4R2AA

Egr1/zif268 zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Early growth response protein 1
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2aA00
2YSPA 2EN4A 2EP3A 2HGHA 2DRPA 1X5WA 5KL5A 1X6EA 1X6HA 5KL2A 2EL6A 2EN8A 2R1FA 4R2QA 4X9JA 2NABA 3MHSC 4R2EA 4M9VC 2YU5A 4F2JC 3MHHC 4IJDA 2EPXA 2EN3A 1YUIA 2JP9A 2WBTA 2EPZA 2EN1A 4R2CA 2EM0A 1ZAAC 1G2DC 1G2FC 1DGCA 3VHTB 4IS1C 4R2SA 1YUJA 2EMZA 2EM3A 2JPAA 1TN9A 2M9AA 5KL7A 2EOZA 4R2DA 2ADRA 2YTOA 2EM8A 1UBDC 2YTPA 2LT7A 2EJ4A 2EMXA 1X6FA 2EM9A 2EOHA 3EPKA 2RSIA 2CTDA 2YRMA 2YRHA 1X3CA 2EMGA 1AAYA 2LV2A 1Z1BA 2DMIA 2EM4A 2EMFA 2VRDA 2EQ0A 2LVHA 2MKDA 1A1JA 1A1LA 2EOYA 2EE8A 2EM2A 2DGCA 1A1KA 4WSGA 1JK1A 1A1FA 2EOSA 2E72A 2YRKA 1UN6B 2D9HA 2MDGA 2EOXA 2MKNA 2EN2A 2GLIA 2EPCA 2EMYA 2EM5A 1BBOA 2A25A 3EPLA 1YSAC 2EM6A 2ENCA 1NCSA 1MEYC 1P47A 2EPRA 4R2PA 1WJPA 2EMKA 2ENHA 2LO3A 5KL4A 2ENAA 2YTGA 1B69A 2EOFA 2CT1A 2EMBA 3UK3C 2YU8A 1LLMC 2EL4A 2I13A 2EM7A 2YTFA 4FK5C 2DLKA 2EOOA 2EPPA 1JK2A 2EOIA 1RMDA 2EPAA 2PRTA 2J7JA 1ZU1A 3M99B 2EMAA 4F6NA 4R2AA 2LCEA 2YTQA 5KL3A 4F6MA 1A1IA 2WBSA 1A1HA 5KL6A 2RPCA 2YTIA 1TF6A 1KJKA 2YTDA 2EMLA 2EPUA 2EL5A 2EMWA 2CSHA 2EQ1A 1BB8A 2GHFA 2EQ3A 2EOJA 4GZNC 2EOEA 2YTJA 2EOQA 2YTEA 2EN6A 2YTNA 3EPJA 2EMHA 1ZR9A 2ELZA 1A1GA 2DLQA 4R2RA 1F2IG 1TF3A 2BB8A 2WCC3 2EN7A 2WBUA 2EOMA 3EPHA 2YSOA 2EORA 2EMIA 2EMCA 2ELYA
chains in the Genus database with same CATH superfamily
4O43A 3KWRA 4MLQA 2L8TA 2YSPA 2DRPA 3QG5C 1X5WA 2M7QA 2RSMA 5KL2A 4JI6E 2EL6A 2EN8A 2E1MA 4X65E 2L2KB 3C6KA 4NXNE 2DSYA 4X9JA 4R2QA 2HHHE 4M9VC 2UUAE 1YYWA 4JI3E 2V83A 4IJDA 4B3ME 2EN1A 1HR0E 4R2CA 4DV7E 2B9DA 5A6BA 3JAMC 1G2FC 3J81C 1DGCA 4DR7E 3OTOE 4BHCA 4LF7E 2UXCE 2EOZA 2ADRA 4RHBB 2EM8A 2DB2A 4DKKA 1UBDC 1FKAE 2B7TA 2VQEE 4M30A 2BBGA 4JI1E 2CTDA 2YRMA 1AH5A 2EMGA 2R76A 3THOB 4ZYGA 4LTYA 1AAYA 2YPNA 1PJSA 1DI2A 1Z1BA 2LTSA 3J80C 3KZYA 2EM4A 4R8OA 4KZSA 2EMFA 4BC7A 1UILA 4DV2E 4JI7E 4WXCA 1IBME 4JV5E 5IXMB 1JK1A 2E72A 5FLXC 4RH8A 2EN2A 2EPCA 1EH6A 4X62E 3OMLA 1XMQE 4F9AB 4LF4E 1YSAC 2RS6A 1I94E 4LF5E 5A6JA 2EPRA 2EPOA 3AUZA 4B3SE 2LO3A 4L5NC 5AC5A 1GQEA 4L8NA 1LLMC 2EL4A 4I8OA 2EOIA 4Q35B 2JY9A 2JWOA 3K6QA 4F6NA 1EKZA 1WXRA 4R2AA 4NHRA 2JOXA 5KL3A 3ADLA 2WBSA 1A1HA 2RPCA 1ZBQA 1TF6A 1N36E 2EMWA 4DR5E 1HNZE 2EQ1A 5IT9C 5A2QC 2EOQA 2YTNA 4GEQB 2EMHA 2ELZA 4LFBE 2JYAA 1X47A 4ZYEA 2YTQA 4DV0E 4DV6E 5CFFE 2HGHA 2NUFA 2V8QB 3C4BA 2B7VA 1X49A 4WYQB 2NABA 4JI4E 4LFAE 2LUPB 2YU5A 2N3HA 1XMOE 2EPXA 1YUIA 2WBTA 2EPMX 2N3GA 1ZAAC 3ADGA 4HEIA 2HJJA 4M0VA 4R2SA 2EM3A 2JPAA 4X66E 4BHBA 1N34E 2M9AA 4JI5E 4JI2E 5KL7A 1N32E 2YTOA 3KZZA 2YTPA 2V85A 2V87A 2EJ4A 2EMXA 1T4LB 2LBSB 2RSIA 2M4IA 4OX9E 1QNTA 1PJTA 2UU9E 2DMIA 5DNYA 1EH8A 1WHNA 4YY3E 1A1LA 5AASA 3ADJA 3IWBA 2EE8A 2KOUA 4N4RB 1IBLE 1A1KA 2DGCA 3J7Yp 1UN6B 1A1FA 3VYYA 4WPYA 1YFHA 2MDGA 4AQYE 2MC5A 2GLIA 1EH7A 2EM5A 5A69A 2A25A 3EPLA 1XNQE 1NCSA 2V88A 1MEYC 1SFEA 4R2PA 4MLVA 4LF9E 5KL4A 2YTGA 2CT1A 2H36X 2RTXA 5LL6R 2EM7A 1PKPA 2YTFA 4WFTA 2L6MA 2EPPA 2WZOA 1WHQA 2GPIA 1ZU1A 5T6JA 2EMAA 1YPNA 2LCEA 4ZYHA 1IMUA 1ZBTA 4TUIA 5LMUE 1X48A 2YTIA 1YYKA 1UHZA 2KONA 2EPUA 3HPSA 2FV4B 3HPZA 2EQ3A 2EOEA 1HNXE 4DR3E 2NA2A 3TQMA 2DMYA 2EN6A 4BMJA 2YWQA 2V89A 1F2IG 2L2MA 3J7AG 2EOMA 2ZM6E 2YSOA 2EMIA 3EQ1A 2F8BA 2IHR1 2YT4A 1WRJA 3ECRA 1NEIA 2EMCA 4O4KA 2EPLX 1O0WA 2EN4A 3JTZA 2M1SA 1X6EA 1X6HA 4KWYA 5AC4A 3RMPA 5A6AA 5IV8B 1GZ6A 4B3RE 1RQ0A 3ADIA 4OOGC 4F2JC 1XNRE 2G7HA 2L92A 5A6KA 4BCAA 1PDAA 3MHHC 2EN3A 1FJGE 2JP9A 3C4TA 2VE7C 1YZ9A 2EPZA 2EM0A 3BF2A 3VHTB 4NZVA 1YUJA 3T1HE 1TN9A 4ZYDA 2L2NA 4J8ZA 5LLQA 2MC6A 2LT7A 1YYOA 3IWDA 2EOHA 3EPKA 1PJQA 3HXLA 4P78A 4YHHE 1J26A 2YRHA 4JI8E 2KHXA 1X3CA 3BGHA 3VYXA 2EZ6A 4JYAE 2LV2A 2FGGA 2ODRC 2EQ0A 2MKDA 3FIGA 4WSGA 3HQ1A 2VF1A 2D9HA 2MKNA 4X8WA 3ZOQB 3BBGA 4DR6E 4B3TE 4NXME 1BBOA 2E5LE 2EM6A 2ENCA 2VQFE 1P47A 1T4OA 3JU0A 1WJPA 2EMKA 4LU9A 2ENHA 4GKJE 1T39A 1MGTA 3AV0A 2EMBA 2YU8A 5TSEA 2I13A 3THNA 4DUYE 4FK5C 4BS9A 4DUZE 2I9IA 1DQ3A 2EOOA 2NUEA 4KHPE 4O5GA 2LRSA 1RMDA 2EPAA 5ADZA 2PRTA 5A6BD 5AE2A 2L33A 4DR4E 3IWCA 5BR8E 4F6MA 5KL6A 1KJKA 2YTDA 4DV5E 3DF6A 1BB8A 2YZTA 3EPJA 1ZR9A 4F54A 4DR1E 2DLQA 4R2RA 2WCC3 2ODRD 1BBGA 1HNWE 2EN7A 2WBUA 1RC7A 1IQOA 1T38A 3F6HA 2N8XA 4X64E 3HTXA 2ELYA 1G2DC 3H09A 5F3WA 2EP3A 3VK6A 5KL5A 2EWLA 2JVAA 1N3GA 4O24A 4P7DA 2R1FA 1KYQA 2F4VE 4GKKE 3MHSC 4R2EA 2EPNA 3LLHA 1STUA 4DV4E 2JOBA 5AE3A 4K0KE 4F9CB 3L00A 2RQLA 2UXDE 4IS1C 2LJUA 2EMZA 2Q8UA 2LMZA 4DV3E 3MSWA 1QU6A 4BC9A 4R2DA 1IBKE 4WSPA 1X6FA 2EM9A 2L3CA 2L3JA 1L4SA 3T1YE 2K7IA 3P1XA 2LTRA 5AE1A 2UUBE 2K4VA 2UXBE 4M2ZA 2EPKX 2VRDA 2LVHA 4WXDA 1IQSA 5IWAE 4DV1E 1A1JA 2JR1A 2EOYA 2EM2A 2EOSA 2YRKA 2EOXA 2LUQA 4DMIA 4JI0E 2EMYA 3F6GA 4Q28A 5LMNE 2B3TB 2ENAA 1B69A 2EOFA 4LF6E 3UK3C 4TUGA 2MDRA 4DR2E 2DLKA 1N33E 1JK2A 4LF8E 1J5EE 2J7JA 3M99B 2V86A 4LFCE 1A1IA 2RS7A 2FTXB 2NUGA 2EMLA 2EL5A 2CSHA 2GHFA 4HTGA 2UUCE 2EOJA 4GZNC 2DIXA 2LE2A 2YTJA 2YTEA 1SR9A 4BBYA 2CPNA 1GTKA 2JXPA 3BIDA 1A1GA 1TF3A 2BB8A 4R03A 4WX9A 3DJWA 4F9BB 3EPHA 2EORA 3C6MA 3LMLA 1T4NA 2HC5A 2LJHA
chains in the Genus database with same CATH topology
2YSPA 2EN4A 2EP3A 2HGHA 2DRPA 1X5WA 5KL5A 1X6EA 1X6HA 5KL2A 2EL6A 2EN8A 2R1FA 4R2QA 4X9JA 2NABA 3MHSC 4R2EA 4M9VC 2YU5A 4F2JC 3MHHC 4IJDA 2EPXA 2EN3A 1YUIA 2JP9A 2WBTA 2EPZA 2EN1A 4R2CA 2EM0A 1ZAAC 1G2DC 1G2FC 1DGCA 3VHTB 4IS1C 4R2SA 1YUJA 2EMZA 2EM3A 2JPAA 1TN9A 2M9AA 5KL7A 2EOZA 4R2DA 2ADRA 2YTOA 2EM8A 1UBDC 2YTPA 2LT7A 2EJ4A 2EMXA 1X6FA 2EM9A 2EOHA 3EPKA 2RSIA 2CTDA 2YRMA 2YRHA 1X3CA 2EMGA 1AAYA 2LV2A 1Z1BA 2DMIA 2EM4A 2EMFA 2VRDA 2EQ0A 2LVHA 2MKDA 1A1JA 1A1LA 2EOYA 2EE8A 2EM2A 2DGCA 1A1KA 4WSGA 1JK1A 1A1FA 2EOSA 2E72A 2YRKA 1UN6B 2D9HA 2MDGA 2EOXA 2MKNA 2EN2A 2GLIA 2EPCA 2EMYA 2EM5A 1BBOA 2A25A 3EPLA 1YSAC 2EM6A 2ENCA 1NCSA 1MEYC 1P47A 2EPRA 4R2PA 1WJPA 2EMKA 2ENHA 2LO3A 5KL4A 2ENAA 2YTGA 1B69A 2EOFA 2CT1A 2EMBA 3UK3C 2YU8A 1LLMC 2EL4A 2I13A 2EM7A 2YTFA 4FK5C 2DLKA 2EOOA 2EPPA 1JK2A 2EOIA 1RMDA 2EPAA 2PRTA 2J7JA 1ZU1A 3M99B 2EMAA 4F6NA 4R2AA 2LCEA 2YTQA 5KL3A 4F6MA 1A1IA 2WBSA 1A1HA 5KL6A 2RPCA 2YTIA 1TF6A 1KJKA 2YTDA 2EMLA 2EPUA 2EL5A 2EMWA 2CSHA 2EQ1A 1BB8A 2GHFA 2EQ3A 2EOJA 4GZNC 2EOEA 2YTJA 2EOQA 2YTEA 2EN6A 2YTNA 3EPJA 2EMHA 1ZR9A 2ELZA 1A1GA 2DLQA 4R2RA 1F2IG 1TF3A 2BB8A 2WCC3 2EN7A 2WBUA 2EOMA 3EPHA 2YSOA 2EORA 2EMIA 2EMCA 2ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSP A;  2EN4 A;  2EP3 A;  2HGH A;  2DRP A;  1X5W A;  5KL5 A;  1X6E A;  1X6H A;  5KL2 A;  2EL6 A;  2EN8 A;  2R1F A;  4R2Q A;  4X9J A;  2NAB A;  3MHS C;  4R2E A;  4M9V C;  2YU5 A;  4F2J C;  3MHH C;  4IJD A;  2EPX A;  2EN3 A;  1YUI A;  2JP9 A;  2WBT A;  2EPZ A;  2EN1 A;  4R2C A;  2EM0 A;  1ZAA C;  1G2D C;  1G2F C;  1DGC A;  3VHT B;  4IS1 C;  4R2S A;  1YUJ A;  2EMZ A;  2EM3 A;  2JPA A;  1TN9 A;  2M9A A;  5KL7 A;  2EOZ A;  4R2D A;  2ADR A;  2YTO A;  2EM8 A;  1UBD C;  2YTP A;  2LT7 A;  2EJ4 A;  2EMX A;  1X6F A;  2EM9 A;  2EOH A;  3EPK A;  2RSI A;  2CTD A;  2YRM A;  2YRH A;  1X3C A;  2EMG A;  1AAY A;  2LV2 A;  1Z1B A;  2DMI A;  2EM4 A;  2EMF A;  2VRD A;  2EQ0 A;  2LVH A;  2MKD A;  1A1J A;  1A1L A;  2EOY A;  2EE8 A;  2EM2 A;  2DGC A;  1A1K A;  4WSG A;  1JK1 A;  1A1F A;  2EOS A;  2E72 A;  2YRK A;  1UN6 B;  2D9H A;  2MDG A;  2EOX A;  2MKN A;  2EN2 A;  2GLI A;  2EPC A;  2EMY A;  2EM5 A;  1BBO A;  2A25 A;  3EPL A;  1YSA C;  2EM6 A;  2ENC A;  1NCS A;  1MEY C;  1P47 A;  2EPR A;  4R2P A;  1WJP A;  2EMK A;  2ENH A;  2LO3 A;  5KL4 A;  2ENA A;  2YTG A;  1B69 A;  2EOF A;  2CT1 A;  2EMB A;  3UK3 C;  2YU8 A;  1LLM C;  2EL4 A;  2I13 A;  2EM7 A;  2YTF A;  4FK5 C;  2DLK A;  2EOO A;  2EPP A;  1JK2 A;  2EOI A;  1RMD A;  2EPA A;  2PRT A;  2J7J A;  1ZU1 A;  3M99 B;  2EMA A;  4F6N A;  4R2A A;  2LCE A;  2YTQ A;  5KL3 A;  4F6M A;  1A1I A;  2WBS A;  1A1H A;  5KL6 A;  2RPC A;  2YTI A;  1TF6 A;  1KJK A;  2YTD A;  2EML A;  2EPU A;  2EL5 A;  2EMW A;  2CSH A;  2EQ1 A;  1BB8 A;  2GHF A;  2EQ3 A;  2EOJ A;  4GZN C;  2EOE A;  2YTJ A;  2EOQ A;  2YTE A;  2EN6 A;  2YTN A;  3EPJ A;  2EMH A;  1ZR9 A;  2ELZ A;  1A1G A;  2DLQ A;  4R2R A;  1F2I G;  1TF3 A;  2BB8 A;  2WCC 3;  2EN7 A;  2WBU A;  2EOM A;  3EPH A;  2YSO A;  2EOR A;  2EMI A;  2EMC A;  2ELY A; 
#chains in the Genus database with same CATH topology
 4O43 A;  3KWR A;  4MLQ A;  2L8T A;  2YSP A;  2DRP A;  3QG5 C;  1X5W A;  2M7Q A;  2RSM A;  5KL2 A;  4JI6 E;  2EL6 A;  2EN8 A;  2E1M A;  4X65 E;  2L2K B;  3C6K A;  4NXN E;  2DSY A;  4X9J A;  4R2Q A;  2HHH E;  4M9V C;  2UUA E;  1YYW A;  4JI3 E;  2V83 A;  4IJD A;  4B3M E;  2EN1 A;  1HR0 E;  4R2C A;  4DV7 E;  2B9D A;  5A6B A;  3JAM C;  1G2F C;  3J81 C;  1DGC A;  4DR7 E;  3OTO E;  4BHC A;  4LF7 E;  2UXC E;  2EOZ A;  2ADR A;  4RHB B;  2EM8 A;  2DB2 A;  4DKK A;  1UBD C;  1FKA E;  2B7T A;  2VQE E;  4M30 A;  2BBG A;  4JI1 E;  2CTD A;  2YRM A;  1AH5 A;  2EMG A;  2R76 A;  3THO B;  4ZYG A;  4LTY A;  1AAY A;  2YPN A;  1PJS A;  1DI2 A;  1Z1B A;  2LTS A;  3J80 C;  3KZY A;  2EM4 A;  4R8O A;  4KZS A;  2EMF A;  4BC7 A;  1UIL A;  4DV2 E;  4JI7 E;  4WXC A;  1IBM E;  4JV5 E;  5IXM B;  1JK1 A;  2E72 A;  5FLX C;  4RH8 A;  2EN2 A;  2EPC A;  1EH6 A;  4X62 E;  3OML A;  1XMQ E;  4F9A B;  4LF4 E;  1YSA C;  2RS6 A;  1I94 E;  4LF5 E;  5A6J A;  2EPR A;  2EPO A;  3AUZ A;  4B3S E;  2LO3 A;  4L5N C;  5AC5 A;  1GQE A;  4L8N A;  1LLM C;  2EL4 A;  4I8O A;  2EOI A;  4Q35 B;  2JY9 A;  2JWO A;  3K6Q A;  4F6N A;  1EKZ A;  1WXR A;  4R2A A;  4NHR A;  2JOX A;  5KL3 A;  3ADL A;  2WBS A;  1A1H A;  2RPC A;  1ZBQ A;  1TF6 A;  1N36 E;  2EMW A;  4DR5 E;  1HNZ E;  2EQ1 A;  5IT9 C;  5A2Q C;  2EOQ A;  2YTN A;  4GEQ B;  2EMH A;  2ELZ A;  4LFB E;  2JYA A;  1X47 A;  4ZYE A;  2YTQ A;  4DV0 E;  4DV6 E;  5CFF E;  2HGH A;  2NUF A;  2V8Q B;  3C4B A;  2B7V A;  1X49 A;  4WYQ B;  2NAB A;  4JI4 E;  4LFA E;  2LUP B;  2YU5 A;  2N3H A;  1XMO E;  2EPX A;  1YUI A;  2WBT A;  2EPM X;  2N3G A;  1ZAA C;  3ADG A;  4HEI A;  2HJJ A;  4M0V A;  4R2S A;  2EM3 A;  2JPA A;  4X66 E;  4BHB A;  1N34 E;  2M9A A;  4JI5 E;  4JI2 E;  5KL7 A;  1N32 E;  2YTO A;  3KZZ A;  2YTP A;  2V85 A;  2V87 A;  2EJ4 A;  2EMX A;  1T4L B;  2LBS B;  2RSI A;  2M4I A;  4OX9 E;  1QNT A;  1PJT A;  2UU9 E;  2DMI A;  5DNY A;  1EH8 A;  1WHN A;  4YY3 E;  1A1L A;  5AAS A;  3ADJ A;  3IWB A;  2EE8 A;  2KOU A;  4N4R B;  1IBL E;  1A1K A;  2DGC A;  3J7Y p;  1UN6 B;  1A1F A;  3VYY A;  4WPY A;  1YFH A;  2MDG A;  4AQY E;  2MC5 A;  2GLI A;  1EH7 A;  2EM5 A;  5A69 A;  2A25 A;  3EPL A;  1XNQ E;  1NCS A;  2V88 A;  1MEY C;  1SFE A;  4R2P A;  4MLV A;  4LF9 E;  5KL4 A;  2YTG A;  2CT1 A;  2H36 X;  2RTX A;  5LL6 R;  2EM7 A;  1PKP A;  2YTF A;  4WFT A;  2L6M A;  2EPP A;  2WZO A;  1WHQ A;  2GPI A;  1ZU1 A;  5T6J A;  2EMA A;  1YPN A;  2LCE A;  4ZYH A;  1IMU A;  1ZBT A;  4TUI A;  5LMU E;  1X48 A;  2YTI A;  1YYK A;  1UHZ A;  2KON A;  2EPU A;  3HPS A;  2FV4 B;  3HPZ A;  2EQ3 A;  2EOE A;  1HNX E;  4DR3 E;  2NA2 A;  3TQM A;  2DMY A;  2EN6 A;  4BMJ A;  2YWQ A;  2V89 A;  1F2I G;  2L2M A;  3J7A G;  2EOM A;  2ZM6 E;  2YSO A;  2EMI A;  3EQ1 A;  2F8B A;  2IHR 1;  2YT4 A;  1WRJ A;  3ECR A;  1NEI A;  2EMC A;  4O4K A;  2EPL X;  1O0W A;  2EN4 A;  3JTZ A;  2M1S A;  1X6E A;  1X6H A;  4KWY A;  5AC4 A;  3RMP A;  5A6A A;  5IV8 B;  1GZ6 A;  4B3R E;  1RQ0 A;  3ADI A;  4OOG C;  4F2J C;  1XNR E;  2G7H A;  2L92 A;  5A6K A;  4BCA A;  1PDA A;  3MHH C;  2EN3 A;  1FJG E;  2JP9 A;  3C4T A;  2VE7 C;  1YZ9 A;  2EPZ A;  2EM0 A;  3BF2 A;  3VHT B;  4NZV A;  1YUJ A;  3T1H E;  1TN9 A;  4ZYD A;  2L2N A;  4J8Z A;  5LLQ A;  2MC6 A;  2LT7 A;  1YYO A;  3IWD A;  2EOH A;  3EPK A;  1PJQ A;  3HXL A;  4P78 A;  4YHH E;  1J26 A;  2YRH A;  4JI8 E;  2KHX A;  1X3C A;  3BGH A;  3VYX A;  2EZ6 A;  4JYA E;  2LV2 A;  2FGG A;  2ODR C;  2EQ0 A;  2MKD A;  3FIG A;  4WSG A;  3HQ1 A;  2VF1 A;  2D9H A;  2MKN A;  4X8W A;  3ZOQ B;  3BBG A;  4DR6 E;  4B3T E;  4NXM E;  1BBO A;  2E5L E;  2EM6 A;  2ENC A;  2VQF E;  1P47 A;  1T4O A;  3JU0 A;  1WJP A;  2EMK A;  4LU9 A;  2ENH A;  4GKJ E;  1T39 A;  1MGT A;  3AV0 A;  2EMB A;  2YU8 A;  5TSE A;  2I13 A;  3THN A;  4DUY E;  4FK5 C;  4BS9 A;  4DUZ E;  2I9I A;  1DQ3 A;  2EOO A;  2NUE A;  4KHP E;  4O5G A;  2LRS A;  1RMD A;  2EPA A;  5ADZ A;  2PRT A;  5A6B D;  5AE2 A;  2L33 A;  4DR4 E;  3IWC A;  5BR8 E;  4F6M A;  5KL6 A;  1KJK A;  2YTD A;  4DV5 E;  3DF6 A;  1BB8 A;  2YZT A;  3EPJ A;  1ZR9 A;  4F54 A;  4DR1 E;  2DLQ A;  4R2R A;  2WCC 3;  2ODR D;  1BBG A;  1HNW E;  2EN7 A;  2WBU A;  1RC7 A;  1IQO A;  1T38 A;  3F6H A;  2N8X A;  4X64 E;  3HTX A;  2ELY A;  1G2D C;  3H09 A;  5F3W A;  2EP3 A;  3VK6 A;  5KL5 A;  2EWL A;  2JVA A;  1N3G A;  4O24 A;  4P7D A;  2R1F A;  1KYQ A;  2F4V E;  4GKK E;  3MHS C;  4R2E A;  2EPN A;  3LLH A;  1STU A;  4DV4 E;  2JOB A;  5AE3 A;  4K0K E;  4F9C B;  3L00 A;  2RQL A;  2UXD E;  4IS1 C;  2LJU A;  2EMZ A;  2Q8U A;  2LMZ A;  4DV3 E;  3MSW A;  1QU6 A;  4BC9 A;  4R2D A;  1IBK E;  4WSP A;  1X6F A;  2EM9 A;  2L3C A;  2L3J A;  1L4S A;  3T1Y E;  2K7I A;  3P1X A;  2LTR A;  5AE1 A;  2UUB E;  2K4V A;  2UXB E;  4M2Z A;  2EPK X;  2VRD A;  2LVH A;  4WXD A;  1IQS A;  5IWA E;  4DV1 E;  1A1J A;  2JR1 A;  2EOY A;  2EM2 A;  2EOS A;  2YRK A;  2EOX A;  2LUQ A;  4DMI A;  4JI0 E;  2EMY A;  3F6G A;  4Q28 A;  5LMN E;  2B3T B;  2ENA A;  1B69 A;  2EOF A;  4LF6 E;  3UK3 C;  4TUG A;  2MDR A;  4DR2 E;  2DLK A;  1N33 E;  1JK2 A;  4LF8 E;  1J5E E;  2J7J A;  3M99 B;  2V86 A;  4LFC E;  1A1I A;  2RS7 A;  2FTX B;  2NUG A;  2EML A;  2EL5 A;  2CSH A;  2GHF A;  4HTG A;  2UUC E;  2EOJ A;  4GZN C;  2DIX A;  2LE2 A;  2YTJ A;  2YTE A;  1SR9 A;  4BBY A;  2CPN A;  1GTK A;  2JXP A;  3BID A;  1A1G A;  1TF3 A;  2BB8 A;  4R03 A;  4WX9 A;  3DJW A;  4F9B B;  3EPH A;  2EOR A;  3C6M A;  3LML A;  1T4N A;  2HC5 A;  2LJH A; 
#chains in the Genus database with same CATH homology
 2YSP A;  2EN4 A;  2EP3 A;  2HGH A;  2DRP A;  1X5W A;  5KL5 A;  1X6E A;  1X6H A;  5KL2 A;  2EL6 A;  2EN8 A;  2R1F A;  4R2Q A;  4X9J A;  2NAB A;  3MHS C;  4R2E A;  4M9V C;  2YU5 A;  4F2J C;  3MHH C;  4IJD A;  2EPX A;  2EN3 A;  1YUI A;  2JP9 A;  2WBT A;  2EPZ A;  2EN1 A;  4R2C A;  2EM0 A;  1ZAA C;  1G2D C;  1G2F C;  1DGC A;  3VHT B;  4IS1 C;  4R2S A;  1YUJ A;  2EMZ A;  2EM3 A;  2JPA A;  1TN9 A;  2M9A A;  5KL7 A;  2EOZ A;  4R2D A;  2ADR A;  2YTO A;  2EM8 A;  1UBD C;  2YTP A;  2LT7 A;  2EJ4 A;  2EMX A;  1X6F A;  2EM9 A;  2EOH A;  3EPK A;  2RSI A;  2CTD A;  2YRM A;  2YRH A;  1X3C A;  2EMG A;  1AAY A;  2LV2 A;  1Z1B A;  2DMI A;  2EM4 A;  2EMF A;  2VRD A;  2EQ0 A;  2LVH A;  2MKD A;  1A1J A;  1A1L A;  2EOY A;  2EE8 A;  2EM2 A;  2DGC A;  1A1K A;  4WSG A;  1JK1 A;  1A1F A;  2EOS A;  2E72 A;  2YRK A;  1UN6 B;  2D9H A;  2MDG A;  2EOX A;  2MKN A;  2EN2 A;  2GLI A;  2EPC A;  2EMY A;  2EM5 A;  1BBO A;  2A25 A;  3EPL A;  1YSA C;  2EM6 A;  2ENC A;  1NCS A;  1MEY C;  1P47 A;  2EPR A;  4R2P A;  1WJP A;  2EMK A;  2ENH A;  2LO3 A;  5KL4 A;  2ENA A;  2YTG A;  1B69 A;  2EOF A;  2CT1 A;  2EMB A;  3UK3 C;  2YU8 A;  1LLM C;  2EL4 A;  2I13 A;  2EM7 A;  2YTF A;  4FK5 C;  2DLK A;  2EOO A;  2EPP A;  1JK2 A;  2EOI A;  1RMD A;  2EPA A;  2PRT A;  2J7J A;  1ZU1 A;  3M99 B;  2EMA A;  4F6N A;  4R2A A;  2LCE A;  2YTQ A;  5KL3 A;  4F6M A;  1A1I A;  2WBS A;  1A1H A;  5KL6 A;  2RPC A;  2YTI A;  1TF6 A;  1KJK A;  2YTD A;  2EML A;  2EPU A;  2EL5 A;  2EMW A;  2CSH A;  2EQ1 A;  1BB8 A;  2GHF A;  2EQ3 A;  2EOJ A;  4GZN C;  2EOE A;  2YTJ A;  2EOQ A;  2YTE A;  2EN6 A;  2YTN A;  3EPJ A;  2EMH A;  1ZR9 A;  2ELZ A;  1A1G A;  2DLQ A;  4R2R A;  1F2I G;  1TF3 A;  2BB8 A;  2WCC 3;  2EN7 A;  2WBU A;  2EOM A;  3EPH A;  2YSO A;  2EOR A;  2EMI A;  2EMC A;  2ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...