4R2AA

Egr1/zif268 zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early growth response protein 1
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2aA00
2EPZA 2EMIA 2EOYA 2EPRA 2ELZA 2EPXA 2EORA 1YUIA 2EPAA 1F2IG 1A1IA 2ELYA 2EN6A 2BB8A 2YTOA 5KL3A 1X3CA 1X6HA 2EN1A 1WJPA 2MDGA 2LCEA 1TF3A 2DGCA 2EOOA 2EM6A 1B69A 4R2QA 2DLQA 1X5WA 2EM5A 2EM2A 2EL5A 2LO3A 2EMFA 4IS1C 2HGHA 2JPAA 2MKDA 2WBTA 2EM0A 2M9AA 2YTPA 1ZU1A 1A1JA 1YSAC 2ENAA 4R2EA 4R2DA 1A1FA 1G2FC 2EOIA 2EM7A 2LT7A 4F6MA 2A25A 1JK1A 4R2AA 2CSHA 2ADRA 4FK5C 2YTFA 4F6NA 2PRTA 2EMAA 2YU5A 5KL6A 2EOJA 4IJDA 2EMYA 2ENCA 2RSIA 2JP9A 2RPCA 2CTDA 1YUJA 2YSPA 1A1HA 2EN3A 2YTGA 1AAYA 1LLMC 2EN4A 4GZNC 1JK2A 2EN2A 3MHHC 3M99B 3MHSC 2GLIA 2LV2A 2EQ0A 5KL5A 2EMHA 4WSGA 4M9VC 1UN6B 2YTQA 2EOSA 1A1KA 1G2DC 2EP3A 2EL6A 2EOFA 5KL7A 3EPLA 2NABA 2WCC3 4R2RA 2EOHA 1UBDC 1X6FA 2EM4A 2EPUA 2YTEA 2ENHA 3EPKA 1P47A 1BBOA 2YSOA 2EN8A 2EPPA 2YTIA 2LVHA 2J7JA 2EE8A 2E72A 2EMKA 1ZR9A 2EPCA 1X6EA 2EM9A 2EOZA 2YTNA 2EMXA 2YTJA 4X9JA 3VHTB 1MEYC 5KL2A 1A1GA 2EJ4A 1A1LA 2EL4A 2DLKA 3EPJA 2EOEA 2YRKA 2YU8A 1NCSA 1TN9A 2EOQA 2EMBA 1TF6A 2EN7A 4R2CA 2EMLA 2EMWA 2MKNA 1KJKA 2EOMA 1ZAAC 2WBUA 2YTDA 2WBSA 2DMIA 2GHFA 2EMCA 2EMZA 4R2PA 1Z1BA 1DGCA 2EQ3A 1RMDA 2EMGA 2CT1A 2YRMA 4F2JC 2R1FA 4R2SA 2EM8A 3UK3C 2EQ1A 2D9HA 2YRHA 1BB8A 5KL4A 2EM3A 2I13A 2DRPA 2EOXA 3EPHA 2VRDA
chains in the Genus database with same CATH superfamily
4OOGC 4R03A 5IT9C 4DMIA 4F54A 4DV6E 2YWQA 2EPAA 2EN6A 3BIDA 1IQOA 1X3CA 1X6HA 2H36X 2LTRA 2DMYA 2LCEA 1GTKA 2DGCA 1XMQE 2EOOA 4X62E 1X5WA 2EL5A 2LO3A 1EH7A 4IS1C 5A2QC 2HGHA 2JPAA 2WBTA 5A6AA 4DUZE 5IWAE 1UILA 2KHXA 1G2FC 4R2DA 2EOIA 2EM7A 5FLXC 2LT7A 4DV4E 4M0VA 3H09A 1XMOE 2ADRA 1L4SA 4FK5C 2PRTA 2NUFA 2RTXA 2EOJA 2ENCA 4KZSA 3ADIA 4NXNE 2V83A 2RPCA 1YUJA 2YSPA 1XNQE 1LLMC 2FTXB 4AQYE 2EPOA 2EN2A 4RH8A 1STUA 4X65E 2K4VA 3VYYA 2EQ0A 5KL5A 2B9DA 2EMHA 1UN6B 4O4KA 4B3RE 1IMUA 2EL6A 5KL7A 3EPLA 1QNTA 2B3TB 5T6JA 2L8TA 1P47A 4O5GA 2DSYA 1ZR9A 2FV4B 2EPCA 1X6EA 1EH6A 3JAMC 2EMXA 2YTJA 3VHTB 1MEYC 5KL2A 5IXMB 4BCAA 2DLKA 4BHBA 2VQFE 2YRKA 2EWLA 1IBME 2L2KB 2EMBA 4HEIA 2E1MA 4NXME 1I94E 2K7IA 2JR1A 2EMWA 1KJKA 5AE1A 4DV3E 1N3GA 1DGCA 2EMCA 2EMZA 3HXLA 2EQ3A 3T1HE 2CT1A 2NA2A 2YRMA 1QU6A 2R1FA 2R76A 2EM8A 3DF6A 1EH8A 5AC4A 1UHZA 4JI7E 1N32E 1FKAE 2L6MA 1YYOA 2DRPA 4JV5E 5LMUE 3EPHA 2EPZA 2EMIA 2EOYA 2EPNA 2JYAA 1A1IA 1FJGE 4X64E 1XNRE 4LU9A 4YHHE 2EN1A 2G7HA 4O24A 2N8XA 3K6QA 1B69A 2DLQA 2EM5A 2LUPB 5A6BD 2LJUA 2M9AA 1SR9A 4DV7E 2LRSA 4MLQA 4JI4E 2F4VE 4DV5E 4F9AB 1X48A 4JI2E 3BGHA 2EMAA 1PDAA 2YU5A 5A69A 5KL6A 4TUIA 4LTYA 4L8NA 4HTGA 2VF1A 1T38A 2JXPA 4WFTA 5AE3A 4TUGA 2JP9A 2CTDA 3T1YE 1PJTA 4R8OA 2YTGA 3VK6A 1HNXE 3KZYA 3M99B 2GLIA 1AH5A 4M9VC 3ECRA 2YTQA 4ZYHA 3MSWA 1G2DC 3OTOE 1T4OA 2NABA 4R2RA 4BC9A 4B3ME 3HQ1A 5A6JA 4P7DA 1X6FA 3BBGA 2V87A 4GEQB 2YSOA 4DR1E 3JTZA 3KZZA 4WSPA 2UUBE 4KWYA 2EMKA 3J81C 1WXRA 4DV0E 4DR5E 2UXCE 2YT4A 1IQSA 2WZOA 4BS9A 5LLQA 4JI0E 3C4BA 1A1GA 1A1LA 1IBLE 3KWRA 4ZYDA 4BC7A 2EL4A 1RC7A 2EPKX 3RMPA 2EPMX 2YU8A 1NCSA 1TN9A 2HC5A 4DR7E 2EOQA 4BBYA 4R2CA 5F3WA 2EMLA 2MKNA 4NHRA 3J7Yp 4F9CB 4Q35B 2DMIA 2GHFA 1Z1BA 2NUEA 3IWCA 2JY9A 3IWDA 4LF8E 1RQ0A 2D9HA 2YRHA 1O0WA 1BB8A 4KHPE 2EM3A 2LBSB 3OMLA 1X47A 2MDRA 2EOXA 4JI1E 1PJSA 4JYAE 2ELZA 2ELYA 5IV8B 2BB8A 4B3SE 2YTOA 2YPNA 5KL3A 4DR4E 1N36E 1WJPA 3QG5C 3THNA 2L3CA 4BMJA 4K0KE 4R2QA 2EM2A 5AASA 2EMFA 2B7TA 2MKDA 4M30A 2EM0A 2YTPA 3ZOQB 2DB2A 2V88A 1IBKE 2ODRD 1A1JA 4GKJE 2ENAA 1A1FA 2NUGA 5LL6R 2ZM6E 2A25A 2CSHA 4Q28A 4BHCA 2YTFA 3THOB 4DR3E 1HR0E 3JU0A 4LF5E 1T4NA 4L5NC 4IJDA 3LMLA 2EMYA 2RSIA 4WXDA 3AUZA 1PKPA 3L00A 1AAYA 2UXBE 3ADGA 4B3TE 2EN4A 3C4TA 2I9IA 4F9BB 5ADZA 4GZNC 5DNYA 1T39A 4JI5E 3MHHC 2L3JA 4LFAE 2L92A 4JI3E 2MC6A 2LV2A 4WX9A 1KYQA 4GKKE 4WSGA 1A1KA 2EP3A 4LF6E 2HHHE 2LJHA 2GPIA 3TQMA 2B7VA 2EPUA 3EPKA 2ENHA 4DR2E 2YZTA 4DV1E 1DI2A 2EN8A 3J80C 2J7JA 5AC5A 2E5LE 2EE8A 2E72A 2UUAE 2V86A 2Q8UA 4JI6E 4LF9E 1MGTA 3HPZA 3F6HA 1N33E 1WRJA 2JVAA 2LE2A 4X9JA 3VYXA 1HNZE 2EZ6A 3HPSA 3C6MA 1TF6A 2EN7A 2V85A 3EQ1A 2YTDA 2RS7A 4ZYGA 4R2PA 4WPYA 1ZBTA 1RMDA 4F2JC 1ZBQA 4R2SA 4RHBB 5CFFE 1N34E 3UK3C 2I13A 4LFBE 4X8WA 1J26A 2EPLX 2VRDA 1NEIA 3F6GA 2EPRA 2EPXA 2EORA 2JOXA 1YUIA 5BR8E 1F2IG 3J7AG 4DV2E 2M4IA 2MDGA 1PJQA 2LUQA 5LMNE 1TF3A 2KOUA 2EM6A 4DKKA 4X66E 1YYWA 5A6KA 2JWOA 1WHQA 4WXCA 3P1XA 1ZU1A 1YSAC 4R2EA 4F6MA 1JK1A 4R2AA 4YY3E 3IWBA 4ZYEA 2M1SA 2JOBA 4F6NA 4LF7E 5A6BA 1YPNA 4DR6E 1SFEA 2RQLA 2N3GA 2V8QB 4O43A 1A1HA 2EN3A 2ODRC 1YZ9A 1JK2A 1X49A 2RS6A 1T4LB 4DUYE 2LMZA 3MHSC 4JI8E 2EOSA 4P78A 2KONA 1YFHA 2HJJA 4WYQB 2EOFA 2WCC3 2L33A 3HTXA 2VE7C 2BBGA 2EOHA 2UXDE 1UBDC 2EM4A 5TSEA 2YTEA 1YYKA 1BBOA 3C6KA 2EPPA 1HNWE 2CPNA 1DQ3A 2LVHA 2YTIA 4MLVA 2F8BA 2VQEE 2EM9A 4LFCE 2EOZA 2L2NA 2YTNA 4OX9E 2M7QA 4I8OA 1GQEA 2MC5A 3ADJA 2V89A 2EJ4A 1J5EE 1GZ6A 1WHNA 2L2MA 3EPJA 2EOEA 2IHR1 2N3HA 2FGGA 2EOMA 1ZAAC 2WBUA 2WBSA 3LLHA 4LF4E 2EMGA 2LTSA 5AE2A 2UUCE 4J8ZA 3AV0A 1EKZA 2EQ1A 3BF2A 2UU9E 3DJWA 3FIGA 1BBGA 2RSMA 5KL4A 4M2ZA 4NZVA 4N4RB 3ADLA 2DIXA
chains in the Genus database with same CATH topology
2EPZA 2EMIA 2EOYA 2EPRA 2ELZA 2EPXA 2EORA 1YUIA 2EPAA 1F2IG 1A1IA 2ELYA 2EN6A 2BB8A 2YTOA 5KL3A 1X3CA 1X6HA 2EN1A 1WJPA 2MDGA 2LCEA 1TF3A 2DGCA 2EOOA 2EM6A 1B69A 4R2QA 2DLQA 1X5WA 2EM5A 2EM2A 2EL5A 2LO3A 2EMFA 4IS1C 2HGHA 2JPAA 2MKDA 2WBTA 2EM0A 2M9AA 2YTPA 1ZU1A 1A1JA 1YSAC 2ENAA 4R2EA 4R2DA 1A1FA 1G2FC 2EOIA 2EM7A 2LT7A 4F6MA 2A25A 1JK1A 4R2AA 2CSHA 2ADRA 4FK5C 2YTFA 4F6NA 2PRTA 2EMAA 2YU5A 5KL6A 2EOJA 4IJDA 2EMYA 2ENCA 2RSIA 2JP9A 2RPCA 2CTDA 1YUJA 2YSPA 1A1HA 2EN3A 2YTGA 1AAYA 1LLMC 2EN4A 4GZNC 1JK2A 2EN2A 3MHHC 3M99B 3MHSC 2GLIA 2LV2A 2EQ0A 5KL5A 2EMHA 4WSGA 4M9VC 1UN6B 2YTQA 2EOSA 1A1KA 1G2DC 2EP3A 2EL6A 2EOFA 5KL7A 3EPLA 2NABA 2WCC3 4R2RA 2EOHA 1UBDC 1X6FA 2EM4A 2EPUA 2YTEA 2ENHA 3EPKA 1P47A 1BBOA 2YSOA 2EN8A 2EPPA 2YTIA 2LVHA 2J7JA 2EE8A 2E72A 2EMKA 1ZR9A 2EPCA 1X6EA 2EM9A 2EOZA 2YTNA 2EMXA 2YTJA 4X9JA 3VHTB 1MEYC 5KL2A 1A1GA 2EJ4A 1A1LA 2EL4A 2DLKA 3EPJA 2EOEA 2YRKA 2YU8A 1NCSA 1TN9A 2EOQA 2EMBA 1TF6A 2EN7A 4R2CA 2EMLA 2EMWA 2MKNA 1KJKA 2EOMA 1ZAAC 2WBUA 2YTDA 2WBSA 2DMIA 2GHFA 2EMCA 2EMZA 4R2PA 1Z1BA 1DGCA 2EQ3A 1RMDA 2EMGA 2CT1A 2YRMA 4F2JC 2R1FA 4R2SA 2EM8A 3UK3C 2EQ1A 2D9HA 2YRHA 1BB8A 5KL4A 2EM3A 2I13A 2DRPA 2EOXA 3EPHA 2VRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPZ A;  2EMI A;  2EOY A;  2EPR A;  2ELZ A;  2EPX A;  2EOR A;  1YUI A;  2EPA A;  1F2I G;  1A1I A;  2ELY A;  2EN6 A;  2BB8 A;  2YTO A;  5KL3 A;  1X3C A;  1X6H A;  2EN1 A;  1WJP A;  2MDG A;  2LCE A;  1TF3 A;  2DGC A;  2EOO A;  2EM6 A;  1B69 A;  4R2Q A;  2DLQ A;  1X5W A;  2EM5 A;  2EM2 A;  2EL5 A;  2LO3 A;  2EMF A;  4IS1 C;  2HGH A;  2JPA A;  2MKD A;  2WBT A;  2EM0 A;  2M9A A;  2YTP A;  1ZU1 A;  1A1J A;  1YSA C;  2ENA A;  4R2E A;  4R2D A;  1A1F A;  1G2F C;  2EOI A;  2EM7 A;  2LT7 A;  4F6M A;  2A25 A;  1JK1 A;  4R2A A;  2CSH A;  2ADR A;  4FK5 C;  2YTF A;  4F6N A;  2PRT A;  2EMA A;  2YU5 A;  5KL6 A;  2EOJ A;  4IJD A;  2EMY A;  2ENC A;  2RSI A;  2JP9 A;  2RPC A;  2CTD A;  1YUJ A;  2YSP A;  1A1H A;  2EN3 A;  2YTG A;  1AAY A;  1LLM C;  2EN4 A;  4GZN C;  1JK2 A;  2EN2 A;  3MHH C;  3M99 B;  3MHS C;  2GLI A;  2LV2 A;  2EQ0 A;  5KL5 A;  2EMH A;  4WSG A;  4M9V C;  1UN6 B;  2YTQ A;  2EOS A;  1A1K A;  1G2D C;  2EP3 A;  2EL6 A;  2EOF A;  5KL7 A;  3EPL A;  2NAB A;  2WCC 3;  4R2R A;  2EOH A;  1UBD C;  1X6F A;  2EM4 A;  2EPU A;  2YTE A;  2ENH A;  3EPK A;  1P47 A;  1BBO A;  2YSO A;  2EN8 A;  2EPP A;  2YTI A;  2LVH A;  2J7J A;  2EE8 A;  2E72 A;  2EMK A;  1ZR9 A;  2EPC A;  1X6E A;  2EM9 A;  2EOZ A;  2YTN A;  2EMX A;  2YTJ A;  4X9J A;  3VHT B;  1MEY C;  5KL2 A;  1A1G A;  2EJ4 A;  1A1L A;  2EL4 A;  2DLK A;  3EPJ A;  2EOE A;  2YRK A;  2YU8 A;  1NCS A;  1TN9 A;  2EOQ A;  2EMB A;  1TF6 A;  2EN7 A;  4R2C A;  2EML A;  2EMW A;  2MKN A;  1KJK A;  2EOM A;  1ZAA C;  2WBU A;  2YTD A;  2WBS A;  2DMI A;  2GHF A;  2EMC A;  2EMZ A;  4R2P A;  1Z1B A;  1DGC A;  2EQ3 A;  1RMD A;  2EMG A;  2CT1 A;  2YRM A;  4F2J C;  2R1F A;  4R2S A;  2EM8 A;  3UK3 C;  2EQ1 A;  2D9H A;  2YRH A;  1BB8 A;  5KL4 A;  2EM3 A;  2I13 A;  2DRP A;  2EOX A;  3EPH A;  2VRD A; 
#chains in the Genus database with same CATH topology
 4OOG C;  4R03 A;  5IT9 C;  4DMI A;  4F54 A;  4DV6 E;  2YWQ A;  2EPA A;  2EN6 A;  3BID A;  1IQO A;  1X3C A;  1X6H A;  2H36 X;  2LTR A;  2DMY A;  2LCE A;  1GTK A;  2DGC A;  1XMQ E;  2EOO A;  4X62 E;  1X5W A;  2EL5 A;  2LO3 A;  1EH7 A;  4IS1 C;  5A2Q C;  2HGH A;  2JPA A;  2WBT A;  5A6A A;  4DUZ E;  5IWA E;  1UIL A;  2KHX A;  1G2F C;  4R2D A;  2EOI A;  2EM7 A;  5FLX C;  2LT7 A;  4DV4 E;  4M0V A;  3H09 A;  1XMO E;  2ADR A;  1L4S A;  4FK5 C;  2PRT A;  2NUF A;  2RTX A;  2EOJ A;  2ENC A;  4KZS A;  3ADI A;  4NXN E;  2V83 A;  2RPC A;  1YUJ A;  2YSP A;  1XNQ E;  1LLM C;  2FTX B;  4AQY E;  2EPO A;  2EN2 A;  4RH8 A;  1STU A;  4X65 E;  2K4V A;  3VYY A;  2EQ0 A;  5KL5 A;  2B9D A;  2EMH A;  1UN6 B;  4O4K A;  4B3R E;  1IMU A;  2EL6 A;  5KL7 A;  3EPL A;  1QNT A;  2B3T B;  5T6J A;  2L8T A;  1P47 A;  4O5G A;  2DSY A;  1ZR9 A;  2FV4 B;  2EPC A;  1X6E A;  1EH6 A;  3JAM C;  2EMX A;  2YTJ A;  3VHT B;  1MEY C;  5KL2 A;  5IXM B;  4BCA A;  2DLK A;  4BHB A;  2VQF E;  2YRK A;  2EWL A;  1IBM E;  2L2K B;  2EMB A;  4HEI A;  2E1M A;  4NXM E;  1I94 E;  2K7I A;  2JR1 A;  2EMW A;  1KJK A;  5AE1 A;  4DV3 E;  1N3G A;  1DGC A;  2EMC A;  2EMZ A;  3HXL A;  2EQ3 A;  3T1H E;  2CT1 A;  2NA2 A;  2YRM A;  1QU6 A;  2R1F A;  2R76 A;  2EM8 A;  3DF6 A;  1EH8 A;  5AC4 A;  1UHZ A;  4JI7 E;  1N32 E;  1FKA E;  2L6M A;  1YYO A;  2DRP A;  4JV5 E;  5LMU E;  3EPH A;  2EPZ A;  2EMI A;  2EOY A;  2EPN A;  2JYA A;  1A1I A;  1FJG E;  4X64 E;  1XNR E;  4LU9 A;  4YHH E;  2EN1 A;  2G7H A;  4O24 A;  2N8X A;  3K6Q A;  1B69 A;  2DLQ A;  2EM5 A;  2LUP B;  5A6B D;  2LJU A;  2M9A A;  1SR9 A;  4DV7 E;  2LRS A;  4MLQ A;  4JI4 E;  2F4V E;  4DV5 E;  4F9A B;  1X48 A;  4JI2 E;  3BGH A;  2EMA A;  1PDA A;  2YU5 A;  5A69 A;  5KL6 A;  4TUI A;  4LTY A;  4L8N A;  4HTG A;  2VF1 A;  1T38 A;  2JXP A;  4WFT A;  5AE3 A;  4TUG A;  2JP9 A;  2CTD A;  3T1Y E;  1PJT A;  4R8O A;  2YTG A;  3VK6 A;  1HNX E;  3KZY A;  3M99 B;  2GLI A;  1AH5 A;  4M9V C;  3ECR A;  2YTQ A;  4ZYH A;  3MSW A;  1G2D C;  3OTO E;  1T4O A;  2NAB A;  4R2R A;  4BC9 A;  4B3M E;  3HQ1 A;  5A6J A;  4P7D A;  1X6F A;  3BBG A;  2V87 A;  4GEQ B;  2YSO A;  4DR1 E;  3JTZ A;  3KZZ A;  4WSP A;  2UUB E;  4KWY A;  2EMK A;  3J81 C;  1WXR A;  4DV0 E;  4DR5 E;  2UXC E;  2YT4 A;  1IQS A;  2WZO A;  4BS9 A;  5LLQ A;  4JI0 E;  3C4B A;  1A1G A;  1A1L A;  1IBL E;  3KWR A;  4ZYD A;  4BC7 A;  2EL4 A;  1RC7 A;  2EPK X;  3RMP A;  2EPM X;  2YU8 A;  1NCS A;  1TN9 A;  2HC5 A;  4DR7 E;  2EOQ A;  4BBY A;  4R2C A;  5F3W A;  2EML A;  2MKN A;  4NHR A;  3J7Y p;  4F9C B;  4Q35 B;  2DMI A;  2GHF A;  1Z1B A;  2NUE A;  3IWC A;  2JY9 A;  3IWD A;  4LF8 E;  1RQ0 A;  2D9H A;  2YRH A;  1O0W A;  1BB8 A;  4KHP E;  2EM3 A;  2LBS B;  3OML A;  1X47 A;  2MDR A;  2EOX A;  4JI1 E;  1PJS A;  4JYA E;  2ELZ A;  2ELY A;  5IV8 B;  2BB8 A;  4B3S E;  2YTO A;  2YPN A;  5KL3 A;  4DR4 E;  1N36 E;  1WJP A;  3QG5 C;  3THN A;  2L3C A;  4BMJ A;  4K0K E;  4R2Q A;  2EM2 A;  5AAS A;  2EMF A;  2B7T A;  2MKD A;  4M30 A;  2EM0 A;  2YTP A;  3ZOQ B;  2DB2 A;  2V88 A;  1IBK E;  2ODR D;  1A1J A;  4GKJ E;  2ENA A;  1A1F A;  2NUG A;  5LL6 R;  2ZM6 E;  2A25 A;  2CSH A;  4Q28 A;  4BHC A;  2YTF A;  3THO B;  4DR3 E;  1HR0 E;  3JU0 A;  4LF5 E;  1T4N A;  4L5N C;  4IJD A;  3LML A;  2EMY A;  2RSI A;  4WXD A;  3AUZ A;  1PKP A;  3L00 A;  1AAY A;  2UXB E;  3ADG A;  4B3T E;  2EN4 A;  3C4T A;  2I9I A;  4F9B B;  5ADZ A;  4GZN C;  5DNY A;  1T39 A;  4JI5 E;  3MHH C;  2L3J A;  4LFA E;  2L92 A;  4JI3 E;  2MC6 A;  2LV2 A;  4WX9 A;  1KYQ A;  4GKK E;  4WSG A;  1A1K A;  2EP3 A;  4LF6 E;  2HHH E;  2LJH A;  2GPI A;  3TQM A;  2B7V A;  2EPU A;  3EPK A;  2ENH A;  4DR2 E;  2YZT A;  4DV1 E;  1DI2 A;  2EN8 A;  3J80 C;  2J7J A;  5AC5 A;  2E5L E;  2EE8 A;  2E72 A;  2UUA E;  2V86 A;  2Q8U A;  4JI6 E;  4LF9 E;  1MGT A;  3HPZ A;  3F6H A;  1N33 E;  1WRJ A;  2JVA A;  2LE2 A;  4X9J A;  3VYX A;  1HNZ E;  2EZ6 A;  3HPS A;  3C6M A;  1TF6 A;  2EN7 A;  2V85 A;  3EQ1 A;  2YTD A;  2RS7 A;  4ZYG A;  4R2P A;  4WPY A;  1ZBT A;  1RMD A;  4F2J C;  1ZBQ A;  4R2S A;  4RHB B;  5CFF E;  1N34 E;  3UK3 C;  2I13 A;  4LFB E;  4X8W A;  1J26 A;  2EPL X;  2VRD A;  1NEI A;  3F6G A;  2EPR A;  2EPX A;  2EOR A;  2JOX A;  1YUI A;  5BR8 E;  1F2I G;  3J7A G;  4DV2 E;  2M4I A;  2MDG A;  1PJQ A;  2LUQ A;  5LMN E;  1TF3 A;  2KOU A;  2EM6 A;  4DKK A;  4X66 E;  1YYW A;  5A6K A;  2JWO A;  1WHQ A;  4WXC A;  3P1X A;  1ZU1 A;  1YSA C;  4R2E A;  4F6M A;  1JK1 A;  4R2A A;  4YY3 E;  3IWB A;  4ZYE A;  2M1S A;  2JOB A;  4F6N A;  4LF7 E;  5A6B A;  1YPN A;  4DR6 E;  1SFE A;  2RQL A;  2N3G A;  2V8Q B;  4O43 A;  1A1H A;  2EN3 A;  2ODR C;  1YZ9 A;  1JK2 A;  1X49 A;  2RS6 A;  1T4L B;  4DUY E;  2LMZ A;  3MHS C;  4JI8 E;  2EOS A;  4P78 A;  2KON A;  1YFH A;  2HJJ A;  4WYQ B;  2EOF A;  2WCC 3;  2L33 A;  3HTX A;  2VE7 C;  2BBG A;  2EOH A;  2UXD E;  1UBD C;  2EM4 A;  5TSE A;  2YTE A;  1YYK A;  1BBO A;  3C6K A;  2EPP A;  1HNW E;  2CPN A;  1DQ3 A;  2LVH A;  2YTI A;  4MLV A;  2F8B A;  2VQE E;  2EM9 A;  4LFC E;  2EOZ A;  2L2N A;  2YTN A;  4OX9 E;  2M7Q A;  4I8O A;  1GQE A;  2MC5 A;  3ADJ A;  2V89 A;  2EJ4 A;  1J5E E;  1GZ6 A;  1WHN A;  2L2M A;  3EPJ A;  2EOE A;  2IHR 1;  2N3H A;  2FGG A;  2EOM A;  1ZAA C;  2WBU A;  2WBS A;  3LLH A;  4LF4 E;  2EMG A;  2LTS A;  5AE2 A;  2UUC E;  4J8Z A;  3AV0 A;  1EKZ A;  2EQ1 A;  3BF2 A;  2UU9 E;  3DJW A;  3FIG A;  1BBG A;  2RSM A;  5KL4 A;  4M2Z A;  4NZV A;  4N4R B;  3ADL A;  2DIX A; 
#chains in the Genus database with same CATH homology
 2EPZ A;  2EMI A;  2EOY A;  2EPR A;  2ELZ A;  2EPX A;  2EOR A;  1YUI A;  2EPA A;  1F2I G;  1A1I A;  2ELY A;  2EN6 A;  2BB8 A;  2YTO A;  5KL3 A;  1X3C A;  1X6H A;  2EN1 A;  1WJP A;  2MDG A;  2LCE A;  1TF3 A;  2DGC A;  2EOO A;  2EM6 A;  1B69 A;  4R2Q A;  2DLQ A;  1X5W A;  2EM5 A;  2EM2 A;  2EL5 A;  2LO3 A;  2EMF A;  4IS1 C;  2HGH A;  2JPA A;  2MKD A;  2WBT A;  2EM0 A;  2M9A A;  2YTP A;  1ZU1 A;  1A1J A;  1YSA C;  2ENA A;  4R2E A;  4R2D A;  1A1F A;  1G2F C;  2EOI A;  2EM7 A;  2LT7 A;  4F6M A;  2A25 A;  1JK1 A;  4R2A A;  2CSH A;  2ADR A;  4FK5 C;  2YTF A;  4F6N A;  2PRT A;  2EMA A;  2YU5 A;  5KL6 A;  2EOJ A;  4IJD A;  2EMY A;  2ENC A;  2RSI A;  2JP9 A;  2RPC A;  2CTD A;  1YUJ A;  2YSP A;  1A1H A;  2EN3 A;  2YTG A;  1AAY A;  1LLM C;  2EN4 A;  4GZN C;  1JK2 A;  2EN2 A;  3MHH C;  3M99 B;  3MHS C;  2GLI A;  2LV2 A;  2EQ0 A;  5KL5 A;  2EMH A;  4WSG A;  4M9V C;  1UN6 B;  2YTQ A;  2EOS A;  1A1K A;  1G2D C;  2EP3 A;  2EL6 A;  2EOF A;  5KL7 A;  3EPL A;  2NAB A;  2WCC 3;  4R2R A;  2EOH A;  1UBD C;  1X6F A;  2EM4 A;  2EPU A;  2YTE A;  2ENH A;  3EPK A;  1P47 A;  1BBO A;  2YSO A;  2EN8 A;  2EPP A;  2YTI A;  2LVH A;  2J7J A;  2EE8 A;  2E72 A;  2EMK A;  1ZR9 A;  2EPC A;  1X6E A;  2EM9 A;  2EOZ A;  2YTN A;  2EMX A;  2YTJ A;  4X9J A;  3VHT B;  1MEY C;  5KL2 A;  1A1G A;  2EJ4 A;  1A1L A;  2EL4 A;  2DLK A;  3EPJ A;  2EOE A;  2YRK A;  2YU8 A;  1NCS A;  1TN9 A;  2EOQ A;  2EMB A;  1TF6 A;  2EN7 A;  4R2C A;  2EML A;  2EMW A;  2MKN A;  1KJK A;  2EOM A;  1ZAA C;  2WBU A;  2YTD A;  2WBS A;  2DMI A;  2GHF A;  2EMC A;  2EMZ A;  4R2P A;  1Z1B A;  1DGC A;  2EQ3 A;  1RMD A;  2EMG A;  2CT1 A;  2YRM A;  4F2J C;  2R1F A;  4R2S A;  2EM8 A;  3UK3 C;  2EQ1 A;  2D9H A;  2YRH A;  1BB8 A;  5KL4 A;  2EM3 A;  2I13 A;  2DRP A;  2EOX A;  3EPH A;  2VRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...