4R2DA

Egr1/zif268 zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
b'ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early growth response protein 1
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2dA00
2YTOA 2EM9A 3VHTB 1JK1A 5KL7A 1ZAAC 4R2CA 2YTDA 2YTJA 4R2AA 2YU5A 4R2SA 2EQ0A 2ELZA 2EPCA 2RPCA 2EMCA 1AAYA 2EP3A 4F6MA 3EPLA 2EM2A 1YUIA 2YRMA 2CTDA 2YTFA 2EN1A 3EPKA 1B69A 1X3CA 4R2EA 2J7JA 2EN3A 1BBOA 1X6EA 2JPAA 2EL5A 2EE8A 2LO3A 1X6HA 1A1FA 2E72A 2EM4A 2PRTA 2NABA 4R2QA 1G2DC 2EMFA 2EMIA 1X6FA 2EMWA 1LLMC 1TN9A 2EOSA 2HGHA 2ADRA 4GZNC 2EOZA 2BB8A 2DLQA 2EM5A 1Z1BA 2I13A 5KL5A 2EMAA 2JP9A 1KJKA 2VRDA 2EPRA 4FK5C 2EOJA 2ELYA 2EOEA 2EJ4A 2WBSA 4M9VC 3EPHA 2EOMA 2EM8A 2EOXA 2EOHA 2YRHA 2M9AA 4WSGA 2EN4A 2EMLA 1NCSA 1ZR9A 2YSPA 2EPXA 2YTQA 4R2DA 1JK2A 2ENAA 2EMHA 2EPUA 2EOOA 2EPAA 2CT1A 1MEYC 4R2PA 2EQ3A 4F6NA 2YTEA 2R1FA 2EOQA 2WBTA 2WCC3 2CSHA 2GLIA 2D9HA 4IS1C 2YSOA 1P47A 1WJPA 2EOYA 1A1JA 1A1KA 2MKDA 2LVHA 3EPJA 2DLKA 2EN8A 2YTNA 1A1IA 2A25A 2EN6A 2EN7A 3MHHC 3M99B 2LT7A 4F2JC 1UBDC 1YUJA 2DMIA 1F2IG 2EL4A 2EMYA 1UN6B 1TF3A 1A1HA 2EMBA 2EOIA 2YU8A 3MHSC 1A1GA 1X5WA 2EN2A 1TF6A 2YTGA 2LCEA 3UK3C 2ENHA 2EMKA 1RMDA 1A1LA 2DGCA 1BB8A 2RSIA 4R2RA 2EMGA 2EOFA 2EORA 2GHFA 2DRPA 1DGCA 5KL2A 2EL6A 2YTPA 2MDGA 1G2FC 2EPZA 1YSAC 2EM6A 2EPPA 2YTIA 2MKNA 2EMZA 2EMXA 2EM7A 5KL3A 2ENCA 5KL4A 4X9JA 1ZU1A 2EQ1A 2EM0A 5KL6A 2WBUA 4IJDA 2YRKA 2LV2A 2EM3A
chains in the Genus database with same CATH superfamily
3RMPA 1PDAA 2LUQA 2YWQA 2YTOA 2CPNA 2YTDA 2YU5A 2ELZA 3HPZA 4X62E 1QNTA 2EPCA 5LL6R 4LF8E 2EMCA 3EPLA 1SFEA 3K6QA 4WSPA 2CTDA 4BS9A 1WRJA 1T4OA 1X3CA 4R2EA 2V85A 4P7DA 3JAMC 2EN3A 1YPNA 1MGTA 1N36E 1PJQA 2JPAA 2EL5A 1WHNA 4WXCA 3IWDA 1A1FA 3FIGA 1KYQA 4DV1E 4JI5E 2EMFA 4N4RB 2RS7A 2BB8A 2DLQA 4DR1E 4AQYE 4P78A 2I13A 3IWCA 2JP9A 2DMYA 2EPRA 4ZYDA 4JI4E 4JI6E 4LF5E 4F9BB 4BC9A 2WBSA 4M9VC 4Q28A 2B7VA 2L2NA 2JVAA 2EOHA 2YRHA 2EN4A 2FTXB 2JXPA 2LE2A 4O43A 1DQ3A 2EMLA 2YSPA 4R2DA 2EPXA 1EH8A 4LF4E 3OMLA 2EOOA 2I9IA 5A6JA 4B3TE 1N3GA 1PJTA 4JI8E 4BBYA 2V87A 3MSWA 2M4IA 4LFBE 4DMIA 1L4SA 4JYAE 2EOYA 2HJJA 4O24A 2GPIA 2YTNA 1A1IA 2A25A 3M99B 4F2JC 5A69A 4DV2E 1HR0E 2LUPB 2K4VA 4MLQA 2YU8A 4JI0E 5TSEA 2EPLX 2LCEA 3QG5C 1RMDA 5A6BA 5IT9C 4BCAA 1N33E 4WPYA 4HEIA 1DGCA 4NXNE 2YTPA 2KOUA 3AUZA 2V8QB 1HNZE 1BBGA 2MKNA 2EMXA 5A6KA 2KHXA 2LJHA 4ZYGA 3JTZA 2WBUA 2YRKA 5LLQA 2M9AA 2UUCE 3C4BA 4J8ZA 2EM3A 2EM9A 2UU9E 4R2CA 4O4KA 2RSMA 3BF2A 1EKZA 4B3RE 2RPCA 4LFCE 1AAYA 5LMNE 1ZBQA 3DF6A 4F6MA 1NEIA 1YUIA 2YRMA 4DV5E 2EN1A 3EPKA 2ODRD 2JYAA 4NXME 5CFFE 1X6EA 2V89A 1XMQE 4MLVA 1IQSA 2PRTA 3ZOQB 1STUA 2M1SA 2EMWA 1HNXE 1PKPA 1TN9A 2HGHA 2K7IA 4GZNC 2ODRC 2EM5A 1Z1BA 5KL5A 4Q35B 1IBLE 4R8OA 2EOJA 4YHHE 5DNYA 4DV4E 2ELYA 2EJ4A 4TUIA 2V88A 5A2QC 2EOMA 4GKJE 2EM8A 3HTXA 4LF9E 2L2KB 2YPNA 1FJGE 2FGGA 1NCSA 2YTQA 2ENAA 4M2ZA 2EMHA 2EPUA 2L3JA 2CT1A 1MEYC 4BHCA 2E1MA 2WBTA 5FLXC 3J80C 2EPMX 2JOBA 4DKKA 4ZYHA 1A1JA 2MDRA 2LTRA 2VQFE 2YZTA 3OTOE 3MHHC 4RH8A 3VK6A 4JV5E 4KHPE 1X49A 2EZ6A 2EMYA 4LFAE 1UN6B 2UXBE 2H36X 1A1GA 4BC7A 2EN2A 2FV4B 1TF6A 5AE3A 2ENHA 2RS6A 2N3HA 4LF6E 1A1LA 4R2RA 2EMGA 2EORA 1SR9A 1EH6A 2L6MA 3ADGA 5A6BD 5KL2A 2MDGA 2L3CA 4JI7E 1T38A 2EMZA 4I8OA 2ENCA 4NZVA 4YY3E 2EQ1A 2L2MA 4X64E 4DUYE 4M30A 2KONA 5A6AA 1IBME 1N32E 2NUEA 2RTXA 4DR3E 3F6GA 5KL7A 2G7HA 1ZAAC 3P1XA 4R2SA 2EQ0A 4BHBA 2L33A 2JWOA 3KZYA 1X48A 2EP3A 2LJUA 2DSYA 1J26A 3EQ1A 1RQ0A 1B69A 1ZBTA 2LRSA 1I94E 5AE1A 3IWBA 3L00A 3BIDA 1FKAE 1GZ6A 1UHZA 2EE8A 2LO3A 4DV0E 2E72A 1IQOA 2NABA 4R2QA 1UILA 2V86A 4JI2E 1X6FA 4TUGA 4O5GA 2NA2A 1RC7A 5F3WA 3DJWA 3T1YE 1YZ9A 4LTYA 1T4NA 2EMAA 1KJKA 1WXRA 2VRDA 3C6MA 4FK5C 2VF1A 3VYYA 2UXDE 2EOEA 3EPHA 4WYQB 4X65E 2NUGA 5BR8E 1JK2A 3VYXA 3BGHA 2EPAA 5AASA 2LBSB 2V83A 3F6HA 2EQ3A 2IHR1 4KZSA 2YTEA 4OX9E 2JR1A 4HTGA 4M0VA 3T1HE 1IMUA 2EOQA 2CSHA 2GLIA 4X8WA 4IS1C 5ADZA 1P47A 4NHRA 3H09A 1A1KA 2EWLA 2LVHA 2MKDA 3LMLA 2UXCE 2DLKA 2EN8A 4L8NA 5AE2A 3ADLA 2EN6A 2EN7A 4OOGC 2LT7A 1UBDC 1YUJA 2DMIA 1F2IG 2EL4A 1TF3A 2EOIA 5T6JA 3HXLA 5LMUE 1X5WA 2MC6A 2YTGA 3UK3C 2UUAE 1XMOE 2EMKA 4L5NC 4GKKE 4DR6E 2RSIA 1BB8A 1N34E 4LF7E 2EOFA 3LLHA 2EL6A 1G2FC 2EPZA 1YSAC 2F4VE 2YTIA 5AC4A 2EM7A 5KL3A 4DUZE 5IXMB 4WXDA 5KL6A 1T39A 1XNQE 3KZZA 5AC5A 4DV3E 4DR5E 2EPOA 4GEQB 3VHTB 1JK1A 1HNWE 4R2AA 2YTJA 2B3TB 4JI1E 1YYOA 4BMJA 2EM2A 2YTFA 2J7JA 1QU6A 1BBOA 3ECRA 2LTSA 3J7AG 4DR4E 4DR7E 4F9CB 1X6HA 3AV0A 4X66E 2EM4A 3C4TA 4RHBB 1G2DC 4JI3E 2EMIA 5IV8B 1LLMC 2EOSA 2ADRA 4B3ME 2R76A 2L8TA 2EOZA 3HQ1A 4B3SE 2VQEE 1AH5A 2MC5A 1YYKA 2WZOA 2EPNA 2JY9A 2VE7C 3J7Yp 1YYWA 4R03A 3THOB 2EPKX 1J5EE 2E5LE 3JU0A 2DB2A 4F9AB 3BBGA 2ZM6E 3J81C 1WHQA 1EH7A 2EOXA 4WFTA 4WSGA 5IWAE 1ZR9A 1IBKE 3C6KA 4ZYEA 2F8BA 4R2PA 2B7TA 4F6NA 2BBGA 4DV7E 2R1FA 3TQMA 2YT4A 2Q8UA 2WCC3 2HHHE 2D9HA 1T4LB 2YSOA 1WJPA 2UUBE 1O0WA 1PJSA 2DIXA 1X47A 1GTKA 3EPJA 3KWRA 2B9DA 2JOXA 3HPSA 4KWYA 1A1HA 2EMBA 2HC5A 3MHSC 2L92A 1YFHA 1GQEA 4DV6E 3ADJA 4LU9A 2DGCA 2LMZA 4WX9A 2GHFA 2DRPA 2M7QA 4F54A 2EM6A 2EPPA 3ADIA 1DI2A 4K0KE 2N3GA 2N8XA 1ZU1A 3THNA 5KL4A 4X9JA 4DR2E 2EM0A 2RQLA 1XNRE 4IJDA 2NUFA 2LV2A
chains in the Genus database with same CATH topology
2YTOA 2EM9A 3VHTB 1JK1A 5KL7A 1ZAAC 4R2CA 2YTDA 2YTJA 4R2AA 2YU5A 4R2SA 2EQ0A 2ELZA 2EPCA 2RPCA 2EMCA 1AAYA 2EP3A 4F6MA 3EPLA 2EM2A 1YUIA 2YRMA 2CTDA 2YTFA 2EN1A 3EPKA 1B69A 1X3CA 4R2EA 2J7JA 2EN3A 1BBOA 1X6EA 2JPAA 2EL5A 2EE8A 2LO3A 1X6HA 1A1FA 2E72A 2EM4A 2PRTA 2NABA 4R2QA 1G2DC 2EMFA 2EMIA 1X6FA 2EMWA 1LLMC 1TN9A 2EOSA 2HGHA 2ADRA 4GZNC 2EOZA 2BB8A 2DLQA 2EM5A 1Z1BA 2I13A 5KL5A 2EMAA 2JP9A 1KJKA 2VRDA 2EPRA 4FK5C 2EOJA 2ELYA 2EOEA 2EJ4A 2WBSA 4M9VC 3EPHA 2EOMA 2EM8A 2EOXA 2EOHA 2YRHA 2M9AA 4WSGA 2EN4A 2EMLA 1NCSA 1ZR9A 2YSPA 2EPXA 2YTQA 4R2DA 1JK2A 2ENAA 2EMHA 2EPUA 2EOOA 2EPAA 2CT1A 1MEYC 4R2PA 2EQ3A 4F6NA 2YTEA 2R1FA 2EOQA 2WBTA 2WCC3 2CSHA 2GLIA 2D9HA 4IS1C 2YSOA 1P47A 1WJPA 2EOYA 1A1JA 1A1KA 2MKDA 2LVHA 3EPJA 2DLKA 2EN8A 2YTNA 1A1IA 2A25A 2EN6A 2EN7A 3MHHC 3M99B 2LT7A 4F2JC 1UBDC 1YUJA 2DMIA 1F2IG 2EL4A 2EMYA 1UN6B 1TF3A 1A1HA 2EMBA 2EOIA 2YU8A 3MHSC 1A1GA 1X5WA 2EN2A 1TF6A 2YTGA 2LCEA 3UK3C 2ENHA 2EMKA 1RMDA 1A1LA 2DGCA 1BB8A 2RSIA 4R2RA 2EMGA 2EOFA 2EORA 2GHFA 2DRPA 1DGCA 5KL2A 2EL6A 2YTPA 2MDGA 1G2FC 2EPZA 1YSAC 2EM6A 2EPPA 2YTIA 2MKNA 2EMZA 2EMXA 2EM7A 5KL3A 2ENCA 5KL4A 4X9JA 1ZU1A 2EQ1A 2EM0A 5KL6A 2WBUA 4IJDA 2YRKA 2LV2A 2EM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTO A;  2EM9 A;  3VHT B;  1JK1 A;  5KL7 A;  1ZAA C;  4R2C A;  2YTD A;  2YTJ A;  4R2A A;  2YU5 A;  4R2S A;  2EQ0 A;  2ELZ A;  2EPC A;  2RPC A;  2EMC A;  1AAY A;  2EP3 A;  4F6M A;  3EPL A;  2EM2 A;  1YUI A;  2YRM A;  2CTD A;  2YTF A;  2EN1 A;  3EPK A;  1B69 A;  1X3C A;  4R2E A;  2J7J A;  2EN3 A;  1BBO A;  1X6E A;  2JPA A;  2EL5 A;  2EE8 A;  2LO3 A;  1X6H A;  1A1F A;  2E72 A;  2EM4 A;  2PRT A;  2NAB A;  4R2Q A;  1G2D C;  2EMF A;  2EMI A;  1X6F A;  2EMW A;  1LLM C;  1TN9 A;  2EOS A;  2HGH A;  2ADR A;  4GZN C;  2EOZ A;  2BB8 A;  2DLQ A;  2EM5 A;  1Z1B A;  2I13 A;  5KL5 A;  2EMA A;  2JP9 A;  1KJK A;  2VRD A;  2EPR A;  4FK5 C;  2EOJ A;  2ELY A;  2EOE A;  2EJ4 A;  2WBS A;  4M9V C;  3EPH A;  2EOM A;  2EM8 A;  2EOX A;  2EOH A;  2YRH A;  2M9A A;  4WSG A;  2EN4 A;  2EML A;  1NCS A;  1ZR9 A;  2YSP A;  2EPX A;  2YTQ A;  4R2D A;  1JK2 A;  2ENA A;  2EMH A;  2EPU A;  2EOO A;  2EPA A;  2CT1 A;  1MEY C;  4R2P A;  2EQ3 A;  4F6N A;  2YTE A;  2R1F A;  2EOQ A;  2WBT A;  2WCC 3;  2CSH A;  2GLI A;  2D9H A;  4IS1 C;  2YSO A;  1P47 A;  1WJP A;  2EOY A;  1A1J A;  1A1K A;  2MKD A;  2LVH A;  3EPJ A;  2DLK A;  2EN8 A;  2YTN A;  1A1I A;  2A25 A;  2EN6 A;  2EN7 A;  3MHH C;  3M99 B;  2LT7 A;  4F2J C;  1UBD C;  1YUJ A;  2DMI A;  1F2I G;  2EL4 A;  2EMY A;  1UN6 B;  1TF3 A;  1A1H A;  2EMB A;  2EOI A;  2YU8 A;  3MHS C;  1A1G A;  1X5W A;  2EN2 A;  1TF6 A;  2YTG A;  2LCE A;  3UK3 C;  2ENH A;  2EMK A;  1RMD A;  1A1L A;  2DGC A;  1BB8 A;  2RSI A;  4R2R A;  2EMG A;  2EOF A;  2EOR A;  2GHF A;  2DRP A;  1DGC A;  5KL2 A;  2EL6 A;  2YTP A;  2MDG A;  1G2F C;  2EPZ A;  1YSA C;  2EM6 A;  2EPP A;  2YTI A;  2MKN A;  2EMZ A;  2EMX A;  2EM7 A;  5KL3 A;  2ENC A;  5KL4 A;  4X9J A;  1ZU1 A;  2EQ1 A;  2EM0 A;  5KL6 A;  2WBU A;  4IJD A;  2YRK A;  2LV2 A;  2EM3 A; 
#chains in the Genus database with same CATH topology
 3RMP A;  1PDA A;  2LUQ A;  2YWQ A;  2YTO A;  2CPN A;  2YTD A;  2YU5 A;  2ELZ A;  3HPZ A;  4X62 E;  1QNT A;  2EPC A;  5LL6 R;  4LF8 E;  2EMC A;  3EPL A;  1SFE A;  3K6Q A;  4WSP A;  2CTD A;  4BS9 A;  1WRJ A;  1T4O A;  1X3C A;  4R2E A;  2V85 A;  4P7D A;  3JAM C;  2EN3 A;  1YPN A;  1MGT A;  1N36 E;  1PJQ A;  2JPA A;  2EL5 A;  1WHN A;  4WXC A;  3IWD A;  1A1F A;  3FIG A;  1KYQ A;  4DV1 E;  4JI5 E;  2EMF A;  4N4R B;  2RS7 A;  2BB8 A;  2DLQ A;  4DR1 E;  4AQY E;  4P78 A;  2I13 A;  3IWC A;  2JP9 A;  2DMY A;  2EPR A;  4ZYD A;  4JI4 E;  4JI6 E;  4LF5 E;  4F9B B;  4BC9 A;  2WBS A;  4M9V C;  4Q28 A;  2B7V A;  2L2N A;  2JVA A;  2EOH A;  2YRH A;  2EN4 A;  2FTX B;  2JXP A;  2LE2 A;  4O43 A;  1DQ3 A;  2EML A;  2YSP A;  4R2D A;  2EPX A;  1EH8 A;  4LF4 E;  3OML A;  2EOO A;  2I9I A;  5A6J A;  4B3T E;  1N3G A;  1PJT A;  4JI8 E;  4BBY A;  2V87 A;  3MSW A;  2M4I A;  4LFB E;  4DMI A;  1L4S A;  4JYA E;  2EOY A;  2HJJ A;  4O24 A;  2GPI A;  2YTN A;  1A1I A;  2A25 A;  3M99 B;  4F2J C;  5A69 A;  4DV2 E;  1HR0 E;  2LUP B;  2K4V A;  4MLQ A;  2YU8 A;  4JI0 E;  5TSE A;  2EPL X;  2LCE A;  3QG5 C;  1RMD A;  5A6B A;  5IT9 C;  4BCA A;  1N33 E;  4WPY A;  4HEI A;  1DGC A;  4NXN E;  2YTP A;  2KOU A;  3AUZ A;  2V8Q B;  1HNZ E;  1BBG A;  2MKN A;  2EMX A;  5A6K A;  2KHX A;  2LJH A;  4ZYG A;  3JTZ A;  2WBU A;  2YRK A;  5LLQ A;  2M9A A;  2UUC E;  3C4B A;  4J8Z A;  2EM3 A;  2EM9 A;  2UU9 E;  4R2C A;  4O4K A;  2RSM A;  3BF2 A;  1EKZ A;  4B3R E;  2RPC A;  4LFC E;  1AAY A;  5LMN E;  1ZBQ A;  3DF6 A;  4F6M A;  1NEI A;  1YUI A;  2YRM A;  4DV5 E;  2EN1 A;  3EPK A;  2ODR D;  2JYA A;  4NXM E;  5CFF E;  1X6E A;  2V89 A;  1XMQ E;  4MLV A;  1IQS A;  2PRT A;  3ZOQ B;  1STU A;  2M1S A;  2EMW A;  1HNX E;  1PKP A;  1TN9 A;  2HGH A;  2K7I A;  4GZN C;  2ODR C;  2EM5 A;  1Z1B A;  5KL5 A;  4Q35 B;  1IBL E;  4R8O A;  2EOJ A;  4YHH E;  5DNY A;  4DV4 E;  2ELY A;  2EJ4 A;  4TUI A;  2V88 A;  5A2Q C;  2EOM A;  4GKJ E;  2EM8 A;  3HTX A;  4LF9 E;  2L2K B;  2YPN A;  1FJG E;  2FGG A;  1NCS A;  2YTQ A;  2ENA A;  4M2Z A;  2EMH A;  2EPU A;  2L3J A;  2CT1 A;  1MEY C;  4BHC A;  2E1M A;  2WBT A;  5FLX C;  3J80 C;  2EPM X;  2JOB A;  4DKK A;  4ZYH A;  1A1J A;  2MDR A;  2LTR A;  2VQF E;  2YZT A;  3OTO E;  3MHH C;  4RH8 A;  3VK6 A;  4JV5 E;  4KHP E;  1X49 A;  2EZ6 A;  2EMY A;  4LFA E;  1UN6 B;  2UXB E;  2H36 X;  1A1G A;  4BC7 A;  2EN2 A;  2FV4 B;  1TF6 A;  5AE3 A;  2ENH A;  2RS6 A;  2N3H A;  4LF6 E;  1A1L A;  4R2R A;  2EMG A;  2EOR A;  1SR9 A;  1EH6 A;  2L6M A;  3ADG A;  5A6B D;  5KL2 A;  2MDG A;  2L3C A;  4JI7 E;  1T38 A;  2EMZ A;  4I8O A;  2ENC A;  4NZV A;  4YY3 E;  2EQ1 A;  2L2M A;  4X64 E;  4DUY E;  4M30 A;  2KON A;  5A6A A;  1IBM E;  1N32 E;  2NUE A;  2RTX A;  4DR3 E;  3F6G A;  5KL7 A;  2G7H A;  1ZAA C;  3P1X A;  4R2S A;  2EQ0 A;  4BHB A;  2L33 A;  2JWO A;  3KZY A;  1X48 A;  2EP3 A;  2LJU A;  2DSY A;  1J26 A;  3EQ1 A;  1RQ0 A;  1B69 A;  1ZBT A;  2LRS A;  1I94 E;  5AE1 A;  3IWB A;  3L00 A;  3BID A;  1FKA E;  1GZ6 A;  1UHZ A;  2EE8 A;  2LO3 A;  4DV0 E;  2E72 A;  1IQO A;  2NAB A;  4R2Q A;  1UIL A;  2V86 A;  4JI2 E;  1X6F A;  4TUG A;  4O5G A;  2NA2 A;  1RC7 A;  5F3W A;  3DJW A;  3T1Y E;  1YZ9 A;  4LTY A;  1T4N A;  2EMA A;  1KJK A;  1WXR A;  2VRD A;  3C6M A;  4FK5 C;  2VF1 A;  3VYY A;  2UXD E;  2EOE A;  3EPH A;  4WYQ B;  4X65 E;  2NUG A;  5BR8 E;  1JK2 A;  3VYX A;  3BGH A;  2EPA A;  5AAS A;  2LBS B;  2V83 A;  3F6H A;  2EQ3 A;  2IHR 1;  4KZS A;  2YTE A;  4OX9 E;  2JR1 A;  4HTG A;  4M0V A;  3T1H E;  1IMU A;  2EOQ A;  2CSH A;  2GLI A;  4X8W A;  4IS1 C;  5ADZ A;  1P47 A;  4NHR A;  3H09 A;  1A1K A;  2EWL A;  2LVH A;  2MKD A;  3LML A;  2UXC E;  2DLK A;  2EN8 A;  4L8N A;  5AE2 A;  3ADL A;  2EN6 A;  2EN7 A;  4OOG C;  2LT7 A;  1UBD C;  1YUJ A;  2DMI A;  1F2I G;  2EL4 A;  1TF3 A;  2EOI A;  5T6J A;  3HXL A;  5LMU E;  1X5W A;  2MC6 A;  2YTG A;  3UK3 C;  2UUA E;  1XMO E;  2EMK A;  4L5N C;  4GKK E;  4DR6 E;  2RSI A;  1BB8 A;  1N34 E;  4LF7 E;  2EOF A;  3LLH A;  2EL6 A;  1G2F C;  2EPZ A;  1YSA C;  2F4V E;  2YTI A;  5AC4 A;  2EM7 A;  5KL3 A;  4DUZ E;  5IXM B;  4WXD A;  5KL6 A;  1T39 A;  1XNQ E;  3KZZ A;  5AC5 A;  4DV3 E;  4DR5 E;  2EPO A;  4GEQ B;  3VHT B;  1JK1 A;  1HNW E;  4R2A A;  2YTJ A;  2B3T B;  4JI1 E;  1YYO A;  4BMJ A;  2EM2 A;  2YTF A;  2J7J A;  1QU6 A;  1BBO A;  3ECR A;  2LTS A;  3J7A G;  4DR4 E;  4DR7 E;  4F9C B;  1X6H A;  3AV0 A;  4X66 E;  2EM4 A;  3C4T A;  4RHB B;  1G2D C;  4JI3 E;  2EMI A;  5IV8 B;  1LLM C;  2EOS A;  2ADR A;  4B3M E;  2R76 A;  2L8T A;  2EOZ A;  3HQ1 A;  4B3S E;  2VQE E;  1AH5 A;  2MC5 A;  1YYK A;  2WZO A;  2EPN A;  2JY9 A;  2VE7 C;  3J7Y p;  1YYW A;  4R03 A;  3THO B;  2EPK X;  1J5E E;  2E5L E;  3JU0 A;  2DB2 A;  4F9A B;  3BBG A;  2ZM6 E;  3J81 C;  1WHQ A;  1EH7 A;  2EOX A;  4WFT A;  4WSG A;  5IWA E;  1ZR9 A;  1IBK E;  3C6K A;  4ZYE A;  2F8B A;  4R2P A;  2B7T A;  4F6N A;  2BBG A;  4DV7 E;  2R1F A;  3TQM A;  2YT4 A;  2Q8U A;  2WCC 3;  2HHH E;  2D9H A;  1T4L B;  2YSO A;  1WJP A;  2UUB E;  1O0W A;  1PJS A;  2DIX A;  1X47 A;  1GTK A;  3EPJ A;  3KWR A;  2B9D A;  2JOX A;  3HPS A;  4KWY A;  1A1H A;  2EMB A;  2HC5 A;  3MHS C;  2L92 A;  1YFH A;  1GQE A;  4DV6 E;  3ADJ A;  4LU9 A;  2DGC A;  2LMZ A;  4WX9 A;  2GHF A;  2DRP A;  2M7Q A;  4F54 A;  2EM6 A;  2EPP A;  3ADI A;  1DI2 A;  4K0K E;  2N3G A;  2N8X A;  1ZU1 A;  3THN A;  5KL4 A;  4X9J A;  4DR2 E;  2EM0 A;  2RQL A;  1XNR E;  4IJD A;  2NUF A;  2LV2 A; 
#chains in the Genus database with same CATH homology
 2YTO A;  2EM9 A;  3VHT B;  1JK1 A;  5KL7 A;  1ZAA C;  4R2C A;  2YTD A;  2YTJ A;  4R2A A;  2YU5 A;  4R2S A;  2EQ0 A;  2ELZ A;  2EPC A;  2RPC A;  2EMC A;  1AAY A;  2EP3 A;  4F6M A;  3EPL A;  2EM2 A;  1YUI A;  2YRM A;  2CTD A;  2YTF A;  2EN1 A;  3EPK A;  1B69 A;  1X3C A;  4R2E A;  2J7J A;  2EN3 A;  1BBO A;  1X6E A;  2JPA A;  2EL5 A;  2EE8 A;  2LO3 A;  1X6H A;  1A1F A;  2E72 A;  2EM4 A;  2PRT A;  2NAB A;  4R2Q A;  1G2D C;  2EMF A;  2EMI A;  1X6F A;  2EMW A;  1LLM C;  1TN9 A;  2EOS A;  2HGH A;  2ADR A;  4GZN C;  2EOZ A;  2BB8 A;  2DLQ A;  2EM5 A;  1Z1B A;  2I13 A;  5KL5 A;  2EMA A;  2JP9 A;  1KJK A;  2VRD A;  2EPR A;  4FK5 C;  2EOJ A;  2ELY A;  2EOE A;  2EJ4 A;  2WBS A;  4M9V C;  3EPH A;  2EOM A;  2EM8 A;  2EOX A;  2EOH A;  2YRH A;  2M9A A;  4WSG A;  2EN4 A;  2EML A;  1NCS A;  1ZR9 A;  2YSP A;  2EPX A;  2YTQ A;  4R2D A;  1JK2 A;  2ENA A;  2EMH A;  2EPU A;  2EOO A;  2EPA A;  2CT1 A;  1MEY C;  4R2P A;  2EQ3 A;  4F6N A;  2YTE A;  2R1F A;  2EOQ A;  2WBT A;  2WCC 3;  2CSH A;  2GLI A;  2D9H A;  4IS1 C;  2YSO A;  1P47 A;  1WJP A;  2EOY A;  1A1J A;  1A1K A;  2MKD A;  2LVH A;  3EPJ A;  2DLK A;  2EN8 A;  2YTN A;  1A1I A;  2A25 A;  2EN6 A;  2EN7 A;  3MHH C;  3M99 B;  2LT7 A;  4F2J C;  1UBD C;  1YUJ A;  2DMI A;  1F2I G;  2EL4 A;  2EMY A;  1UN6 B;  1TF3 A;  1A1H A;  2EMB A;  2EOI A;  2YU8 A;  3MHS C;  1A1G A;  1X5W A;  2EN2 A;  1TF6 A;  2YTG A;  2LCE A;  3UK3 C;  2ENH A;  2EMK A;  1RMD A;  1A1L A;  2DGC A;  1BB8 A;  2RSI A;  4R2R A;  2EMG A;  2EOF A;  2EOR A;  2GHF A;  2DRP A;  1DGC A;  5KL2 A;  2EL6 A;  2YTP A;  2MDG A;  1G2F C;  2EPZ A;  1YSA C;  2EM6 A;  2EPP A;  2YTI A;  2MKN A;  2EMZ A;  2EMX A;  2EM7 A;  5KL3 A;  2ENC A;  5KL4 A;  4X9J A;  1ZU1 A;  2EQ1 A;  2EM0 A;  5KL6 A;  2WBU A;  4IJD A;  2YRK A;  2LV2 A;  2EM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...