4R25A

Structure of b. subtilis glnk
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
SHMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory PII-like protein
publication title Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r25A00
2J9DA 2ZFHA 3AHPA 3DFEA 4OZNA 1QY7A 3M05A 1NH7A 4AFFA 3LF0A 3T9ZA 1PILA 5D4PA 3NCRA 1V9OA 2XG8A 3GSDA 2J9CA 3TA1A 2EG2A 3NCPA 4WK3A 1UFLA 4CO3A 3OPKA 5D4OA 1UMJA 4RWXA 2PIIA 4Y65A 2NS1B 3TA2A 2ZOMA 4C3KA 2Z0GA 3HLUA 4C3LA 2GW8A 4CO1A 1GNKA 3TA0A 2NUHA 4OZJA 1Q1KA 3AA9A 4CNYA 2CZ4A 4RX6A 4Y6IA 1VFJA 3N5BA 4D3HA 2GX8A 2EG1A 4R25A 1O51A 4CNZA 1H3DA 4ZK7M 2O67A 3CE8A 2JJ4D 4USHA 3NCQA 2RD5C 1O5JA 1VHFA 4E98A 4YB7A 1V3SA 4CO2A 4USIA 2V5HG 4IYQA 1V6HA 3O8WA 3AH6A 3AA8A 2NUUG 2XULA 5D4LA 4WK1A 3BZQA 1P1LA 1XK8A 5DS7A 4RLEA 4CO0A 1OSCA 1NAQA 2XZWA 4RWWA 1NH8A 5L9NA 1UKUA 3L7PA 4CO4A 2E66A 4USJC 1J2VA 1HWUA 2DCLA 2J9DE 3MHYA 3O5TB 1UL3A 2J9EA 2VD3A 1NZAA 4NYOA 4C3MA 4OZLA 4YB5A 2O66A 4YB6A 4D3GA 4CO5A 2GNKA 5DRKA 3X3UA 5D4NA 1KR4A 1V3RA 4NYPA 2XBPA
chains in the Genus database with same CATH superfamily
4LRFA 1QY7A 4I0WA 2WBRA 3DLEB 1HWJA 3DM2A 1MSWD 3NAIA 3KOAA 4URQU 2FJDB 1RZMA 3UVJB 4DV4F 1ZTWA 1NHUA 3TA2A 1TL3B 3I0RB 1DBDA 4KHPJ 2AEJA 4YQWA 1S9GB 1YHQS 2V68A 2Z57B 4O3OA 2LECA 3TUPA 1FERA 1FRMA 1XBWA 2HFZA 5HLFA 1J5OB 3PO4A 3BR8A 4QIVA 4ID8A 3HDSA 1U1NA 3AJ1A 3AD7C 2C3OA 2RDIA 1J5EJ 1YBTA 3CDAA 2EFGA 5T7LA 2MQOA 3HO1A 1H6KX 2I1RA 3ZZTA 4ZPCA 5AJ3F 1BD6A 5K8MA 2FVQA 4W98A 4AT1B 2RDJA 1RISA 3QIDA 3QSIA 2F9JA 4CP5A 2RF2A 2CQ0A 2F8MA 3RZAA 2KG1A 1X4GA 4LF4J 3M8WA 5D0EA 3TUJC 4MKAA 3HVTB 2HHWA 3BSCA 2WSFC 3ZTSA 2AWZA 2WVCA 3B8HA 1MROA 3T41A 4UTGA 1WC5A 3T5HA 1X4AA 2GGPA 1FDBA 4ZVSB 4WFBQ 3VGUA 2LQ5A 3DRPB 1NK9A 5E5NA 4PPDA 3J81j 1AFJA 2HQGA 4C8NA 3I9V9 3ET6B 1DURA 1S4EA 1Z2ZA 2YXLA 2DO4A 3AA8A 1IBLF 3DXSX 1UPPA 4OI2A 2YKNB 2DBBA 5L9NA 3GPAA 1TZ0A 5K8PA 4F25A 3FQKA 4NX9A 4YY3J 2ZD1B 1P9YA 3KMSA 2DGXA 3J7YU 4DR1F 4LSNB 4DR4F 2GQQA 2ZH3A 1S49A 3JSMA 1PBUA 4DS4A 3TAMB 4KGVB 4QIEA 2UUAF 1O6XA 4ZS6A 4MIBA 1TP7A 3F56A 1IBKF 3RR7A 5LL6d 3TNVA 3CDEA 5U47A 2C2OB 5DG9A 2L9NA 2FVPA 3AB4B 5ETQA 4J9OA 2CDQA 4TLQA 4LFBJ 4MJKA 1Q7LB 1UJ5A 4U95A 3NMAA 2IAJA 4H4MA 3FZ2A 1U2RA 3N6LA 2GZOA 1H72C 4E8UA 1QDUB 3AXKA 1NSAA 2BJ9A 4IQMA 2FDNA 2F65A 5J1EB 2E1RA 2PMZD 4DFJA 3J7AN 1AUSL 1HHTP 1URNA 4KGKA 4WK1A 1XK8A 1OS5A 2D3ZA 1WTBA 1VBXA 3ETMA 4LRAA 1RA7A 2B8PA 2XEXA 4TU9A 4X4SA 1VLYA 4NYZA 2DIUA 4WFZA 3IXQA 4JI2J 5AE2A 3TWZA 4YHHF 4KSEB 1S4FA 4NA1A 4QWDA 1J27A 4P9SA 1YX2A 1W26A 1VOMA 4IKAA 1J5OA 3L3CA 3A3PB 1B7YB 4NLSA 4OJGA 3O2IA 1Q8LA 1TV6A 3KLFA 3KJQB 4DQPA 1PKUA 3NS5A 4PWDA 1BWVA 2HVZA 3IS9A 2Y8YA 1QTNB 4H4KC 1KLNA 5H9EJ 2G1DA 2GW8A 3A3OB 2XB2D 4OZJA 5KFRA 3H7HB 2W9BA 2BW2A 3WDOA 1WD6A 3B54A 4JI4F 1SUQA 4MK8A 2HHTA 4USMA 3LP2B 3OTCA 2YY3A 1CQNA 1NH8A 4JUZA 4XIUA 1FXDA 3A8JA 4EUVA 1OIAA 2LVWA 4UY85 2HFSA 4K4WA 1FKOB 1MMDA 1NZAA 5KTQA 4LFCJ 4X4OA 1R8CA 1U45A 4PG8A 1S0NA 2RH3A 2VASA 4L3KA 3DHWC 3M32B 4ZPVR 3R5GA 1IM4A 4C8MA 3V6HA 4OMFG 5G4DA 1SV5B 3H0PA 1GMWA 3ITHB 1G1XA 1C4AA 4OYIA 1PJ6A 1CEZA 2DRAA 2KJWA 1MWZA 4PABA 1KBRA 2BVZA 5ETSA 4ZPTR 1R0BG 2HRYA 3GP9A 1VFJA 4LSNA 1F9EB 5LMUJ 3OXFA 4F4KA 5HVHA 4QR2A 2ZH8A 2XYGB 4USHA 2ZH9A 4DV2J 4X65J 3TAMA 4YB1P 2HNZB 1HA1A 1XMQF 4NA3A 3NS6A 4F67A 5HJXA 2ASDA 2G1HA 5F8HA 1VJWA 3TX8A 5E3QA 1FXLA 1R8PA 3W1YC 3D67A 2HG4A 4IRDA 2LP4A 2EEYA 3HM9A 3UCUP 3JSRA 3M8PA 3KLIB 3D54A 4ECZA 3N4WA 3DYAB 3KUEA 2CJAA 2ZITA 1T9TA 5J1EA 1U4BA 4ECQA 2JEJA 6AT1B 3HFZB 3ZZRA 4ZPAA 1KQFB 1HPZB 4EZ9A 2Y8WA 5JVGQ 3EXCX 3OW2R 4M8LA 3B78A 2VG6B 3WX4A 3TEHB 4CLPA 3D4JA 5HMXA 1ITPA 3ZNJ1 3HHLD 3W9JA 1Q1KA 2UXDF 5D77A 2J8AA 5KFHA 3BPDA 4X4NA 4DUYF 4IR1A 1ZZFA 2QMXA 3H42A 2V5HG 3BGOP 5LSOA 2AP6A 4WYWA 2KHDA 2LXFA 1SJFA 4MKVA 5B0AA 3UD4P 5CCLA 4DSIA 1HNWF 1WSRA 2Z4PA 2XNRA 4QR1A 1VQ6S 2LEBA 2FZGB 2CZ9A 4TQSA 1X0PA 2H51B 4P52A 3T5KA 3A12A 4MKBA 1EKRA 1S7IA 1S7HA 4N5SA 2H5EA 4IDKA 4QIWD 1NEEA 1SI9A 1LWCB 2B7CB 3O6QA 2HBZB 2OEKA 2NCKL 1OYEA 2Z8QA 4C3KA 1NXIA 2NREA 1BQNB 1UVJA 1G6BA 3K5NA 2COLA 1QAYA 1JJ4A 1FKOA 4K5RA 3TVYA 2JHEA 5CAAA 1N5QA 1XJWB 3UR3C 2LQBA 3BGFA 4A47A 4USKA 1UEVA 4A46A 4Q7AA 2HWTA 1UVMA 1FKAF 2X3GA 1CJTB 2PN6A 3RU0A 2C3MA 2A6MA 4HTIA 1A6LA 1HARA 2CKWA 1SV5A 2HMIA 4P72A 5GMKa 2UV8A 3ITHA 2DTJA 2UVWA 3HHNB 2IM0A 3FSYA 3H4BA 1K8AT 5SUHA 4W92B 2V8PA 4AL7A 2ZUGA 2KO1A 2OFHX 3BB5A 1WNEA 4WU3A 1F2GA 1HFEL 1PAUB 3J7A1 1KONA 3RBXA 5D4NA 2MZSA 4IFVA 2MJUA 1ZH5A 5EHHA 2DKOB 3EZUA 2V8GA 1F5CA 4G65A 1PILA 1RWNB 4DXLA 4PQAA 1G4CA 3MM9B 3FCWA 2HNZA 4KR0B 2MZ1A 2PIIA 1KDNA 1Q5VA 2A0FB 4DX5A 1L3TA 2ZDPA 3F0NA 2JSXA 3EGNA 2HRUA 2HNDA 3N5BA 3G2XA 1KN6A 4GRSA 2MGZB 3MMBB 1JLAA 4YR0A 1C1BB 2IMWP 2BACA 4YB7A 1XMBA 3HD1A 3M7VA 4ECVA 1OMSA 2BRKA 3K89A 2XLJA 1FE0A 1HPZA 1RT4A 1L3UA 5HVFA 1WOSA 3BSNA 1CJUA 4M5LA 1EIYB 1KRPA 1S76D 5J2PB 4YB6A 3ZO7A 1FWPA 4FPIA 5GAHU 5IWAF 3D0IE 1S1UB 3SQOP 3QJLA 1FRJA 2AIRB 2E5JA 2LKZA 3VGTA 5A0YB 4YN3B 1IWAA 4AFFA 4X84A 2E7XA 2YKMA 1VRTA 3GCWP 1VBZA 1UVLA 4KFBA 2LA4A 3W2VB 2Y0BB 1HBUA 2B4PA 1RBLA 4TYBA 2M8HA 2OMLA 2J7KA 3R5CA 5E3PA 1SH0A 5J2NA 1RUSA 4J9NA 3V5RA 1RKJA 4DLEA 4C98A 4JI1F 4I64A 4F04B 4M5HA 3VZHA 2W2MP 2ZKTA 4CLTA 1S6PB 5DDOC 2OTJS 1WKJA 4C8LA 4ZJLA 5B0DA 2ZE2B 2VBWA 1RB0A 2V4JB 1M1KT 1HYSA 2X1AA 3O1LA 3A13A 4ED3A 4OL8A 2JEFA 3A8EA 2AX0A 2XYHB 3UI3A 1OJ4A 1XMOF 4C6AA 2ASLA 3AOBA 1R0CB 2J9DA 4F0MA 1DARA 5KFSA 2AZ1A 3DLBA 4OYPA 4QU6A 2VOPA 2IA6A 2KXHA 2HAIA 2VQEF 1RHRB 1X9SA 1YJ9S 2F4VF 3LO3A 3MMAA 1N36F 1FRXA 3KG1A 3M9NB 1JKHA 5RUBA 1UFWA 3B6BA 5KFWA 3LGNA 3R27A 4Q5VA 5M2PA 1TKZB 4HR2A 2OIHA 3Q8SB 2RIJA 4Q44A 3GR1A 4JV5F 1TK0A 1PCAA 1FJ7A 3MEGB 3DLLQ 1IKYA 2E7VA 1VQMS 1GX5A 2CIMA 2XGPA 5GAEI 2CQDA 3KLGA 5I4MA 1U1MA 1LQ9A 4NZ7A 1FNXH 1MW7A 1R7IA 2P9CA 3W61A 2JLEA 2VOOA 2RRAA 2ZBRA 3SCIE 2HGLA 5DRKA 3M8QB 4C8OA 2UUTA 2WONB 1M5VC 4CH1A 1KLMB 3I6PA 3K5OA 5HN0A 1HNZJ 1RWVB 1T9UA 2ZHBA 4N7TA 4B3TJ 3WQPA 3VGVA 1RJJA 2V2KA 3DRRB 4KYZA 4WE1A 1S9FA 1RYSA 3PG9A 1LW2B 4EZ6A 4RW6B 1LWFB 2VUGA 2OMOA 1MMNA 1CPZA 1NSKL 3MUTP 2HBRB 5KFXA 1MNEA 5IV4A 1S1XB 1T95A 2MLYA 3CJ3A 5HQLA 1S1UA 1VIXA 4DR6J 3BBCA 3GV8B 2DGVA 3MM6B 4JYAF 5A0YA 4OYMA 1K1QA 5ETTA 3C8YA 5HVGA 3EGVA 3KJVA 4KKOA 4CO4A 3EXYA 3W2VA 4JI3J 2VG7B 4M5DB 4OJ3A 3JYTA 1KEKA 3ZTOA 3G71S 3QGGA 4DCOB 4F8RA 2EFNA 1UA1A 4F0KA 2P6TA 2DH8A 2YX7A 4FF2A 1JXEA 3GV5B 4QYZJ 3TI0A 4K0KF 4PG4A 1M1HA 4LR8A 4G1QA 2G2YA 2KHCA 4V19J 5D8HB 4K7QA 1KVIA 3IBCB 1I6JA 3FEXB 2MQLA 1N88A 5KG6A 4OHWA 1TQLA 1U48A 1M90T 1S6PA 2DNQA 3OHBA 1HR0F 2KYZA 1EQ0A 3H2LA 2I8EA 2FHOB 2HHUA 3BKFA 1R8AA 2DPJA 2XMJA 1TKXA 2ZBIA 2ZZNA 2BOAA 2CG4A 4ICLB 4KGZB 4NLYA 4ZPDA 3KJFB 4B9TA 2VQFJ 2VDIA 3T6JA 2GAGC 3L7OA 1N5VA 3OL6A 4RLEA 2C22A 2QIFA 4QQBA 1YZ7A 5B08A 1BC6A 2JWNA 3UN3A 1E6YA 1IKVB 5J2MB 3VAKA 2XTJP 4LSZB 1HW8A 3LANA 5L1IA 1NJIT 3MFIA 5IQQA 4LF2A 3OUYB 2UVVA 3CW2C 1NB7A 2DHHA 3GONA 1VHIA 4AXJA 1NCLA 4DUZF 5KFUA 3SFGA 4R5PB 3UFCX 1WC4A 2MZTA 3EYZA 4LR7A 1YJVA 5B0EA 3MCMA 3TUZC 2XG8A 4RO0A 5A8RA 3D2WA 2LQ9A 3H5XA 5I42A 3PFEA 3BQ0A 1REGX 3HZGA 4GVBB 3MD1A 3HX9A 1BHNA 3W66A 4ES3A 3NCQA 4LREA 3C66A 2KYXA 2DXFA 1MG7A 4BBYA 3SDEB 3ISNC 1RLDA 3LPEA 5IFMA 3QZ8A 3WC0A 1U47A 3Q24A 2NXEA 2R8KA 2MQQA 3HPOA 3G6ES 1VQ5S 4O4GA 3HSZA 3L7PA 3DRRA 2QGFB 4PXDA 1R6YA 3NNCA 1F60B 3Q8VA 3TW0A 4U67Q 1LW2A 4CO5A 2HVDA 4KJIA 1LWFA 1VK8A 1ZAVA 1NRKA 2POKA 1JLEB 5AXLA 4I7FA 3ZC4A 1NH7A 1MLAA 1RWPB 1FFSB 4MTPA 1RWMB 2FJWA 5A8KB 1S1XA 5MAOA 2Q79A 4ILRA 3B4MA 2CQ2A 2HLUA 1FK9A 5LSRA 3ZZOA 4A8YA 3MM6A 1FRLA 3Q0AA 5B7WA 1NJZA 2MYFA 4L74A 2CFXA 4TVAB 1P9QC 2PMWA 3L4BC 4JI8J 3CVKA 1SIZA 3R1HA 3QFWA 3G8TA 2JNJA 2ZH7A 4B02A 1TMMA 1U25A 3JSBA 4UF4A 1CLFA 5BR8J 1Y3JA 4M5MA 3ZZYA 3KHLA 3P5TL 4OYAA 2XQCA 5ETPA 1T3OA 4KY3A 2DGTA 3CC4S 3G6YA 3GB0A 3T19A 2DNHA 1KFSA 3MM8B 4USJC 4DL6A 1KC8T 3FGVA 4DFPA 2N7YA 2KXNB 3S6EA 2V2VA 3KK2A 2VFRA 4IO9Q 3THTA 4JI5J 3LAMA 3RB4A 3T5LA 2HAFA 1U0HA 2OPRA 4CYUB 4F26A 4ECRA 2YQ1A 4YDXA 3G6XA 1FESA 1N5SA 5CYQA 1JXLA 1N6QA 1OY9A 1ZA1B 4UOCA 2QTWA 3Q8QB 5K20B 1HWLA 2HKEA 2LLZA 5J2MA 3BSOA 2VJUA 3KNGA 5I3UB 3THVA 3OUYA 2DGOA 1S1TB 4HDHA 2XZDB 2OD6A 3OHAA 1DTTA 3EVOA 5KT3A 4GC7A 3F44A 4LBHA 4PXEA 4FF1A 3AOAA 1CS4B 4IH5A 1XR7A 3CIMA 2XO6A 4NLUA 1GXUA 3WC2A 4G6VB 3FMBA 1QUPA 2FYXA 2J9DE 2N3OA 5KFTA 2CDRB 3W60A 3ZXWA 2IBOA 2RUGA 3CO0P 2QYCA 2GJ2A 2VFTA 3MF5A 2F8EX 2PE8A 2IPOB 3GYXB 4K2JA 2MLZA 2DY9A 3WHIA 5IOLA 1RTZA 3DFEA 5JVHQ 3DOLB 4YR3A 3CWJA 2LQ8A 3CUNA 4IH7A 2B4VA 1JWWA 3MGJA 3PJ9A 4Z7CA 1BWEA 4A8KA 3T9NA 5CCMA 2GIRA 1NPKA 4FBTA 4LIWA 3OL8A 4O3QA 2BR0A 4ZN1A 4XTTA 5C7PA 1X4BA 2OAUA 4C8KA 1WF2A 2NQPA 2LDIA 2ZM6J 2O67A 3R9LA 3HXMA 4WPAA 3GCXP 2RUSA 2XULA 3DI6A 1UTAA 3GJTB 3FZBA 2ZH5A 2VHGA 2HQIA 2E66A 3ILLA 3PDNA 2BYCA 4WIIA 3M1VB 1H73A 3ZZUA 2CQIA 2QSFA 2V34A 5AE1A 3DOKB 7FDRA 1RAEB 1QTMA 3CJTA 1SC1B 2EPIA 2VB6A 5D4PA 1YVFA 4DHVA 3L7UA 1RK8A 1LW0B 2A1BA 3VV2B 3SXLA 2NSCA 1EX8A 1SXLA 5GADU 2XC9A 3M2UB 4KPCA 5HL7Q 3G8QA 3D68A 4DQQA 3WX8A 3AB2B 1IUJA 2JLFA 1N34J 2V8VA 3BBBA 3DLGB 5LXRA 3QGPA 2MSTA 3R7BB 5LT5A 3AXMA 3ADAC 4ZVFA 1RT5A 4LSLB 7FD1A 3HHLA 1NLKL 1Q53A 1X5SA 4CYUA 2FJEB 3C14A 1EAYC 1EQMA 2JC0A 2XMWA 1IKXA 3VR1A 4LF1A 4QWCA 3RAXA 3CCQS 3UWTA 1UL3A 2XSFA 2JVRA 4LIRA 5EGYA 1OYDA 2CJXB 2DNZA 5DM7Q 4IUFA 1KFDA 4KO0A 2OP5A 1YLXA 1LWEB 4I68A 1X5PA 1U49A 2CVIA 1RDRA 3M05A 2FHMA 1MWYA 2BE2B 5ADZA 5I3UA 1S1TA 3BDPA 1AFIA 3FRZA 2AJQA 3W8PA 2UUCF 4EFAC 1R43A 2DJWA 4LRBA 3POTB 4U7UD 1EJ7L 3CJ5A 2MKCA 4YS2A 5DG8A 2DH9A 5GMDA 3C15B 4DV5F 4M1KA 3Q8YA 1KWMA 2R7TA 4HL9A 1WACA 4FF4A 4OHXA 2VG5B 2H5IB 1VBYA 4Q0BB 3GJRB 2OPQA 1JLQB 1Z4UA 2ALYB 2NPIA 3SV3A 4A8XA 4CO2A 4PR6A 3DOLA 3TEGA 5E0OA 2ZH2A 3BYRA 2H48B 4HEA9 3MWBA 5GVQA 4Y2MA 1VQPS 1CJVA 2RQ4A 3DGPA 2IDEA 2FTRA 3FFIB 5AE3A 1EETA 2V6AA 4NYPA 2QG9B 1IWGA 3FDSA 4DZ6A 1CG2A 3LF0A 4F3MA 3Q2TC 3T1HJ 1SVDA 1JNZB 2R2TA 1X4CA 2QA2A 3CDBA 2EFPA 2CQHA 5CYMB 2MHNA 3OXLA 5KG5A 4BLGA 1RQ0A 3EPIA 2FC9A 2DHGA 3W9IA 2EFQA 3AA9A 4OLPA 2DVIA 2H54B 3DHXA 2HZAA 1GMUA 1YWXA 4WFNQ 4KPYA 5D3GB 2DHSA 3LWMA 3P5BP 4ANEA 2B0GA 2OGUA 4KV8A 4KHPF 3J7YI 1F2HA 2HGNA 2LU1A 2B4UA 1NBEB 2HQFA 2IVFB 5L46A 5E41A 4C3MA 4B08A 3TO8A 1J5EF 2ERRA 3I55S 1PIEA 4RW7B 3BBFA 4O4RA 5DLGA 1MN9A 3FSXA 2IBKA 4DQIA 4JB8B 1BGXT 2RS8A 4R0JA 2B43A 4E0DA 2X3DA 1HQEA 2C3UA 1N5TA 4KHRA 3TZYA 1K44A 4FYDA 3OPKA 4KC5A 2K7JA 2QFIA 4DN0A 2APOA 2BQUA 4V1Ak 3DXBA 1HD1A 2MKIA 4OHVA 4LF4F 2DRDA 2CZ4A 3VWSA 1P6TA 1UW4A 1BLUA 3DN9A 2AQ4A 1VC0A 2EG1A 4FKXA 3IA0A 3NGRA 2EI5A 4Y2KA 3OT9A 2CPIA 4NLQA 1GMWD 1ROFA 1AZSB 3K8VA 1LWEA 2N4DA 4ZCIA 4QCLA 4I6WA 5LJ3Y 1FFGB 1D09B 3F73A 2KZMA 1IKWA 2UZAA 2KT5A 3NMRA 3PW5A 3R5DA 4ZVTB 5J1PA 2GVDA 2C2RA 4DX6A 2R42A 2C3YA 3UO0A 1HHQA 5HQ8A 4DI6A 2IJNA 3KUGA 4A8MP 1PC4A 4M5IA 3S7RA 1JLQA 1UA0A 3HKZD 5HANA 2ILYA 2YNGB 4GVLA 4EK2A 2IMOA 5KFDA 1Z2LA 1FKPB 9ATCB 3N5FA 2I5JA 2GHPA 1NPRA 4H4OA 3PW0A 4Y34A 2OTLS 2RQKA 4CQ1A 3E01B 4CCHA 3R2CJ 4JI0J 2DNGA 2MMYA 3PKMA 3OQ2A 4O0IA 1D0EA 5DQGA 3AJDA 4LVOP 3JQMA 2XLIA 4LFBF 1IR1A 5F41A 1V6HA 3QWUA 4ZPBA 4UZCA 1GXLA 3QJPA 1NKBA 4FYWB 3G6VA 3D7SB 3P3DA 4DR4J 4YUDA 1NDPA 3PZPA 4WYLA 4J37A 2UUAJ 4KB7A 3PR5B 5E3AA 4K8RA 2V50A 4I56A 4D3GA 5B0CA 2O5DA 3HF5A 1LV5A 2KTQA 1IBKJ 4JP8A 2CYYA 5DG7A 4FXVA 3CF5Q 2CRLA 2FLOA 2U1AA 5LJ5Y 3EICA 2Q6BA 4NMXA 3DDNA 3MR3A 4L6V3 2PMHA 1RABB 3PYEA 2R8JA 4DSJA 3C3LA 1S1VB 1TL4A 4CNYA 2V2QA 1NHKL 2B9WA 3BF4A 3I4PA 2H4YB 4I2QA 1W7WA 4UW2A 3ISND 3KFWX 1N33F 4FXDA 3S01A 2YNIB 3NWRA 1CJKA 2UU9J 5A2QY 3Q2SC 3NBPA 1T02A 2Q66A 4B9LA 3AOCA 2BE9B 4DUTA 1NDKA 4RL1A 4PPZA 2Y1RI 1M5SA 4DN9A 2UXCJ 2VA2A 2Z58B 2DXDA 2HNYB 3EJMA 1RTJA 2YWGA 4PWWA 2W7PA 1JX4A 4ED0A 1APSA 2OEJA 3CCSS 1TTHB 5B0FA 1JLFA 2W24A 3CJQA 3H20A 2P8IA 2KL8A 1S79A 4I2PB 3CCTA 1AZSA 3CSKA 3NP5A 4LFCF 4DG1A 3QLHA 3JQKA 4XAKA 3MUMP 2PI4A 2DNLA 5KFNA 2RAQA 2R7SA 1Y9OA 4QW8A 4NCGB 1FFWB 3U7JA 3PIOQ 1HNVA 4WZMA 1PAEX 1YI2S 1BUXA 3FMWA 2EKNA 4IOBA 4CLUA 1R31A 2L08A 3MM7B 4DWIA 2HHVA 4TY8B 1RWOB 2XI3A 2FIUA 3RUBL 3VVUA 1JJHA 5HJYA 2NXJA 3KNAA 4I6AA 5D15A 1LK7A 4CWBA 2YNGA 4RUBA 2NZ4A 4ZLLA 3EGWB 2W4DA 1Y4ZB 5LMUF 3MCOA 3NLCA 1WOOA 4ZCLA 2VPZB 4FZVA 4LF8J 3W2WB 4X65F 4N56A 3AJ2A 4DL4A 2VPYB 1U6FA 2DT9A 3H98A 1K73T 2B5JB 1EARA 3KTQA 4HTJA 4EBDA 2BMBA 3QO9A 4IFYB 2WSCC 1H38A 2OKQA 4QPXA 3DLHA 3HD2A 5E3CA 4ZHRA 1IN0A 3SQGB 1RKIA 1RAOA 1F1BB 1DHMA 4F4YA 2AYMA 5EX0A 1N4LA 4ED7A 3OR1B 3N01A 2PEHA 3TJ8A 2IFXA 6FD1A 3HLUA 3K59A 2KH9A 4CT8A 4OYXA 2ASYA 2M52A 2HFUA 1HKAA 3V2UC 1T94A 1SL1A 4AQYJ 2FLPA 1F5AA 2YWEA 4JI6F 1S9EB 2F9DA 4OYOA 1XMQJ 4N47A 5DGAA 3GZ7A 3QSYB 1CC8A 1X8DA 5C24A 3CDUA 5EX3A 2HVHA 4B3MF 4NL5A 1XNRJ 3J7Z5 4PQUB 2MY8A 1WF1A 2HHXA 4LFAJ 4N77A 3TR5A 1ZM2A 1R89A 4P2XA 1BQMA 3QT8A 2M7SA 3DCAA 3GJQB 2VBZA 1C1CB 2V2ZA 1S6QB 4TKTA 2WVBA 4HYKA 4NMLA 1KOHA 2JFKA 1YTYA 2P9EA 3TZZA 4R8UB 4ZLPA 3ZTPA 4P7TA 8ATCB 4B3SJ 3IBFB 4HHUA 2QLFB 1SCJB 2CA9A 2JC1A 2YNIA 2V67A 2CPFA 4BWMA 5C2CA 4ZDNA 3TZXA 4PAAA 1SJ1A 3TARA 2HBQB 3VHQA 3SSSA 4A4JA 3DU5A 4DUYJ 1X0FA 3QFHA 3V4IB 2BKOA 2BV3A 3VZIA 2BKPA 2XCAA 1LFWA 1Q16B 4WFXA 1NMEB 3AD8C 4J7CA 1HNWJ 2EKYA 2BUNA 1RHJB 4MK9A 4C7QA 4ECUA 5D0RA 5DDPC 4F4WA 1B7FA 3LALA 4CLSA 5KFFA 5CD4A 3IRWP 2C2EA 1FTCA 2RDDA 3IWNC 2XS5A 4X66F 2R3VA 2J76E 3US5A 4HH1A 1RTDA 1UW9A 2QC3A 2ACYA 1KHVA 3MM7A 4PUOB 5CZXA 5F0WA 3BSAA 3DNCA 2FZCB 1PSDA 4CLZA 2LCWA 2J6TA 4RWXA 2BJEA 1X5OA 4YP3A 1FDDA 4CO1A 3QPIA 1Y00A 2VF3A 3VAGA 3GIIA 4PRFA 1OPZA 1RAIB 1CULB 2YPZA 2RKIB 2ADCA 4CNZA 1XR5A 2JJ4D 1TL1A 2UUWA 2W7AA 3Q23A 2B5JA 4ED8A 1DFDA 4CLWA 3RAQA 3F41A 4P75A 4TQRA 4IFYA 4Y2CA 2KJVA 2QE5A 1R0AA 5HI7A 2PFDA 3D28A 4FYVB 1VQSA 3RAMA 1KKHA 1Q8KA 1C0UA 2AGOA 1S1WB 2OO4A 2MKKA 2AEMA 2MEWA 4DFKA 4O3SA 4OZLA 1U0SA 1T11A 5DJBA 3LP1B 2QV6A 1RADB 4EBCA 1HW9A 4UOGA 2MPUA 2IYIA 5KG2A 4MMOA 1B3TA 4DL3A 1RT1B 2BQRA 3IR7B 2AKWB 5FIIA 4UUXA 2FLNA 1VQ7S 4B3OB 3QYYA 3IM8A 2E9ZA 3T1AA 4DR7F 4ZITA 3DRYA 3GU0A 1NSQA 3W64A 5DQHA 2NZCA 3GYGA 1KOOA 1LFPA 1C1CA 4N8NA 2HSEB 2GFFA 2BE7D 4C0OC 4ZIVA 1FJEB 1KVJA 1PBAA 3QIPA 3NAHA 2QT7A 3FEZA 1QLNA 4LR9A 2IJRA 1RAJA 4DEZA 2OD4A 1VQ8S 5DO2A 4I1TA 2KFYA 4CIOA 4USTA 2CQGA 4CH0S 1VMBA 5L39A 3I31A 3CJ8A 2WVDA 2KDOA 1XIQA 1AW0A 5IWAJ 4HT5A 3I82A 1UZHA 4MFBB 1AUDA 3KXDA 3T5JA 2XWXA 4WP3A 1XC9A 1IQZA 1Z1ZA 2F63A 4DV7F 4F2RA 3HMJG 5HROB 4XDCA 1L3SA 1VQ4S 5EUHA 2BZ2A 4F3QA 3OBIA 1LNQA 3G9CA 2RRNA 5ITHA 2GA7A 2V4RA 1YRUA 3R6GB 4QZVB 4QJVA 4RPFA 1EP4A 1YBAA 2HGMA 1KTQA 5E33A 5G0RB 3W63A 2ZBPA 2H3EB 3FK4A 1WEYA 4DV6J 4MAKA 2HIYA 4USWA 1KQKA 3I0SA 2A2CA 5HK4A 3MAAB 3D66A 3EE3A 1L3KA 4DR3J 2QEXS 2OJ3A 2XZWA 1QD1A 2GQ2A 4GC6A 2OSQA 3QQCD 5A76A 4F36A 3I5BA 5KFBA 4QU7A 3I96A 1XMOJ 3PEJA 2EC0A 4RW9A 2KZZA 2LDYA 2LQJA 3GWCA 4U6PA 3FBEA 1CULA 2FJAB 1VQLS 2RKIA 1F3VA 4Q45A 5D0HA 1WUUA 1NJXA 3QRQA 3KLVA 2F3JA 4ED1A 1RT2A 1QSSA 3D6MB 4NI2B 3M8YA 2KRRA 1RT3B 2OPPB 4F50A 2A2DA 3QZ7A 4ZLNA 4X4QA 5AT1B 3M2RB 2EK1A 2MKSA 2ZH1A 1JQGA 3RBEA 3TVKA 3JAMU 2QYGA 4B3TF 1VRUA 4O44A 1U1RA 1ZOTA 3M9MB 4OYZA 2DNRA 2J6SA 4FN5A 3DRSB 2GVZB 1HLWA 3CJKA 5D4LA 2HFNA 2DR8A 4TU8A 1RT1A 2FVRA 2ZJRQ 2WZ1A 2HIQA 3IAS9 3HCXA 3GFYA 3MCSA 5HQMA 2JDJA 3D3CJ 1I94J 4EEYA 3PXGa 3G82B 3V6DB 3NGDA 1HNIA 5ETVA 4E2FB 1K47A 2MTLA 4RU9A 2WOMB 4HHJA 5K14A 1SH3A 2DEIA 4Y2AA 4NLXA 4G1PA 1S0OA 3W7BA 3MEDB 2ZBQA 1KTVA 3VVTA 4RBUA 2HK3A 3CD0A 3NCRA 4K5SA 4WFAQ 2W25A 2HVIA 2CJBA 3D9BA 5HBMA 1HBNB 2W2PP 4HACA 2DR9A 3D3BJ 3Q8RB 2VDHA 5B0GA 2DNOA 2YNHB 1T3NA 2DK2A 4DJBA 3MTJA 3CCLS 2FZKB 4AXIA 5J2QB 1WC1A 3DLEA 4M5KA 4DR5J 5B0BA 4TY9A 3QRRA 1DLOB 1UETA 3SV4A 3UVJA 2E1CA 4E98A 4NCBA 2CPYA 1OWXA 1TL3A 3I0RA 3B4DA 3PX4A 4RNFA 4URGA 1S9GA 4PG5A 3MCNA 3BREA 1RU2A 3LAKA 1FNMA 3U1NA 3GFXA 3KLEB 3ILJA 3BQ1A 2DCLA 1B70B 1F0XA 2Z2LA 1DJ0A 3H2UB 2OUGA 3I4HX 2DPIA 2W2OP 2GMHA 5M2UA 2DR7A 2VQFF 5HSPA 2ZFHA 4DBQA 3KK3B 4XK8C 2AT1B 3ZTQA 2H9ZA 4FYXB 3DDIA 2PD1A 5D6GA 3CB4A 5T14A 3G8SA 1X9WA 4CTAB 5D4OA 1FRHA 2VICA 3FEYB 3IG1B 4J9PA 2CJQA 2HLTA 1SKSA 3HVTA 4G3IA 4M5GA 2CPHA 2AV5A 3FBCA 3C6TB 4P2SA 2MQPA 1SPBP 3KG4A 3KHGA 3LWLA 3MAQA 3LPYA 4F7VA 2IC3B 3HKWA 3DRPA 3P8BB 4NI2A 2OPPA 3R8YA 1JLCB 1XN9A 4CLYA 3ET6A 4IQXA 4IG0B 1T7PA 2VL1A 2QLWA 4DUZJ 4ECXA 1YJUA 2YKNA 3GG1A 1QVFR 2JVOA 1NDLA 3DLKB 4HI1A 2ZD1A 2FD2A 1U09A 5D0GA 1F9FA 2CVEA 2E9TA 4L73A 1Q8IA 4WK3A 1UFLA 1Y5LB 3H90A 5KT7A 2K1RB 4O3NA 4CI0B 2AJ1A 1S97A 3I56S 3EPGA 4ELVA 2E5HA 2CPEA 3CMES 3LW5C 2VKRA 5LMNJ 2WTFA 4B9UA 4M95A 1UZDA 5LSLA 2DITA 4J9KA 1TVRB 4JI8F 5KT5A 3D5MA 3MD3A 5K8NA 1SC3B 1ZM9A 2BABA 1LOUA 4ECTA 4K4YA 1NNDA 4U7UK 3JQJA 3PACA 3BS9A 1H0HB 2NXNA 4HHHA 2DGQA 3W65A 3IGNA 1V5IB 2IJFA 2DGUA 3H40A 1N32J 4RBVA 1KNZA 1IM6A 3UDLA 4ZKAA 4DS5A 4NZ6A 1T0TV 1YIJS 2VH7A 2XCPA 2D9PA 3MFHA 4NLDA 4YFUA 3VALA 3H8YA 4JI5F 4DFMA 4ZVPB 1JLGB 3FVYA 3WIUA 1NDCA 1NPPA 3FBBA 3NRBA 2BQ3A 3W9HA 3CCES 3PNIA 2OEMA 5I3QA 1KS2A 3M9OB 2HWIA 4K4SA 3RGIA 1TL7B 1HQ2A 5K8OA 8AT1B 4AL5A 2OELA 1PO6A 1NO8A 2LU2A 4P74A 4KRWA 4O3PA 3R1LA 4FXWA 2FVCA 2MZQA 2ZZTA 3LP2A 3V81B 4BWJA 3GJSB 4IRKA 2W2QP 3H4DA 3D6HB 5GADI 4OFZA 3PW2A 1FXRA 2H4WB 5BJRA 1T05B 5ETOA 1LXJA 1CVJA 1M5PC 1FVSA 3C19A 2WB1D 3CMQA 1QM9A 1P27B 3IRXB 2KG0A 2QLXA 4C3LA 2HFVA 3M32A 2J6UA 4P2MA 4Z37A 5IM0B 3OVAA 1D8ZA 3H59A 1ZPVA 4LMZA 4DPTA 1TK5A 4C8ZA 1HIYA 3ZZZA 5GAGU 3PRVA 3DDKA 3RJMB 2RD5C 3BN4A 4IYQA 2VPWB 1RT7B 2AYEA 3CJSA 5HP1B 1VQNS 2FPHX 3KLHB 3IMQJ 1SJ4P 1EKSA 1W2BR 3WZ0A 4K4XA 3R7SB 4K4VA 4KBIA 5DDRC 1GK8A 2ZM6F 4DF8A 3D1HA 3PRDA 2IHR1 1RTIB 2RQMA 1YG0A 4M5NA 3R97A 2B6AB 4C4WA 3FKBA 4K2XA 2Q1LA 5KFQA 3AHPA 2DYAA 1U1LA 4PEOA 3BH6B 4CM2A 3CC2S 3U02A 3PY8A 3GILA 4J9SA 4IOAQ 3AD9C 2HURA 3SI8A 5I3PA 3ZZ0A 4I69A 2GHWA 3CT9A 2R2UA 2GS8A 3BDEA 1Q0NA 3MPUB 3LGMA 1IBMJ 4DOZA 5JUMA 3KK1B 4ED6A 2HS3A 2MDAA 2B9YA 3B82A 2HQ3A 3KLIA 1HQUB 1FNOA 3KDOA 1WHYA 2C2NA 4YEAA 1U6BA 1FX2A 3DYAA 2FB0A 2W4PA 2YWHA 1XERA 3HJVA 2GX8A 2E5IA 2R8IA 4Y00A 1H3DA 2KI2A 3KWMA 2XSJB 4A8SA 3FCHA 4NASA 4P6QA 3S8SA 2BJDA 2VG6A 2AJFE 5FDLB 2H65B 1N54B 1WC0A 3AODA 4OV6A 1RT6B 3JTPA 3HP6A 4NLGA 4U9RA 3CJ4A 3DM2B 5B09A 1F9HA 1I51B 1C0TB 3R7NB 1XNQJ 1DY3A 1Y5IB 4DQRA 2VFVA 2HBYB 2VFUA 3ENQA 2LXIA 2YWFA 3GYNA 2D3O1 3VGSA 5KOWA 2PA3A 1ZAWA 1VIOA 4QYRA 4GKKF 1JLGA 3CCUS 4LF7F 4TLRA 2PI5A 1Q95G 5A2QU 4OV1A 5HLFB 4MIAA 4Q2MA 3W5XA 1YJRA 1HBOB 3O44A 1FX4A 4FKYA 3PW4A 1SKRA 2HW3A 4LF6F 4B9VA 3MR7A 5T7LB 3G4SS 4D3HA 1T9VA 1SJ3P 1X9MA 3ULHA 1M5KC 1B0TA 4QW9A 2Y9HA 5BYQA 1LWCA 3V81A 2WK4A 1REVB 2X7IA 1H2VZ 3P49B 2NUUG 1QUVA 2RF2B 1BQNA 3J81Y 4UY8T 1YITS 2VA3A 2CJ9A 1R8BA 1T05A 2IDLA 2IIHA 2RE1A 1WG5A 3V4MA 1V5VA 4PCQA 1A7GE 2ROPA 4EI2A 3IRXA 4NLPA 1YJTA 1RP5A 1SB6A 3NWGA 1VGYA 2RILA 3Q22A 1CJTA 1V3RA 3D0GE 3LOUA 2GGPB 3A8IA 4ETXA 4ERDA 2UUCJ 1IJFB 3K5PA 4AD6A 2YPYA 3SCKE 4ZIWA 3KKFA 1RT7A 3HVRA 1Y0HA 3RG6A 4DV5J 3NKYA 2J0SD 3KLHA 1CBKA 2DNYA 3W5YA 3TA0A 3M30B 4IRCA 1Y3KA 2HFOA 1SKUB 4RUAA 2E29A 1TUWA 4RX6A 4WTYA 1VS3A 2MHEA 3MM9A 3T1HF 1O51A 4LF5J 3OVBA 2XHCA 2DNKA 3BN7A 2CQPA 3JSMB 2XS2A 4ZVEA 2A6OA 1D9AA 5EWFA 1RHKB 3HHDA 2MGZA 3MMBA 2BXJA 3FC9A 3CD7A 1HBMB 1C1BA 3K58A 4LQ3A 4NEZA 4K50A 1YSJA 3NNAA 4PYDA 3MM5B 2IAJB 4H4MB 2FJXA 4USVA 3IWLA 3D6TB 2U2FA 2XSJA 1PJ7A 4YDDB 2FVSA 2WSEC 3D1OA 1SKWA 3FNNA 5J2PA 2GIFA 2MZRA 4DL0C 3NOCA 3J80Y 1NK6A 1IXKA 1H2TZ 1RWUA 1X4FA 2QA4G 2X51A 1RT6A 3TVZA 3AQOA 2NUHA 1C0TA 3P4UB 1QJHA 3K0JA 4LRCA 4DLGA 1R8HA 3K57A 4K4ZA 2HRTA 2V9WA 2CQCA 1SJRA 1R3NA 1BXNA 5L1KA 3TAPA 2FY1A 2N82B 3G86A 4K59A 4LVNP 2ZWPA 2QX0A 2KFNA 2VFSA 1TV6B 2BJ3A 3KLFB 4QWBA 2NXUA 1WEZA 4DV0J 1VCTA 1HBOA 2VD3A 7AT1B 4RKUC 4PWDB 1NSPA 4OX8A 1YGYA 2JEIA 4BC9A 1Y7PA 3IS9B 4WXWA 1GAOA 3QGIA 2ZE2A 3MR5A 3MDFA 4CM0A 2ZVIA 1X31C 3NG8A 1U7LA 4JI7J 2V4JA 2W9BB 1REVA 5L38A 3KHRA 3I32A 1N5YB 2OI2A 2CAJA 2BJ1A 1SUQB 3MR2A 4ER8A 2ABYA 3EX7B 2OHDA 3HSDA 4B3RJ 3LP0B 2BJ8A 1DQ9A 3RR8A 4TYAA 2KM8B 2RRBA 3S1TA 2M3DA 5KFLA 2B9XA 3OJUA 3AY0A 1Y10A 2WB4A 3G96A 1V3ZA 1LKZA 2PC6A 4CRJA 1FJCA 1EZZB 4P10A 1FDAA 4KAIA 2ZC3A 3ONQA 1T03B 1S59A 1CC7A 3R3TA 4FNHA 3NS7B 1F6TA 4GKJJ 3VAMA 1UWBB 1D1UA 2XI2A 4YMEA 2E5GA 1T8EA 2C2DA 1UKUA 4JI0F 3N6NA 5KG0A 2CPXA 4CLFA 3CD6S 3MPVA 1TKZA 1WOPA 3IN5A 2ZOGA 2GMJA 3D6FB 5IXUA 1HMVB 4HLBA 5IT4A 3M30A 3MEGA 3TANA 3IR5B 1S57A 3SSRA 1OY6A 5DM6Q 3CIZA 4C8YA 1MU2B 3E8OA 2ASJA 2MQMA 2VC1A 3QWPA 4K4TA 2KN4A 4NRUA 1BY9A 1ZZNA 3M8QA 3BO3A 2WONA 1JMTA 3U1LA 4F0HA 1KLMA 3HSJA 3HK2A 1TFYA 2LEPA 2Y1LB 1HBMA 4Y2IA 4DPYA 3QNWB 5A6WA 3HFKA 1E6VB 2DRBA 3DRXA 3MM5A 4ZP6A 1UVIA 5F8JA 1FJGJ 1RSCA 3OLAA 4NXNF 3OD2A 3M8PB 3V6JA 4RW6A 3PHTA 2MSSA 1JJCB 3CULA 5FLXU 4OIXA 2R2SA 4DCJB 1TK8A 4NXMF 2LYVA 1B64A 2GHVC 5CZVA 1S5ZA 2E1MC 4DL7A 2UU9F 1KR4A 3M6VA 1S72S 1JXVA 1D9DA 2O1PA 4EBEA 4DR2J 3SSQA 5KFCA 3OTOJ 1Q86T 3HT0A 1EHWA 2ADBA 2VG7A 2LA6A 4M5DA 2YH0A 2PGCA 3IGVA 2LXUA 2UXCF 2QRRA 3GMGA 1DAXA 2KKHA 4L75A 4Y65A 3OSPA 1Y5NB 3CDWA 1AROP 5KFEA 1A9NB 3U27A 1N33J 2IRYA 2G4BA 4PYAA 2AEFA 1FHTA 2P9GA 3NGTA 2EXUA 3PX6A 2VPXB 4H54A 5E7OB 1OSCA 4NLOA 4RU2A 3P45B 1UWAA 1U8WA 2GAHC 2XMMA 2NSBA 4DV1F 1N5YA 3RYLA 5J1NA 1UVNA 4UQGA 4IDKB 4ICLA 2AGQA 2YWKA 4O0NA 3LP0A 2YQ0A 2J0XA 2R7XA 2JLGA 1NU4A 2B8QA 3UN5A 1WWHA 5THWA 4QIFA 3PW7A 1HNXF 3CXCR 3PYFA 4JV2A 2CNKB 1IKVA 4XPEA 1ZS6A 1T03A 1S0VA 3TX0A 5L1LA 1SQEA 2WCXA 4HH0A 2GV1A 2HHHJ 1KQGB 4FYYB 1IR2A 3NOGA 4LF8F 1UWBA 2M5YA 4Q43A 4OI3A 3CCWA 5H9FK 1YZ6A 4OHYA 4B9NA 1DQ8A 4LF9F 4M63A 2ZNZA 4R5PA 2HMIB 2YTCA 3NGKA 4HVZA 3Q83A 1IBCB 1HMVA 5JXSA 1Q4RA 4CLKA 2B9EA 2QLJB 1RWKB 2DY1A 1RACB 2GC8A 1VYAA 1K1SA 2YKPA 5FD1A 3DGVA 4IFVB 2CPJA 1HI1A 3JAMY 1MU2A 4GVBA 1WC3A 1ACMB 4AQYF 3RRGA 4CZCA 3MEKA 1UP1A 2K06A 2PEBA 3BGRB 3T1YF 2MB0B 4WCEQ 3BJYA 3SDEA 3X3UA 1B0PA 3MZIA 2UP1A 4KHMA 1XNRF 1XEZA 4JBCA 1E6VA 4LFAF 4GMKA 2KT2A 3CCVS 4RW4B 1AT1B 2HNDB 3TZWA 4N76A 1VQKS 1JLAB 1RU1A 4NA2A 2QL7B 3MPWA 2HZVA 2I0XA 4X62J 2DIVA 1VC6A 1JLEA 2BKNA 3P96A 4JI6J 2BRLA 2X1FA 5A8KA 2G13A 4QOTA 4Z2XA 4OX9F 4B3SF 1RT4B 2RHQB 4OZ5A 4ZP7A 1CSJA 1CJUB 3MI7X 2E5LF 3MOJB 1JLBB 2RVJA 4B3MJ 2VC0A 3GQCA 1VR6A 4MH8A 3UPFA 4Q8FA 1CQMA 3I87A 2F5GA 1OO0B 5KOXA 2YKMB 1VRTB 4JV0A 2MKYA 3E3XA 1VQOS 4KFBB 2Y3YA 2ATCB 2A10A 2O01C 1HBUB 2CNOB 3M4XA 4P73A 2UXBF 2ZBCA 3HSGA 4ES2A 5J2NB 1FRIA 4UZBA 4ELTA 3MM8A 4F02A 2F8HA 1Q81T 2F4FA 3MMCB 5T41A 5KG3A 3OJSA 3GFHA 2RJZA 3SMZA 4ZVGA 3UNYA 1HI8A 2UVRA 3OL9A 5IS2A 1HWKA 4OZ3A 2BEFA 4KQZA 1PC5A 1GQEA 3EWGA 1HYSB 1RA6A 4GO7X 2W8KA 4BC7A 4CDIA 1QAIA 3TYTA 1Q8BA 5KG1A 4DSFA 2ZOFA 3BZQA 1P1LA 2DR5A 1Q79A 3NNHA 2QFJA 1S12A 1VQYA 3OSNA 4DX8H 4KH1B 2FGCA 3MAHA 1BMQB 2A3JA 4ED4A 1WORA 3RTVA 3BPSP 2XY6A 1DZ5A 1SH2A 2M88A 4DSKA 3JS9A 1N56A 4X66J 2XWYA 3MMAB 2JOQA 2ZC4A 4Y28C 3EGZA 1JKHB 1SC4B 1TUGB 4Y3CA 1CS4A 3V6KA 2EBEA 4XPCA 2FHJA 1N48A 1QE1B 3TA1A 4USUA 2V8DA 4NZ0A 1NJYA 1LEOA 1IKYB 2VU5A 1RE1B 2JEGA 4ZJQA 4RJVA 4DV3J 3KLGB 4FVCA 3C6UB 4J9MA 3BGRA 4YOEA 2V8HA 1M0SA 3UD3P 3HULA 4ITSA 4OI6A 3TQ1A 3ISZA 5F9NA 2N7CA 4ANDA 4X64F 4FF3A 3W8GA 2DXEA 4RWWA 4RW4A 2WBMA 3AT1B 2KVQE 4G1IA 1VBKA 1FT8A 2R2RA 4OYWA 3RRHA 3BEGB 2MZJA 3UDVA 3Q89A 1ICEB 4ZCMA 3BM7A 1WKKA 3H5UA 1HWIA 4WE1B 1WTFA 2BDPA 4Z7YA 2Q3PA 2K3KA 2KB2A 2QSWA 5ETKA 2K2PA 4KT0C 4WZQA 1T9XA 3M1VA 5F9LA 4RZRA 2XMUA 1JLBA 4DR7J 2C2KB 4QWEA 1QSYA 3DC2A 2OH2A 1UAWA 3CGIA 2I9SA 2DB1A 4LBPA 3GV7B 1BE4A 1FWKA 1VDHA 2W8LA 3EDRB 3DOKA 3PIPQ 1NKCA 5BXIA 4X2BA 2YNFB 3R5AA 4AE5A 1S77D 2RU3A 2Y0SD 3KJVB 4KKOB 5KFPA 2FQQB 3ENVA 2MQ8A 3KUHA 5E3RA 1LW0A 3JYTB 4DX7A 2UUBJ 2ZVSA 2ROGA 3M2UA 2B56A 4RUHA 1RLCL 3OV7A 2W7OA 3BO4A 4EWTA 2MXYA 4WKYA 3MMCA 5KFIA 2M70A 1SL0A 4KTQA 2D7SA 3R5BA 4G1QB 4NEYA 2D41A 4DV6F 4X4RA 1HHSA 3DLGA 4DV4J 1UFKA 4DV7J 3NEKA 4ENOA 4HDGA 4MYUA 1X5TA 4DR3F 4LSLA 3OXGA 1YBUA 2K7KA 2SXLA 3T9ZA 2VBXA 4ED2A 4PG7A 4DDFA 2DNMA 1UJ6A 5IT9Y 1TKXB 1U2CA 1Y11A 4A8OA 4CO3A 3RB6A 1IR0A 2RU9A 2ZOMA 3JTOA 4XDDA 1D8YA 3MURP 2BE2A 1IJEB 1E6YB 2JH3A 3CC7S 3CJ0A 1GEHA 5AJ3J 1X4EA 3HHKA 4ATNA 1VHFA 1R27B 5F8NA 2EC2A 4FNIA 3POTA 4ZLJA 2PFFB 3BH7B 5JMNA 2DCUB 5BYSA 4UT4A 2IYGA 2J0WA 5HO4A 3C15A 1VI7A 1GTEA 1PJ5A 1KD1T 1ZPWX 2VG5A 1WG1A 4Q0BA 1QE1A 2JRSA 3IO1A 2J0QD 2C3PA 4YY3F 4EYIB 1T9YA 3T3FA 1WKLA 3KMQA 1WDTA 5A8RB 2ZDOA 2IM1A 2XGQA 1ZYQA 2EW9A 3TOQA 5I42B 1RHMB 3C6UA 2ZZMA 2IA0A 1AB8A 3E51A 2DGSA 2EK6A 1X4HA 1I94F 4TNOA 3FFIA 2R8HA 5K9FA 3PYDA 4J90A 1IBLJ 5KFVA 4NLRA 3PJWA 5SZTA 2MQNA 2KM8C 3UDCA 1KHWA 4DSLA 4O4GB 4UUWA 3PKYA 2R9LA 4DR1J 1RAAB 4ECSA 1RBAA 1WJ9A 1S48A 2MJNA 2RMLA 2WVEA 3DLJA 5CYMA 3OFHA 1H98A 5C2GA 4OI4A 4L3NA 3GIMA 3A1YG 5IV3A 3IBWA 4NLVA 4TU7A 2R7QA 4A8QA 5KFMA 3CCMS 4I7FB 1U1KA 5HMZA 4DR5F 4W4MA 2IRXA 1KQSR 1FK9B 5D3GA 3MPYA 1B0VA 2O66A 2YNFA 2CQBA 4JI2F 5K5MA 2VKZG 3OFEA 2EBGA 2MKHA 2UV8G 2XBPA 4NE9C 4OQJA 1RAHB 4ZCKA 2K3IA 2RHSB 5LXYA 4ZP9A 1TKTB 4FBUA 2WVFA 2CUYA 4ZVUB 3HVAA 1F3FA 3AFGA 2FLLA 4OHZA 3SZ2A 3QBCA 2QMWA 4Q2LA 4RW7A 2AZ3A 3WIVA 1RYRA 1U24A 3ETOA 4IO1A 2M4MA 1H74A 2QN6B 4YHHJ 4RUCA 2E9RX 2W9CB 1V3SA 1OQ6A 4C9DA 2CG8A 2LMIA 3W5ZA 3TRGA 3KK2B 3A4TA 4O3RA 3L09A 2OSRA 1P8GA 2MY7A 2M2BA 3LH2S 3TP2A 3QAEA 1B99A 4EO8A 1FD2A 2R7UA 1J2VA 2XZTB 2IY5B 1U0HB 2OPRB 4HT7A 3K17A 2PA8D 4OLOA 1LWXA 2HYIB 2Z2MA 2P5VA 1A0OB 2G0CA 1B4SA 4HKQA 5DZ6A 2AW0A 5CYQB 1NJWA 1N6QB 1U1PA 3SCLE 2YKAA 1H2UX 3CO9A 5KG4A 1WF0A 2AHOB 4UOHA 3J81U 2WAQD 4JI4J 2D3UA 4BCAA 1YJNS 1DTTB 1SBRA 2W9AA 3QRPA 3IM9A 1UJ4A 1ZBTA 2XHWA 4C2MA 4RBTA 4P71A 4XO0A 5IQ6A 5F3ZA 4ZVRB 2C2MB 2CQ1A 2WRMA 4U96A 1FKPA 2XY7A 1X7VA 4MT1A 2R7VA 1RAGB 3BQ2A 4FP9A 4DV2F 1YJWS 2J5AA 2QLBB 3HT3A 1RTHB 4X4TA 4RNMA 3E01A 3MEEB 2L9WA 3QJJA 4ZPWR 1U2FA 3CEDA 3RB0A 4BDPA 1JB0C 2HWHA 1MWQA 3QT5A 1S10A 1KVKA 5LMNF 3CCJS 2NPFA 2Y1JA 5HMWA 3CMAS 4OI1A 1I1GA 3OLBA 3JB9k 3GTYX 2D3OR 2DGWA 2BM0A 5HAOA 4ZN3A 2GQCA 5CH7B 4WP8A 5GAGI 4PG6A 3DI6B 3H5SA 5LM7E 3K5MA 3TJ9A 3MR6A 3GFZA 3M8ZA 1KSPA 4BS2A 3CJRA 1N32F 4FDFA 3IFEA 4CT9A 3K5LA 1PYOB 4ZVOB 5C25B 4RNHA 2JZ5A 4I6YA 5HATA 1RGVA 3Q8UA 4ZVQB 5KT4A 3PYGA 2RT3A 1TKTA 3N79A 1S1VA 2A18A 2HQCA 3J80U 4J5OA 3ZTRA 2DEJA 1Q7YT 2ZKUA 1HWUA 2QA1A 3UCZP 1Q5YA 1LXNA 2QJ3A 2AJ2A 3FJ2A 2RNEA 1ZETA 1C2PA 1U8SA 1VQ9S 2UXDJ 2YX1A 3DU6A 4WTOB 1OQ3A 5DLFA 2W9CA 4JV1A 1H7XA 4F4ZA 3BV8A 2HNYA 2H1YA 3RW7A 2ZJQQ 1WC6A 2K8GA 2GJFA 1P1TA 2KXFA 2F7VA 1WI8A 1RT5B 3HHLB 3PRBA 2AU0A 4AYBD 3C14B 2HZCA 1QVGR 4I2PA 3JSYA 5GAHI 1IKXB 2YKOA 1BQXA 2Z30B 3GSIA 4ZVHA 2WHOA 1D9FA 3VQSA 4NCGA 1SC6A 1GH8A 4KO0B 9RUBA 3VAJA 3T6BA 4S0MA 3GG0A 4L72B 3O3LA 2UVUA 3CNQP 2CJKA 4DL5A 3DOMB 3PJXA 3ILOA 2FJVA 3GR0A 4ILLA 4J91A 3QMQA 5KAKA 5ETRA 4TY8A 3C2PA 5HMYA 2N3LA 2XNQA 4OZNA 4C0BA 1TU0B 2Y1IA 3CD5A 4C11B 2HQDA 2OPQB 3CTRA 2QZ8A 1V9OA 2BA9A 1FO1A 4B9MA 4OZ1A 4EU0A 1N0VC 3W2WA 1RTHA 3IWXA 2ZJPQ 1GTHA 3M6WA 3MEEA 3TQEA 2ZHAA 1GNKA 2DH7A 2AYGA 5KFAA 5EWEA 5MLCV 3OTBA 4J9QA 2F40A 2NR0A 4FPRA 2CZVC 5DETA 3RRKA 3SQGA 2AF6A 2QO3A 3PX0A 1CJVB 2ZWOA 1YDLA 3DGPB 2PO4A 2LFVA 4NOHA 1S6OA 3UCGA 1IBMF 3KHHA 4IR9A 3OR1A 1EETB 2C1EB 2E1PA 3CCRS 2MKJA 4PXBA 2BM1A 1WSVA 2YKQA 1FEHA 4ECWA 5F8LA 4KGMA 1S9EA 2GIQA 4DL2A 4DPWA 3KJNB 5C5JA 1U6ZA 3HVWA 1U02A 5GMEA 2EFOA 3PV8A 1YQHA 3PO5A 4FS2A 3EZOA 1FEEA 2PT0A 4PQUA 4EMDA 2DHXA 4NPOA 4ED5A 2CQ4A 4QBUA 5FLXY 1NZ8A 3M6UA 1NB2A 5C25A 1TELA 5IC6B 1XNQF 2J9CA 5ETMA 3R2DJ 1S6QA 3AAWB 4LQ9A 3DKDA 4KV8B 3BYPA 1O8BA 4OI0A 4R8UA 3BKUA 2AGPA 1K0VA 3LGHA 2RS2A 2LEAA 3ILIA 1FD8A 5ETLA 3OR2B 4ZK7M 1FI4A 3A3NB 2IRUA 3MPDA 2G2ZA 3EVMA 3I5AA 4QIGA 1WI6A 1F5BA 3WBZA 1AA1B 2VODA 3FUYA 1OY8A 1NAQA 3MMJA 5FJ4A 3TUIC 4B9SA 2MLXA 4AUKA 5H9EK 1AXQA 3SYZA 2Q43A 3V4IA 2DO0A 2IM3A 5IZHA 1HQEB 1WHVA 3M2VB 3OL7A 1GX6A 2J9EA 4URSA 2Z2YB 5DGBA 4DQSA 4DZDA 4GKKJ 4LF7J 2N4CA 1HD0A 2W2NP 2H5JB 5CHCB 1U1QA 1TAQA 1VJQA 3CPWR 1KP6A 3LUYA 2BX6A 1XQIA 2BANB 4JI1J 3BGUA 2EG2A 4OX6A 3P6YC 5AXKA 2O3DA 2HHQA 3QT6A 4LF6J 3DOMA 3EMTA 2FHKA 1IKWB 1I3OB 4PUOA 1FDNA 1PYSB 5H1SV 1DRZA 1NUEA 1HI0P 2GVDB 2W4CA 4OZ2A 2CADA 3W62A 4NLWA 3LTOA 3UDEA 4ZA1A 3HHEA 4J9LA 2QL9B 1DQAA 3ZZPA 4L76A 4QPTA 4OJHA 3PTWA 4C11A 1NM2A 3VF0B 3VAHA 4CLLA 1ZAXA 3EM1A 1FA0A 4ZMMA 3H25A 2J8SA 3DMJB 2VQEJ 4LF5F 1T9WA 1VISA 3Q86A 5H9FJ 4MIWA 2DR6A 4ZP8A 3ELHA 2F4VJ 2I5JB 1W25A 2FGOA 1N36J 4DPOA 2ZH4A 4H4OB 5L1JA 3ICLA 3HFVA 3I9ZA 4N8OA 4NWBA 2I2YA 4A8FA 4NRTA 2KT3A 1S1WA 4BHQA 2L3MA 1HNZF 4U8VA 4M94A 1UVKA 2ZUAA 2NYIA 3U1MA 5C42B 3A8KA 3LP1A 2XMAA 4JV5J 3PHEA 4CH7A 1SIWB 3BKTA 1GXTA 2YH1A 3C16B 2B51A 2ZHOA 4ES1A 3KYLA 3OFGA 4Y6IA 3M8RA 4ALZA 3JXOA 4KE5A 4A48A 4R25A 5L9XA 4B3OA 3NY0A 1QAJA 2R7OA 2V69A 3J7ZT 2V94A 5A8WB 4AL6A 4O23A 2OFGX 3RB3A 2CNLB 5DS7A 2HPUA 4DR6F 2NYHA 5EDWA 2R4FA 4NLTA 2XLKA 3UE2A 4WP9A 3TJAA 3MOZA 2ZEJA 4WFYA 5D78A 4JI3F 2DHAA 2JX2A 2YQ3A 2AD9A 2CXEA 2GNKA 4ECYA 4F4AA 1MMLA 2Z2ZA 1TKDA 3BGLA 3ZNUA 2G0IA 2AJ0A 3Q8PB 3OR2A 3OVSA 4WU2A 2CQ3A 1G2EA 1RWWB 4DV0F 4I2QB 5L8RC 2C28A 1FF2A 4MFBA 1CJKB 4JYAJ 3PM9A 3FQLA 3NBPB 3RW6A 1NK7A 5HROA 3M2VA 4QR0A 1TFWA 4JI7F 4Q8EA 1L5UA 1S99A 3PVXA 1RTJB 1FRKA 5IC4B 4FVMA 3PFOA 3C46A 4B3RF 4U8YA 3OTDA 2YVSA 1NK4A 2VV5A 5G0RA 3SCJE 4K0KJ 2BANA 1IQTA 1JLFB 1ELOA 3H5YA 4RNOA 4YB5A 4DG1B 3EZ5A 3QLHB 3MAAA 5GAEU 3NGSA 1Q78A 5KFOA 1HR0J 3D0HE 2YWWA 4GKJF 2V0NA 4F2SA 2XYPB 1GMVA 3UW1A 1HNVB 3K8WA 1RI7A 3PR4A 5JJBA 4PXCA 1ZTTA 1N8RT 2V9KA 2VIHA 1RWXB 2B7BB 2XO7A 2J7UA 4I4BA 4LBIA 3G87A 2HHSA 1YRTA 2BW7A 5E2QA 1M5HA 1X4DA 2F1FA 4EO6A 2E7WA 5CYJA 4NCAA 2DISA 3DMJA 3E2EA 4KH0B 3CJ2A 5CABA 4WWSA 1YKWA 4J9VA 1RT3A 3BR9A 1JK9B 1PG5B 1WDDA 2W01A 3PEHA 3M2RA 2G0JA 5KFKA 1ZA2B 2DNNA 3QO9B 2HEKA 4C0HA 4ZHRB 2VZ9A 4ELUA 5C42A 3R6LB 4IG3B 5BYRA 3MTKA 4OJ1A 2M8DB 5KFYA 2D69A 1YK9A 2G2OA 1FJGF 4DCPB 3DRSA 1VC5A 3C16A 4I67A 2GVZA 2CWXA 3VAIA 3EVWA 2HVEA 3R5JB 2CPZA 3LA0A 2XMKA 3SIPB 1G3OA 2KRBA 2IVMA 3G82A 5A8WA 4ILMA 3V6DA 3N6MA 4M5JA 1UMJA 4C97A 2KU7A 3IC1A 1RHUB 2WOMA 5C24B 4DR2F 1UEUA 1TMJA 6FDRA 2ROEA 3N0VA 3MEDA 4OX7A 3OTOF 3NL0A 1M1GA 1BQMB 1HBNA 4NXNJ 1Q82T 1VK3A 2CJYB 4USIA 2P6SA 5BR8F 2YNHA 3N9UC 2FJBB 1SQFA 2VBYA 4MYTA 1RCOB 5J2QA 3OTEA 4IOCQ 4NXMJ 1MN7A 2L48A 1W2IA 1DLOA 1PGZA 2QL5B 1RCXB 3FRYA 2ZNYA 3O5TB 1M5OC 3W3SA 5LOQA 4DSEA 3EUNA 3FCVA 1UEKA 1OSDA 1XWLA 1FTRA 4N41A 4X4UA 5KT2A 2V63A 3KLEA 1U26A 3FBFA 4DPXA 1WHWA 4WKRA 1WHXA 4ZOSA 2XMTA 3VTIA 3PCOB 5KG7A 4YR2A 4ETZA 2NS1B 2ILZA 1ZM4A 5DDQC 5M2RA 1TL5A 2B4OA 4K4UA 3KK3A 1JNRB 3NXZA 1QAXA 3EDQB 5F0UA 2Q6CA 4B17A 1L3VA 1X60A 3H2VE 3HI9A 1XTZA 4LT6A 3MECB 3CE8A 3SEOA 2EVZA 3SFUA 2HHHF 1NKEA 4CTAA 2FHJD 2CWKA 2C42A 5IT9U 2JL9A 3IG1A 4X4VA 2WW8A 3VCDA 2P2CB 4TN2A 4DV1J 2NXCA 4EGLA 4W90B 4RR5A 1RTDB 1TAUA 3CCZA 8RUCA 5KFGA 4X4PA 5ETNA 3C6TA 1AYEA 5CXTA 1HNXJ 2XMVA 2HK2A 3L9ZA 3UN2A 1FE4A 2E44A 3KDNA 2OLWA 4ZJOA 2IC3A 1N0UA 2D74B 1K0TA 1JLCA 1G7CB 2QA4S 1NK8A 5AXMA 2X1BA 1TL1B 2IM2A 2PDAA 4JOUA 4IG0A 3ZFVA 5EN1A 4ID5B 2AJ4A 1U1OA 4LF9J 2HS0A 2GO9A 2M0GB 3K2YA 2Z0GA 3VAFA 1K9MT 4UQTA 4DU8A 1XR6A 3DLKA 1R0AB 2AMCB 4IG3A 3HHLC 1C0UB 4GO5X 3RBZA 3JTNA 1O5JA 2CNNB 4J9RA 4X62F 3N28A 1DTQB 3GE9A 1FVQA 4KIAA 1JIHA 2EFVA 4A8WA 2K1RA 2IVYA 2FC8A 3UNGC 4DMZA 1VLOA 2XS7A 4WIQA 1ULRA 2NLWA 2DNPA 1S6UA 4WBFA 3AQPA 2FUG9 4DU7A 3T1YJ 4H4KA 3QGHA 2I6WA 5DQIA 4WF9Q 2V4QA 2BOPA 5AXNA 1FWLA 1JJ2R 1IVZA 2FY8A 5CQGA 3IAM9 1TVRA 1LK5A 1C4CA 1GFWB 5KT6A 3LQVA 1S0MA 2RSQA 4ANCA 1YJ7A 1VRQC 4UOFA 3GSDA 3GIRA 3TAQA 3VQTA 3NCPA 3OFFA 2OPSB 3HJFA 3QIPB 4PWUA 1NK0A 4C48A 4RW8B 1TUVA 2YX4A 4OX9J 4QYZK 3FSIA 4P2FA 2E5LJ 2R8GA 1WEXA 4LJMA 2BJ7A 2GJIA 1WELA 1RAFB 1N34F 5F8GA 3M8SA 2PSZA 2DD8S 3O8WA 3AH6A 2R7RA 1SQGA 4OYBA 4IH6A 3MXHP 3ENWA 5CA5A 2W1BA 4EYHB 3IR6B 1SJQA 2XY5A 1RBOB 1TR0A 2B3TB 5A6PA 2UXBJ 2J7WA 1R6VA 5DZ7A 3SBMA 2HHPA 1I5OB 1EP4B 2D9OA 4KGXB 1PYTA 3UR0A 1TL7A 1SL2A 4DPUA 3MECA 2C2ZB 2XM3A 4LUBA 1GT8A 3BO2A 3I0SB 4RNNA 2ATLA 1RXOB 3MUVP 2ALZA 1UPMB 5CD4H 4OZ0A 3QATA 3UQSA 3RBDA 4R0EA 2R7WA 2Z56B 1OPIA 2KVIA 2GO8A 3ENAA 2WW4A 4MKYA 3M6XA 2VONA 2X1GA 4F3OA 4P7VA 4RW9B 2GMLA 1MROB 1ZM3A 1QSLA 4CO0A 3GIKA 4DF4A 3I5CA 5IM0A 2CPDA 5KFZA 1WG4A 4DV3F 2D1CA 3MHYA 1RT2B 4LRDA 4ID5A 3D1QA 2M9KA 2JFDA 4QWAA 3HZEA 5F3TA 4J9UE 1YRXA 1RHQB 5HP1A 4WJBA 2BBEA 3K7RA 2ACMA 1O0PA 5IT0A 1NK5A 1URRA 1EB0A 2HS4A 5EWGA 1VRUB 4O44B 3L95X 4PKDB 2YBVA 2RQCA 1DTQA 1D3WA 1N52B 1RTIA 3QT7A 2B6AA 4TXSA 3CJKB 1NHVA 2QMUB 3NGUA 2KFZA 1HL6A 4V19X 4PZVA 4HI2A 2L41A 1FCAA 5F8IA 3THPA 1H7WA 2I38A 4WXOA 4FS1A 2G9OA 3QAUA 2L9DA 2GCFA 4X64J 5F8MA 1HNIB 3UD5A 3KK1A 5KFJA 2VJVA 1HQUA 4U7CA 5K14B 2AX1A 3GIJA 2RB7A 4F4XA 4MK7A 2EWHA 2ZH6A 1UCNA 3GLJA 2OPSA 3IP0A 4NYOA 5HBMB 3X1LB 2E1AA 4HACB 4Y0FA 2UUBF 2AYBA 4RW8A 5FDLA 3KG0A
chains in the Genus database with same CATH topology
4OQJA 4ZCKA 2K3IA 2EPIA 1QY7A 4I0WA 2IJFA 2WBRA 2DGUA 5LXYA 3H40A 4ZP9A 3DLEB 1HWJA 1TKTB 3DM2A 4FBUA 1MSWD 3NAIA 4RBVA 2VB6A 5D4PA 3KOAA 1YVFA 1KNZA 3HVAA 4URQU 4DHVA 1RK8A 1LW0B 2A1BA 2FJDB 3UDLA 4ZKAA 3SXLA 4DS5A 4NZ6A 2NSCA 1YIJS 2VH7A 4DV4F 2FLLA 1SXLA 5GADU 4OHZA 2D9PA 2XCPA 3SZ2A 1NHUA 1ZTWA 2QMWA 3MFHA 3TA2A 2XC9A 1TL3B 3I0RB 1DBDA 3M2UB 4NLDA 4Q2LA 4RW7A 1RYRA 1U24A 5HL7Q 4YQWA 1S9GB 1YHQS 4YFUA 4O3OA 3VALA 2LECA 3H8YA 3ETOA 3G8QA 1FERA 4JI5F 4IO1A 2M4MA 4DQQA 1FRMA 3AB2B 4DFMA 1XBWA 2HFZA 1JLGB 5HLFA 1J5OB 3PO4A 1IUJA 3BR8A 3FVYA 4QIVA 2JLFA 4ID8A 3HDSA 2V8VA 1U1NA 3AJ1A 2C3OA 2RDIA 3NRBA 2BQ3A 4RUCA 3DLGB 2E9RX 2W9CB 1V3SA 5LXRA 3QGPA 1OQ6A 2MSTA 3CDAA 2EFGA 3CCES 3PNIA 4C9DA 2LMIA 5LT5A 5I3QA 3TRGA 1KS2A 3KK2B 4O3RA 3M9OB 3L09A 2OSRA 1P8GA 2HWIA 4ZVFA 2MY7A 1RT5A 2M2BA 4K4SA 4LSLB 3LH2S 3TP2A 3HHLA 7FD1A 3QAEA 1Q53A 1X5SA 5K8OA 2FJEB 5T7LA 4EO8A 2MQOA 4AL5A 1FD2A 3HO1A 2R7UA 1H6KX 2JC0A 1PO6A 1NO8A 1J2VA 2LU2A 2XMWA 2I1RA 3ZZTA 4ZPCA 1IKXA 1BD6A 3VR1A 5AJ3F 4KRWA 2OPRB 4O3PA 4HT7A 3UWTA 4QWCA 3CCQS 3R1LA 2PA8D 3RAXA 1UL3A 2XSFA 5K8MA 2FVQA 2JVRA 4FXWA 2FVCA 4OLOA 2HYIB 4LIRA 2RDJA 1RISA 2MZQA 2Z2MA 2P5VA 5EGYA 2DNZA 3QIDA 2G0CA 2F9JA 3LP2A 2RF2A 5DM7Q 1NJWA 1KFDA 2AW0A 2CQ0A 4KO0A 5CYQB 4IUFA 3V81B 4BWJA 1N6QB 4IRKA 2F8MA 2OP5A 3RZAA 1U1PA 3SCLE 2YKAA 1LWEB 1X4GA 4I68A 1H2UX 1X5PA 2KG1A 3H4DA 3CO9A 1U49A 2CVIA 1RDRA 3M05A 2FHMA 1MWYA 1WF0A 5KG4A 5GADI 2BE2B 3TUJC 5ADZA 4MKAA 5I3UA 4OFZA 3PW2A 3HVTB 1S1TA 3BDPA 2HHWA 1FXRA 5BJRA 3BSCA 1AFIA 3FRZA 2WAQD 1T05B 2AJQA 1LXJA 2WSFC 1CVJA 1M5PC 2AWZA 1FVSA 2WB1D 3B8HA 1MROA 2D3UA 2UUCF 2QEXS 4BCAA 4EFAC 1YJNS 1R43A 2DJWA 3POTB 1QM9A 1DTTB 3CJ5A 1P27B 3IRXB 1SBRA 2KG0A 2W9AA 2QLXA 4C3LA 2MKCA 1UJ4A 1ZBTA 1X4AA 3T5HA 5DG8A 3M32A 2GGPA 1FDBA 2DH9A 2J6UA 4Z37A 5IM0B 4M1KA 4DV5F 2XHWA 3OVAA 1D8ZA 3H59A 4C2MA 2R7TA 4WFBQ 1ZPVA 4LMZA 4HL9A 4RBTA 1WACA 4FF4A 4OHXA 2VG5B 1VBYA 2LQ5A 3DRPB 1TK5A 1NK9A 5E5NA 4C8ZA 4Q0BB 4XO0A 5IQ6A 3ZZZA 5GAGU 5F3ZA 2OPQA 4PPDA 1JLQB 1AFJA 2CQ1A 2WRMA 3DDKA 4C8NA 1Z4UA 1FKPA 2RD5C 2XY7A 1X7VA 3I9V9 2NPIA 3SV3A 3BN4A 1DURA 2R7VA 4A8XA 1Z2ZA 4CO2A 4IYQA 2DO4A 3BQ2A 2VPWB 4FP9A 1RT7B 4DV2F 3AA8A 1YJWS 1IBLF 3DXSX 2J5AA 3HT3A 2AYEA 1RTHB 4OI2A 4PR6A 5HP1B 2YKNB 4X4TA 2DBBA 3DOLA 5E0OA 4RNMA 3E01A 1VQNS 3MEEB 2ZH2A 5L9NA 2FPHX 2L9WA 1TZ0A 3KLHB 5K8PA 3QJJA 4F25A 4HEA9 3FQKA 4ZPWR 1U2FA 1SJ4P 3MWBA 3CEDA 4NX9A 3RB0A 5GVQA 1W2BR 4BDPA 1JB0C 2HWHA 4Y2MA 3WZ0A 1VQPS 4K4XA 2RQ4A 2ZD1B 3DGPA 4K4VA 3KMSA 2DGXA 1S10A 4KBIA 5DDRC 3J7YU 5LMNF 4DR1F 2FTRA 2ZM6F 3FFIB 3CCJS 2NPFA 4DF8A 4LSNB 4DR4F 5AE3A 2GQQA 3D1HA 3PRDA 2ZH3A 2Y1JA 2IHR1 1RTIB 1EETA 1YG0A 2RQMA 5HMWA 1S49A 3JSMA 2B6AB 3CMAS 4DS4A 4OI1A 3TAMB 1I1GA 4QIEA 3OLBA 2UUAF 4C4WA 4K2XA 3JB9k 4NYPA 4ZS6A 2Q1LA 5KFQA 3AHPA 4MIBA 1U1LA 1TP7A 3FDSA 1CG2A 3CC2S 2D3OR 2DGWA 3F56A 3U02A 3GILA 3LF0A 4J9SA 1IBKF 3RR7A 4F3MA 2BM0A 4IOAQ 5LL6d 3TNVA 3Q2TC 3CDEA 5U47A 3SI8A 5I3PA 3ZZ0A 4I69A 2GHWA 5DG9A 2L9NA 3CT9A 2FVPA 2R2UA 3AB4B 3BDEA 2GQCA 1JNZB 3LGMA 2R2TA 4J9OA 1X4CA 5CH7B 2QA2A 4DOZA 2CDQA 4TLQA 5JUMA 4MJKA 3CDBA 2EFPA 3KK1B 2CQHA 1Q7LB 5CYMB 1UJ5A 2MHNA 4ED6A 5GAGI 3OXLA 2HS3A 2IAJA 2MDAA 4PG6A 3NMAA 2B9YA 3B82A 2HQ3A 4H4MA 5KG5A 3KLIA 3DI6B 3H5SA 3K5MA 1HQUB 3FZ2A 1FNOA 1U2RA 1WHYA 4YEAA 3MR6A 1RQ0A 3GFZA 3EPIA 1U6BA 3N6LA 2FC9A 2DHGA 2EFQA 3DYAA 1KSPA 2FB0A 4BS2A 3AA9A 4OLPA 2W4PA 4E8UA 2YWHA 2DVIA 1XERA 1N32F 3IFEA 4CT9A 2GX8A 2E5IA 2FDNA 4IQMA 2R8IA 3DHXA 3K5LA 4Y00A 1H3DA 5J1EB 1YWXA 2E1RA 2KI2A 3KWMA 4WFNQ 4KPYA 2XSJB 4A8SA 3FCHA 2PMZD 5D3GB 5C25B 4P6QA 4DFJA 4RNHA 2DHSA 3S8SA 2JZ5A 3LWMA 2BJDA 4I6YA 2VG6A 1HHTP 2AJFE 2B0GA 5FDLB 1URNA 4KV8A 1RGVA 4KGKA 4WK1A 3J7YI 4KHPF 2HGNA 5KT4A 2LU1A 1XK8A 1N54B 1OS5A 2D3ZA 2RT3A 1WTBA 1VBXA 1TKTA 1RA7A 3N79A 1S1VA 2A18A 4J5OA 2B4UA 2XEXA 1RT6B 3JTPA 3HP6A 4NLGA 2IVFB 4TU9A 4U9RA 3CJ4A 3DM2B 5B09A 4X4SA 1Q7YT 1VLYA 2ZKUA 1C0TB 4NYZA 1HWUA 2DIUA 1Y5IB 4DQRA 2QA1A 4WFZA 2VFVA 3IXQA 5E41A 4C3MA 5AE2A 4B08A 2VFUA 3TO8A 1J5EF 2ERRA 3UCZP 4YHHF 4KSEB 1S4FA 4NA1A 4QWDA 3ENQA 3I55S 1LXNA 2LXIA 2YWFA 3GYNA 3FJ2A 5KOWA 2PA3A 1ZAWA 1VIOA 2RNEA 1ZETA 4RW7B 4O4RA 1C2PA 4QYRA 1U8SA 1VOMA 4GKKF 4IKAA 5DLGA 1J5OA 1JLGA 3FSXA 3L3CA 1VQ9S 2IBKA 4NLSA 3CCUS 4DQIA 4LF7F 4TLRA 2YX1A 2PI5A 3DU6A 4OJGA 1BGXT 2RS8A 3O2IA 4R0JA 4OV1A 2B43A 5HLFB 4E0DA 1Q8LA 1TV6A 4MIAA 1HQEA 2C3UA 3KLFA 1OQ3A 5DLFA 2W9CA 1N5TA 4JV1A 4DQPA 3NS5A 4KHRA 1H7XA 4Q2MA 4F4ZA 4PWDA 4FYDA 2HNYA 1YJRA 3OPKA 2HVZA 4KC5A 2K7JA 3IS9A 3RW7A 2ZJQQ 4DN0A 1HBOB 3O44A 2APOA 4H4KC 2K8GA 2BQUA 1P1TA 1KLNA 5H9EJ 2G1DA 2GW8A 2KXFA 2XB2D 2F7VA 3DXBA 2MKIA 3PW4A 1HD1A 4OHVA 1WI8A 4LF4F 4OZJA 1SKRA 1RT5B 2HW3A 5KFRA 4LF6F 3HHLB 2CZ4A 3PRBA 2AU0A 3VWSA 4AYBD 1P6TA 4B9VA 1UW4A 5T7LB 1BLUA 3G4SS 4D3HA 2HZCA 3DN9A 2W9BA 1SJ3P 1X9MA 2AQ4A 1QVGR 4I2PA 3ULHA 1VC0A 2EG1A 3IA0A 3JSYA 2BW2A 2EI5A 5GAHI 1IKXB 2YKOA 3WDOA 1M5KC 1WD6A 1B0TA 4QW9A 4Y2KA 4JI4F 1BQXA 2CPIA 1SUQA 5BYQA 4MK8A 1LWCA 4NLQA 4ZVHA 2WK4A 1REVB 3V81A 1ROFA 2WHOA 3K8VA 1LWEA 1D9FA 2N4DA 3VQSA 1H2VZ 4ZCIA 3P49B 2NUUG 2HHTA 4QCLA 1QUVA 4NCGA 1SC6A 2RF2B 3LP2B 4I6WA 4KO0B 1GH8A 5LJ3Y 1BQNA 3VAJA 3OTCA 3T6BA 2YY3A 3J81Y 4UY8T 3GG0A 1CQNA 1NH8A 4L72B 3F73A 3O3LA 1YITS 2KZMA 4JUZA 4XIUA 1FXDA 1IKWA 2VA3A 2UZAA 2CJ9A 2CJKA 1R8BA 1T05A 2UVUA 4EUVA 4DL5A 2KT5A 1OIAA 3NMRA 2RE1A 2LVWA 1WG5A 3PW5A 4UY85 3R5DA 3V4MA 4K4WA 1FKOB 3PJXA 4PCQA 2FJVA 3GR0A 5J1PA 2C2RA 4ILLA 1A7GE 2ROPA 1MMDA 3QMQA 1NZAA 5KTQA 2C3YA 4X4OA 5KAKA 3IRXA 4NLPA 4TY8A 1YJTA 5HQ8A 1R8CA 3C2PA 1U45A 1RP5A 1SB6A 2IJNA 5HMYA 3NWGA 4PG8A 4A8MP 1VGYA 2RILA 3Q22A 1S0NA 1V3RA 3D0GE 2N3LA 2VASA 2RH3A 3LOUA 2XNQA 3DHWC 3M32B 1PC4A 2GGPB 4OZNA 4ZPVR 4C0BA 3S7RA 1JLQA 1UA0A 1IM4A 4C8MA 3V6HA 3HKZD 2Y1IA 3CD5A 4C11B 4ETXA 2ILYA 4ERDA 4OMFG 5G4DA 1SV5B 2YNGB 2OPQB 1IJFB 2QZ8A 3CTRA 1V9OA 3K5PA 3ITHB 1G1XA 3SCKE 2BA9A 1FO1A 2IMOA 1C4AA 3KKFA 4B9MA 1RT7A 3HVRA 4OZ1A 5KFDA 4EU0A 1Z2LA 1FKPB 1N0VC 3W2WA 3N5FA 1RTHA 2I5JA 3IWXA 1Y0HA 2ZJPQ 1GTHA 3M6WA 1CEZA 2GHPA 3MEEA 2DRAA 3NKYA 4H4OA 3PW0A 2J0SD 4Y34A 3KLHA 2KJWA 2DNYA 1MWZA 2ZHAA 2OTLS 1GNKA 2DH7A 3TA0A 2AYGA 2RQKA 5KFAA 4CQ1A 5EWEA 2BVZA 3M30B 4IRCA 3E01B 5MLCV 4CCHA 1Y3KA 2HFOA 3OTBA 4J9QA 2F40A 4ZPTR 4RUAA 2NR0A 4FPRA 2CZVC 5DETA 2E29A 3RRKA 2DNGA 4RX6A 2HRYA 4WTYA 3SQGA 2MMYA 1VFJA 2AF6A 3PKMA 2QO3A 3PX0A 1VS3A 2MHEA 4LSNA 3OQ2A 3MM9A 3OXFA 4O0IA 1O51A 3T1HF 2PO4A 1D0EA 4F4KA 5DQGA 4NOHA 4QR2A 2ZH8A 4USHA 2ZH9A 1S6OA 3OVBA 3TAMA 2DNKA 3UCGA 4YB1P 4LVOP 3KHHA 1IBMF 4IR9A 3OR1A 1EETB 2XLIA 4LFBF 3BN7A 2CQPA 5F41A 1V6HA 3QWUA 2HNZB 1HA1A 3JSMB 1XMQF 4NA3A 2XS2A 4ZPBA 4ZVEA 3CCRS 2MKJA 1GXLA 4PXBA 3QJPA 3NS6A 4F67A 1NKBA 1D9AA 5EWFA 2BM1A 2YKQA 1FEHA 3G6VA 4ECWA 2ASDA 5F8LA 3HHDA 3P3DA 2MGZA 4KGMA 3MMBA 1S9EA 4YUDA 2BXJA 3CD7A 1HBMB 5F8HA 1VJWA 2GIQA 4DL2A 1C1BA 3K58A 4LQ3A 3PZPA 3TX8A 4WYLA 5E3QA 5C5JA 4J37A 4K50A 1U6ZA 1YSJA 3HVWA 1FXLA 1R8PA 2EFOA 4KB7A 3PR5B 3PV8A 5E3AA 3NNAA 1YQHA 2HG4A 4FS2A 3PO5A 4IRDA 4I56A 3MM5B 4D3GA 5B0CA 3HM9A 3UCUP 2O5DA 3JSRA 2IAJB 1FEEA 3M8PA 4H4MB 3HF5A 2PT0A 3KLIB 4PQUA 2FJXA 1LV5A 2KTQA 2DHXA 3IWLA 4NPOA 2CYYA 3D54A 2CQ4A 4ECZA 4ED5A 3N4WA 4QBUA 5DG7A 5FLXY 3M6UA 3DYAB 4FXVA 3CF5Q 2CJAA 2ZITA 2U2FA 5J1EA 2CRLA 2FLOA 2XSJA 2U1AA 1U4BA 5C25A 4ECQA 2JEJA 1XNQF 5LJ5Y 4YDDB 2J9CA 3ZZRA 2Q6BA 4ZPAA 1KQFB 1HPZB 2WSEC 3D1OA 1SKWA 3FNNA 5JVGQ 2FVSA 4EZ9A 5J2PA 3EXCX 2MZRA 3OW2R 1S6QA 4DL0C 3J80Y 4M8LA 1NK6A 1IXKA 3AAWB 4LQ9A 3B78A 3DDNA 3MR3A 4L6V3 2PMHA 2VG6B 3WX4A 1H2TZ 1RWUA 1X4FA 4KV8B 2QA4G 2R8JA 2X51A 1RT6A 3TVZA 4DSJA 5HMXA 3AQOA 1O8BA 3C3LA 4OI0A 4R8UA 2NUHA 1S1VB 3HHLD 2AGPA 1TL4A 1C0TA 1K0VA 1Q1KA 4CNYA 1QJHA 2UXDF 5D77A 2J8AA 3K0JA 2B9WA 5KFHA 4DLGA 2RS2A 3BF4A 3I4PA 3PY8A 4X4NA 1R8HA 2LEAA 4DUYF 1FD8A 4IR1A 4I2QA 1ZZFA 3K57A 3OR2B 4K4ZA 4ZK7M 2QMXA 2IRUA 4UW2A 3ISND 3KFWX 1N33F