXYA 3K96A 3FTPA 3MJSA 2DUWA 4WJZA 2ZKLA 5BSFA 2G0TA 4HFJA 3VZQA 4XDYA 2HUNA 4FFMA 3PYMA 4HFMA 3E18A 3I9JA 4DYVA 3WYEA 4BNZA 3HN2A 5IZCA 1NVMB 3V1YA 3ROPA 2ZJ1A 3IOYA 2AEMA 1ULSA 2O3QA 1M2WA 3L6EA 2HK8A 4PG7A 4BHTA 3FNGA 1Z74A 1B16A 5JCXA 4ITUA 4KMSA 1NFRA 2B35A 3A1NA 3DR3A 4M86A 4DPKA 1ORRA 2BFAA 1KVUA 1U2GA 3I4CA 1NQ5A 4UUMA 3H6KA 2EJWA 2Q1TA 2FOIA 3MOGA 4AJLA 5KVCA 1ENOA 2ZK7A 5AVOA 5L4SA 2VWPA 3SEFA 4BNNA 4I1IA 2XXBA 4IZHA 4MPDA 1FDVA 4RPKA 4CM5A 1BSVA 2OL4A 3U4CA 1JKIA 2FPGA 2QZZA 3O03A 1LLCA 5JLAA 1WXDA 3BXXA 4TZTA 1XU9A 3RUIA 1K0UA 3S2IA 4W82A 3EHEA 1CEQA 4AJ1A 4JP2A 3VTZA 3NEPX 1MX3A 2YHIA 5ICMA 3WBFA 2Z95A 2X5KO 3D3WB 3QVSA 3AFMA 2ZYGA 1PGPA 3ETGA 3D5QA 1G1AA 4ALMA 2OHXA 4ZRMA 4RZHA 3ZU3A 1XHLA 2ZQZA 1SEVA 1SPXA 4CUJA 3JQ6A 4DGSA 3TZKA 4L0QA 3EGOA 3T7EA 4XCVA 2YV1A 4E21A 2AQIA 2ZB4A 1SEPA 3AU9A 2G5CA 1VL0A 1N9GB 3DBHA 2OZPA 4ID9A 4UULA 4ZQGA 1RYDA 3WQQA 4E31A 2RIRA 2EKLA 3DAPA 3PWZA 4WK6A 4GKVA 4OKIA 1ISIA 4NHEA 2YY7A 2YDYA 1P77A 2X23A 1QP8A 3JQ9A 3G3EA 1ZK4A 3KZVA 4XWYA 3AI2A 3AK4A 1Y9EA 1DC3A 1KETA 2Y68A 2IEDA 5G2OA 3PPIA 1DLJA 4Y6SA 2V6MA 4L73A 2G82A 4EJMA 1Y5MA 1HRDA 1H2HA 1P31A 4PLZA 4CUKA 1FMCA 3GGGA 1ZMTA 3BMOA 3AY7A 3H9QA 3GN1A 4Y6RA 4WCFA 1JAXA 3D4OA 4W9NC 4S3MA 2IYOA 3AOGA 3E9MA 1P0FA 5FF9A 4EUFA 4MIYA 4Z0TA 4R51A 3GF4A 2WE8A 5KTKA 5C7OO 4BQPA 1VJ1A 1R15A 3N58A 2GYYA 2QRKA 3TRIA 1GPDG 1NWHA 4JJFA 4RORA 3PWSA 5C3MA 4BNMA 3W4JA 1NTOA 1N2SA 1I2BA 4CL3A 4CMEC 4O0LA 4IXWA 1Q7BA 4BV8A 1OZAA 2NQ8A 3LT2A 1EFKA 3QWFA 4J1QA 1IUKA 3LSYA 2Q99A 4FQ8A 4L4SA 4FGSA 4NU6A 4OJNA 1DHTA 3EVNA 4RF3A 4IUYA 4KQWA 4E30A 2W2KB 3D1LA 4HADA 1BDMA 7MDHA 2X5OA 3RUEA 4JX8A 4UREA 4JJIA 1XEAA 5ICSA 1SAYA 3HADA 4LGVA 3I9LA 3PDUA 4PLWA 2BFOA 3ZH2A 1KEWA 3GZNB 4FC7A 3UCFA 1I0ZA 4J3FA 2V7PA 5IDYA 4CM7A 2UUPA 2CY0A 4HP8A 2AEJA 4NIMA 3FRJA 3ZU4A 3JQEA 3PHJA 4E6PA 1BXKA 3ZV4A 2PV7A 2PH5A
chains in the Genus database with same CATH superfamily
2HK6A 3L4BC 2BTQB 1GRVA 4L8VA 5E7IA 4A0QA 4KRYA 2QX7A 1CUSA 1EFVB 3JZFA 3MTQA 4FYJA 3WMWA 4Q3NA 2I3ZA 4E32A 2AG0A 5I45A 3T0FA 1XKTA 4ML3A 5H80A 3AJEA 1G59A 1S2MA 3KR2A 1K2VN 4NE9A 4KO8A 3S4YA 4BEBA 4DMFA 4EH1A 1NPYA 5HJ7A 5LWQA 4YXFA 1UP6A 2CB0A 3UWDA 3K8ZA 4YAIA 1I9GA 3ZIAA 1NX6A 5EIBD 2JG3A 1OYWA 1JL3A 3IJEB 3M6VA 4NK5A 4DG9A 5TMEA 2W7TA 1ZJ4A 1GPKA 1ZCAA 2YN4A 2ZFUA 2YXNA 4FSHA 1H1TA 1DG1G 1KI1A 1LDBA 2VT7A 2MHCA 4KCGA 3S0JA 4C4AA 1L5GB 2ZU0C 4DTIA 1TIPA 1Z39A 3L8GA 4NBRA 4A2QA 3FDJA 1VBFA 1NJ2A 1P6UA 1FP6A 4H16A 1NBEA 1NVAA 1XZHA 3CPEA 3A3OA 4MUBA 4QEZA 3JQQA 3DXZA 2HC9A 4G5QA 5AXAA 5JQGF 3NTLA 2X0RA 3HSSA 4ZU6X 5KYXA 5DE3A 1V8ZA 4IBOA 3T7TA 3WJAA 1V6AA 2H8GA 1QIFA 3QPCA 4JVLA 2ZDGA 3MA0A 2B37A 4MARA 2FP3A 2CZQA 1WUTA 2PPVA 4MI9A 1H2FA 4GEKA 3FHTA 4AJEA 1E7RA 2CMFA 6PFKA 1XFAA 2IOHA 4K9NA 5B3KA 2OB1A 1YNSA 1S1MA 2WKQA 3QVKA 1R4MA 4RKRA 4X60A 3EXEB 3AOEA 1QQAA 3CSUA 2GUWA 3EN0A 4GLLA 1FL9A 2VYCA 3D3WA 4N5MA 1QS0B 2I6QA 4B2PA 4ZO4A 2PM8A 2IZ1A 4QTYA 1XZDA 2CMKA 3NDRA 3UT0A 1GYPA 2H2DA 3HR4A 1N32B 2QWXA 1UQTA 1TJYA 4LY6A 4TYPA 5CA0B 4K2AA 4RD3A 3FJ1A 5DX1A 5DHUA 3ZNPA 2RJNA 1H1LA 1A4IA 1B6RA 3WGHA 1J0DA 1SIUA 3OC6A 4LJYA 4P0QB 5IT4A 3PKJA 1ZZEA 1PYOA 3VKVA 4D97A 4Q6BA 4E14A 1LTKA 5BMOA 3RYIA 4UOZA 1ODCA 1TM1E 3EGVA 1KYVA 2HA7A 3PGMA 1R1DA 4K0KB 1N0HA 4HXYA 2FK7A 1I7SB 1A97A 2KB0A 5LQJA 2YJ6A 3RTCA 1YB7A 1J2JA 5MGNA 5CYFA 3AR6A 1EMDA 1UXIA 3GFBA 5I47A 4B44A 4YEDA 3OOSA 1EWYA 3ILXA 4MQ6A 2Y9PB 4I9HA 1U98A 3NWJA 3KC2A 1AY0A 3FJYA 3RRXA 1BG6A 5CVDA 3SHTA 2I1LA 3MTEA 1Z7BA 4IQ4A 1QGUA 3G5TA 2HX1A 4Q02A 4Y0VA 4HPXB 2VEOA 4HYQA 3OZVA 4AURA 4FYMA 4YDRA 1FTYA 4OJYA 3SZGA 1LPSA 3HA3A 3JWGA 5ILOA 1HL3A 2PA0A 1CYEA 1G21B 1E4YA 5A3JA 1VSUA 5CLIA 5FBZA 4QTUB 4LJLA 4DHWA 3QSGA 4WOCA 5KYTA 3X0DA 4I4NA 5F77A 1RWNA 1YKGA 4NZPA 3TRJA 4GR9A 2WFZA 4NJMB 3G0OA 5KTYA 1MABB 3R0ZA 3FUUA 4FHCA 1L7DA 3H65A 4XJSA 1MQ8B 2X7XA 721PA 4BJ5A 4ZPJA 3O3OB 2CV1A 4TXLA 1D2CA 3OP1A 4C06A 5BV0A 2H92A 3FOWA 4EB8A 1U4NA 2NXCA 2I33A 2F3SA 5AOAA 3UGKA 5JDIA 2VYND 4NECA 5JJCA 1PP4A 4GZ5A 4D8XA 4GPZA 3IV6A 5GPBA 2R9VA 4DDUA 3L84A 1NNI1 1PSDA 1OFCX 4AY6A 3QENA 2GR9A 1NN3A 1OTHA 1R0CA 1AS2A 4MRVA 3PCRB 3F7TA 5IBCA 3FD8A 2NADA 2XCUA 1FNNA 3A4YA 5IVKA 3BMXA 2CF6A 2X40A 3IP9A 3M7IA 4GE3A 4JX9A 2DPHA 2FR8A 3IAEA 1U0BB 1L7AA 4L9AA 1DAFA 5EP2A 2PEYA 2HF2A 1TJ5A 2CHGA 2MR6A 1HFKA 1NF3A 2BMJA 2APJA 3UHFA 1Z13A 4IF6A 3AHIA 1VPVA 1E3WB 1V5GA 1HTTA 3DO6A 3N6VA 4K6CA 3KKNA 1H0HA 1QYXA 2VT2A 1S3FA 3BA1A 3EA0A 3A2LA 3QUSA 1SULA 2RFLA 2BSQA 4LHEA 4KLRA 1P9RA 5F7XA 2D1YA 2XYVA 3PC7A 1XWIA 2Y93A 4C1BA 2B8NA 2P9FA 3EQ2A 3UXMA 4D8TA 4N03A 3WLOA 2VBIA 4TTJA 4BX8A 3MRSA 4PCUA 5KSOA 2WQ7A 3UGTA 3IODA 2AZMA 1AV6A 2OESA 1VG8A 4CKBA 3S5JA 3THXA 2BGKA 5F4BA 4YRBA 1RQPA 1TC1A 4Y6OA 1E18A 3G13A 5HOQA 3SEAA 4FEYA 4HDQB 3GZ4A 1IG3A 1VJDA 4YNBA 1VL6A 1YULA 5AUQA 5BN3A 1D1SA 2HLPA 1V11A 2VHUA 3N39C 3EQ9A 4B82A 5HYVA 2LE0A 3JQBC 1BHSA 5LIPA 2CBZA 2FOLA 3HN6A 4OSOA 2XMGA 1IY8A 1KFKB 4U0JA 2ST1A 1DEKA 5F1YA 4A8JC 1KL7A 3BSWA 3SC4A 1AUXA 8OHMA 4GI1A 1NKTA 5F7JA 2H2HA 2O2YA 1XCJA 1JR3D 3OICA 4L22A 5FLEX 3RRYA 2OECA 3QNUA 1SHJA 2F1HA 3CO5A 1Y98A 3ENNA 1SXIA 1VKHA 3ZNOA 1JKMA 1M7HA 1J8DA 4JT8A 4UBIA 1VBNA 3SE0A 1IM5A 3FHCB 2PMEA 4I3HA 4D9FA 2FSPA 3FYSA 1NW8A 1WW2A 4EITA 1FFXA 2MMGA 2ZPAA 1G20B 2F4NA 3AZOA 3HJHA 1DZIA 2O2HA 3G5LA 4JCCA 4TMWA 2Z6QA 3AVUA 2WV7A 2BFMA 2IW3A 2OBNA 5EZ6B 2NU8B 3LGSA 4BASA 1E1CA 2D5BA 2WRZA 3G79A 5K0FA 3EIEA 5DIFA 2CFIA 4UATA 2IY9A 4Y2UA 1KI7A 2H1IA 2JLUA 2XF8A 3VSEA 3EVBA 1TA4A 1XK7A 5A2QA 4UU0A 4HAOA 3ZVNA 2BHTA 2FZ4A 2Y27A 3FCCA 5C1BA 1UPFA 3K9WA 1RBYA 5EWLA 3TAXA 1TAQA 3EVZA 2ZJ6A 1ZVMA 1AUVA 3HHEA 3KD2A 4FUTA 2QTZA 5JANA 4RLQA 5FT9A 1RDFA 4HRVA 4NE2A 5ITZB 3DVRX 4IHJF 1U3TA 4UBKA 5BY2A 2B36A 2RKWA 4LXUA 2CBXA 1Q0PA 5SZKB 1J2RA 1DJPA 4IXNA 4JEIA 4JGIA 1ZNYA 5H3CA 1U7HA 3B2EA 1RWMA 3GD5A 4X63A 3UUGA 3QEAZ 1YC5A 3EUAA 4F6RB 1GL6A 4NCXA 1YQTA 4H1HA 3ABZA 3LF2A 4OQNA 3EPRA 3PX7A 3D59A 3BTUA 3Q8MA 2IS6A 1WZIA 3MTAA 3V8PA 4A8HA 5HF6A 4MVJF 3TAUA 4XD7A 1OJLA 1TO1E 2J3KA 3HVHA 4FS3A 5CIQA 1M6WA 1RJEA 2XY4A 2QRUA 3E3MA 5DH9A 3P1JA 1PVVA 4UE3S 2O23A 3FXAA 1G4HA 4D0SA 1KXZA 2ABWA 2DSNA 2GH1A 4QXAA 5ITWA 2V6GA 1J42A 3PI6A 2BJWA 1ZWKA 2BISA 1Z5PA 3FBGA 2Z8XA 1LK5A 1GZ7A 1R4NA 3LS2A 1YE3A 3CW9A 3QI7A 3I0ZA 1P5ZB 3CRVA 1U0LA 4PZ9A 4F4HA 5IKPA 1BDBA 5AUPB 4LYEA 1FSGA 3LUHA 3KHKA 3A6GA 3ZD9A 4H15A 5EUBA 4K6FA 3VOSA 3Q1LA 4PHTA 4EY7A 1GZ3A 3LLUA 3R7WB 1ZVKA 1YBMA 1VMEA 2DBZA 3WRXC 2VF4X 1F48A 4O1HA 2MOKA 2W2OA 3JWEA 3P9RA 4QULA 4HYEA 1XQYA 4RBNA 3EGDA 5LU9A 1IBCA 3NVMB 3U56A 2H0QA 1MAWA 3EXHA 2IH2A 4DWJA 3GRFA 3PXCX 2A1UA 1ZHFA 3RVSA 3FMOB 3RFCA 4DWVA 4W5WA 3ZV5A 3Q8KA 3QUBA 2IDMA 1A98A 4QRIA 3HH8A 3IJPA 5IEBA 5L7TA 4L72A 5A9RA 2GEVA 5EUMA 3FYUB 5KZMB 1WHSA 4YR7A 1UKYA 4ZYLA 2JRLA 1JG1A 1PJCA 2NU7B 3ZGOA 5F3DA 2H3HA 1K2WA 3B3AA 5E38A 3U3XA 4AWXA 3AFGA 4DKJA 4JBGA 5B6IA 3B2QA 2ISQA 4L5AA 3ZBQA 5JDIC 1K08A 3ESZA 1NVVR 1GXSA 2OOKA 2UVQA 2XGOA 1XVIA 1PDVA 2ZJ5A 4OIMA 2ASVA 2H52A 2R8PA 2A94A 1IBRA 2ZJ4A 4ZO8A 4Q3LA 4ZYUA 1HDOA 1N8KA 1GRNA 3DDCA 2EZ9A 4HDMB 3EZ7A 2SKDA 3ECSA 3MRVA 4B4OA 5K05A 2Q5IA 2FFBA 3WIBA 4FFBA 5C34B 1QE5A 2WBLC 4U7JA 3WRYC 4WOKA 4Y2YA 2YZ7A 1UMDB 1PV4A 2WSBA 4QFMA 4EGSA 1WBDA 3T35A 2I91A 1WHSB 3FPAA 4FFOA 4G4SP 3AG5A 1F3LA 2Q5OA 3F67A 2B61A 3GVCA 3TXXA 1Z8HA 2XECA 1MC1A 5LKRA 2PH1A 1TLTA 2PT7A 3EGIA 2AJ8A 4RKFA 4W99A 1EK0A 5CX1A 4OI2A 4MB2A 1Q5PA 1JFSA 2UYGA 3W5SA 4Y18A 3EUEA 3U81A 1U99A 3GLIA 2FWPA 2V54A 5JAQA 5JCJA 5DWDA 4F56A 1OFGA 1C9KA 3N5KA 1UZLA 4KXVA 4B32A 4ZVNA 4GI3A 2AKAB 4TN5A 5CXSA 4MIEA 1P4SA 4UHEA 5BN4B 4YT2A 2P7HA 2VKQA 1I0IA 3KB6A 2QA5A 4G24A 3GNTA 3H4IA 4HZUB 1R10A 1I1OA 3BCUA 3BGOS 4XYLA 1EWRA 1FBNA 5SY9A 3TLZA 2WPNA 1Y3CE 2O7VA 3ORYA 3HEAA 2PZLA 2QR2A 2ZSHA 2GESA 3BOSA 4W5NA 1DAIA 1EP3B 1RPTA 3OLCX 1EVQA 1XMSA 2V7QA 3LUGA 1HV8A 3TGPA 1WJGA 2XCLA 2JJ1D 2XNSA 4JC8A 3ZHRA 3CNHA 3OC0A 3EDOA 1FTWA 5KI6A 1JDBC 1ND5A 2HJSA 5DRTA 2NYVA 1IN4A 3B1KA 2AHRA 3TIFA 3ORHA 2J48A 2ZCUA 3BICA 2P9ZA 3FZNA 4FEGA 5HFNA 5HF9A 2GN9A 5ILQA 2OPHA 4BC1A 1AHHA 5KQRA 1XZNA 1R8XA 3ZXUB 1C30A 2WHPA 4NATA 3ITDA 3D6FA 3IEIA 1Z6TA 2XXAA 3DCYA 3A9SA 3JYLA 2BFDB 5JRZA 3O75A 4NJEB 2A2ZA 2VDWB 4KX5A 2W71A 3E0XA 1XMOB 1E7WA 4M1ZA 4YIKA 4K1LA 4R31A 2HRCA 3DDUA 2N9UA 5FUBA 4QXQA 3ORFA 3OTGA 1UXOA 2L82A 4XJXA 5JG7A 5T41A 4DLRA 2BFWA 4OKSA 4R4JA 1NP7A 1SKYB 3A1TA 5A0VA 2A7QA 2QPLA 1E4OA 4JLSA 1LS1A 1U2TA 1GNQA 2E4WA 1IXYA 3RS8A 3GLSA 4WE3A 1PQWA 3IQZA 3QNMA 5D3MA 3C85A 3AJDA 3D8RA 4GMGA 4MOWA 3T5DA 4ETMA 2GZMA 1RZRA 1WUHS 2NO1A 2L19A 4LY0A 3SMVA 1AOXA 2EJTA 1EUCB 1RD4A 3A26A 3M1AA 4AMUA 4RQUA 2ZDHA 1PZEA 3UC5A 1TTTA 3KJQA 1I32A 2EKBA 4GGPA 4Z99A 3LZ6A 3ANLA 2QX6A 1XN1A 5DW0A 3OA0A 3CZ5A 4GLBA 4YRFA 1EAMA 2GDJA 3AEUB 4G36A 4WACA 1NI5A 3FNRA 3VR6H 1QC5B 5H68A 2RE8A 1R5NA 1PEDA 2O1EA 1JVSA 3NUZA 4X6UA 3L41A 3SC6A 2FKNA 4H2DA 4Z9BA 4O5AA 4NS1A 3B3JA 3BJIC 2IZ7A 2GBGA 3E7FA 3PZBA 4KQGA 5F3RA 3S40A 3ZDFA 5MFZA 3U44A 5G02A 1ULZA 2W6OA 4FMDF 5T8KA 3BD9A 5EZYB 1MOZA 1P60A 1VHWA 4ZT3A 3D3QA 1LPMA 1L3BA 1SXHA 2GHQA 3G5MA 5H16A 1XZMA 1GILA 4DUGA 5EERA 2IDKA 3LW7A 4PZZA 2AEEA 2JNWA 3DVLA 4REMA 4RYLA 5JSHA 5GIPE 5IH7A 1JVNA 1CJBA 2X19A 3GA0A 4WN9B 5MN4A 3LW8A 1IG0A 2H4XA 4WUVA 1KQFA 1GG2A 4PZPA 4IV8A 1VLMA 3PFKA 3A70A 1XRLA 3FIUA 2JGDB 3G89A 2WD7A 1JIUA 2IYPA 2I71A 2JI7A 4BZPA 1EESA 3PX2A 1N5RA 1NL3A 1Q74A 2G1JA 4ISCA 2GN0A 3UUFA 4G09A 3PLNA 1LSJA 1Z4QA 5AKXA 2QQFA 3W6OA 1VLLA 3FOEC 3I61A 3MF4A 4RL4A 4BRWA 1Q2UA 4ISBA 2IA5A 3ET4A 4PHFA 5FJJA 3LKZA 1NVWQ 1Z38A 1ZXXA 1ZI6A 1GFZA 3AUJB 1P1HA 1GGKA 5LYJA 3TTWA 4E7PA 4NESA 1SG6A 5GADl 1A27A 4YMLA 3S8YA 2WWRA 3R3HA 1JKJA 2XODA 4ABTA 5T3UA 4Y9UA 4JZKA 1Q11A 2FZGA 3A4VA 3DXFA 3J81k 4F1KA 2BZ1A 4N9QA 2QAGA 4KKVA 1D04A 4DANA 3ZH9B 1CUWA 2JDIA 3F74A 5LBUA 1K5HA 4YWJA 3TTTA 1V5WA 1Z12A 4OHPA 4C7BA 3FKQA 1YZFA 3N2YA 1QDLB 1KGDA 4R68A 3DTYA 1XK6A 2RG1A 3PDCA 3AJ8A 2FZKA 2G1KA 2WJZB 3K0EA 1P2UA 3IULA 3OCVA 3E81A 2AT1A 5TJ9A 4BQSA 5LWHA 3INGA 3L06A 1OT5A 2O2SA 4OB6A 3B6MA 2R62A 2UZ4A 1ZUD1 1U0TA 2FHSA 3QEMB 8GPBA 3E1GA 3FRHA 3INTA 1EG2A 2PZJA 3ITEA 3PNVA 3BN3A 2OC9A 5DPMA 1D1TA 2PLNA 1H3FA 2JANA 1WULS 2WLSA 5FWYB 4ER5A 5B58C 3RKUA 4DIMA 4R1NA 2PX6A 4F9TA 4RXUA 1YI1A 5FTMA 1N8SA 1RW4A 1RXIA 3U44B 3O92A 4YPFA 2LPMA 1H66A 1TEHA 3BGDA 2ESRA 2XVYA 5SZHB 3TLEA 1JX6A 3WK6A 4J1NA 1NBOA 4COOA 3QE3A 5I7FA 4MGYR 1YHNA 1YS7A 1PEAA 2JGRA 2WUVA 3HKEA 4B76A 4QTTB 4OQEA 2JGFA 2ZJ8A 3DHYA 3FWYA 3W1EA 1JLRA 3ORQA 2QD3A 2Z8ZA 4AULA 1VSBA 3O4RA 2AYZA 1EVLA 2BFPA 2P3OA 2OAEA 3RV3A 4IEFB 1M1NA 3IQDB 4MV7A 4M8LA 4YYZA 1O54A 1TOAA 3P4UA 1K6JA 1CUHA 2JGJA 2IHYA 2QTBA 3D2CA 3GFVA 4G07A 3I2IA 3B7GA 1IRIA 3QG1A 1C7EA 10MHA 3BREA 2Q6KA 1E6WA 4C6HA 4YAFA 2H4WA 1ZAYA 2ZW9A 2RCNA 3AEKA 1P4GA 1YB6A 1U8AA 2ICAA 2LKCA 2X42A 4JXXA 4F3RA 1EEHA 2R5WA 3LYUA 3PHIA 3EXIB 4Q5IA 3SJUA 3ZLUA 2PSFA 3KB2A 4TMZA 3QTLA 1E3JA 3QU9A 3DDWA 3VVBA 3H2KA 3PNSA 5BSKA 1TAGA 2GKGA 1KI2A 3PFNA 3BQMB 4F45A 5AOBA 2ZROA 1TL7C 2ZT5A 2FMKA 4CM4A 3FOCA 3N0TA 1ZI9A 3ZIDA 4KK3A 2QLMA 1YRAA 1ST3A 2ZBQA 2SECE 2CEKA 2RKBA 1PL8A 1TCUA 1FFHA 1YZGA 1XD2A 3LC2O 4JUAA 4LXHA 2HJ9A 4CTOA 1D4FA 2CCGA 1NBMD 3TTYA 2LW7A 2JIBA 2PT5A 3BTSA 5K0BA 2JIZA 2R1UA 4Q19A 2DF8A 3BWDD 4FW8A 3ZW9A 1LJUA 2CVZA 4LOAA 4NZYA 4TS1A 3N3AC 3UJHA 4S05A 2IS1A 4BLRA 4EDHA 1NZFA 2SKEA 5ENDA 2IWRA 3BD6A 1YO6A 4NCBA 3NIGB 3HKCA 2BD0A 3K9NA 3GVPA 4D8WA 2DETA 2AB0A 3NDIA 4IOKA 4V0ME 2EJUA 1C2TA 1W52X 1GIAA 3HBAA 2OA0A 3I32A 1G60A 3PFWO 4IFIA 4K6MA 4PYOA 3EDMA 4QYIB 4CV0A 1K66A 2ZJYA 2ATVA 4JI2B 1GADO 1GV1A 2YWCA 2ZZNA 1T9HA 1WD7A 1NR7A 4XFDA 3AILA 5D2CA 3VC7A 2H08A 4BO8A 2C29D 2QTMA 2CNBA 1YV9A 2X7JA 3FFBA 5E2AA 2BI7A 2PXXA 2ZRLA 2VRCD 2YINC 3WOVA 2BGRA 4BKPA 5CURA 2PMWB 4AZ0B 2PSHA 3I34X 5IVHA 2A1UB 4ZHQA 1FSFA 3AUXA 1VRWA 2NO6A 2G0AA 3L6UA 1G6KA 1GT91 1RWVA 1Y8RA 3WGNA 2PVSA 4NSNA 4M1MA 2ASEA 1GPJA 4I1SA 4R2HA 4R3NA 5D00A 3TSAA 4ND2A 1VL5A 1Z5ZA 3AQ4A 4MRPA 3EEIA 4A0HA 4KJXA 1D2HA 4MI3A 4XGKA 3I9OA 3OT5A 4LF4B 3ZU5A 4EUHA 2GSWA 1YRWA 1JE0A 2VJNA 3IBFA 3IUPA 1B42A 3O4IA 4LHZA 1YQDA 3TMKA 1QFXA 3HFRA 1W4CA 3EZ6A 3WJ1A 2WFMA 5T8KC 4BPRA 3QYPA 4V2IA 4CTNA 4MW5A 1PK8A 1OR8A 3IUNA 4E22A 2BW0A 1REQA 1AG9A 2Y6UA 2HQSA 3L1KA 2QL6A 5LQSA 4CLOB 5JS7A 3DZIA 5JAOA 5AO9A 4WINA 3VZDA 2XMQA 4AXBA 4DQDA 2WM3A 4AJIA 1QOZA 1SXGA 2HJVA 3OE7A 3USCS 3ZDAA 4F3CA 1WB9A 2HJGA 1FX0A 3A05A 1HYBA 3NM4A 2BUAA 3BXFA 3AI1A 4M0LA 1M8GA 4YI3A 5K3SA 1CW2B 2OE2A 4D42A 5HIIA 3NYIA 4I08A 1JZTA 4CIYA 2WMOB 3BPSA 4QNMA 3L79A 2OBYA 3CUKA 4C6TB 4BFLA 5H9VA 1H65A 4MHOA 4ZQFA 5JZOA 4JV5B 2YS6A 2JRCA 1ZM7A 1U28C 3EZGA 3H4MA 2OD9A 4Z2YA 2OCKA 4KQFA 3SSNA 3ZDDA 1C0LA 4JT9A 4YMSA 1K7XB 4WZAB 3U16A 1FW8A 4QXPA 5EWJA 5EQDA 1DXHA 1EZ4A 1AS3A 2CL6X 4XDZA 3UKJA 2X0NA 1MR3F 2DPXA 2W2VA 2O9JA 2W6ID 4O1MA 1EBFA 4CT4B 3OQOA 4LDPA 2O0HA 3CZPA 4IRUB 4D98A 5TR9A 3PLAE 1V2GA 2QMHA 3DMPA 5KQSA 2C84A 5JECA 1Q14A 4PZUA 3DEYX 4DDTA 4EHNA 4HBGA 2I6GA 3UQZA 3DPUA 4LOHA 3QX3A 1LU9A 3N70A 2I2BA 3MTIA 5ALDA 3N9IA 2NU8A 1GDDA 1GEGA 1VKJA 2EFHB 2Q5FA 5HM6A 5JQGA 1WA5A 3QKTA 1TXGA 2HGSA 2OQRA 5KKNB 1ECPA 4L4XA 2SBTA 1PTJA 4M7OA 1YQGA 3T95A 1OU0A 1WXWA 1TO2E 2A9FA 3O93A 2BZGA 3AKZA 4Q3CA 2WTAA 3ZN2A 2K4MA 2QZ4A 3BXGA 4H18A 4OBBA 5ENZA 1EFHA 1CP3A 3LY8A 5BMVA 2Y2VA 2GEDA 3LPAA 4BEVA 4HNGA 3JQAA 2WF9A 1VE5A 4RGBA 1UT6A 4L78A 5CMLA 2CL7X 5JCZA 4UPEA 1T4MA 1QG2A 4RQAA 2NU9B 3W77A 1SC9A 5FPHA 4B9EA 2FCAA 3R3XA 3NDBB 2GMWA 4AQDA 1YZ3A 4KXLA 3FPSA 1LZLA 1EDBA 4GH5A 3K20A 3V6LA 2PBZA 4M83A 5C3UA 2GA8A 3UB4A 3R20A 1UP4A 3CNBA 1C4XA 4ADSG 3FKSA 3VDXA 3MRXA 3L1IA 1A9XB 2VDUE 4AO7A 2H1LA 4ZHQB 2B8TA 3MVEA 1WB5A 3Q40A 2QTVA 3QP9A 1DAOA 4JITA 4NONA 4LYFA 4G1CA 1JLKA 3E5HA 3WWCA 3QU2A 5C5CA 4ZI5A 1NMXA 4MP8A 2O48X 3N8HA 3NBAA 4CDGA 2X0EA 5U4QA 1A5TA 1MRSA 2EEZA 2GJ4A 4BYGA 2XDYA 4XM2A 1I13A 1WWKA 2GAAA 4WK4B 1YUBA 1SZJG 1YJXA 4AFNA 4BVEA 3HKEB 3F6BX 3VHLB 4RHTA 1Z25A 2VAWA 3C16C 2QLJA 3GMSA 2VQDA 3IEUA 1GR1A 4ZT5A 3S55A 5JD6A 2E5FA 1ZIOA 3VH4A 2X8LA 1IZ0A 3TNYA 1N36B 4YRRA 3U0BA 3VR2A 3KIPA 3M4YA 1DKUA 3MJEA 4DB4A 2ARKA 4BRZA 2FWJA 1AU9A 3A3KA 3H5OA 2JD0A 2YS7A 4QDJA 1E5LA 1Z6XA 2QE6A 4CKXA 3COSA 1Z6GA 1P19A 3TSZA 3OZRA 5JI2E 4AN1A 5IVDA 4X91A 5H4HA 4BO2A 4JUCA 4MMYB 3FDZB 5IP5A 4PYJA 3DPSA 3PEVA 4M1TA 2DWUA 3VV2A 3ZNNA 4XQCA 1AZTA 1CQJA 3DR5A 5DOVA 3RWMB 3C0KA 3DL2A 1SVSA 2EQAA 3D6MA 1FLAA 5G0VA 5K51A 2AL7A 3GUHA 5C5DA 5A02A 1IXRC 2CJXA 3ONVA 2AMFA 2ATEA 1Y7TA 3JQDA 2XYRA 4MA4A 1GLNA 1Y1TA 3JZIA 1OYOA 4OHBA 1GEEA 2FFJA 2O0LA 1L8XA 2Y1EA 1QAMA 3H1FA 4DZTA 2IFTA 1L7RA 4Y30A 3FPLA 3V9AA 1SNYA 4LMRA 3RT1A 1ZMRA 4ABYA 3PHGA 4GPIB 5ICGA 2PH3A 3O3NB 4B71A 2W22A 3X3HA 2ZGVA 3LE8A 3QY9A 3LCUA 2XDWA 1BMQA 3EG5A 3KL2A 1RLMA 4ARZA 2UXBB 2PZKA 1BKSB 2CLCX 4XH9B 3OPYA 1HEYA 2PGAA 2X77A 3L01A 2QLBA 2ERXA 1DX6A 1DO2A 3A32A 2CBGA 2P9QA 4CCAA 3AR9A 2W6IA 1C41A 3OEEA 1W29A 4XWOA 1DBSA 1N25A 4QT0A 2CK3D 1Z6YA 4MKZA 3OHMA 4OLJA 1Z73A 4U8GA 5DYYA 4EI8A 4OLBA 3U4MA 4KC0A 5C51B 2JGDA 5E4YA 4HB2A 4TXNA 4PG8A 4FHEA 1ULAA 1YRBA 4D3XA 1XDWA 2C99A 2N47A 3K31A 4HH0A 4FKMA 1IVNA 3SR0A 3TL6A 3U39A 4DM7A 2FDXA 3OOWA 3HI4A 1H94A 3FWZA 4YTEA 5G3ZA 3VKFA 1KAQA 5DFAA 5KX5F 2BI8A 3DW3X 3IPRA 3ANYB 2JLVA 1Y7PA 4HR7A 8ABPA 1GGVA 2X2PA 4Q3BA 1FVXA 2PGLA 2ZIGA 4CG3A 4RV9A 3MIIA 5SYMA 4P3PA 4PGHA 2FWRA 3FMPB 1TMGE 3JQAB 3TLYA 2L18A 3OMLA 2KJQA 5G1PA 4BO6A 2XUHA 1OAKA 1YR1A 1YJQA 2X58A 3HUEA 5CTJA 5EQJB 5TNXA 4C7MA 4BQEA 4QOIA 5IAEA 4Q3AA 1EQAA 5CFPA 1V3QE 4RVHA 3SG0A 3NJ4A 1T9BA 2XMDA 4G2NA 2OV3A 2DU8A 1GARA 3THSA 3WZ2A 1UBOS 3Q0EA 2OXFA 1C0EA 3OLZA 5ADHA 1VQ1A 2V45A 3N8GA 4NBVA 1WBBA 1KAMA 4AYTA 1JDNA 1KY3A 3IB3A 2VA8A 7ADHA 3IBYA 2D5AA 1YFJA 3UOGA 1V4NA 1OIXA 1VSVA 1M2VA 3OCXA 4RV5A 4FD3A 3WKBA 3AIMA 5JNRA 4TS3A 5TV2A 1DC8A 1T8YA 4M37A 1FNCA 4ZP1A 1XLTA 1SQ0A 1T8TA 1H69A 1J0EA 2QGFA 5D3QA 2C2HA 3F5FA 1TYAE 4JHXA 3T1HB 5GZ6A 1P4HA 4M53A 2G9RA 4PLFA 1NNSA 4EEZA 2PZ8A 2AWNA 4WFKA 3AVWA 1AGYA 2YHAA 1T5HX 3ZI0A 3PFIA 4WZAA 1PJLA 2HW8A 1JWAB 2VXYA 2WNSA 4QUIA 3K70C 2W2NA 3ONFA 1SOMA 2VNKA 1ZMOA 4DLUA 4GUAA 1JSLA 3JS5A 2K7ZA 4R5MA 4E5UA 4ZYXA 4K5QA 4YRDA 2HMWA 3J7AC 1VC2A 1UMCB 4XKJA 2YWXA 3R77A 3CNQS 3S1AA 2IQ5A 2MCFA 1KK1A 1M2GA 3IQIX 4PFQA 4EW3A 5TB5A 4AZ3A 5IM5A 4K8OA 4JELA 3BB4A 3WLTA 3HFSA 4UDXX 3Q72A 1G5IA 1L4GA 1WG8A 2Q0QA 4IVNA 2PGXA 2HXGA 1C3VA 3ZJYA 1I4TD 4O8ZA 4ZCSA 4EMBA 4EO9A 1SUSA 3ADOA 1QFYA 2WJVA 2H9AA 1CQPA 4CW7A 5JHHB 2GEBA 1RIIA 2BUCA 4KO3S 4KVAA 4Q4JA 3LAWA 1UXKA 2YZGA 2GEFA 2ZDQA 1OROA 1YQUA 3QIVA 1LPPA 2FJPA 2FDCA 1A9OA 3TIXB 4LF6B 1CUEA 1GZHB 2AE1A 5ER6A 3AY3A 1IU9A 4FFDA 3MWDB 4P2GA 1Y4ZA 1F3OA 2VNJA 2FWNA 1T1GA 3F1KA 2VSFA 5E6UB 5CLQA 4HLQB 2QZSA 3WXBA 4EO7A 1H6BA 1RM5A 1T5LA 2WWTA 4JU8A 2VBCA 1CZKA 2RARA 4QUAA 5CBPA 1T2CA 3PNMA 1PZFA 2PYDA 5EE9A 2AKYA 3ZWKA 3KR1A 2P2CA 4XIYA 2YN0A 1LDMA 2BBOA 3KEOA 4FHZA 4RNDB 3GGCA 4AUEA 1CF2O 5L3RA 3QBEA 3SIWA 1UKAA 2RMKA 2C8KA 1S7CA 1RQNA 4QBGB 5IC5A 1AO3A 5REQA 1ZONA 4ZIRA 3R7BA 1QH8B 4BN0A 5KTSA 5A9SB 4Y7DA 2I99A 2LNDA 4WNIA 3TLXA 4EUKA 3LQ1A 1U6KA 2IZOA 1GQFA 2E37A 1ETUA 1MFPA 2VAMA 2Y76A 4GR4A 4XVUA 1RTTA 1PJZA 3HZHA 3EOAI 3NM6B 4FZVA 3CWCA 1M76A 2CL5A 4KVZA 1HY3A 1N7JA 1EFRA 1Q1ZA 4RDIA 4AJOA 1T2DA 2IYRA 3ZWDA 1OVMA 3M2TA 1LLUA 4W4TA 1G2IA 1L5ZA 3BHNA 1XDDA 3C1UA 4JH0A 4XSVA 1NX9A 2GCOB 5J63A 1GWNA 1W9MA 2FRDA 2OO3A 2Z2ZA 3I2JA 4TUYB 1DPGA 1KTVA 1FTNA 4HFRA 3MS4A 5EN4A 1W44A 3ADBA 1E2FA 1YB5A 1N5KA 1V8BA 1I6WA 1LTQA 3JVIA 3HMKA 3LT4A 2AW5A 2YWRA 2HRBA 3BULA 2JAXA 3DZBA 4FMCB 3QLUA 4HF7A 1C0KA 4C7XA 5JH7F 3GEBA 2PGNA 1VPDA 1Y5NA 1RYNA 2Z4SA 3KD3A 2AS0A 4XCQA 4AAYA 1Y5LA 3T4XA 3AF1A 3H4VA 1RPAA 4RH1A 9GPBA 5K3OA 2FWBA 2HFJA 5L7YA 3NPMA 2VWHA 1H2EA 3I2YX 2CYBA 4S24A 3WICA 4CN8A 1J9EA 2PNJA 4O3MA 3WS7A 3DVAB 4QOJA 1GLVA 4G8BA 3WGQA 2EDAA 4QUBA 1DSSG 5GONA 3VR4D 1LB1B 2D4AA 4G0YA 3IIEA 3GUZA 3UAOA 4CL2A 2M6LA 4D8VA 2DERA 3H75A 4ME6A 1LZKA 4PW0A 3B1VA 2XRYA 1MP0A 4BMSA 4TTRA 3DDOA 2FQXA 5IKOA 2PV0A 1M3SA 2Y4NA 2CE7A 1FP4B 3O8QB 3RC3A 2O8DA 2VZLA 2BGUA 1KI6B 1RLOA 4HWSA 3TPZA 1ZK0A 4K87A 4ZV9A 3CH5A 2GN8A 2Y4OA 121PA 1E1RD 1MVLA 3DQZA 4IHJA 5GV8A 2V74B 5HFJA 3RJ5A 1NW9B 3QV1A 4DF3A 4EVSA 1I2DA 2QHXA 3ZCXA 4F60A 1KJQA 1DAMA 2G9NA 6NULA 2OP0A 2DHRA 4RCVA 2WOOA 1I2AA 1NNUA 3AB3A 2DY1A 2I7XA 2C3UA 1VKNA 2POCA 4L6IA 3T9FA 1UIRA 1VBMA 4GWKA 1TZJA 3AHCA 4CM8A 3BIOA 1QKIA 5G0UA 3LOUA 2EHDA 3EK2A 2YZ2A 3OE4A 3FCXA 3Q9NA 3SXUA 5LBTA 6YASA 2WU8A 4QNNA 2AFVA 4D41A 1BE0A 1ES9A 2JK0A 1LNQA 2XMZA 3FFWA 1MA0A 5H0IA 1LLQA 1G3QA 4REQB 4JBIA 1P0CA 4L57A 1K63A 4CG1A 1H3NA 4KAAA 3GRAA 1YVUA 5TXGA 2BAGA 2BZSA 2Q3HA 4OQQA 3WA6A 5CDTA 1L4KA 3UCEA 5FA6A 5K45A 1VPEA 3GB9A 3STHA 5C46F 2F3PA 3IB6A 2JFXA 4HEQA 3T6KA 2AOUA 3MT8A 1A0OA 3K16A 5KQLA 1F12A 4AKHA 1DL5A 2DWQA 1DI0A 1VIYA 3RQIA 1HNWB 3VR6D 1X1QA 3HB1A 2HIMA 3EGDB 1TRKA 4ZEOA 3BERA 2PTGA 3PFCA 5BN5A 5TT0A 1XQVA 4UE6A 5IYZA 4LN1A 1TF5A 3A11A 5EIWA 5BR1A 2WUGA 1W6UA 3E1KA 3LWDA 3NEYA 1SC6A 2TYSB 1P6QA 1O6GA 3TIIA 2XB2A 1N2XA 4ZARA 5JADA 2EQ5A 3ABSB 3ZHTA 1DQSA 2YHIB 1X1AA 5AR1A 1MORA 2II6A 1B8VA 2OGUA 4EF4A 2IGBA 3ZV6A 4LV8B 2GKOA 4H35A 1N77A 5F12A 4C05A 5BWNA 4AMZA 2P2LA 3R6TA 1FUKA 3LUKA 3S2EA 3VZPA 5LQCA 1ATZA 4BJHB 2HNAA 1K7SN 3B36A 1E89A 4G1UC 2EYQA 2H5IA 2HADA 3C4JA 3F9CA 3AGPA 2BEVB 3QVOA 5A7GA 1ZEMA 1USVA 2IV3A 4IJKA 1MMFB 1OGIA 4IGEA 1Q7EA 4M87A 2WILA 3G49A 3TECE 5BVHB 4MIOA 2R6AA 1XLVA 1BX1A 1RRFA 4IJUA 3X1XA 5K2OA 4MDHA 4B7XA 1FDRA 2ONYA 2QIOA 4MKIA 4TSKA 5DNUA 4UCWA 3EBLA 4DJ5X 2ZREA 4MLDA 1KWGA 3GBSA 2RIPA 3ADDA 4ICIA 1C3OB 4KBGA 5I9MA 4F04A 2VPXA 5HQTA 2I4MA 4UVIA 1FU4A 3QA3E 2DWOA 1JHQA 3HY4A 1HT1E 1RQ7A 1SBZA 3LGXA 4M1SA 3GY0A 1DWOA 4EQ6B 5AD1A 2OB2A 5K0GA 5J2TB 4RTOA 3WYAA 3HDHA 2AFHE 5GVSA 3GEMA 3DZHA 4L8FA 3RNOA 1Y37A 1W1WA 3PKZA 1TK3A 1ZPDA 3OAAD 1JA9A 2P5UA 4LGYA 2VDNB 1YU9A 4OYLA 2AFIE 2X13A 3ELBA 4MINA 1X8XA 4N3NA 4ARVA 4BNWA 4K81B 3UV6A 1D7AA 1E77A 2J5BA 2YIMA 1XU4A 3QMWA 2A58A 1JKFA 5HIAA 3ILSA 5KEIA 7REQB 1PG2A 2AUMA 4INZA 4FKBA 1CZLA 1X1DA 3GEGA 2ZETA 4ZFNA 2OXEA 2C95A 1M8JA 4WECA 3QHAA 1Y8AA 5CIYA 1W19A 4EMUA 4HPWA 2IW1A 3M1LA 4DCVA 5HKAA 1CZUA 2PGIA 1PI3A 3OF3A 2PRJA 4LJAA 3F90A 1E5QA 1MEOA 3IR7A 4BCBA 4OHUA 3BILA 2DUNA 3ZE7A 2OGSA 2WAMA 4FZJA 9LDTA 1MBZA 3OKCA 3PSAA 4LYGA 4ZKEA 4BQOA 4JGBA 3AVQA 1UBCA 2ONZA 3RRBA 4UJ5A 4GRAA 1L3IA 3LNCA 2P6MA 2NSDA 5FFFA 1J8VA 2ACKA 2V55B 1UF9A 3HB4X 4LRSB 1DRJA 3TSCA 1WSBA 4PNZA 3PQ2A 1AUPA 3L0OA 1CNFA 3L4BA 4AMVA 3C4VA 3CG0A 1G7CA 2P5SA 3K9CA 4AJ2A 5KWIA 2GM9A 1J8YF 3DQPA 5D86A 3DD1A 4TM7A 4M0EA 5I9NA 4BVJA 4D25A 3F9IA 3PC6A 3LG2A 2E1PA 4BZWA 3OQVA 5KMGA 1P1CA 1VKOA 2V6FA 2WR8A 2RAPA 4XCXA 3HCAA 2P5TB 3AVTA 2RC5A 2BSAA 2ETVA 1CQZA 3BTVA 1N6OA 3P97A 5JR3A 4TWIA 1QX4A 2VI5A 4EHAA 1ODSA 3ICOA 1VJCA 1A1VA 1R0RE 4RESA 2VHTA 5L4LA 4G5OA 4FX5A 4CDNA 2PWYA 1T0PA 3DWGA 2Z6VA 3HNRA 4W1QA 2OQIA 5A4AA 2Q1WA 4PX5A 2CMDA 1K7FB 1Y3FE 3U3KA 3P4XA 2UV8A 2WJGA 1Q0RA 2C2OA 1ESDA 4F84A 1I36A 3E61A 4ND1A 4YLEA 3UMJA 3BCSA 3I8XA 4RAOA 1ZNWA 4I5GA 3FFAA 3A6JA 1YCHA 3KS9A 1PNRA 1DUIA 1SOVA 2W6JA 2UXDB 1JR3E 2IH4A 3GPCA 4L4RA 4NPAA 1FS5A 3IX7A 2C3MA 3RC9A 1BROA 1C8VB 1QLJA 3K6RA 4WZBB