4R28A

Mspji restriction endonuclease in complex with 27-mer oligonucleotide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
449
structure length
449
Chain Sequence
b'IAWAASAEVANKPRLVFVGDELRYAQGANQRDVELDGFVNYHWLTSPGGLGLPKVMLEAGINAPAEVVGPDRSRRALIAIRSSPWKAGHETNPWHDEFDLDHGHVRYFGDHKPSTVGLPGETKGNRLLLEAARLHAGTTREERLLAPPLFLFRAVTVHRAGRAVVKGHVEFCGAAIIERLEHVVQRDPETGRSFPNLSLDLAVVSGGEIDGVDFRWIDDRRNAALAAGETLRHAPESWIRWVRQGRLAIPGIRRRVLASAVQSSKEQQPASGSAEAATLQTLYKFYDGRKHAFELLASRVAAEVFRESGARYKEGWLSRSSGDGGVDFIGRIDMGSLKASTPVVVLGQAKCIQPTSSVSPEQVARVVARLRRGWIGVYVTTGSFSRQAQVEIIDDQYPVVLIAGGTLAATVRRMVQANYGGDLDALLASTVDEYGAAVTHRRPEEVISL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease
publication title Modification-dependent restriction endonuclease, MspJI, flips 5-methylcytosine out of the DNA helix.
pubmed doi rcsb
source organism Mycobacterium sp. jls
molecule tags Hydrolase/dna
total genus 90
structure length 449
sequence length 449
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04471 Mrr_cat Restriction endonuclease
A PF18062 RE_AspBHI_N Restriction endonuclease AspBHI N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.20 Mainly Beta Roll PUA domain-like PUA domain-like 4r28A01
3.40.91.100 Alpha Beta 3-Layer(aba) Sandwich Restriction Endonuclease Restriction Endonuclease 4r28A02
4F0PA 4F0QA 4RZLA 4OC8A 4R28A
chains in the Genus database with same CATH superfamily
4F0PA 4PW5A 1BHMA 4YGIA 5FDDA 1DC1A 5DBSA 3EBJA 2GB7A 3Q0CA 4E5GA 5D4GA 3FDEA 4E5LA 3BI7A 3CAEA 4CGXA 2BAMA 3BM3A 2ZKEA 3V20A 4AWHA 3Q0DA 3HW3A 4AWGA 4CGSA 5JHTA 2ZO2B 3V21A 3N78A 5DESA 5JHVA 3WVIA 2PB7A 4OC8A 3MQ6A 4ZQQA 3WVKA 2PFJA 4NFZA 3F8JB 3DW9A 1SDOA 1FZRA 3HW4A 5CGVA 3MQYA 3HW5A 4E5EA 3Q0FA 1M0IA 4YYLA 3ODHA 2FOKA 1D2IA 4PW7A 1FOKA 4NJ5A 5D9JA 4AVQA 4RZLA 2ZKDA 1DFMA 4AVLA 5D2OA 5FDGA 4ZHZA 3Q0BX 2P0JA 3A4KA 4AWKA 3CLZA 5EGAA 4AVGA 2ZKGA 2ZKFA 3F8IA 3DPGA 1ESGA 2FQZA 4CHCA 5D42A 5DEBA 4E5HA 3WVHA 4PW6A 5CCYA 3OLNA 2XI7A 4AWFA 3DWHA 4E5JA 3BAMA 4F0QA 2ZO1B 3V1ZA 5D8UA 3N7BA 1CFRA 3HW6A 5CZNA 2EWFA 3WVGA 3WVPA 2P14A 4ZI0A 1M0DA 1KNVA 1VRRA 2E52A 2ZO0B 5I13A 3DVOA 4R28A 1ES8A 4E5IA 5CL0A 4E5FA 1BAMA 2XI5A 4AWMA
chains in the Genus database with same CATH topology
4F0PA 1BHMA 4YGIA 5FDDA 1DC1A 5DBSA 3EBJA 2GB7A 3Q0CA 4E5GA 5D4GA 4E5LA 3CAEA 4CGXA 2BAMA 3BM3A 3V20A 4AWHA 3Q0DA 3HW3A 4AWGA 4CGSA 5JHTA 3V21A 3N78A 5DESA 5JHVA 3WVIA 4OC8A 3MQ6A 4ZQQA 3WVKA 2PFJA 4NFZA 3DW9A 1SDOA 1FZRA 3HW4A 5CGVA 3MQYA 3HW5A 4E5EA 3Q0FA 1M0IA 4YYLA 3ODHA 2FOKA 1D2IA 1FOKA 5D9JA 4AVQA 4RZLA 1DFMA 4AVLA 5D2OA 5FDGA 4ZHZA 3Q0BX 2P0JA 3A4KA 4AWKA 5EGAA 4AVGA 3DPGA 1ESGA 2FQZA 4CHCA 5D42A 5DEBA 4E5HA 3WVHA 5CCYA 2XI7A 4AWFA 4E5JA 3BAMA 4F0QA 3V1ZA 5D8UA 3N7BA 1CFRA 3HW6A 5CZNA 2EWFA 3WVGA 3WVPA 2P14A 4ZI0A 1M0DA 1KNVA 1VRRA 2E52A 5I13A 3DVOA 4R28A 1ES8A 4E5IA 5CL0A 4E5FA 1BAMA 2XI5A 4AWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0P A;  4F0Q A;  4RZL A;  4OC8 A;  4R28 A; 
#chains in the Genus database with same CATH topology
 4F0P A;  4PW5 A;  1BHM A;  4YGI A;  5FDD A;  1DC1 A;  5DBS A;  3EBJ A;  2GB7 A;  3Q0C A;  4E5G A;  5D4G A;  3FDE A;  4E5L A;  3BI7 A;  3CAE A;  4CGX A;  2BAM A;  3BM3 A;  2ZKE A;  3V20 A;  4AWH A;  3Q0D A;  3HW3 A;  4AWG A;  4CGS A;  5JHT A;  2ZO2 B;  3V21 A;  3N78 A;  5DES A;  5JHV A;  3WVI A;  2PB7 A;  4OC8 A;  3MQ6 A;  4ZQQ A;  3WVK A;  2PFJ A;  4NFZ A;  3F8J B;  3DW9 A;  1SDO A;  1FZR A;  3HW4 A;  5CGV A;  3MQY A;  3HW5 A;  4E5E A;  3Q0F A;  1M0I A;  4YYL A;  3ODH A;  2FOK A;  1D2I A;  4PW7 A;  1FOK A;  4NJ5 A;  5D9J A;  4AVQ A;  4RZL A;  2ZKD A;  1DFM A;  4AVL A;  5D2O A;  5FDG A;  4ZHZ A;  3Q0B X;  2P0J A;  3A4K A;  4AWK A;  3CLZ A;  5EGA A;  4AVG A;  2ZKG A;  2ZKF A;  3F8I A;  3DPG A;  1ESG A;  2FQZ A;  4CHC A;  5D42 A;  5DEB A;  4E5H A;  3WVH A;  4PW6 A;  5CCY A;  3OLN A;  2XI7 A;  4AWF A;  3DWH A;  4E5J A;  3BAM A;  4F0Q A;  2ZO1 B;  3V1Z A;  5D8U A;  3N7B A;  1CFR A;  3HW6 A;  5CZN A;  2EWF A;  3WVG A;  3WVP A;  2P14 A;  4ZI0 A;  1M0D A;  1KNV A;  1VRR A;  2E52 A;  2ZO0 B;  5I13 A;  3DVO A;  4R28 A;  1ES8 A;  4E5I A;  5CL0 A;  4E5F A;  1BAM A;  2XI5 A;  4AWM A; 
#chains in the Genus database with same CATH homology
 4F0P A;  1BHM A;  4YGI A;  5FDD A;  1DC1 A;  5DBS A;  3EBJ A;  2GB7 A;  3Q0C A;  4E5G A;  5D4G A;  4E5L A;  3CAE A;  4CGX A;  2BAM A;  3BM3 A;  3V20 A;  4AWH A;  3Q0D A;  3HW3 A;  4AWG A;  4CGS A;  5JHT A;  3V21 A;  3N78 A;  5DES A;  5JHV A;  3WVI A;  4OC8 A;  3MQ6 A;  4ZQQ A;  3WVK A;  2PFJ A;  4NFZ A;  3DW9 A;  1SDO A;  1FZR A;  3HW4 A;  5CGV A;  3MQY A;  3HW5 A;  4E5E A;  3Q0F A;  1M0I A;  4YYL A;  3ODH A;  2FOK A;  1D2I A;  1FOK A;  5D9J A;  4AVQ A;  4RZL A;  1DFM A;  4AVL A;  5D2O A;  5FDG A;  4ZHZ A;  3Q0B X;  2P0J A;  3A4K A;  4AWK A;  5EGA A;  4AVG A;  3DPG A;  1ESG A;  2FQZ A;  4CHC A;  5D42 A;  5DEB A;  4E5H A;  3WVH A;  5CCY A;  2XI7 A;  4AWF A;  4E5J A;  3BAM A;  4F0Q A;  3V1Z A;  5D8U A;  3N7B A;  1CFR A;  3HW6 A;  5CZN A;  2EWF A;  3WVG A;  3WVP A;  2P14 A;  4ZI0 A;  1M0D A;  1KNV A;  1VRR A;  2E52 A;  5I13 A;  3DVO A;  4R28 A;  1ES8 A;  4E5I A;  5CL0 A;  4E5F A;  1BAM A;  2XI5 A;  4AWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...