4R2AA

Egr1/zif268 zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
b'ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early growth response protein 1
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2aA00
2EPPA 2EP3A 2EN2A 2CT1A 1NCSA 2EMWA 2EM7A 2EL6A 2EMKA 2EOQA 2EPCA 2YRKA 2PRTA 2EMXA 1X3CA 1TF3A 2EOEA 2JP9A 2EMGA 1F2IG 1DGCA 2EOSA 4F6MA 1A1KA 2J7JA 1A1IA 1YSAC 4IJDA 2R1FA 2EL5A 4R2EA 1A1HA 2EOMA 2MKNA 2WBUA 1ZR9A 2YTGA 2ADRA 2ELYA 2EPXA 2DGCA 4R2CA 2GLIA 2YTQA 2ENHA 1BBOA 5KL3A 1UN6B 3VHTB 2EPAA 3EPLA 2HGHA 1TN9A 2MKDA 2YSPA 4M9VC 2YTDA 1MEYC 5KL5A 2E72A 2EPUA 2YTJA 2NABA 4F6NA 2EM3A 1P47A 3EPKA 2EORA 2GHFA 2YRMA 2ELZA 2EN3A 3MHHC 1G2DC 2ENAA 2EQ0A 4WSGA 2EOFA 4R2PA 2EM2A 1LLMC 4R2AA 2LT7A 2EPRA 2EM6A 2RPCA 2M9AA 2EPZA 3EPJA 2RSIA 1JK2A 2VRDA 2LV2A 1X6FA 2YU5A 2EM0A 1X5WA 2EM9A 4R2QA 5KL6A 2JPAA 2LO3A 2EN6A 2EN1A 4R2RA 2YTOA 3UK3C 1BB8A 2EOJA 2LVHA 2BB8A 2EMHA 2EOYA 2DLKA 2YU8A 1A1GA 2EOIA 5KL7A 2WCC3 1B69A 2EE8A 3EPHA 2EOXA 4F2JC 2DMIA 1WJPA 2EMAA 1UBDC 2EMCA 2YTIA 2WBTA 4R2SA 2EOOA 2EJ4A 2YTFA 1X6EA 4R2DA 2EL4A 4GZNC 1A1FA 1G2FC 1KJKA 2EM5A 2LCEA 2ENCA 1Z1BA 2DLQA 2YTEA 2YTPA 2EN4A 4FK5C 2EMLA 1ZAAC 2EN8A 2YSOA 1X6HA 5KL2A 2EMYA 2EOHA 3MHSC 4X9JA 2DRPA 2CTDA 2CSHA 2A25A 2YRHA 2WBSA 2EMBA 1JK1A 1TF6A 2EMFA 2EM4A 1A1LA 2MDGA 1ZU1A 2D9HA 3M99B 2EM8A 2YTNA 4IS1C 2EOZA 5KL4A 1RMDA 1A1JA 1YUIA 2EMIA 1YUJA 1AAYA 2EN7A 2EMZA 2EQ3A 2EQ1A 2I13A
chains in the Genus database with same CATH superfamily
2JR1A 3J81C 2EM7A 2YRKA 2EOQA 2UXDE 4P7DA 4X62E 2RQLA 4BMJA 4F9BB 2L3JA 1F2IG 5AC4A 1DGCA 2EOSA 2JY9A 2HJJA 1MGTA 4KHPE 3C6MA 1ZBTA 2DSYA 1A1HA 2MKNA 2MC5A 2WBUA 2GLIA 1EH7A 4MLVA 5KL3A 1UN6B 3EPLA 2HGHA 4LF6E 4JI5E 2N8XA 2YSPA 2YTDA 3AV0A 5KL5A 1PKPA 2EORA 1XMOE 2K7IA 4WSGA 1LLMC 4R2AA 2JWOA 2EM6A 4M0VA 4BC7A 1N3GA 5A6KA 4LF7E 2EM0A 2E5LE 1EH8A 1X5WA 4F9AB 3ADGA 4HTGA 5KL6A 1HNWE 1WXRA 2EN1A 4DV1E 3P1XA 1STUA 4F54A 4R2RA 4DV2E 4DR2E 1EH6A 1IBKE 2UXBE 2B9DA 4L5NC 2EOIA 4WXCA 2UU9E 5IV8B 4RHBB 3EPHA 1WHNA 2EMAA 2YWQA 2L8TA 2M1SA 3C4TA 1I94E 2B7TA 4JV5E 1KJKA 3JU0A 4BCAA 4DV5E 4DV7E 1Z1BA 4X8WA 5AE2A 2EN4A 2YZTA 1X48A 5F3WA 2V86A 3J7AG 4ZYHA 1QU6A 1X6HA 4ZYEA 2WZOA 5KL2A 3AUZA 3T1YE 2DRPA 4ZYGA 2A25A 4O24A 2HHHE 1SR9A 1A1LA 2EM4A 3IWCA 2D9HA 2LUQA 2YTNA 4NZVA 5A6JA 1YUJA 2EN7A 2EMZA 2EQ1A 1T39A 3C6KA 2FV4B 4LFCE 4KWYA 2EP3A 4GEQB 2EN2A 5LMUE 2CT1A 5DNYA 2EL6A 2V85A 2PRTA 4LF9E 2JOBA 2EOEA 2M4IA 4JI0E 4O5GA 2EMGA 2RSMA 2N3GA 2G7HA 1DQ3A 1WRJA 2V87A 3MSWA 4WX9A 4F6MA 5A69A 4RH8A 1XNRE 2EL5A 3J80C 4X64E 2EOMA 3ZOQB 2ELYA 2EPXA 4YY3E 4DR7E 1RQ0A 3KZZA 4DV6E 2N3HA 2LTSA 1WHQA 5A6BD 5IWAE 2MKDA 1GTKA 4X66E 2VQEE 4JI2E 2E72A 2EPNA 2NABA 4F6NA 1P47A 3LLHA 5A6AA 2ELZA 1RC7A 1G2DC 4JI4E 2ENAA 3BIDA 5T6JA 2EOFA 3RMPA 5AE3A 4NXME 1YZ9A 4O4KA 2LT7A 4BBYA 2ZM6E 2RPCA 1JK2A 3DJWA 4M2ZA 2YU5A 1PJQA 4LF5E 2EM9A 4DUZE 4ZYDA 2EOJA 3QG5C 5IT9C 2V88A 3BF2A 5AASA 2EMHA 2F4VE 2YU8A 1A1GA 4F9CB 5KL7A 2LBSB 3T1HE 1YPNA 1UBDC 2EMCA 2YTIA 2EOOA 1X6EA 3BBGA 4B3ME 4R8OA 4N4RB 2ODRC 3OTOE 2LCEA 2YTEA 4FK5C 2UUBE 4J8ZA 3ADLA 2B7VA 3THNA 5BR8E 1IBLE 4LF4E 4R03A 1O0WA 2EN8A 2JOXA 2JXPA 2CTDA 2CSHA 2YRHA 2EMBA 4DMIA 1BBGA 2MDGA 2LMZA 1YYOA 3K6QA 1EKZA 2EOZA 5A6BA 2E1MA 2UXCE 1UILA 2NUEA 1RMDA 4OX9E 1YUIA 4LFAE 1AAYA 2EPOA 2DIXA 4LTYA 2EMWA 2GPIA 4DKKA 2HC5A 2EMXA 4B3TE 3ECRA 4YHHE 2JP9A 2MDRA 1DI2A 3ADJA 3HQ1A 4JI1E 2K4VA 2LE2A 2V89A 2J7JA 1IMUA 1A1IA 1PJTA 4OOGC 2V8QB 1YSAC 2M7QA 1ZBQA 3KWRA 3LMLA 1QNTA 1ZR9A 2YTGA 2ADRA 1UHZA 1PDAA 2ODRD 2LTRA 4DV0E 1J5EE 2EPAA 5ADZA 4JI8E 4JI3E 2V83A 4M9VC 1MEYC 1GQEA 2B3TB 2EPUA 2YTJA 2EWLA 3DF6A 3H09A 3EPKA 2YRMA 2EN3A 1L4SA 3MHHC 4WXDA 4LF8E 2FGGA 2L6MA 1HNZE 1AH5A 2EPRA 2LJUA 2EZ6A 5LLQA 3EPJA 4DR1E 2KONA 4BHCA 4JI6E 2RSIA 4P78A 2VRDA 1T38A 2UUAE 2JPAA 2LO3A 2IHR1 2EN6A 4B3RE 3UK3C 1BB8A 2LVHA 3F6HA 5TSEA 4DV3E 2F8BA 2EOYA 2EPMX 2LJHA 1GZ6A 1J26A 4I8OA 2YPNA 2EOXA 4WSPA 3IWBA 2FTXB 2Q8UA 2WBTA 4R2SA 4LU9A 5LL6R 2YTFA 4R2DA 1IQSA 5AE1A 2DLQA 4BS9A 2YT4A 4HEIA 1SFEA 1ZAAC 3F6GA 1HR0E 4B3SE 2RS7A 4AQYE 4GKKE 2YSOA 2JVAA 5LMNE 2EMYA 2EOHA 4X9JA 2WBSA 1X49A 1JK1A 2EMFA 4M30A 2LRSA 2EPLX 2LUPB 4O43A 3BGHA 1NEIA 5KL4A 3J7Yp 5AC5A 4DR5E 4L8NA 4DR3E 1N36E 2EQ3A 3HXLA 3HTXA 3JAMC 2EPPA 5A2QC 1HNXE 1NCSA 2EMKA 2EPCA 2CPNA 1X3CA 1TF3A 2L2KB 1IBME 2DB2A 1N34E 3VYXA 4BHBA 4TUGA 2KHXA 5IXMB 1KYQA 2L92A 1A1KA 2RS6A 2VF1A 2L3CA 1X47A 4JI7E 4IJDA 2R1FA 4R2EA 2H36X 2VE7C 2DGCA 4KZSA 4R2CA 2KOUA 2YTQA 2ENHA 3JTZA 1BBOA 5CFFE 3VHTB 4BC9A 4DR4E 1T4OA 4JYAE 1TN9A 5FLXC 2L33A 4DV4E 1FKAE 2L2MA 4TUIA 4Q35B 3FIGA 1YYKA 2EM3A 2NA2A 2GHFA 2NUGA 4X65E 1YYWA 2EQ0A 4R2PA 2EM2A 2M9AA 2EPZA 1FJGE 2LV2A 1X6FA 4DR6E 2NUFA 4R2QA 2BBGA 2RTXA 4WYQB 2YTOA 1IQOA 2BB8A 4K0KE 3C4BA 2DLKA 4MLQA 2MC6A 4NXNE 2WCC3 1B69A 2EE8A 4F2JC 2DMIA 1WJPA 1T4NA 1N32E 1PJSA 2L2NA 3TQMA 2EJ4A 4LFBE 2EL4A 4Q28A 4GZNC 1A1FA 1G2FC 3VYYA 3EQ1A 2EM5A 1XMQE 2ENCA 4NHRA 2YTPA 2EMLA 3IWDA 3L00A 1YFHA 2I9IA 2R76A 3MHSC 4WFTA 1TF6A 3THOB 1ZU1A 4DUYE 2UUCE 3M99B 3HPSA 2EM8A 4IS1C 4GKJE 3OMLA 2DMYA 1A1JA 2JYAA 3VK6A 2EMIA 1T4LB 3HPZA 3ADIA 2EPKX 1XNQE 1N33E 3KZYA 4WPYA 2I13A 2VQFE
chains in the Genus database with same CATH topology
2EPPA 2EP3A 2EN2A 2CT1A 1NCSA 2EMWA 2EM7A 2EL6A 2EMKA 2EOQA 2EPCA 2YRKA 2PRTA 2EMXA 1X3CA 1TF3A 2EOEA 2JP9A 2EMGA 1F2IG 1DGCA 2EOSA 4F6MA 1A1KA 2J7JA 1A1IA 1YSAC 4IJDA 2R1FA 2EL5A 4R2EA 1A1HA 2EOMA 2MKNA 2WBUA 1ZR9A 2YTGA 2ADRA 2ELYA 2EPXA 2DGCA 4R2CA 2GLIA 2YTQA 2ENHA 1BBOA 5KL3A 1UN6B 3VHTB 2EPAA 3EPLA 2HGHA 1TN9A 2MKDA 2YSPA 4M9VC 2YTDA 1MEYC 5KL5A 2E72A 2EPUA 2YTJA 2NABA 4F6NA 2EM3A 1P47A 3EPKA 2EORA 2GHFA 2YRMA 2ELZA 2EN3A 3MHHC 1G2DC 2ENAA 2EQ0A 4WSGA 2EOFA 4R2PA 2EM2A 1LLMC 4R2AA 2LT7A 2EPRA 2EM6A 2RPCA 2M9AA 2EPZA 3EPJA 2RSIA 1JK2A 2VRDA 2LV2A 1X6FA 2YU5A 2EM0A 1X5WA 2EM9A 4R2QA 5KL6A 2JPAA 2LO3A 2EN6A 2EN1A 4R2RA 2YTOA 3UK3C 1BB8A 2EOJA 2LVHA 2BB8A 2EMHA 2EOYA 2DLKA 2YU8A 1A1GA 2EOIA 5KL7A 2WCC3 1B69A 2EE8A 3EPHA 2EOXA 4F2JC 2DMIA 1WJPA 2EMAA 1UBDC 2EMCA 2YTIA 2WBTA 4R2SA 2EOOA 2EJ4A 2YTFA 1X6EA 4R2DA 2EL4A 4GZNC 1A1FA 1G2FC 1KJKA 2EM5A 2LCEA 2ENCA 1Z1BA 2DLQA 2YTEA 2YTPA 2EN4A 4FK5C 2EMLA 1ZAAC 2EN8A 2YSOA 1X6HA 5KL2A 2EMYA 2EOHA 3MHSC 4X9JA 2DRPA 2CTDA 2CSHA 2A25A 2YRHA 2WBSA 2EMBA 1JK1A 1TF6A 2EMFA 2EM4A 1A1LA 2MDGA 1ZU1A 2D9HA 3M99B 2EM8A 2YTNA 4IS1C 2EOZA 5KL4A 1RMDA 1A1JA 1YUIA 2EMIA 1YUJA 1AAYA 2EN7A 2EMZA 2EQ3A 2EQ1A 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPP A;  2EP3 A;  2EN2 A;  2CT1 A;  1NCS A;  2EMW A;  2EM7 A;  2EL6 A;  2EMK A;  2EOQ A;  2EPC A;  2YRK A;  2PRT A;  2EMX A;  1X3C A;  1TF3 A;  2EOE A;  2JP9 A;  2EMG A;  1F2I G;  1DGC A;  2EOS A;  4F6M A;  1A1K A;  2J7J A;  1A1I A;  1YSA C;  4IJD A;  2R1F A;  2EL5 A;  4R2E A;  1A1H A;  2EOM A;  2MKN A;  2WBU A;  1ZR9 A;  2YTG A;  2ADR A;  2ELY A;  2EPX A;  2DGC A;  4R2C A;  2GLI A;  2YTQ A;  2ENH A;  1BBO A;  5KL3 A;  1UN6 B;  3VHT B;  2EPA A;  3EPL A;  2HGH A;  1TN9 A;  2MKD A;  2YSP A;  4M9V C;  2YTD A;  1MEY C;  5KL5 A;  2E72 A;  2EPU A;  2YTJ A;  2NAB A;  4F6N A;  2EM3 A;  1P47 A;  3EPK A;  2EOR A;  2GHF A;  2YRM A;  2ELZ A;  2EN3 A;  3MHH C;  1G2D C;  2ENA A;  2EQ0 A;  4WSG A;  2EOF A;  4R2P A;  2EM2 A;  1LLM C;  4R2A A;  2LT7 A;  2EPR A;  2EM6 A;  2RPC A;  2M9A A;  2EPZ A;  3EPJ A;  2RSI A;  1JK2 A;  2VRD A;  2LV2 A;  1X6F A;  2YU5 A;  2EM0 A;  1X5W A;  2EM9 A;  4R2Q A;  5KL6 A;  2JPA A;  2LO3 A;  2EN6 A;  2EN1 A;  4R2R A;  2YTO A;  3UK3 C;  1BB8 A;  2EOJ A;  2LVH A;  2BB8 A;  2EMH A;  2EOY A;  2DLK A;  2YU8 A;  1A1G A;  2EOI A;  5KL7 A;  2WCC 3;  1B69 A;  2EE8 A;  3EPH A;  2EOX A;  4F2J C;  2DMI A;  1WJP A;  2EMA A;  1UBD C;  2EMC A;  2YTI A;  2WBT A;  4R2S A;  2EOO A;  2EJ4 A;  2YTF A;  1X6E A;  4R2D A;  2EL4 A;  4GZN C;  1A1F A;  1G2F C;  1KJK A;  2EM5 A;  2LCE A;  2ENC A;  1Z1B A;  2DLQ A;  2YTE A;  2YTP A;  2EN4 A;  4FK5 C;  2EML A;  1ZAA C;  2EN8 A;  2YSO A;  1X6H A;  5KL2 A;  2EMY A;  2EOH A;  3MHS C;  4X9J A;  2DRP A;  2CTD A;  2CSH A;  2A25 A;  2YRH A;  2WBS A;  2EMB A;  1JK1 A;  1TF6 A;  2EMF A;  2EM4 A;  1A1L A;  2MDG A;  1ZU1 A;  2D9H A;  3M99 B;  2EM8 A;  2YTN A;  4IS1 C;  2EOZ A;  5KL4 A;  1RMD A;  1A1J A;  1YUI A;  2EMI A;  1YUJ A;  1AAY A;  2EN7 A;  2EMZ A;  2EQ3 A;  2EQ1 A;  2I13 A; 
#chains in the Genus database with same CATH topology
 2JR1 A;  3J81 C;  2EM7 A;  2YRK A;  2EOQ A;  2UXD E;  4P7D A;  4X62 E;  2RQL A;  4BMJ A;  4F9B B;  2L3J A;  1F2I G;  5AC4 A;  1DGC A;  2EOS A;  2JY9 A;  2HJJ A;  1MGT A;  4KHP E;  3C6M A;  1ZBT A;  2DSY A;  1A1H A;  2MKN A;  2MC5 A;  2WBU A;  2GLI A;  1EH7 A;  4MLV A;  5KL3 A;  1UN6 B;  3EPL A;  2HGH A;  4LF6 E;  4JI5 E;  2N8X A;  2YSP A;  2YTD A;  3AV0 A;  5KL5 A;  1PKP A;  2EOR A;  1XMO E;  2K7I A;  4WSG A;  1LLM C;  4R2A A;  2JWO A;  2EM6 A;  4M0V A;  4BC7 A;  1N3G A;  5A6K A;  4LF7 E;  2EM0 A;  2E5L E;  1EH8 A;  1X5W A;  4F9A B;  3ADG A;  4HTG A;  5KL6 A;  1HNW E;  1WXR A;  2EN1 A;  4DV1 E;  3P1X A;  1STU A;  4F54 A;  4R2R A;  4DV2 E;  4DR2 E;  1EH6 A;  1IBK E;  2UXB E;  2B9D A;  4L5N C;  2EOI A;  4WXC A;  2UU9 E;  5IV8 B;  4RHB B;  3EPH A;  1WHN A;  2EMA A;  2YWQ A;  2L8T A;  2M1S A;  3C4T A;  1I94 E;  2B7T A;  4JV5 E;  1KJK A;  3JU0 A;  4BCA A;  4DV5 E;  4DV7 E;  1Z1B A;  4X8W A;  5AE2 A;  2EN4 A;  2YZT A;  1X48 A;  5F3W A;  2V86 A;  3J7A G;  4ZYH A;  1QU6 A;  1X6H A;  4ZYE A;  2WZO A;  5KL2 A;  3AUZ A;  3T1Y E;  2DRP A;  4ZYG A;  2A25 A;  4O24 A;  2HHH E;  1SR9 A;  1A1L A;  2EM4 A;  3IWC A;  2D9H A;  2LUQ A;  2YTN A;  4NZV A;  5A6J A;  1YUJ A;  2EN7 A;  2EMZ A;  2EQ1 A;  1T39 A;  3C6K A;  2FV4 B;  4LFC E;  4KWY A;  2EP3 A;  4GEQ B;  2EN2 A;  5LMU E;  2CT1 A;  5DNY A;  2EL6 A;  2V85 A;  2PRT A;  4LF9 E;  2JOB A;  2EOE A;  2M4I A;  4JI0 E;  4O5G A;  2EMG A;  2RSM A;  2N3G A;  2G7H A;  1DQ3 A;  1WRJ A;  2V87 A;  3MSW A;  4WX9 A;  4F6M A;  5A69 A;  4RH8 A;  1XNR E;  2EL5 A;  3J80 C;  4X64 E;  2EOM A;  3ZOQ B;  2ELY A;  2EPX A;  4YY3 E;  4DR7 E;  1RQ0 A;  3KZZ A;  4DV6 E;  2N3H A;  2LTS A;  1WHQ A;  5A6B D;  5IWA E;  2MKD A;  1GTK A;  4X66 E;  2VQE E;  4JI2 E;  2E72 A;  2EPN A;  2NAB A;  4F6N A;  1P47 A;  3LLH A;  5A6A A;  2ELZ A;  1RC7 A;  1G2D C;  4JI4 E;  2ENA A;  3BID A;  5T6J A;  2EOF A;  3RMP A;  5AE3 A;  4NXM E;  1YZ9 A;  4O4K A;  2LT7 A;  4BBY A;  2ZM6 E;  2RPC A;  1JK2 A;  3DJW A;  4M2Z A;  2YU5 A;  1PJQ A;  4LF5 E;  2EM9 A;  4DUZ E;  4ZYD A;  2EOJ A;  3QG5 C;  5IT9 C;  2V88 A;  3BF2 A;  5AAS A;  2EMH A;  2F4V E;  2YU8 A;  1A1G A;  4F9C B;  5KL7 A;  2LBS B;  3T1H E;  1YPN A;  1UBD C;  2EMC A;  2YTI A;  2EOO A;  1X6E A;  3BBG A;  4B3M E;  4R8O A;  4N4R B;  2ODR C;  3OTO E;  2LCE A;  2YTE A;  4FK5 C;  2UUB E;  4J8Z A;  3ADL A;  2B7V A;  3THN A;  5BR8 E;  1IBL E;  4LF4 E;  4R03 A;  1O0W A;  2EN8 A;  2JOX A;  2JXP A;  2CTD A;  2CSH A;  2YRH A;  2EMB A;  4DMI A;  1BBG A;  2MDG A;  2LMZ A;  1YYO A;  3K6Q A;  1EKZ A;  2EOZ A;  5A6B A;  2E1M A;  2UXC E;  1UIL A;  2NUE A;  1RMD A;  4OX9 E;  1YUI A;  4LFA E;  1AAY A;  2EPO A;  2DIX A;  4LTY A;  2EMW A;  2GPI A;  4DKK A;  2HC5 A;  2EMX A;  4B3T E;  3ECR A;  4YHH E;  2JP9 A;  2MDR A;  1DI2 A;  3ADJ A;  3HQ1 A;  4JI1 E;  2K4V A;  2LE2 A;  2V89 A;  2J7J A;  1IMU A;  1A1I A;  1PJT A;  4OOG C;  2V8Q B;  1YSA C;  2M7Q A;  1ZBQ A;  3KWR A;  3LML A;  1QNT A;  1ZR9 A;  2YTG A;  2ADR A;  1UHZ A;  1PDA A;  2ODR D;  2LTR A;  4DV0 E;  1J5E E;  2EPA A;  5ADZ A;  4JI8 E;  4JI3 E;  2V83 A;  4M9V C;  1MEY C;  1GQE A;  2B3T B;  2EPU A;  2YTJ A;  2EWL A;  3DF6 A;  3H09 A;  3EPK A;  2YRM A;  2EN3 A;  1L4S A;  3MHH C;  4WXD A;  4LF8 E;  2FGG A;  2L6M A;  1HNZ E;  1AH5 A;  2EPR A;  2LJU A;  2EZ6 A;  5LLQ A;  3EPJ A;  4DR1 E;  2KON A;  4BHC A;  4JI6 E;  2RSI A;  4P78 A;  2VRD A;  1T38 A;  2UUA E;  2JPA A;  2LO3 A;  2IHR 1;  2EN6 A;  4B3R E;  3UK3 C;  1BB8 A;  2LVH A;  3F6H A;  5TSE A;  4DV3 E;  2F8B A;  2EOY A;  2EPM X;  2LJH A;  1GZ6 A;  1J26 A;  4I8O A;  2YPN A;  2EOX A;  4WSP A;  3IWB A;  2FTX B;  2Q8U A;  2WBT A;  4R2S A;  4LU9 A;  5LL6 R;  2YTF A;  4R2D A;  1IQS A;  5AE1 A;  2DLQ A;  4BS9 A;  2YT4 A;  4HEI A;  1SFE A;  1ZAA C;  3F6G A;  1HR0 E;  4B3S E;  2RS7 A;  4AQY E;  4GKK E;  2YSO A;  2JVA A;  5LMN E;  2EMY A;  2EOH A;  4X9J A;  2WBS A;  1X49 A;  1JK1 A;  2EMF A;  4M30 A;  2LRS A;  2EPL X;  2LUP B;  4O43 A;  3BGH A;  1NEI A;  5KL4 A;  3J7Y p;  5AC5 A;  4DR5 E;  4L8N A;  4DR3 E;  1N36 E;  2EQ3 A;  3HXL A;  3HTX A;  3JAM C;  2EPP A;  5A2Q C;  1HNX E;  1NCS A;  2EMK A;  2EPC A;  2CPN A;  1X3C A;  1TF3 A;  2L2K B;  1IBM E;  2DB2 A;  1N34 E;  3VYX A;  4BHB A;  4TUG A;  2KHX A;  5IXM B;  1KYQ A;  2L92 A;  1A1K A;  2RS6 A;  2VF1 A;  2L3C A;  1X47 A;  4JI7 E;  4IJD A;  2R1F A;  4R2E A;  2H36 X;  2VE7 C;  2DGC A;  4KZS A;  4R2C A;  2KOU A;  2YTQ A;  2ENH A;  3JTZ A;  1BBO A;  5CFF E;  3VHT B;  4BC9 A;  4DR4 E;  1T4O A;  4JYA E;  1TN9 A;  5FLX C;  2L33 A;  4DV4 E;  1FKA E;  2L2M A;  4TUI A;  4Q35 B;  3FIG A;  1YYK A;  2EM3 A;  2NA2 A;  2GHF A;  2NUG A;  4X65 E;  1YYW A;  2EQ0 A;  4R2P A;  2EM2 A;  2M9A A;  2EPZ A;  1FJG E;  2LV2 A;  1X6F A;  4DR6 E;  2NUF A;  4R2Q A;  2BBG A;  2RTX A;  4WYQ B;  2YTO A;  1IQO A;  2BB8 A;  4K0K E;  3C4B A;  2DLK A;  4MLQ A;  2MC6 A;  4NXN E;  2WCC 3;  1B69 A;  2EE8 A;  4F2J C;  2DMI A;  1WJP A;  1T4N A;  1N32 E;  1PJS A;  2L2N A;  3TQM A;  2EJ4 A;  4LFB E;  2EL4 A;  4Q28 A;  4GZN C;  1A1F A;  1G2F C;  3VYY A;  3EQ1 A;  2EM5 A;  1XMQ E;  2ENC A;  4NHR A;  2YTP A;  2EML A;  3IWD A;  3L00 A;  1YFH A;  2I9I A;  2R76 A;  3MHS C;  4WFT A;  1TF6 A;  3THO B;  1ZU1 A;  4DUY E;  2UUC E;  3M99 B;  3HPS A;  2EM8 A;  4IS1 C;  4GKJ E;  3OML A;  2DMY A;  1A1J A;  2JYA A;  3VK6 A;  2EMI A;  1T4L B;  3HPZ A;  3ADI A;  2EPK X;  1XNQ E;  1N33 E;  3KZY A;  4WPY A;  2I13 A;  2VQF E; 
#chains in the Genus database with same CATH homology
 2EPP A;  2EP3 A;  2EN2 A;  2CT1 A;  1NCS A;  2EMW A;  2EM7 A;  2EL6 A;  2EMK A;  2EOQ A;  2EPC A;  2YRK A;  2PRT A;  2EMX A;  1X3C A;  1TF3 A;  2EOE A;  2JP9 A;  2EMG A;  1F2I G;  1DGC A;  2EOS A;  4F6M A;  1A1K A;  2J7J A;  1A1I A;  1YSA C;  4IJD A;  2R1F A;  2EL5 A;  4R2E A;  1A1H A;  2EOM A;  2MKN A;  2WBU A;  1ZR9 A;  2YTG A;  2ADR A;  2ELY A;  2EPX A;  2DGC A;  4R2C A;  2GLI A;  2YTQ A;  2ENH A;  1BBO A;  5KL3 A;  1UN6 B;  3VHT B;  2EPA A;  3EPL A;  2HGH A;  1TN9 A;  2MKD A;  2YSP A;  4M9V C;  2YTD A;  1MEY C;  5KL5 A;  2E72 A;  2EPU A;  2YTJ A;  2NAB A;  4F6N A;  2EM3 A;  1P47 A;  3EPK A;  2EOR A;  2GHF A;  2YRM A;  2ELZ A;  2EN3 A;  3MHH C;  1G2D C;  2ENA A;  2EQ0 A;  4WSG A;  2EOF A;  4R2P A;  2EM2 A;  1LLM C;  4R2A A;  2LT7 A;  2EPR A;  2EM6 A;  2RPC A;  2M9A A;  2EPZ A;  3EPJ A;  2RSI A;  1JK2 A;  2VRD A;  2LV2 A;  1X6F A;  2YU5 A;  2EM0 A;  1X5W A;  2EM9 A;  4R2Q A;  5KL6 A;  2JPA A;  2LO3 A;  2EN6 A;  2EN1 A;  4R2R A;  2YTO A;  3UK3 C;  1BB8 A;  2EOJ A;  2LVH A;  2BB8 A;  2EMH A;  2EOY A;  2DLK A;  2YU8 A;  1A1G A;  2EOI A;  5KL7 A;  2WCC 3;  1B69 A;  2EE8 A;  3EPH A;  2EOX A;  4F2J C;  2DMI A;  1WJP A;  2EMA A;  1UBD C;  2EMC A;  2YTI A;  2WBT A;  4R2S A;  2EOO A;  2EJ4 A;  2YTF A;  1X6E A;  4R2D A;  2EL4 A;  4GZN C;  1A1F A;  1G2F C;  1KJK A;  2EM5 A;  2LCE A;  2ENC A;  1Z1B A;  2DLQ A;  2YTE A;  2YTP A;  2EN4 A;  4FK5 C;  2EML A;  1ZAA C;  2EN8 A;  2YSO A;  1X6H A;  5KL2 A;  2EMY A;  2EOH A;  3MHS C;  4X9J A;  2DRP A;  2CTD A;  2CSH A;  2A25 A;  2YRH A;  2WBS A;  2EMB A;  1JK1 A;  1TF6 A;  2EMF A;  2EM4 A;  1A1L A;  2MDG A;  1ZU1 A;  2D9H A;  3M99 B;  2EM8 A;  2YTN A;  4IS1 C;  2EOZ A;  5KL4 A;  1RMD A;  1A1J A;  1YUI A;  2EMI A;  1YUJ A;  1AAY A;  2EN7 A;  2EMZ A;  2EQ3 A;  2EQ1 A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...