4R2AA

Egr1/zif268 zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early growth response protein 1
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2aA00
1DGCA 2YTOA 2CTDA 2EOXA 1X6EA 2EPAA 2M9AA 2EOYA 2BB8A 2RSIA 4F2JC 1ZAAC 1JK1A 2EPPA 1RMDA 2LV2A 3EPHA 1MEYC 1G2DC 1A1LA 1BB8A 2MKNA 4F6NA 2LO3A 1A1HA 1AAYA 2CT1A 2YRMA 4R2PA 2CSHA 2EL4A 2EM7A 2EMBA 2EMFA 2EE8A 3EPJA 2LT7A 2YSPA 2HGHA 2EOSA 2YRHA 2YTGA 2EMCA 2ADRA 2EMWA 1F2IG 1YUJA 2MKDA 2EOZA 1A1JA 2EPZA 2WBTA 1ZU1A 1JK2A 2EM9A 1A1FA 1TF3A 1LLMC 2DRPA 2YTFA 2EN6A 2EQ0A 3M99B 2EN2A 2EOEA 2ELYA 2EP3A 2WBSA 2EOHA 1A1KA 2EORA 2EMIA 2EOQA 2YTDA 2EL5A 2EN8A 4IS1C 2YTQA 3MHSC 2D9HA 2EOJA 2EOFA 2LVHA 2YTPA 2EMYA 1BBOA 2VRDA 2LCEA 1TN9A 2EM2A 2NABA 1B69A 2GLIA 1X6FA 4R2SA 2ENHA 2EOIA 4FK5C 3UK3C 4GZNC 2EM5A 2ENCA 3VHTB 2I13A 2EMHA 2EM3A 2YTJA 2WBUA 4F6MA 3MHHC 2EOMA 1UN6B 4R2CA 2YU5A 2EM0A 2EMKA 4R2QA 1YUIA 2WCC3 1P47A 1X3CA 5KL7A 1A1GA 2E72A 2EM8A 5KL6A 3EPKA 1YSAC 1X5WA 2JPAA 2ELZA 5KL5A 5KL2A 2EN4A 2YTIA 2EMZA 2A25A 1UBDC 2EM6A 2EPUA 1NCSA 2JP9A 2EOOA 1Z1BA 2EMXA 2ENAA 2EQ1A 4M9VC 2EN7A 2EPCA 2EMAA 1ZR9A 1X6HA 2EMLA 3EPLA 2EN1A 2R1FA 5KL3A 2DGCA 4X9JA 2MDGA 1KJKA 2YSOA 2DLKA 4IJDA 4R2AA 2EN3A 2J7JA 1WJPA 4R2DA 1A1IA 1G2FC 2YTNA 2EQ3A 2GHFA 5KL4A 2RPCA 2DMIA 2YTEA 4WSGA 2EPRA 4R2EA 2YU8A 1TF6A 2EM4A 4R2RA 2EL6A 2YRKA 2EJ4A 2EMGA 2EPXA 2DLQA 2PRTA
chains in the Genus database with same CATH superfamily
2EOXA 5LMNE 4DUZE 2EPAA 2RSIA 4DV4E 4BS9A 4F2JC 4JI5E 1ZAAC 3ADJA 3DF6A 5A6KA 5CFFE 2L3CA 2ODRC 4R03A 1A1LA 2RTXA 1BB8A 4JI7E 4DR4E 2YT4A 4R2PA 2F4VE 2RSMA 2L8TA 1YYOA 1WHQA 5IXMB 2EMCA 2V83A 4WSPA 1ZBTA 4LFAE 1YYKA 3OMLA 2EM9A 2JXPA 2NUEA 1STUA 4HEIA 4DV6E 2EN6A 4OOGC 2EN2A 5A6AA 2NA2A 2EOHA 2EMIA 2EL5A 2V88A 2LE2A 2CPNA 3HXLA 1XNRE 1EH8A 4O4KA 5A6JA 3ADGA 2VRDA 2VQFE 3KWRA 2EM2A 2GLIA 2LMZA 4FK5C 3UK3C 3JTZA 2YPNA 4LF8E 3HTXA 4LF4E 1X49A 2I13A 2EM3A 2VE7C 2WBUA 4BBYA 2EOMA 4L5NC 1UN6B 4JYAE 3H09A 4DV7E 1O0WA 1J5EE 4BHCA 4JI8E 2DIXA 1P47A 4B3RE 1X48A 4OX9E 2EM8A 1N3GA 2JWOA 2FV4B 5KL2A 2EN4A 2YTIA 2A25A 1UBDC 1IMUA 2MC6A 1NCSA 4O5GA 2KONA 1PKPA 2EMAA 3KZZA 4MLQA 3J7Yp 2L3JA 1AH5A 2M7QA 3J81C 2MDGA 4LFBE 4N4RB 2UUCE 2DLKA 4R2AA 1A1IA 1MGTA 1WJPA 2E5LE 4O43A 2EQ3A 5KL4A 1WRJA 4M2ZA 4WSGA 2MC5A 2EM4A 1DQ3A 2EL6A 2EMGA 2HJJA 2LRSA 4JI1E 1WHNA 1DGCA 2CTDA 1EKZA 2M9AA 2L33A 4F9AB 1YFHA 1JK1A 3ADIA 3EPHA 4K0KE 1PJQA 1MEYC 5A69A 1NEIA 2CT1A 2V86A 2YRMA 3KZYA 4DR7E 2RS7A 4RHBB 4DV5E 2UUAE 2LT7A 2YRHA 1IBME 2Q8UA 3BF2A 1YUJA 3ECRA 2L6MA 3IWDA 1BBGA 1EH6A 1TF3A 5F3WA 3LMLA 2YTFA 1XNQE 4BC7A 2JOBA 2EOEA 3THNA 2EP3A 1RC7A 1A1KA 3JU0A 4IS1C 2EPLX 3MHSC 2HC5A 2D9HA 4X64E 4ZYEA 2L2KB 1T4NA 4X65E 1IBLE 1T4OA 2LCEA 1TN9A 2G7HA 2V89A 1B69A 1X6FA 4BMJA 3J80C 2EOIA 3HQ1A 4NZVA 2EM5A 2ENCA 4LF9E 2L2NA 3MSWA 2EPOA 1SFEA 3P1XA 4BCAA 4ZYHA 2NUGA 4R2QA 2JVAA 2ODRD 1IQSA 5KL7A 4DUYE 1IBKE 5KL6A 4Q28A 1X5WA 2JPAA 5LLQA 2LJUA 5KL5A 2EPNA 2N8XA 3QG5C 2EM6A 3BIDA 3TQMA 2EMXA 2EN7A 2EPCA 2UXDE 2EMLA 5DNYA 2R1FA 4X9JA 2LBSB 2YSOA 1HNWE 1YZ9A 4TUGA 2EZ6A 2EN3A 1G2FC 4P7DA 3C4TA 2MDRA 4P78A 4HTGA 2DMIA 5AE1A 1N36E 1I94E 2DB2A 1XMQE 1TF6A 5IV8B 4R2RA 2YRKA 4NHRA 4M0VA 5FLXC 4YHHE 1N33E 4WYQB 1X6EA 4X62E 2EOYA 2BB8A 4WPYA 5LL6R 1YYWA 3THOB 2EPPA 4F6NA 2LO3A 1A1HA 1AAYA 2L92A 2CSHA 5A6BD 2EL4A 1HNXE 3EPJA 4AQYE 2DMYA 2EOSA 2FGGA 3AV0A 2F8BA 2ADRA 2EMWA 2B7VA 1F2IG 4DV0E 2MKDA 2EOZA 2EPZA 2V8QB 1ZU1A 2WBTA 1SR9A 5ADZA 1A1FA 3IWBA 4WX9A 3IWCA 2UUBE 3VYYA 3M99B 1X47A 2UU9E 4J8ZA 2EORA 2EOQA 2YTDA 2YTQA 4JI6E 1RQ0A 3EQ1A 5TSEA 2EOFA 2LVHA 2YTPA 2EMYA 2VQEE 5LMUE 1T39A 2UXBE 2V87A 1BBOA 2ZM6E 1GTKA 2KOUA 3VK6A 4DR1E 4B3TE 4JI3E 2ENHA 2NUFA 4GZNC 2LTSA 2L2MA 2B7TA 2EMHA 4F9CB 1HR0E 2YTJA 3MHHC 4R2CA 2YU5A 4RH8A 2N3GA 2K7IA 2B9DA 2EMKA 3VYXA 1FJGE 5A2QC 4JV5E 3C6MA 2WCC3 4DR5E 3C4BA 1PJTA 1YSAC 2VF1A 5IWAE 4B3SE 3FIGA 4DV3E 3ZOQB 4DV2E 4GEQB 5IT9C 4BHBA 2EPUA 3HPZA 1N32E 4DR6E 3T1YE 4M9VC 4O24A 2B3TB 1FKAE 4GKKE 2LJHA 1ZR9A 3LLHA 3EPLA 4LTYA 1T4LB 2DGCA 1KJKA 5AC4A 1YPNA 2I9IA 4IJDA 2J7JA 5AC5A 4R2DA 2M1SA 2N3HA 2HHHE 2M4IA 4YY3E 3ADLA 1XMOE 3L00A 1WXRA 2RS6A 2EPRA 4R2EA 4NXNE 4LF7E 4MLVA 2H36X 5A6BA 4F54A 2PRTA 2YTOA 1IQOA 1RMDA 2LV2A 2EPKX 1G2DC 3K6QA 4WXCA 5AE2A 2MKNA 4KHPE 4GKJE 1J26A 4DKKA 1HNZE 4M30A 4L8NA 4DMIA 2EM7A 1UILA 2EMBA 2EMFA 2EE8A 2YSPA 2HGHA 2JR1A 1T38A 3AUZA 3HPSA 2YTGA 1ZBQA 4DV1E 4LFCE 2UXCE 3F6HA 3T1HE 1A1JA 3F6GA 1JK2A 2YZTA 4I8OA 4JI4E 2LUQA 1LLMC 4WXDA 2DRPA 4X8WA 1KYQA 4NXME 2JYAA 2EQ0A 2ELYA 2KHXA 2FTXB 2WBSA 4R8OA 4ZYDA 2EN8A 2E1MA 2EWLA 2EOJA 3OTOE 2DSYA 2WZOA 2IHR1 4LF6E 4BC9A 2GPIA 4KZSA 2NABA 4KWYA 4R2SA 4LU9A 1L4SA 3VHTB 4X66E 4F6MA 3JAMC 1N34E 2EM0A 4TUIA 1YUIA 1EH7A 2EPMX 2JOXA 4F9BB 1X3CA 1A1GA 4DR3E 2E72A 2LUPB 3EPKA 3J7AG 4WFTA 2ELZA 2EMZA 4JI2E 4LF5E 5BR8E 1QU6A 2BBGA 3C6KA 5AASA 2JP9A 2EOOA 2YWQA 1Z1BA 2ENAA 2EQ1A 1GQEA 5AE3A 1UHZA 1DI2A 1QNTA 1X6HA 4DR2E 4B3ME 2EN1A 4ZYGA 2LTRA 4Q35B 2JY9A 5KL3A 2RQLA 4JI0E 2V85A 1GZ6A 3DJWA 3BBGA 3BGHA 2YTNA 2GHFA 2RPCA 2YTEA 2K4VA 2YU8A 2R76A 3RMPA 1PJSA 1PDAA 2EJ4A 2EPXA 2DLQA 5T6JA
chains in the Genus database with same CATH topology
1DGCA 2YTOA 2CTDA 2EOXA 1X6EA 2EPAA 2M9AA 2EOYA 2BB8A 2RSIA 4F2JC 1ZAAC 1JK1A 2EPPA 1RMDA 2LV2A 3EPHA 1MEYC 1G2DC 1A1LA 1BB8A 2MKNA 4F6NA 2LO3A 1A1HA 1AAYA 2CT1A 2YRMA 4R2PA 2CSHA 2EL4A 2EM7A 2EMBA 2EMFA 2EE8A 3EPJA 2LT7A 2YSPA 2HGHA 2EOSA 2YRHA 2YTGA 2EMCA 2ADRA 2EMWA 1F2IG 1YUJA 2MKDA 2EOZA 1A1JA 2EPZA 2WBTA 1ZU1A 1JK2A 2EM9A 1A1FA 1TF3A 1LLMC 2DRPA 2YTFA 2EN6A 2EQ0A 3M99B 2EN2A 2EOEA 2ELYA 2EP3A 2WBSA 2EOHA 1A1KA 2EORA 2EMIA 2EOQA 2YTDA 2EL5A 2EN8A 4IS1C 2YTQA 3MHSC 2D9HA 2EOJA 2EOFA 2LVHA 2YTPA 2EMYA 1BBOA 2VRDA 2LCEA 1TN9A 2EM2A 2NABA 1B69A 2GLIA 1X6FA 4R2SA 2ENHA 2EOIA 4FK5C 3UK3C 4GZNC 2EM5A 2ENCA 3VHTB 2I13A 2EMHA 2EM3A 2YTJA 2WBUA 4F6MA 3MHHC 2EOMA 1UN6B 4R2CA 2YU5A 2EM0A 2EMKA 4R2QA 1YUIA 2WCC3 1P47A 1X3CA 5KL7A 1A1GA 2E72A 2EM8A 5KL6A 3EPKA 1YSAC 1X5WA 2JPAA 2ELZA 5KL5A 5KL2A 2EN4A 2YTIA 2EMZA 2A25A 1UBDC 2EM6A 2EPUA 1NCSA 2JP9A 2EOOA 1Z1BA 2EMXA 2ENAA 2EQ1A 4M9VC 2EN7A 2EPCA 2EMAA 1ZR9A 1X6HA 2EMLA 3EPLA 2EN1A 2R1FA 5KL3A 2DGCA 4X9JA 2MDGA 1KJKA 2YSOA 2DLKA 4IJDA 4R2AA 2EN3A 2J7JA 1WJPA 4R2DA 1A1IA 1G2FC 2YTNA 2EQ3A 2GHFA 5KL4A 2RPCA 2DMIA 2YTEA 4WSGA 2EPRA 4R2EA 2YU8A 1TF6A 2EM4A 4R2RA 2EL6A 2YRKA 2EJ4A 2EMGA 2EPXA 2DLQA 2PRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGC A;  2YTO A;  2CTD A;  2EOX A;  1X6E A;  2EPA A;  2M9A A;  2EOY A;  2BB8 A;  2RSI A;  4F2J C;  1ZAA C;  1JK1 A;  2EPP A;  1RMD A;  2LV2 A;  3EPH A;  1MEY C;  1G2D C;  1A1L A;  1BB8 A;  2MKN A;  4F6N A;  2LO3 A;  1A1H A;  1AAY A;  2CT1 A;  2YRM A;  4R2P A;  2CSH A;  2EL4 A;  2EM7 A;  2EMB A;  2EMF A;  2EE8 A;  3EPJ A;  2LT7 A;  2YSP A;  2HGH A;  2EOS A;  2YRH A;  2YTG A;  2EMC A;  2ADR A;  2EMW A;  1F2I G;  1YUJ A;  2MKD A;  2EOZ A;  1A1J A;  2EPZ A;  2WBT A;  1ZU1 A;  1JK2 A;  2EM9 A;  1A1F A;  1TF3 A;  1LLM C;  2DRP A;  2YTF A;  2EN6 A;  2EQ0 A;  3M99 B;  2EN2 A;  2EOE A;  2ELY A;  2EP3 A;  2WBS A;  2EOH A;  1A1K A;  2EOR A;  2EMI A;  2EOQ A;  2YTD A;  2EL5 A;  2EN8 A;  4IS1 C;  2YTQ A;  3MHS C;  2D9H A;  2EOJ A;  2EOF A;  2LVH A;  2YTP A;  2EMY A;  1BBO A;  2VRD A;  2LCE A;  1TN9 A;  2EM2 A;  2NAB A;  1B69 A;  2GLI A;  1X6F A;  4R2S A;  2ENH A;  2EOI A;  4FK5 C;  3UK3 C;  4GZN C;  2EM5 A;  2ENC A;  3VHT B;  2I13 A;  2EMH A;  2EM3 A;  2YTJ A;  2WBU A;  4F6M A;  3MHH C;  2EOM A;  1UN6 B;  4R2C A;  2YU5 A;  2EM0 A;  2EMK A;  4R2Q A;  1YUI A;  2WCC 3;  1P47 A;  1X3C A;  5KL7 A;  1A1G A;  2E72 A;  2EM8 A;  5KL6 A;  3EPK A;  1YSA C;  1X5W A;  2JPA A;  2ELZ A;  5KL5 A;  5KL2 A;  2EN4 A;  2YTI A;  2EMZ A;  2A25 A;  1UBD C;  2EM6 A;  2EPU A;  1NCS A;  2JP9 A;  2EOO A;  1Z1B A;  2EMX A;  2ENA A;  2EQ1 A;  4M9V C;  2EN7 A;  2EPC A;  2EMA A;  1ZR9 A;  1X6H A;  2EML A;  3EPL A;  2EN1 A;  2R1F A;  5KL3 A;  2DGC A;  4X9J A;  2MDG A;  1KJK A;  2YSO A;  2DLK A;  4IJD A;  4R2A A;  2EN3 A;  2J7J A;  1WJP A;  4R2D A;  1A1I A;  1G2F C;  2YTN A;  2EQ3 A;  2GHF A;  5KL4 A;  2RPC A;  2DMI A;  2YTE A;  4WSG A;  2EPR A;  4R2E A;  2YU8 A;  1TF6 A;  2EM4 A;  4R2R A;  2EL6 A;  2YRK A;  2EJ4 A;  2EMG A;  2EPX A;  2DLQ A;  2PRT A; 
#chains in the Genus database with same CATH topology
 2EOX A;  5LMN E;  4DUZ E;  2EPA A;  2RSI A;  4DV4 E;  4BS9 A;  4F2J C;  4JI5 E;  1ZAA C;  3ADJ A;  3DF6 A;  5A6K A;  5CFF E;  2L3C A;  2ODR C;  4R03 A;  1A1L A;  2RTX A;  1BB8 A;  4JI7 E;  4DR4 E;  2YT4 A;  4R2P A;  2F4V E;  2RSM A;  2L8T A;  1YYO A;  1WHQ A;  5IXM B;  2EMC A;  2V83 A;  4WSP A;  1ZBT A;  4LFA E;  1YYK A;  3OML A;  2EM9 A;  2JXP A;  2NUE A;  1STU A;  4HEI A;  4DV6 E;  2EN6 A;  4OOG C;  2EN2 A;  5A6A A;  2NA2 A;  2EOH A;  2EMI A;  2EL5 A;  2V88 A;  2LE2 A;  2CPN A;  3HXL A;  1XNR E;  1EH8 A;  4O4K A;  5A6J A;  3ADG A;  2VRD A;  2VQF E;  3KWR A;  2EM2 A;  2GLI A;  2LMZ A;  4FK5 C;  3UK3 C;  3JTZ A;  2YPN A;  4LF8 E;  3HTX A;  4LF4 E;  1X49 A;  2I13 A;  2EM3 A;  2VE7 C;  2WBU A;  4BBY A;  2EOM A;  4L5N C;  1UN6 B;  4JYA E;  3H09 A;  4DV7 E;  1O0W A;  1J5E E;  4BHC A;  4JI8 E;  2DIX A;  1P47 A;  4B3R E;  1X48 A;  4OX9 E;  2EM8 A;  1N3G A;  2JWO A;  2FV4 B;  5KL2 A;  2EN4 A;  2YTI A;  2A25 A;  1UBD C;  1IMU A;  2MC6 A;  1NCS A;  4O5G A;  2KON A;  1PKP A;  2EMA A;  3KZZ A;  4MLQ A;  3J7Y p;  2L3J A;  1AH5 A;  2M7Q A;  3J81 C;  2MDG A;  4LFB E;  4N4R B;  2UUC E;  2DLK A;  4R2A A;  1A1I A;  1MGT A;  1WJP A;  2E5L E;  4O43 A;  2EQ3 A;  5KL4 A;  1WRJ A;  4M2Z A;  4WSG A;  2MC5 A;  2EM4 A;  1DQ3 A;  2EL6 A;  2EMG A;  2HJJ A;  2LRS A;  4JI1 E;  1WHN A;  1DGC A;  2CTD A;  1EKZ A;  2M9A A;  2L33 A;  4F9A B;  1YFH A;  1JK1 A;  3ADI A;  3EPH A;  4K0K E;  1PJQ A;  1MEY C;  5A69 A;  1NEI A;  2CT1 A;  2V86 A;  2YRM A;  3KZY A;  4DR7 E;  2RS7 A;  4RHB B;  4DV5 E;  2UUA E;  2LT7 A;  2YRH A;  1IBM E;  2Q8U A;  3BF2 A;  1YUJ A;  3ECR A;  2L6M A;  3IWD A;  1BBG A;  1EH6 A;  1TF3 A;  5F3W A;  3LML A;  2YTF A;  1XNQ E;  4BC7 A;  2JOB A;  2EOE A;  3THN A;  2EP3 A;  1RC7 A;  1A1K A;  3JU0 A;  4IS1 C;  2EPL X;  3MHS C;  2HC5 A;  2D9H A;  4X64 E;  4ZYE A;  2L2K B;  1T4N A;  4X65 E;  1IBL E;  1T4O A;  2LCE A;  1TN9 A;  2G7H A;  2V89 A;  1B69 A;  1X6F A;  4BMJ A;  3J80 C;  2EOI A;  3HQ1 A;  4NZV A;  2EM5 A;  2ENC A;  4LF9 E;  2L2N A;  3MSW A;  2EPO A;  1SFE A;  3P1X A;  4BCA A;  4ZYH A;  2NUG A;  4R2Q A;  2JVA A;  2ODR D;  1IQS A;  5KL7 A;  4DUY E;  1IBK E;  5KL6 A;  4Q28 A;  1X5W A;  2JPA A;  5LLQ A;  2LJU A;  5KL5 A;  2EPN A;  2N8X A;  3QG5 C;  2EM6 A;  3BID A;  3TQM A;  2EMX A;  2EN7 A;  2EPC A;  2UXD E;  2EML A;  5DNY A;  2R1F A;  4X9J A;  2LBS B;  2YSO A;  1HNW E;  1YZ9 A;  4TUG A;  2EZ6 A;  2EN3 A;  1G2F C;  4P7D A;  3C4T A;  2MDR A;  4P78 A;  4HTG A;  2DMI A;  5AE1 A;  1N36 E;  1I94 E;  2DB2 A;  1XMQ E;  1TF6 A;  5IV8 B;  4R2R A;  2YRK A;  4NHR A;  4M0V A;  5FLX C;  4YHH E;  1N33 E;  4WYQ B;  1X6E A;  4X62 E;  2EOY A;  2BB8 A;  4WPY A;  5LL6 R;  1YYW A;  3THO B;  2EPP A;  4F6N A;  2LO3 A;  1A1H A;  1AAY A;  2L92 A;  2CSH A;  5A6B D;  2EL4 A;  1HNX E;  3EPJ A;  4AQY E;  2DMY A;  2EOS A;  2FGG A;  3AV0 A;  2F8B A;  2ADR A;  2EMW A;  2B7V A;  1F2I G;  4DV0 E;  2MKD A;  2EOZ A;  2EPZ A;  2V8Q B;  1ZU1 A;  2WBT A;  1SR9 A;  5ADZ A;  1A1F A;  3IWB A;  4WX9 A;  3IWC A;  2UUB E;  3VYY A;  3M99 B;  1X47 A;  2UU9 E;  4J8Z A;  2EOR A;  2EOQ A;  2YTD A;  2YTQ A;  4JI6 E;  1RQ0 A;  3EQ1 A;  5TSE A;  2EOF A;  2LVH A;  2YTP A;  2EMY A;  2VQE E;  5LMU E;  1T39 A;  2UXB E;  2V87 A;  1BBO A;  2ZM6 E;  1GTK A;  2KOU A;  3VK6 A;  4DR1 E;  4B3T E;  4JI3 E;  2ENH A;  2NUF A;  4GZN C;  2LTS A;  2L2M A;  2B7T A;  2EMH A;  4F9C B;  1HR0 E;  2YTJ A;  3MHH C;  4R2C A;  2YU5 A;  4RH8 A;  2N3G A;  2K7I A;  2B9D A;  2EMK A;  3VYX A;  1FJG E;  5A2Q C;  4JV5 E;  3C6M A;  2WCC 3;  4DR5 E;  3C4B A;  1PJT A;  1YSA C;  2VF1 A;  5IWA E;  4B3S E;  3FIG A;  4DV3 E;  3ZOQ B;  4DV2 E;  4GEQ B;  5IT9 C;  4BHB A;  2EPU A;  3HPZ A;  1N32 E;  4DR6 E;  3T1Y E;  4M9V C;  4O24 A;  2B3T B;  1FKA E;  4GKK E;  2LJH A;  1ZR9 A;  3LLH A;  3EPL A;  4LTY A;  1T4L B;  2DGC A;  1KJK A;  5AC4 A;  1YPN A;  2I9I A;  4IJD A;  2J7J A;  5AC5 A;  4R2D A;  2M1S A;  2N3H A;  2HHH E;  2M4I A;  4YY3 E;  3ADL A;  1XMO E;  3L00 A;  1WXR A;  2RS6 A;  2EPR A;  4R2E A;  4NXN E;  4LF7 E;  4MLV A;  2H36 X;  5A6B A;  4F54 A;  2PRT A;  2YTO A;  1IQO A;  1RMD A;  2LV2 A;  2EPK X;  1G2D C;  3K6Q A;  4WXC A;  5AE2 A;  2MKN A;  4KHP E;  4GKJ E;  1J26 A;  4DKK A;  1HNZ E;  4M30 A;  4L8N A;  4DMI A;  2EM7 A;  1UIL A;  2EMB A;  2EMF A;  2EE8 A;  2YSP A;  2HGH A;  2JR1 A;  1T38 A;  3AUZ A;  3HPS A;  2YTG A;  1ZBQ A;  4DV1 E;  4LFC E;  2UXC E;  3F6H A;  3T1H E;  1A1J A;  3F6G A;  1JK2 A;  2YZT A;  4I8O A;  4JI4 E;  2LUQ A;  1LLM C;  4WXD A;  2DRP A;  4X8W A;  1KYQ A;  4NXM E;  2JYA A;  2EQ0 A;  2ELY A;  2KHX A;  2FTX B;  2WBS A;  4R8O A;  4ZYD A;  2EN8 A;  2E1M A;  2EWL A;  2EOJ A;  3OTO E;  2DSY A;  2WZO A;  2IHR 1;  4LF6 E;  4BC9 A;  2GPI A;  4KZS A;  2NAB A;  4KWY A;  4R2S A;  4LU9 A;  1L4S A;  3VHT B;  4X66 E;  4F6M A;  3JAM C;  1N34 E;  2EM0 A;  4TUI A;  1YUI A;  1EH7 A;  2EPM X;  2JOX A;  4F9B B;  1X3C A;  1A1G A;  4DR3 E;  2E72 A;  2LUP B;  3EPK A;  3J7A G;  4WFT A;  2ELZ A;  2EMZ A;  4JI2 E;  4LF5 E;  5BR8 E;  1QU6 A;  2BBG A;  3C6K A;  5AAS A;  2JP9 A;  2EOO A;  2YWQ A;  1Z1B A;  2ENA A;  2EQ1 A;  1GQE A;  5AE3 A;  1UHZ A;  1DI2 A;  1QNT A;  1X6H A;  4DR2 E;  4B3M E;  2EN1 A;  4ZYG A;  2LTR A;  4Q35 B;  2JY9 A;  5KL3 A;  2RQL A;  4JI0 E;  2V85 A;  1GZ6 A;  3DJW A;  3BBG A;  3BGH A;  2YTN A;  2GHF A;  2RPC A;  2YTE A;  2K4V A;  2YU8 A;  2R76 A;  3RMP A;  1PJS A;  1PDA A;  2EJ4 A;  2EPX A;  2DLQ A;  5T6J A; 
#chains in the Genus database with same CATH homology
 1DGC A;  2YTO A;  2CTD A;  2EOX A;  1X6E A;  2EPA A;  2M9A A;  2EOY A;  2BB8 A;  2RSI A;  4F2J C;  1ZAA C;  1JK1 A;  2EPP A;  1RMD A;  2LV2 A;  3EPH A;  1MEY C;  1G2D C;  1A1L A;  1BB8 A;  2MKN A;  4F6N A;  2LO3 A;  1A1H A;  1AAY A;  2CT1 A;  2YRM A;  4R2P A;  2CSH A;  2EL4 A;  2EM7 A;  2EMB A;  2EMF A;  2EE8 A;  3EPJ A;  2LT7 A;  2YSP A;  2HGH A;  2EOS A;  2YRH A;  2YTG A;  2EMC A;  2ADR A;  2EMW A;  1F2I G;  1YUJ A;  2MKD A;  2EOZ A;  1A1J A;  2EPZ A;  2WBT A;  1ZU1 A;  1JK2 A;  2EM9 A;  1A1F A;  1TF3 A;  1LLM C;  2DRP A;  2YTF A;  2EN6 A;  2EQ0 A;  3M99 B;  2EN2 A;  2EOE A;  2ELY A;  2EP3 A;  2WBS A;  2EOH A;  1A1K A;  2EOR A;  2EMI A;  2EOQ A;  2YTD A;  2EL5 A;  2EN8 A;  4IS1 C;  2YTQ A;  3MHS C;  2D9H A;  2EOJ A;  2EOF A;  2LVH A;  2YTP A;  2EMY A;  1BBO A;  2VRD A;  2LCE A;  1TN9 A;  2EM2 A;  2NAB A;  1B69 A;  2GLI A;  1X6F A;  4R2S A;  2ENH A;  2EOI A;  4FK5 C;  3UK3 C;  4GZN C;  2EM5 A;  2ENC A;  3VHT B;  2I13 A;  2EMH A;  2EM3 A;  2YTJ A;  2WBU A;  4F6M A;  3MHH C;  2EOM A;  1UN6 B;  4R2C A;  2YU5 A;  2EM0 A;  2EMK A;  4R2Q A;  1YUI A;  2WCC 3;  1P47 A;  1X3C A;  5KL7 A;  1A1G A;  2E72 A;  2EM8 A;  5KL6 A;  3EPK A;  1YSA C;  1X5W A;  2JPA A;  2ELZ A;  5KL5 A;  5KL2 A;  2EN4 A;  2YTI A;  2EMZ A;  2A25 A;  1UBD C;  2EM6 A;  2EPU A;  1NCS A;  2JP9 A;  2EOO A;  1Z1B A;  2EMX A;  2ENA A;  2EQ1 A;  4M9V C;  2EN7 A;  2EPC A;  2EMA A;  1ZR9 A;  1X6H A;  2EML A;  3EPL A;  2EN1 A;  2R1F A;  5KL3 A;  2DGC A;  4X9J A;  2MDG A;  1KJK A;  2YSO A;  2DLK A;  4IJD A;  4R2A A;  2EN3 A;  2J7J A;  1WJP A;  4R2D A;  1A1I A;  1G2F C;  2YTN A;  2EQ3 A;  2GHF A;  5KL4 A;  2RPC A;  2DMI A;  2YTE A;  4WSG A;  2EPR A;  4R2E A;  2YU8 A;  1TF6 A;  2EM4 A;  4R2R A;  2EL6 A;  2YRK A;  2EJ4 A;  2EMG A;  2EPX A;  2DLQ A;  2PRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...