4R2AA

Egr1/zif268 zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Early growth response protein 1
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2aA00
3EPJA 2YTQA 1MEYC 2EM6A 3EPKA 2EPPA 2EOXA 4R2CA 2WBUA 2EN3A 1YUJA 2DGCA 1BBOA 1A1KA 2E72A 2EMKA 2EPAA 2EPZA 2VRDA 2DLQA 2EL4A 2EOJA 2WBSA 1ZU1A 1WJPA 2EOYA 1UBDC 2MKNA 2DMIA 3M99B 1UN6B 1RMDA 1JK1A 2YRMA 3UK3C 2EORA 2LO3A 2YTNA 2EPUA 4X9JA 3EPLA 2JPAA 2EQ1A 4FK5C 2EMFA 2LCEA 1A1JA 2EM7A 2BB8A 2YRKA 5KL4A 3EPHA 4F6MA 2EMLA 2ADRA 2EOOA 1Z1BA 2HGHA 1X6EA 2EMWA 2NABA 1A1IA 3MHSC 2EPCA 1A1HA 2WBTA 2YTGA 2ENCA 1A1FA 1YSAC 1F2IG 2ELYA 1B69A 4F2JC 2EOZA 2EQ0A 2EE8A 2YTJA 2RPCA 1G2FC 4R2RA 1ZR9A 2EOMA 1X3CA 2EMHA 2EL5A 2EMBA 2EM5A 2GHFA 2EM4A 1X6FA 2M9AA 2EMGA 2DLKA 4F6NA 2LV2A 2YTOA 2YTDA 2EN8A 1X6HA 2EOFA 2EOQA 2YTEA 4R2QA 2YSPA 1KJKA 1ZAAC 2EPXA 4GZNC 2EN4A 2ENHA 2EMAA 2D9HA 1YUIA 4IJDA 1NCSA 2EN2A 2PRTA 2EMIA 2YTIA 1P47A 2ELZA 2EP3A 1TF6A 2JP9A 2MKDA 2EMCA 2J7JA 2A25A 2CT1A 4R2DA 1AAYA 3VHTB 2DRPA 2GLIA 2CSHA 2EMZA 4R2PA 1A1GA 2EOEA 2EN7A 2EM8A 4R2EA 5KL7A 4M9VC 2MDGA 1BB8A 2CTDA 2EMYA 2EN1A 2YTFA 2EOIA 2EQ3A 2EOHA 1LLMC 4R2AA 2LT7A 2YTPA 5KL6A 1TN9A 3MHHC 5KL2A 2YU5A 1JK2A 4IS1C 2RSIA 2LVHA 2EMXA 4R2SA 2EM9A 2WCC3 2ENAA 2EOSA 2EJ4A 2EM0A 1DGCA 5KL3A 2EM2A 1A1LA 2YRHA 2EN6A 2I13A 1G2DC 2EPRA 2EM3A 1TF3A 1X5WA 2YSOA 2EL6A 5KL5A 2R1FA 2YU8A 4WSGA
chains in the Genus database with same CATH superfamily
2V8QB 4Q35B 3EPJA 1UILA 3ADIA 5ADZA 4TUGA 1IQOA 5AE3A 3HQ1A 3HTXA 4WX9A 4HTGA 3EPKA 3VYXA 3K6QA 2EN3A 1N33E 1A1KA 2EMKA 2EPAA 3DF6A 3IWDA 2GPIA 2WBSA 4LF4E 4DR6E 2FV4B 1ZU1A 5T6JA 4X65E 4ZYDA 1UN6B 3AV0A 2YRMA 4RHBB 2EORA 4X9JA 3EPLA 3VYYA 1SR9A 4X62E 2LCEA 5IWAE 3F6GA 2EM7A 4NHRA 2YPNA 4LTYA 5KL4A 2JY9A 2ADRA 4F9CB 1Z1BA 2RQLA 3DJWA 2VE7C 1SFEA 1F2IG 5A2QC 3EQ1A 2JOXA 4F2JC 2YTJA 4R2RA 2EOMA 4DR1E 4DV0E 1X3CA 4MLQA 1MGTA 2L2MA 4BC7A 4JV5E 3ECRA 2R76A 3P1XA 2EN8A 1X6HA 2EOFA 4R2QA 4LF6E 3JU0A 1KJKA 2LTSA 1T4OA 1ZAAC 4GZNC 2EN4A 1PKPA 2D9HA 2E5LE 5LMUE 2HJJA 4HEIA 2KONA 1FJGE 2LMZA 2YTIA 3J81C 3H09A 1YYKA 3LLHA 2MKDA 5AC5A 2CT1A 2DRPA 3VHTB 1QNTA 4DKKA 2L3JA 5A6JA 2CSHA 2JOBA 4X8WA 1A1GA 1YZ9A 2E1MA 1PJQA 2MDGA 5AE2A 5DNYA 5LLQA 5KL6A 2MC6A 1X47A 3MHHC 4F54A 2LTRA 1KYQA 4Q28A 1BBGA 2EM9A 3C6KA 4JI2E 2WCC3 4DV3E 5A69A 2V86A 4R03A 1A1LA 2UUAE 1ZBTA 2I13A 4NXNE 1YPNA 2YSOA 4DR7E 2EL6A 2WZOA 2Q8UA 4DV2E 2LE2A 1MEYC 2EPPA 2WBUA 1XNRE 2E72A 4X66E 2EPZA 2EPKX 2DLQA 2VRDA 3THOB 2EOJA 4B3RE 1WJPA 2L2KB 3J80C 3J7AG 4KWYA 4F9BB 2EOYA 1UBDC 2FGGA 4WPYA 3ADGA 1JK1A 3TQMA 3C4BA 4DV7E 4WSPA 1IBLE 2IHR1 4ZYEA 4FK5C 2EMFA 4LF7E 2CPNA 5AC4A 3VK6A 4OOGC 2YRKA 3EPHA 4LF5E 2I9IA 4F9AB 3KWRA 4JI3E 2EMWA 3OTOE 4JI4E 2NA2A 2K7IA 1J26A 3HPZA 2UXCE 4BMJA 2KHXA 2HC5A 2EE8A 1G2FC 1ZR9A 2YWQA 2EMHA 4O5GA 1EKZA 2L33A 2EM4A 4BS9A 2B3TB 2RS6A 1X48A 2ENHA 2EMAA 1N34E 2EN2A 1YYOA 4BC9A 4OX9E 4BHCA 4ZYGA 2ELZA 1EH6A 5IT9C 2EMCA 4R2DA 2ODRD 3OMLA 4JI8E 2GLIA 4KHPE 3C4TA 2L6MA 3ADLA 2UUBE 2EN7A 2EM8A 1HNZE 4M9VC 1N36E 1HNWE 2EMYA 2LUQA 2EN1A 2RS7A 2EOIA 1LLMC 2EOHA 1N32E 2L8TA 4R2AA 1YFHA 2EPMX 3T1HE 4R8OA 2LJUA 4DR3E 3AUZA 4IS1C 2B9DA 2RSIA 2LVHA 2EMXA 2RTXA 3FIGA 2EOSA 3J7Yp 2EM0A 1DGCA 2JXPA 2DMYA 1PJSA 2N3HA 3THNA 1G2DC 1TF3A 2EM3A 4N4RB 3QG5C 4DV6E 2DGCA 5CFFE 2YTQA 4DR2E 1WXRA 1WRJA 4LU9A 2V88A 2VQEE 1L4SA 2G7HA 1XNQE 2EL4A 4DR4E 2K4VA 2LJHA 2MKNA 2DMIA 3LMLA 4DV1E 1IBKE 1RMDA 2B7VA 2YTNA 3IWBA 2M7QA 4I8OA 1PJTA 5A6AA 1STUA 1NEIA 1A1JA 4DR5E 3IWCA 2BB8A 2MC5A 4K0KE 4GEQB 4B3ME 4F6MA 4JI1E 2EMLA 2HGHA 4B3SE 3HXLA 2F8BA 1IMUA 4B3TE 1DQ3A 2NABA 3MHSC 1A1HA 4DUYE 1T4NA 2ENCA 1UHZA 1YSAC 2ELYA 1B69A 2F4VE 2EOZA 2RPCA 4M0VA 4NXME 2M9AA 2EPLX 2YTOA 2YTDA 2EOQA 2N8XA 2YSPA 2L92A 4WYQB 4MLVA 1YUIA 2DIXA 2PRTA 3ZOQB 2EMIA 5BR8E 2YZTA 4DUZE 1T38A 1GQEA 2VQFE 2EP3A 2V87A 1TF6A 2J7JA 2UXBE 1AAYA 4AQYE 1XMOE 4X64E 2H36X 3HPSA 5F3WA 1YYWA 4R2PA 3BBGA 1HNXE 2EOEA 5IXMB 4L5NC 5A6BD 4TUIA 1N3GA 4R2EA 1PDAA 5KL7A 2CTDA 2EQ3A 1RQ0A 4BCAA 4DV5E 2RSMA 2LT7A 2YTPA 1TN9A 1WHQA 4WFTA 3KZZA 5KL2A 3ADJA 4NZVA 2YU5A 4LFCE 2BBGA 5A6BA 4R2SA 1XMQE 4JI5E 2YT4A 2JWOA 2L2NA 2EJ4A 1HR0E 5FLXC 1GZ6A 4YY3E 2YRHA 2EN6A 4DV4E 2M4IA 2EPRA 2EZ6A 1X5WA 2R1FA 2YU8A 2EM6A 2JVAA 1BBOA 4R2CA 2EOXA 2MDRA 2ODRC 4KZSA 1YUJA 4BBYA 1FKAE 2B7TA 1EH8A 3T1YE 4P78A 3KZYA 3M99B 1GTKA 3BF2A 4ZYHA 3UK3C 2LO3A 1EH7A 2EPUA 3JAMC 4GKKE 4LF8E 1IBME 2JPAA 1AH5A 2EQ1A 5A6KA 1ZBQA 4JI7E 2JYAA 4M2ZA 4LF9E 2KOUA 2V89A 2V83A 1RC7A 2EOOA 4LFAE 2UUCE 1X6EA 1A1IA 4GKJE 2EPCA 5TSEA 3BIDA 2WBTA 5LMNE 2YTGA 4BHBA 1A1FA 4L8NA 5AASA 2EQ0A 1WHNA 4P7DA 2EM5A 2EMBA 2EL5A 2GHFA 4JYAE 1X6FA 2V85A 2EMGA 2ZM6E 2DLKA 4F6NA 2FTXB 2LV2A 4M30A 4O4KA 2YTEA 1DI2A 2EPXA 2JR1A 2N3GA 1T39A 2UXDE 2LBSB 4IJDA 1NCSA 4WXCA 2EPOA 5IV8B 2NUFA 5LL6R 4J8ZA 2EWLA 1P47A 4DMIA 1J5EE 2JP9A 2LUPB 5AE1A 1T4LB 2UU9E 2A25A 1I94E 1QU6A 2EMZA 4YHHE 3F6HA 4O43A 2EPNA 1BB8A 1IQSA 2HHHE 2M1SA 2YTFA 4JI6E 3C6MA 3MSWA 3JTZA 1O0WA 4RH8A 2NUGA 2L3CA 2VF1A 4O24A 1JK2A 4JI0E 4LFBE 2DSYA 2ENAA 2NUEA 3RMPA 5KL3A 2EM2A 3L00A 2LRSA 2DB2A 4WXDA 1X49A 3BGHA 5KL5A 4WSGA
chains in the Genus database with same CATH topology
3EPJA 2YTQA 1MEYC 2EM6A 3EPKA 2EPPA 2EOXA 4R2CA 2WBUA 2EN3A 1YUJA 2DGCA 1BBOA 1A1KA 2E72A 2EMKA 2EPAA 2EPZA 2VRDA 2DLQA 2EL4A 2EOJA 2WBSA 1ZU1A 1WJPA 2EOYA 1UBDC 2MKNA 2DMIA 3M99B 1UN6B 1RMDA 1JK1A 2YRMA 3UK3C 2EORA 2LO3A 2YTNA 2EPUA 4X9JA 3EPLA 2JPAA 2EQ1A 4FK5C 2EMFA 2LCEA 1A1JA 2EM7A 2BB8A 2YRKA 5KL4A 3EPHA 4F6MA 2EMLA 2ADRA 2EOOA 1Z1BA 2HGHA 1X6EA 2EMWA 2NABA 1A1IA 3MHSC 2EPCA 1A1HA 2WBTA 2YTGA 2ENCA 1A1FA 1YSAC 1F2IG 2ELYA 1B69A 4F2JC 2EOZA 2EQ0A 2EE8A 2YTJA 2RPCA 1G2FC 4R2RA 1ZR9A 2EOMA 1X3CA 2EMHA 2EL5A 2EMBA 2EM5A 2GHFA 2EM4A 1X6FA 2M9AA 2EMGA 2DLKA 4F6NA 2LV2A 2YTOA 2YTDA 2EN8A 1X6HA 2EOFA 2EOQA 2YTEA 4R2QA 2YSPA 1KJKA 1ZAAC 2EPXA 4GZNC 2EN4A 2ENHA 2EMAA 2D9HA 1YUIA 4IJDA 1NCSA 2EN2A 2PRTA 2EMIA 2YTIA 1P47A 2ELZA 2EP3A 1TF6A 2JP9A 2MKDA 2EMCA 2J7JA 2A25A 2CT1A 4R2DA 1AAYA 3VHTB 2DRPA 2GLIA 2CSHA 2EMZA 4R2PA 1A1GA 2EOEA 2EN7A 2EM8A 4R2EA 5KL7A 4M9VC 2MDGA 1BB8A 2CTDA 2EMYA 2EN1A 2YTFA 2EOIA 2EQ3A 2EOHA 1LLMC 4R2AA 2LT7A 2YTPA 5KL6A 1TN9A 3MHHC 5KL2A 2YU5A 1JK2A 4IS1C 2RSIA 2LVHA 2EMXA 4R2SA 2EM9A 2WCC3 2ENAA 2EOSA 2EJ4A 2EM0A 1DGCA 5KL3A 2EM2A 1A1LA 2YRHA 2EN6A 2I13A 1G2DC 2EPRA 2EM3A 1TF3A 1X5WA 2YSOA 2EL6A 5KL5A 2R1FA 2YU8A 4WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPJ A;  2YTQ A;  1MEY C;  2EM6 A;  3EPK A;  2EPP A;  2EOX A;  4R2C A;  2WBU A;  2EN3 A;  1YUJ A;  2DGC A;  1BBO A;  1A1K A;  2E72 A;  2EMK A;  2EPA A;  2EPZ A;  2VRD A;  2DLQ A;  2EL4 A;  2EOJ A;  2WBS A;  1ZU1 A;  1WJP A;  2EOY A;  1UBD C;  2MKN A;  2DMI A;  3M99 B;  1UN6 B;  1RMD A;  1JK1 A;  2YRM A;  3UK3 C;  2EOR A;  2LO3 A;  2YTN A;  2EPU A;  4X9J A;  3EPL A;  2JPA A;  2EQ1 A;  4FK5 C;  2EMF A;  2LCE A;  1A1J A;  2EM7 A;  2BB8 A;  2YRK A;  5KL4 A;  3EPH A;  4F6M A;  2EML A;  2ADR A;  2EOO A;  1Z1B A;  2HGH A;  1X6E A;  2EMW A;  2NAB A;  1A1I A;  3MHS C;  2EPC A;  1A1H A;  2WBT A;  2YTG A;  2ENC A;  1A1F A;  1YSA C;  1F2I G;  2ELY A;  1B69 A;  4F2J C;  2EOZ A;  2EQ0 A;  2EE8 A;  2YTJ A;  2RPC A;  1G2F C;  4R2R A;  1ZR9 A;  2EOM A;  1X3C A;  2EMH A;  2EL5 A;  2EMB A;  2EM5 A;  2GHF A;  2EM4 A;  1X6F A;  2M9A A;  2EMG A;  2DLK A;  4F6N A;  2LV2 A;  2YTO A;  2YTD A;  2EN8 A;  1X6H A;  2EOF A;  2EOQ A;  2YTE A;  4R2Q A;  2YSP A;  1KJK A;  1ZAA C;  2EPX A;  4GZN C;  2EN4 A;  2ENH A;  2EMA A;  2D9H A;  1YUI A;  4IJD A;  1NCS A;  2EN2 A;  2PRT A;  2EMI A;  2YTI A;  1P47 A;  2ELZ A;  2EP3 A;  1TF6 A;  2JP9 A;  2MKD A;  2EMC A;  2J7J A;  2A25 A;  2CT1 A;  4R2D A;  1AAY A;  3VHT B;  2DRP A;  2GLI A;  2CSH A;  2EMZ A;  4R2P A;  1A1G A;  2EOE A;  2EN7 A;  2EM8 A;  4R2E A;  5KL7 A;  4M9V C;  2MDG A;  1BB8 A;  2CTD A;  2EMY A;  2EN1 A;  2YTF A;  2EOI A;  2EQ3 A;  2EOH A;  1LLM C;  4R2A A;  2LT7 A;  2YTP A;  5KL6 A;  1TN9 A;  3MHH C;  5KL2 A;  2YU5 A;  1JK2 A;  4IS1 C;  2RSI A;  2LVH A;  2EMX A;  4R2S A;  2EM9 A;  2WCC 3;  2ENA A;  2EOS A;  2EJ4 A;  2EM0 A;  1DGC A;  5KL3 A;  2EM2 A;  1A1L A;  2YRH A;  2EN6 A;  2I13 A;  1G2D C;  2EPR A;  2EM3 A;  1TF3 A;  1X5W A;  2YSO A;  2EL6 A;  5KL5 A;  2R1F A;  2YU8 A;  4WSG A; 
#chains in the Genus database with same CATH topology
 2V8Q B;  4Q35 B;  3EPJ A;  1UIL A;  3ADI A;  5ADZ A;  4TUG A;  1IQO A;  5AE3 A;  3HQ1 A;  3HTX A;  4WX9 A;  4HTG A;  3EPK A;  3VYX A;  3K6Q A;  2EN3 A;  1N33 E;  1A1K A;  2EMK A;  2EPA A;  3DF6 A;  3IWD A;  2GPI A;  2WBS A;  4LF4 E;  4DR6 E;  2FV4 B;  1ZU1 A;  5T6J A;  4X65 E;  4ZYD A;  1UN6 B;  3AV0 A;  2YRM A;  4RHB B;  2EOR A;  4X9J A;  3EPL A;  3VYY A;  1SR9 A;  4X62 E;  2LCE A;  5IWA E;  3F6G A;  2EM7 A;  4NHR A;  2YPN A;  4LTY A;  5KL4 A;  2JY9 A;  2ADR A;  4F9C B;  1Z1B A;  2RQL A;  3DJW A;  2VE7 C;  1SFE A;  1F2I G;  5A2Q C;  3EQ1 A;  2JOX A;  4F2J C;  2YTJ A;  4R2R A;  2EOM A;  4DR1 E;  4DV0 E;  1X3C A;  4MLQ A;  1MGT A;  2L2M A;  4BC7 A;  4JV5 E;  3ECR A;  2R76 A;  3P1X A;  2EN8 A;  1X6H A;  2EOF A;  4R2Q A;  4LF6 E;  3JU0 A;  1KJK A;  2LTS A;  1T4O A;  1ZAA C;  4GZN C;  2EN4 A;  1PKP A;  2D9H A;  2E5L E;  5LMU E;  2HJJ A;  4HEI A;  2KON A;  1FJG E;  2LMZ A;  2YTI A;  3J81 C;  3H09 A;  1YYK A;  3LLH A;  2MKD A;  5AC5 A;  2CT1 A;  2DRP A;  3VHT B;  1QNT A;  4DKK A;  2L3J A;  5A6J A;  2CSH A;  2JOB A;  4X8W A;  1A1G A;  1YZ9 A;  2E1M A;  1PJQ A;  2MDG A;  5AE2 A;  5DNY A;  5LLQ A;  5KL6 A;  2MC6 A;  1X47 A;  3MHH C;  4F54 A;  2LTR A;  1KYQ A;  4Q28 A;  1BBG A;  2EM9 A;  3C6K A;  4JI2 E;  2WCC 3;  4DV3 E;  5A69 A;  2V86 A;  4R03 A;  1A1L A;  2UUA E;  1ZBT A;  2I13 A;  4NXN E;  1YPN A;  2YSO A;  4DR7 E;  2EL6 A;  2WZO A;  2Q8U A;  4DV2 E;  2LE2 A;  1MEY C;  2EPP A;  2WBU A;  1XNR E;  2E72 A;  4X66 E;  2EPZ A;  2EPK X;  2DLQ A;  2VRD A;  3THO B;  2EOJ A;  4B3R E;  1WJP A;  2L2K B;  3J80 C;  3J7A G;  4KWY A;  4F9B B;  2EOY A;  1UBD C;  2FGG A;  4WPY A;  3ADG A;  1JK1 A;  3TQM A;  3C4B A;  4DV7 E;  4WSP A;  1IBL E;  2IHR 1;  4ZYE A;  4FK5 C;  2EMF A;  4LF7 E;  2CPN A;  5AC4 A;  3VK6 A;  4OOG C;  2YRK A;  3EPH A;  4LF5 E;  2I9I A;  4F9A B;  3KWR A;  4JI3 E;  2EMW A;  3OTO E;  4JI4 E;  2NA2 A;  2K7I A;  1J26 A;  3HPZ A;  2UXC E;  4BMJ A;  2KHX A;  2HC5 A;  2EE8 A;  1G2F C;  1ZR9 A;  2YWQ A;  2EMH A;  4O5G A;  1EKZ A;  2L33 A;  2EM4 A;  4BS9 A;  2B3T B;  2RS6 A;  1X48 A;  2ENH A;  2EMA A;  1N34 E;  2EN2 A;  1YYO A;  4BC9 A;  4OX9 E;  4BHC A;  4ZYG A;  2ELZ A;  1EH6 A;  5IT9 C;  2EMC A;  4R2D A;  2ODR D;  3OML A;  4JI8 E;  2GLI A;  4KHP E;  3C4T A;  2L6M A;  3ADL A;  2UUB E;  2EN7 A;  2EM8 A;  1HNZ E;  4M9V C;  1N36 E;  1HNW E;  2EMY A;  2LUQ A;  2EN1 A;  2RS7 A;  2EOI A;  1LLM C;  2EOH A;  1N32 E;  2L8T A;  4R2A A;  1YFH A;  2EPM X;  3T1H E;  4R8O A;  2LJU A;  4DR3 E;  3AUZ A;  4IS1 C;  2B9D A;  2RSI A;  2LVH A;  2EMX A;  2RTX A;  3FIG A;  2EOS A;  3J7Y p;  2EM0 A;  1DGC A;  2JXP A;  2DMY A;  1PJS A;  2N3H A;  3THN A;  1G2D C;  1TF3 A;  2EM3 A;  4N4R B;  3QG5 C;  4DV6 E;  2DGC A;  5CFF E;  2YTQ A;  4DR2 E;  1WXR A;  1WRJ A;  4LU9 A;  2V88 A;  2VQE E;  1L4S A;  2G7H A;  1XNQ E;  2EL4 A;  4DR4 E;  2K4V A;  2LJH A;  2MKN A;  2DMI A;  3LML A;  4DV1 E;  1IBK E;  1RMD A;  2B7V A;  2YTN A;  3IWB A;  2M7Q A;  4I8O A;  1PJT A;  5A6A A;  1STU A;  1NEI A;  1A1J A;  4DR5 E;  3IWC A;  2BB8 A;  2MC5 A;  4K0K E;  4GEQ B;  4B3M E;  4F6M A;  4JI1 E;  2EML A;  2HGH A;  4B3S E;  3HXL A;  2F8B A;  1IMU A;  4B3T E;  1DQ3 A;  2NAB A;  3MHS C;  1A1H A;  4DUY E;  1T4N A;  2ENC A;  1UHZ A;  1YSA C;  2ELY A;  1B69 A;  2F4V E;  2EOZ A;  2RPC A;  4M0V A;  4NXM E;  2M9A A;  2EPL X;  2YTO A;  2YTD A;  2EOQ A;  2N8X A;  2YSP A;  2L92 A;  4WYQ B;  4MLV A;  1YUI A;  2DIX A;  2PRT A;  3ZOQ B;  2EMI A;  5BR8 E;  2YZT A;  4DUZ E;  1T38 A;  1GQE A;  2VQF E;  2EP3 A;  2V87 A;  1TF6 A;  2J7J A;  2UXB E;  1AAY A;  4AQY E;  1XMO E;  4X64 E;  2H36 X;  3HPS A;  5F3W A;  1YYW A;  4R2P A;  3BBG A;  1HNX E;  2EOE A;  5IXM B;  4L5N C;  5A6B D;  4TUI A;  1N3G A;  4R2E A;  1PDA A;  5KL7 A;  2CTD A;  2EQ3 A;  1RQ0 A;  4BCA A;  4DV5 E;  2RSM A;  2LT7 A;  2YTP A;  1TN9 A;  1WHQ A;  4WFT A;  3KZZ A;  5KL2 A;  3ADJ A;  4NZV A;  2YU5 A;  4LFC E;  2BBG A;  5A6B A;  4R2S A;  1XMQ E;  4JI5 E;  2YT4 A;  2JWO A;  2L2N A;  2EJ4 A;  1HR0 E;  5FLX C;  1GZ6 A;  4YY3 E;  2YRH A;  2EN6 A;  4DV4 E;  2M4I A;  2EPR A;  2EZ6 A;  1X5W A;  2R1F A;  2YU8 A;  2EM6 A;  2JVA A;  1BBO A;  4R2C A;  2EOX A;  2MDR A;  2ODR C;  4KZS A;  1YUJ A;  4BBY A;  1FKA E;  2B7T A;  1EH8 A;  3T1Y E;  4P78 A;  3KZY A;  3M99 B;  1GTK A;  3BF2 A;  4ZYH A;  3UK3 C;  2LO3 A;  1EH7 A;  2EPU A;  3JAM C;  4GKK E;  4LF8 E;  1IBM E;  2JPA A;  1AH5 A;  2EQ1 A;  5A6K A;  1ZBQ A;  4JI7 E;  2JYA A;  4M2Z A;  4LF9 E;  2KOU A;  2V89 A;  2V83 A;  1RC7 A;  2EOO A;  4LFA E;  2UUC E;  1X6E A;  1A1I A;  4GKJ E;  2EPC A;  5TSE A;  3BID A;  2WBT A;  5LMN E;  2YTG A;  4BHB A;  1A1F A;  4L8N A;  5AAS A;  2EQ0 A;  1WHN A;  4P7D A;  2EM5 A;  2EMB A;  2EL5 A;  2GHF A;  4JYA E;  1X6F A;  2V85 A;  2EMG A;  2ZM6 E;  2DLK A;  4F6N A;  2FTX B;  2LV2 A;  4M30 A;  4O4K A;  2YTE A;  1DI2 A;  2EPX A;  2JR1 A;  2N3G A;  1T39 A;  2UXD E;  2LBS B;  4IJD A;  1NCS A;  4WXC A;  2EPO A;  5IV8 B;  2NUF A;  5LL6 R;  4J8Z A;  2EWL A;  1P47 A;  4DMI A;  1J5E E;  2JP9 A;  2LUP B;  5AE1 A;  1T4L B;  2UU9 E;  2A25 A;  1I94 E;  1QU6 A;  2EMZ A;  4YHH E;  3F6H A;  4O43 A;  2EPN A;  1BB8 A;  1IQS A;  2HHH E;  2M1S A;  2YTF A;  4JI6 E;  3C6M A;  3MSW A;  3JTZ A;  1O0W A;  4RH8 A;  2NUG A;  2L3C A;  2VF1 A;  4O24 A;  1JK2 A;  4JI0 E;  4LFB E;  2DSY A;  2ENA A;  2NUE A;  3RMP A;  5KL3 A;  2EM2 A;  3L00 A;  2LRS A;  2DB2 A;  4WXD A;  1X49 A;  3BGH A;  5KL5 A;  4WSG A; 
#chains in the Genus database with same CATH homology
 3EPJ A;  2YTQ A;  1MEY C;  2EM6 A;  3EPK A;  2EPP A;  2EOX A;  4R2C A;  2WBU A;  2EN3 A;  1YUJ A;  2DGC A;  1BBO A;  1A1K A;  2E72 A;  2EMK A;  2EPA A;  2EPZ A;  2VRD A;  2DLQ A;  2EL4 A;  2EOJ A;  2WBS A;  1ZU1 A;  1WJP A;  2EOY A;  1UBD C;  2MKN A;  2DMI A;  3M99 B;  1UN6 B;  1RMD A;  1JK1 A;  2YRM A;  3UK3 C;  2EOR A;  2LO3 A;  2YTN A;  2EPU A;  4X9J A;  3EPL A;  2JPA A;  2EQ1 A;  4FK5 C;  2EMF A;  2LCE A;  1A1J A;  2EM7 A;  2BB8 A;  2YRK A;  5KL4 A;  3EPH A;  4F6M A;  2EML A;  2ADR A;  2EOO A;  1Z1B A;  2HGH A;  1X6E A;  2EMW A;  2NAB A;  1A1I A;  3MHS C;  2EPC A;  1A1H A;  2WBT A;  2YTG A;  2ENC A;  1A1F A;  1YSA C;  1F2I G;  2ELY A;  1B69 A;  4F2J C;  2EOZ A;  2EQ0 A;  2EE8 A;  2YTJ A;  2RPC A;  1G2F C;  4R2R A;  1ZR9 A;  2EOM A;  1X3C A;  2EMH A;  2EL5 A;  2EMB A;  2EM5 A;  2GHF A;  2EM4 A;  1X6F A;  2M9A A;  2EMG A;  2DLK A;  4F6N A;  2LV2 A;  2YTO A;  2YTD A;  2EN8 A;  1X6H A;  2EOF A;  2EOQ A;  2YTE A;  4R2Q A;  2YSP A;  1KJK A;  1ZAA C;  2EPX A;  4GZN C;  2EN4 A;  2ENH A;  2EMA A;  2D9H A;  1YUI A;  4IJD A;  1NCS A;  2EN2 A;  2PRT A;  2EMI A;  2YTI A;  1P47 A;  2ELZ A;  2EP3 A;  1TF6 A;  2JP9 A;  2MKD A;  2EMC A;  2J7J A;  2A25 A;  2CT1 A;  4R2D A;  1AAY A;  3VHT B;  2DRP A;  2GLI A;  2CSH A;  2EMZ A;  4R2P A;  1A1G A;  2EOE A;  2EN7 A;  2EM8 A;  4R2E A;  5KL7 A;  4M9V C;  2MDG A;  1BB8 A;  2CTD A;  2EMY A;  2EN1 A;  2YTF A;  2EOI A;  2EQ3 A;  2EOH A;  1LLM C;  4R2A A;  2LT7 A;  2YTP A;  5KL6 A;  1TN9 A;  3MHH C;  5KL2 A;  2YU5 A;  1JK2 A;  4IS1 C;  2RSI A;  2LVH A;  2EMX A;  4R2S A;  2EM9 A;  2WCC 3;  2ENA A;  2EOS A;  2EJ4 A;  2EM0 A;  1DGC A;  5KL3 A;  2EM2 A;  1A1L A;  2YRH A;  2EN6 A;  2I13 A;  1G2D C;  2EPR A;  2EM3 A;  1TF3 A;  1X5W A;  2YSO A;  2EL6 A;  5KL5 A;  2R1F A;  2YU8 A;  4WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...