4R2DA

Egr1/zif268 zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Early growth response protein 1
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2dA00
2WBSA 1X3CA 1YUJA 2EMAA 2BB8A 2EOMA 3MHHC 4WSGA 2WBTA 2YRHA 1ZAAC 2EN8A 3UK3C 2EL4A 2EPCA 2EQ1A 2EN4A 2EN2A 2EPXA 2EOQA 1A1KA 2EOIA 1MEYC 1A1IA 5KL7A 2DLKA 1A1FA 1LLMC 2DGCA 4IJDA 1ZR9A 2EE8A 2ELYA 1JK2A 2EQ0A 1BB8A 2EPPA 2EMHA 4X9JA 2YRMA 3EPKA 2EM9A 2YTEA 4R2CA 2EM0A 2EOOA 2NABA 3EPLA 1G2FC 2EPRA 2ENCA 1JK1A 2GHFA 2EOHA 2EMWA 4M9VC 2YTNA 1UBDC 2YTJA 2R1FA 2EPUA 2LV2A 4F6NA 2CTDA 2A25A 5KL3A 2MDGA 2YTGA 2E72A 4FK5C 3M99B 2EM6A 2EOSA 2EMYA 2YSPA 3MHSC 2WCC3 2MKNA 2CT1A 2EOXA 2DLQA 1G2DC 2LCEA 1X5WA 2MKDA 2EL5A 2EMBA 2LO3A 5KL4A 2ENAA 2EORA 2EMIA 2EN1A 2EOJA 2J7JA 1TF6A 3VHTB 1X6EA 2EQ3A 1X6FA 4F2JC 3EPHA 2I13A 1UN6B 1F2IG 4F6MA 2ADRA 2YTOA 2EPAA 4R2AA 2RPCA 2YRKA 1TF3A 2PRTA 2EM7A 2EOZA 4R2PA 2YTIA 2YSOA 1Z1BA 2DRPA 1WJPA 4R2DA 2EM4A 4R2RA 1P47A 2LT7A 2EM5A 2EM2A 2EPZA 1RMDA 1A1JA 2GLIA 2JPAA 1ZU1A 2EMFA 1NCSA 2EM8A 2YTFA 2EMZA 4R2SA 2EJ4A 4R2EA 2ENHA 1TN9A 2JP9A 2EOYA 1A1GA 1A1HA 2EP3A 2EN7A 2YU5A 4GZNC 5KL6A 4R2QA 2EN3A 5KL2A 2DMIA 2EMCA 2EN6A 2EOEA 2HGHA 2YTDA 1KJKA 2YU8A 1YUIA 1B69A 2LVHA 2VRDA 2EMLA 2ELZA 5KL5A 1A1LA 4IS1C 2EMXA 2CSHA 2EL6A 2EM3A 2M9AA 1AAYA 1YSAC 1BBOA 2D9HA 3EPJA 2EMGA 2EMKA 1DGCA 2YTPA 2YTQA 2EOFA 2WBUA 1X6HA 2RSIA
chains in the Genus database with same CATH superfamily
2RTXA 2WBSA 1YUJA 4WXCA 2N3GA 4LTYA 5LMUE 4DKKA 2YRHA 2EN8A 1IQSA 2NA2A 1T4NA 3BBGA 4Q28A 4WYQB 1A1KA 4BHCA 4F9CB 1SFEA 4JI0E 4NHRA 1A1FA 2FTXB 1LLMC 2DGCA 3ZOQB 1PJQA 2EQ0A 5IV8B 2EPPA 2EMHA 5IWAE 2EM9A 2B7VA 4OX9E 3H09A 2LRSA 2RS7A 2EPRA 1XMQE 3HTXA 2UXCE 1RC7A 2R1FA 1SR9A 2CTDA 1N36E 2MDGA 3IWBA 3M99B 2EM6A 2YSPA 3RMPA 4X66E 3C6MA 1HNZE 2MKNA 2RQLA 1G2DC 4LF8E 2MKDA 2NUGA 4DV1E 4BC7A 2RSMA 3JU0A 1ZBTA 2FGGA 2J7JA 1X6EA 5A6AA 3EPHA 2I13A 1UN6B 1F2IG 4JI6E 2K4VA 2RPCA 3THOB 2EZ6A 4P78A 3J7Yp 1HR0E 1GTKA 5LLQA 2UXBE 2K7IA 5AASA 1PDAA 1Z1BA 2UUAE 1YZ9A 4R2DA 2EM4A 1P47A 2LT7A 2EPZA 2LE2A 2EMZA 3AUZA 4WFTA 2UU9E 4DMIA 4JI5E 1XNRE 1XNQE 2UXDE 4JI7E 2VF1A 2EP3A 4GZNC 2LTSA 4GKKE 3C4BA 5KL2A 2DMIA 2MDRA 2LVHA 1GZ6A 1PJTA 3JTZA 3DF6A 4DR3E 4LFBE 1A1LA 1WHQA 1QU6A 4KZSA 2EMXA 2CSHA 2D9HA 3EPJA 1NEIA 2YTQA 2MC5A 3IWDA 1EKZA 4KWYA 2RS6A 1X6HA 3MSWA 4RHBB 2RSIA 4OOGC 1YYOA 1X3CA 2EMAA 2BB8A 4AQYE 3MHHC 3UK3C 1N33E 3THNA 5CFFE 2EPCA 2KOUA 5F3WA 1I94E 1WXRA 2B9DA 2EOIA 4M30A 3HPSA 1DQ3A 5KL7A 3C6KA 4O5GA 4DR2E 1X47A 5TSEA 4IJDA 2ELYA 1BB8A 2YRMA 2M4IA 4BMJA 4R8OA 2NABA 3KWRA 5IXMB 4LF6E 2H36X 1FKAE 2GHFA 4RH8A 2L3JA 4L5NC 4WXDA 4N4RB 2EPUA 4I8OA 2LV2A 1MGTA 3F6HA 3HPZA 2ODRD 2YPNA 3DJWA 2WCC3 1HNWE 2CT1A 2EOXA 4KHPE 3BIDA 2EMBA 2M1SA 4DUZE 2EN1A 2LUQA 1N32E 4NXNE 1TF6A 4O43A 2EQ3A 4DV5E 1X6FA 4HEIA 1QNTA 5A6BD 4BBYA 2EPAA 2LTRA 1TF3A 2PRTA 2EOZA 4R2PA 4JYAE 2YSOA 2DRPA 4R2RA 2EPMX 2EM5A 1RMDA 3JAMC 2VQFE 2GLIA 4LFAE 1UILA 3F6GA 4JI8E 2YTFA 5LMNE 4R2SA 1IMUA 2EJ4A 1PJSA 2ENHA 3C4TA 5AC4A 3VYXA 2JP9A 4LF5E 2EN7A 2YU5A 2EN3A 3P1XA 4LF9E 4M0VA 2EMCA 2EN6A 4B3RE 4Q35B 1YUIA 1B69A 2BBGA 2VRDA 3BGHA 1X48A 1T4LB 2ELZA 5KL5A 2YZTA 4IS1C 2EL6A 2EM3A 2V85A 2M9AA 1AAYA 4ZYGA 2YTPA 2WBUA 2EPNA 4MLVA 5AC5A 2L8TA 3HQ1A 1FJGE 5T6JA 4DV0E 2EOMA 4MLQA 1ZAAC 2DIXA 3OTOE 2EL4A 2Q8UA 2EQ1A 2E1MA 2EN2A 2EPXA 5AE1A 1MEYC 4GKJE 2LMZA 4GEQB 1A1IA 2DLKA 4NXME 1EH8A 3ADGA 2LJUA 1YYKA 4X9JA 3EPKA 4BCAA 2EM0A 2EOOA 2YWQA 2F8BA 4DV7E 4NZVA 1JK1A 3T1HE 4WPYA 2EOHA 2EMWA 4LF4E 4M9VC 1UBDC 1GQEA 3ADJA 3T1YE 2UUCE 4F6NA 1YPNA 2YTGA 2EPLX 2YT4A 2E72A 4JI2E 3MHSC 2JOXA 2LBSB 3ECRA 1PKPA 2N3HA 4B3ME 4ZYDA 2LCEA 2B3TB 1X5WA 2JR1A 2JOBA 2EORA 3L00A 1AH5A 5AE2A 4JI3E 4LFCE 2EOJA 4JI4E 3VK6A 4HTGA 2L6MA 2V89A 1J5EE 3ADIA 1WHNA 2ZM6E 4R2AA 2L33A 1KYQA 1BBGA 4B3SE 4J8ZA 2EM7A 1T4OA 2YTIA 4DR6E 2V88A 2WZOA 4LU9A 4O4KA 4X65E 5A6KA 1ZU1A 2EMFA 2KHXA 2EPOA 5AE3A 4DV3E 2VQEE 3HXLA 3J80C 1RQ0A 1TN9A 1IBME 1IQOA 2EPKX 3TQMA 2EOYA 2FV4B 3AV0A 2LUPB 1YFHA 3LMLA 1ZBQA 5KL6A 4R2QA 2KONA 4P7DA 1EH7A 2EOEA 2HGHA 2YTDA 5A6JA 2MC6A 5IT9C 1IBKE 5BR8E 1EH6A 1DGCA 3J81C 2B7TA 2EOFA 1UHZA 2EWLA 3ADLA 2HJJA 4YY3E 2VE7C 2L2KB 4LF7E 4WSGA 2WBTA 2V8QB 2L3CA 2LJHA 2HHHE 2EN4A 2EOQA 4DUYE 2JYAA 2E5LE 2V86A 4WX9A 5LL6R 1T38A 1HNXE 1ZR9A 3FIGA 2EE8A 3OMLA 1JK2A 4DV6E 2DB2A 2ODRC 2YTEA 4R2CA 4F9AB 1YYWA 3EPLA 1G2FC 2ENCA 4F9BB 4B3TE 1STUA 4R03A 2V87A 2YTNA 1XMOE 2YTJA 3KZYA 2A25A 4BC9A 5KL3A 4FK5C 2EOSA 4WSPA 2EMYA 4TUGA 4JI1E 5ADZA 4M2ZA 2F4VE 2DLQA 2DMYA 2UUBE 2EL5A 4X64E 2LO3A 1N34E 5KL4A 2ENAA 4ZYHA 2EMIA 5A6BA 3J7AG 3K6QA 1DI2A 2L2NA 3VHTB 2JVAA 2DSYA 4F2JC 4DR5E 2GPIA 5A69A 4F6MA 2ADRA 2NUEA 2YTOA 4YHHE 2YRKA 2I9IA 4DR4E 4X8WA 4DV4E 1T39A 4DR1E 1WJPA 2L2MA 3IWCA 3BF2A 2EM2A 1A1JA 2NUFA 2JPAA 3KZZA 2IHR1 2EM8A 1NCSA 1WRJA 4ZYEA 2L92A 2N8XA 4R2EA 2JY9A 4F54A 1L4SA 4DV2E 4JV5E 1A1GA 5A2QC 1A1HA 1X49A 2JXPA 1N3GA 2HC5A 2CPNA 4O24A 4X62E 2V83A 4BHBA 2R76A 3EQ1A 5FLXC 1KJKA 4DR7E 1IBLE 3QG5C 2G7HA 1J26A 2YU8A 2M7QA 2EMLA 4L8NA 3VYYA 4K0KE 4TUIA 1YSAC 1BBOA 2EMGA 2EMKA 2JWOA 3LLHA 1O0WA 4BS9A 5DNYA
chains in the Genus database with same CATH topology
2WBSA 1X3CA 1YUJA 2EMAA 2BB8A 2EOMA 3MHHC 4WSGA 2WBTA 2YRHA 1ZAAC 2EN8A 3UK3C 2EL4A 2EPCA 2EQ1A 2EN4A 2EN2A 2EPXA 2EOQA 1A1KA 2EOIA 1MEYC 1A1IA 5KL7A 2DLKA 1A1FA 1LLMC 2DGCA 4IJDA 1ZR9A 2EE8A 2ELYA 1JK2A 2EQ0A 1BB8A 2EPPA 2EMHA 4X9JA 2YRMA 3EPKA 2EM9A 2YTEA 4R2CA 2EM0A 2EOOA 2NABA 3EPLA 1G2FC 2EPRA 2ENCA 1JK1A 2GHFA 2EOHA 2EMWA 4M9VC 2YTNA 1UBDC 2YTJA 2R1FA 2EPUA 2LV2A 4F6NA 2CTDA 2A25A 5KL3A 2MDGA 2YTGA 2E72A 4FK5C 3M99B 2EM6A 2EOSA 2EMYA 2YSPA 3MHSC 2WCC3 2MKNA 2CT1A 2EOXA 2DLQA 1G2DC 2LCEA 1X5WA 2MKDA 2EL5A 2EMBA 2LO3A 5KL4A 2ENAA 2EORA 2EMIA 2EN1A 2EOJA 2J7JA 1TF6A 3VHTB 1X6EA 2EQ3A 1X6FA 4F2JC 3EPHA 2I13A 1UN6B 1F2IG 4F6MA 2ADRA 2YTOA 2EPAA 4R2AA 2RPCA 2YRKA 1TF3A 2PRTA 2EM7A 2EOZA 4R2PA 2YTIA 2YSOA 1Z1BA 2DRPA 1WJPA 4R2DA 2EM4A 4R2RA 1P47A 2LT7A 2EM5A 2EM2A 2EPZA 1RMDA 1A1JA 2GLIA 2JPAA 1ZU1A 2EMFA 1NCSA 2EM8A 2YTFA 2EMZA 4R2SA 2EJ4A 4R2EA 2ENHA 1TN9A 2JP9A 2EOYA 1A1GA 1A1HA 2EP3A 2EN7A 2YU5A 4GZNC 5KL6A 4R2QA 2EN3A 5KL2A 2DMIA 2EMCA 2EN6A 2EOEA 2HGHA 2YTDA 1KJKA 2YU8A 1YUIA 1B69A 2LVHA 2VRDA 2EMLA 2ELZA 5KL5A 1A1LA 4IS1C 2EMXA 2CSHA 2EL6A 2EM3A 2M9AA 1AAYA 1YSAC 1BBOA 2D9HA 3EPJA 2EMGA 2EMKA 1DGCA 2YTPA 2YTQA 2EOFA 2WBUA 1X6HA 2RSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBS A;  1X3C A;  1YUJ A;  2EMA A;  2BB8 A;  2EOM A;  3MHH C;  4WSG A;  2WBT A;  2YRH A;  1ZAA C;  2EN8 A;  3UK3 C;  2EL4 A;  2EPC A;  2EQ1 A;  2EN4 A;  2EN2 A;  2EPX A;  2EOQ A;  1A1K A;  2EOI A;  1MEY C;  1A1I A;  5KL7 A;  2DLK A;  1A1F A;  1LLM C;  2DGC A;  4IJD A;  1ZR9 A;  2EE8 A;  2ELY A;  1JK2 A;  2EQ0 A;  1BB8 A;  2EPP A;  2EMH A;  4X9J A;  2YRM A;  3EPK A;  2EM9 A;  2YTE A;  4R2C A;  2EM0 A;  2EOO A;  2NAB A;  3EPL A;  1G2F C;  2EPR A;  2ENC A;  1JK1 A;  2GHF A;  2EOH A;  2EMW A;  4M9V C;  2YTN A;  1UBD C;  2YTJ A;  2R1F A;  2EPU A;  2LV2 A;  4F6N A;  2CTD A;  2A25 A;  5KL3 A;  2MDG A;  2YTG A;  2E72 A;  4FK5 C;  3M99 B;  2EM6 A;  2EOS A;  2EMY A;  2YSP A;  3MHS C;  2WCC 3;  2MKN A;  2CT1 A;  2EOX A;  2DLQ A;  1G2D C;  2LCE A;  1X5W A;  2MKD A;  2EL5 A;  2EMB A;  2LO3 A;  5KL4 A;  2ENA A;  2EOR A;  2EMI A;  2EN1 A;  2EOJ A;  2J7J A;  1TF6 A;  3VHT B;  1X6E A;  2EQ3 A;  1X6F A;  4F2J C;  3EPH A;  2I13 A;  1UN6 B;  1F2I G;  4F6M A;  2ADR A;  2YTO A;  2EPA A;  4R2A A;  2RPC A;  2YRK A;  1TF3 A;  2PRT A;  2EM7 A;  2EOZ A;  4R2P A;  2YTI A;  2YSO A;  1Z1B A;  2DRP A;  1WJP A;  4R2D A;  2EM4 A;  4R2R A;  1P47 A;  2LT7 A;  2EM5 A;  2EM2 A;  2EPZ A;  1RMD A;  1A1J A;  2GLI A;  2JPA A;  1ZU1 A;  2EMF A;  1NCS A;  2EM8 A;  2YTF A;  2EMZ A;  4R2S A;  2EJ4 A;  4R2E A;  2ENH A;  1TN9 A;  2JP9 A;  2EOY A;  1A1G A;  1A1H A;  2EP3 A;  2EN7 A;  2YU5 A;  4GZN C;  5KL6 A;  4R2Q A;  2EN3 A;  5KL2 A;  2DMI A;  2EMC A;  2EN6 A;  2EOE A;  2HGH A;  2YTD A;  1KJK A;  2YU8 A;  1YUI A;  1B69 A;  2LVH A;  2VRD A;  2EML A;  2ELZ A;  5KL5 A;  1A1L A;  4IS1 C;  2EMX A;  2CSH A;  2EL6 A;  2EM3 A;  2M9A A;  1AAY A;  1YSA C;  1BBO A;  2D9H A;  3EPJ A;  2EMG A;  2EMK A;  1DGC A;  2YTP A;  2YTQ A;  2EOF A;  2WBU A;  1X6H A;  2RSI A; 
#chains in the Genus database with same CATH topology
 2RTX A;  2WBS A;  1YUJ A;  4WXC A;  2N3G A;  4LTY A;  5LMU E;  4DKK A;  2YRH A;  2EN8 A;  1IQS A;  2NA2 A;  1T4N A;  3BBG A;  4Q28 A;  4WYQ B;  1A1K A;  4BHC A;  4F9C B;  1SFE A;  4JI0 E;  4NHR A;  1A1F A;  2FTX B;  1LLM C;  2DGC A;  3ZOQ B;  1PJQ A;  2EQ0 A;  5IV8 B;  2EPP A;  2EMH A;  5IWA E;  2EM9 A;  2B7V A;  4OX9 E;  3H09 A;  2LRS A;  2RS7 A;  2EPR A;  1XMQ E;  3HTX A;  2UXC E;  1RC7 A;  2R1F A;  1SR9 A;  2CTD A;  1N36 E;  2MDG A;  3IWB A;  3M99 B;  2EM6 A;  2YSP A;  3RMP A;  4X66 E;  3C6M A;  1HNZ E;  2MKN A;  2RQL A;  1G2D C;  4LF8 E;  2MKD A;  2NUG A;  4DV1 E;  4BC7 A;  2RSM A;  3JU0 A;  1ZBT A;  2FGG A;  2J7J A;  1X6E A;  5A6A A;  3EPH A;  2I13 A;  1UN6 B;  1F2I G;  4JI6 E;  2K4V A;  2RPC A;  3THO B;  2EZ6 A;  4P78 A;  3J7Y p;  1HR0 E;  1GTK A;  5LLQ A;  2UXB E;  2K7I A;  5AAS A;  1PDA A;  1Z1B A;  2UUA E;  1YZ9 A;  4R2D A;  2EM4 A;  1P47 A;  2LT7 A;  2EPZ A;  2LE2 A;  2EMZ A;  3AUZ A;  4WFT A;  2UU9 E;  4DMI A;  4JI5 E;  1XNR E;  1XNQ E;  2UXD E;  4JI7 E;  2VF1 A;  2EP3 A;  4GZN C;  2LTS A;  4GKK E;  3C4B A;  5KL2 A;  2DMI A;  2MDR A;  2LVH A;  1GZ6 A;  1PJT A;  3JTZ A;  3DF6 A;  4DR3 E;  4LFB E;  1A1L A;  1WHQ A;  1QU6 A;  4KZS A;  2EMX A;  2CSH A;  2D9H A;  3EPJ A;  1NEI A;  2YTQ A;  2MC5 A;  3IWD A;  1EKZ A;  4KWY A;  2RS6 A;  1X6H A;  3MSW A;  4RHB B;  2RSI A;  4OOG C;  1YYO A;  1X3C A;  2EMA A;  2BB8 A;  4AQY E;  3MHH C;  3UK3 C;  1N33 E;  3THN A;  5CFF E;  2EPC A;  2KOU A;  5F3W A;  1I94 E;  1WXR A;  2B9D A;  2EOI A;  4M30 A;  3HPS A;  1DQ3 A;  5KL7 A;  3C6K A;  4O5G A;  4DR2 E;  1X47 A;  5TSE A;  4IJD A;  2ELY A;  1BB8 A;  2YRM A;  2M4I A;  4BMJ A;  4R8O A;  2NAB A;  3KWR A;  5IXM B;  4LF6 E;  2H36 X;  1FKA E;  2GHF A;  4RH8 A;  2L3J A;  4L5N C;  4WXD A;  4N4R B;  2EPU A;  4I8O A;  2LV2 A;  1MGT A;  3F6H A;  3HPZ A;  2ODR D;  2YPN A;  3DJW A;  2WCC 3;  1HNW E;  2CT1 A;  2EOX A;  4KHP E;  3BID A;  2EMB A;  2M1S A;  4DUZ E;  2EN1 A;  2LUQ A;  1N32 E;  4NXN E;  1TF6 A;  4O43 A;  2EQ3 A;  4DV5 E;  1X6F A;  4HEI A;  1QNT A;  5A6B D;  4BBY A;  2EPA A;  2LTR A;  1TF3 A;  2PRT A;  2EOZ A;  4R2P A;  4JYA E;  2YSO A;  2DRP A;  4R2R A;  2EPM X;  2EM5 A;  1RMD A;  3JAM C;  2VQF E;  2GLI A;  4LFA E;  1UIL A;  3F6G A;  4JI8 E;  2YTF A;  5LMN E;  4R2S A;  1IMU A;  2EJ4 A;  1PJS A;  2ENH A;  3C4T A;  5AC4 A;  3VYX A;  2JP9 A;  4LF5 E;  2EN7 A;  2YU5 A;  2EN3 A;  3P1X A;  4LF9 E;  4M0V A;  2EMC A;  2EN6 A;  4B3R E;  4Q35 B;  1YUI A;  1B69 A;  2BBG A;  2VRD A;  3BGH A;  1X48 A;  1T4L B;  2ELZ A;  5KL5 A;  2YZT A;  4IS1 C;  2EL6 A;  2EM3 A;  2V85 A;  2M9A A;  1AAY A;  4ZYG A;  2YTP A;  2WBU A;  2EPN A;  4MLV A;  5AC5 A;  2L8T A;  3HQ1 A;  1FJG E;  5T6J A;  4DV0 E;  2EOM A;  4MLQ A;  1ZAA C;  2DIX A;  3OTO E;  2EL4 A;  2Q8U A;  2EQ1 A;  2E1M A;  2EN2 A;  2EPX A;  5AE1 A;  1MEY C;  4GKJ E;  2LMZ A;  4GEQ B;  1A1I A;  2DLK A;  4NXM E;  1EH8 A;  3ADG A;  2LJU A;  1YYK A;  4X9J A;  3EPK A;  4BCA A;  2EM0 A;  2EOO A;  2YWQ A;  2F8B A;  4DV7 E;  4NZV A;  1JK1 A;  3T1H E;  4WPY A;  2EOH A;  2EMW A;  4LF4 E;  4M9V C;  1UBD C;  1GQE A;  3ADJ A;  3T1Y E;  2UUC E;  4F6N A;  1YPN A;  2YTG A;  2EPL X;  2YT4 A;  2E72 A;  4JI2 E;  3MHS C;  2JOX A;  2LBS B;  3ECR A;  1PKP A;  2N3H A;  4B3M E;  4ZYD A;  2LCE A;  2B3T B;  1X5W A;  2JR1 A;  2JOB A;  2EOR A;  3L00 A;  1AH5 A;  5AE2 A;  4JI3 E;  4LFC E;  2EOJ A;  4JI4 E;  3VK6 A;  4HTG A;  2L6M A;  2V89 A;  1J5E E;  3ADI A;  1WHN A;  2ZM6 E;  4R2A A;  2L33 A;  1KYQ A;  1BBG A;  4B3S E;  4J8Z A;  2EM7 A;  1T4O A;  2YTI A;  4DR6 E;  2V88 A;  2WZO A;  4LU9 A;  4O4K A;  4X65 E;  5A6K A;  1ZU1 A;  2EMF A;  2KHX A;  2EPO A;  5AE3 A;  4DV3 E;  2VQE E;  3HXL A;  3J80 C;  1RQ0 A;  1TN9 A;  1IBM E;  1IQO A;  2EPK X;  3TQM A;  2EOY A;  2FV4 B;  3AV0 A;  2LUP B;  1YFH A;  3LML A;  1ZBQ A;  5KL6 A;  4R2Q A;  2KON A;  4P7D A;  1EH7 A;  2EOE A;  2HGH A;  2YTD A;  5A6J A;  2MC6 A;  5IT9 C;  1IBK E;  5BR8 E;  1EH6 A;  1DGC A;  3J81 C;  2B7T A;  2EOF A;  1UHZ A;  2EWL A;  3ADL A;  2HJJ A;  4YY3 E;  2VE7 C;  2L2K B;  4LF7 E;  4WSG A;  2WBT A;  2V8Q B;  2L3C A;  2LJH A;  2HHH E;  2EN4 A;  2EOQ A;  4DUY E;  2JYA A;  2E5L E;  2V86 A;  4WX9 A;  5LL6 R;  1T38 A;  1HNX E;  1ZR9 A;  3FIG A;  2EE8 A;  3OML A;  1JK2 A;  4DV6 E;  2DB2 A;  2ODR C;  2YTE A;  4R2C A;  4F9A B;  1YYW A;  3EPL A;  1G2F C;  2ENC A;  4F9B B;  4B3T E;  1STU A;  4R03 A;  2V87 A;  2YTN A;  1XMO E;  2YTJ A;  3KZY A;  2A25 A;  4BC9 A;  5KL3 A;  4FK5 C;  2EOS A;  4WSP A;  2EMY A;  4TUG A;  4JI1 E;  5ADZ A;  4M2Z A;  2F4V E;  2DLQ A;  2DMY A;  2UUB E;  2EL5 A;  4X64 E;  2LO3 A;  1N34 E;  5KL4 A;  2ENA A;  4ZYH A;  2EMI A;  5A6B A;  3J7A G;  3K6Q A;  1DI2 A;  2L2N A;  3VHT B;  2JVA A;  2DSY A;  4F2J C;  4DR5 E;  2GPI A;  5A69 A;  4F6M A;  2ADR A;  2NUE A;  2YTO A;  4YHH E;  2YRK A;  2I9I A;  4DR4 E;  4X8W A;  4DV4 E;  1T39 A;  4DR1 E;  1WJP A;  2L2M A;  3IWC A;  3BF2 A;  2EM2 A;  1A1J A;  2NUF A;  2JPA A;  3KZZ A;  2IHR 1;  2EM8 A;  1NCS A;  1WRJ A;  4ZYE A;  2L92 A;  2N8X A;  4R2E A;  2JY9 A;  4F54 A;  1L4S A;  4DV2 E;  4JV5 E;  1A1G A;  5A2Q C;  1A1H A;  1X49 A;  2JXP A;  1N3G A;  2HC5 A;  2CPN A;  4O24 A;  4X62 E;  2V83 A;  4BHB A;  2R76 A;  3EQ1 A;  5FLX C;  1KJK A;  4DR7 E;  1IBL E;  3QG5 C;  2G7H A;  1J26 A;  2YU8 A;  2M7Q A;  2EML A;  4L8N A;  3VYY A;  4K0K E;  4TUI A;  1YSA C;  1BBO A;  2EMG A;  2EMK A;  2JWO A;  3LLH A;  1O0W A;  4BS9 A;  5DNY A; 
#chains in the Genus database with same CATH homology
 2WBS A;  1X3C A;  1YUJ A;  2EMA A;  2BB8 A;  2EOM A;  3MHH C;  4WSG A;  2WBT A;  2YRH A;  1ZAA C;  2EN8 A;  3UK3 C;  2EL4 A;  2EPC A;  2EQ1 A;  2EN4 A;  2EN2 A;  2EPX A;  2EOQ A;  1A1K A;  2EOI A;  1MEY C;  1A1I A;  5KL7 A;  2DLK A;  1A1F A;  1LLM C;  2DGC A;  4IJD A;  1ZR9 A;  2EE8 A;  2ELY A;  1JK2 A;  2EQ0 A;  1BB8 A;  2EPP A;  2EMH A;  4X9J A;  2YRM A;  3EPK A;  2EM9 A;  2YTE A;  4R2C A;  2EM0 A;  2EOO A;  2NAB A;  3EPL A;  1G2F C;  2EPR A;  2ENC A;  1JK1 A;  2GHF A;  2EOH A;  2EMW A;  4M9V C;  2YTN A;  1UBD C;  2YTJ A;  2R1F A;  2EPU A;  2LV2 A;  4F6N A;  2CTD A;  2A25 A;  5KL3 A;  2MDG A;  2YTG A;  2E72 A;  4FK5 C;  3M99 B;  2EM6 A;  2EOS A;  2EMY A;  2YSP A;  3MHS C;  2WCC 3;  2MKN A;  2CT1 A;  2EOX A;  2DLQ A;  1G2D C;  2LCE A;  1X5W A;  2MKD A;  2EL5 A;  2EMB A;  2LO3 A;  5KL4 A;  2ENA A;  2EOR A;  2EMI A;  2EN1 A;  2EOJ A;  2J7J A;  1TF6 A;  3VHT B;  1X6E A;  2EQ3 A;  1X6F A;  4F2J C;  3EPH A;  2I13 A;  1UN6 B;  1F2I G;  4F6M A;  2ADR A;  2YTO A;  2EPA A;  4R2A A;  2RPC A;  2YRK A;  1TF3 A;  2PRT A;  2EM7 A;  2EOZ A;  4R2P A;  2YTI A;  2YSO A;  1Z1B A;  2DRP A;  1WJP A;  4R2D A;  2EM4 A;  4R2R A;  1P47 A;  2LT7 A;  2EM5 A;  2EM2 A;  2EPZ A;  1RMD A;  1A1J A;  2GLI A;  2JPA A;  1ZU1 A;  2EMF A;  1NCS A;  2EM8 A;  2YTF A;  2EMZ A;  4R2S A;  2EJ4 A;  4R2E A;  2ENH A;  1TN9 A;  2JP9 A;  2EOY A;  1A1G A;  1A1H A;  2EP3 A;  2EN7 A;  2YU5 A;  4GZN C;  5KL6 A;  4R2Q A;  2EN3 A;  5KL2 A;  2DMI A;  2EMC A;  2EN6 A;  2EOE A;  2HGH A;  2YTD A;  1KJK A;  2YU8 A;  1YUI A;  1B69 A;  2LVH A;  2VRD A;  2EML A;  2ELZ A;  5KL5 A;  1A1L A;  4IS1 C;  2EMX A;  2CSH A;  2EL6 A;  2EM3 A;  2M9A A;  1AAY A;  1YSA C;  1BBO A;  2D9H A;  3EPJ A;  2EMG A;  2EMK A;  1DGC A;  2YTP A;  2YTQ A;  2EOF A;  2WBU A;  1X6H A;  2RSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...