4R2DA

Egr1/zif268 zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Early growth response protein 1
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2dA00
2DLKA 2EMHA 2YU8A 4R2CA 2YTFA 2DGCA 1ZAAC 2EOJA 2EN8A 2EM0A 1MEYC 2A25A 2EPZA 2ENAA 2EPXA 4WSGA 1YUIA 2EM6A 2YSPA 2YTIA 2VRDA 1KJKA 2E72A 2EE8A 2EOZA 4R2DA 3MHSC 2YSOA 2I13A 2MDGA 3MHHC 1NCSA 2HGHA 2YTOA 4R2PA 2YU5A 2YTEA 2YTPA 2EN6A 2EOYA 2YTGA 1A1GA 1DGCA 1BB8A 2LCEA 2M9AA 2EOFA 2EMAA 1A1HA 2EMFA 2EM8A 2ENHA 4F2JC 2EMBA 2NABA 1A1KA 5KL3A 2EL4A 2EMLA 1LLMC 2EMCA 2MKNA 2EPUA 1WJPA 1AAYA 4R2RA 2LT7A 1X5WA 4F6MA 2EMIA 2WBUA 2BB8A 2EOXA 2EMZA 2WBTA 2MKDA 2EPCA 1UN6B 2YTQA 2EQ3A 2EOOA 3UK3C 2YRKA 3EPLA 1YUJA 2EN3A 1JK1A 2EM7A 2DMIA 2GHFA 5KL2A 4M9VC 2EORA 1UBDC 3M99B 2YRMA 1A1JA 1A1FA 4F6NA 2ADRA 1X3CA 2EM3A 2ENCA 2YTJA 1A1LA 2PRTA 2EM5A 1JK2A 1ZR9A 2CT1A 2LO3A 2EMKA 2EN4A 1TF6A 4IJDA 5KL7A 2RPCA 2EQ1A 2DRPA 4X9JA 2D9HA 2LV2A 3EPHA 4R2AA 4R2QA 3EPKA 3VHTB 2EM4A 2LVHA 2EPPA 2EOQA 1A1IA 1BBOA 2EOMA 1TN9A 2YTNA 1X6HA 4GZNC 2EQ0A 4FK5C 1G2DC 4IS1C 2EOIA 2JPAA 2JP9A 2ELZA 3EPJA 4R2SA 2EOSA 2EOEA 2WBSA 1Z1BA 2EPRA 1RMDA 2EMXA 2R1FA 2CTDA 2EPAA 2EP3A 2J7JA 2RSIA 2WCC3 2EMGA 5KL6A 2EN2A 2YTDA 2EMYA 2EMWA 2DLQA 2EL5A 4R2EA 1G2FC 2EN7A 2ELYA 1P47A 1ZU1A 1TF3A 2EL6A 2EJ4A 1X6EA 2EM9A 2EN1A 2YRHA 1X6FA 1YSAC 2GLIA 5KL5A 2EOHA 1B69A 5KL4A 1F2IG 2EM2A 2CSHA
chains in the Genus database with same CATH superfamily
2K4VA 2RTXA 4DR2E 1XMOE 1WRJA 2YTFA 5A6BD 3AUZA 2EOJA 4LF5E 2H36X 4F54A 2DSYA 3OMLA 4MLVA 2E72A 2EOZA 4LF8E 4TUGA 2LUQA 2MDGA 2HHHE 1N32E 1NCSA 4LF6E 4R2PA 2M4IA 4JI6E 4BS9A 2YTGA 2DIXA 5TSEA 1DGCA 2UUCE 3ADJA 1J5EE 5AE3A 2DMYA 4O24A 2N3HA 4L5NC 5A2QC 2FV4B 1EH7A 4Q28A 1WJPA 4M0VA 1AAYA 4R2RA 3IWDA 3THNA 3F6HA 2UU9E 1IQSA 1X5WA 4DR4E 1PJTA 3HPZA 4ZYEA 2BBGA 5IV8B 2BB8A 2EMZA 2LRSA 2K7IA 2WBTA 4M30A 3UK3C 3L00A 5AE2A 5FLXC 1YUJA 2EN3A 2KOUA 4DMIA 2EM7A 2DMIA 2GHFA 2RS6A 3C6MA 4DV4E 1IMUA 1L4SA 3F6GA 4O4KA 3THOB 4F6NA 1T4LB 1I94E 1X3CA 2PRTA 2E1MA 2E5LE 3HXLA 1ZR9A 2LMZA 2LO3A 3HPSA 2JOBA 4IJDA 2YZTA 3VYYA 3HTXA 4DR3E 2EPOA 2V89A 3J7AG 1N34E 3VHTB 1A1IA 2FGGA 4O43A 1YYKA 4N4RB 3EPJA 2YT4A 2EOEA 3KWRA 2EPRA 1RMDA 2R1FA 2EPAA 2EP3A 4KZSA 5LLQA 2L92A 2ODRD 2R76A 4MLQA 4RH8A 2DLQA 4R2EA 2ELYA 4OOGC 1TF3A 5A6AA 4NHRA 2EJ4A 1X6EA 1GZ6A 2GLIA 2V8QB 5KL4A 3IWCA 3DF6A 2L33A 2EM2A 1N36E 2HJJA 3C4BA 2HC5A 4R2CA 4WPYA 2ODRC 1IBLE 1ZAAC 5IWAE 4RHBB 2A25A 2V86A 1X49A 4WSGA 4DV2E 5IXMB 1STUA 1KJKA 3MHSC 2I13A 2L2KB 2RS7A 4LFCE 2YTEA 2YTPA 2EN6A 4X64E 1A1GA 4LF9E 1BB8A 4DUYE 2LCEA 5AC5A 4YHHE 2M7QA 4LF4E 2ENHA 4X62E 4GEQB 2EMBA 2NABA 1A1KA 5KL3A 2EL4A 2EMLA 2V85A 4R8OA 1RQ0A 3OTOE 4F9CB 4LFAE 1T4OA 2B7VA 4DV0E 4JI2E 2LT7A 4GKKE 4F6MA 2WBUA 2M1SA 2IHR1 1UN6B 4DKKA 2EOOA 3EPLA 4BC7A 1JK1A 1YYWA 4X66E 2LBSB 1RC7A 2EORA 2YRMA 1A1JA 2UXDE 2EM3A 1A1LA 4J8ZA 2B3TB 5BR8E 1JK2A 4B3ME 3ADIA 4WXCA 2EMKA 5KL7A 5ADZA 2KONA 2RPCA 3TQMA 1QNTA 2DRPA 1DQ3A 1SFEA 3C4TA 4JV5E 4R2AA 3C6KA 2UXCE 2G7HA 2EPPA 3RMPA 3ADLA 5CFFE 2YTNA 1BBGA 1X6HA 4GZNC 1PKPA 4NXME 3IWBA 2EOIA 2JPAA 2NUGA 4JI1E 1PJQA 2EOSA 1WXRA 2WBSA 2JY9A 2EMXA 1IBKE 3JU0A 4O5GA 2RSIA 1HNXE 2WCC3 4JI4E 5KL6A 2N3GA 4K0KE 2EMYA 5DNYA 1MGTA 5T6JA 2EN7A 4ZYGA 2EN1A 2YRHA 2UUAE 3K6QA 1B69A 5LMNE 1T4NA 4I8OA 2FTXB 3VK6A 1EH8A 1F2IG 2NUFA 1ZBTA 2LTRA 4BCAA 2EMHA 2YU8A 5IT9C 4DR7E 3P1XA 4LF7E 4R03A 2EPMX 2EN8A 2EM0A 3T1HE 1FJGE 2EPZA 2ENAA 2JVAA 4BMJA 5A69A 2YSPA 2YTIA 2VRDA 4B3SE 1UHZA 2EE8A 2LJHA 2L8TA 3MHHC 2Q8UA 4KHPE 2HGHA 2YTOA 4JYAE 5AC4A 1YYOA 1AH5A 2EPLX 2VF1A 2M9AA 1T39A 1NEIA 2EMAA 2EOFA 4JI5E 1A1HA 2N8XA 2ZM6E 3J80C 2L3CA 3HQ1A 2RQLA 2LTSA 2MKNA 5AE1A 2L2NA 5F3WA 4B3TE 2V88A 2EMIA 4AQYE 2EOXA 1PDAA 2EQ3A 2YRKA 4LFBE 2YWQA 2LE2A 2VQEE 4ZYHA 5KL2A 2EZ6A 4KWYA 2EPNA 1HR0E 1YZ9A 1SR9A 2B7TA 1FKAE 4DUZE 2ADRA 2EWLA 2ENCA 2CT1A 4X8WA 4DR6E 2EN4A 4JI3E 2MC5A 4DR5E 2VE7C 4JI7E 4X9JA 4WX9A 2LV2A 3EPHA 1BBOA 2EM4A 2EOQA 1KYQA 4P78A 3EQ1A 1TN9A 2YPNA 2V87A 4IS1C 3ZOQB 4YY3E 1GQEA 3AV0A 3KZZA 2UXBE 2EPKX 2ELZA 2LJUA 1Z1BA 4BC9A 4DV6E 2EMGA 4DR1E 1UILA 1XMQE 4HEIA 3J7Yp 2V83A 1G2FC 2EL5A 1N33E 1EKZA 1YFHA 1PJSA 5A6JA 3BF2A 2CPNA 2EM9A 5AASA 4Q35B 5A6BA 1X6FA 1XNRE 5KL5A 4DV1E 3QG5C 2WZOA 2CSHA 2DLKA 1IBME 3BGHA 4WSPA 2DGCA 4F9AB 3T1YE 1MEYC 5LL6R 2JR1A 3JTZA 4GKJE 2EPXA 1YUIA 2EM6A 1GTKA 4R2DA 2YSOA 3BBGA 4HTGA 2YU5A 2EOYA 4BHCA 1O0WA 4F9BB 5A6KA 4L8NA 3BIDA 2EMFA 2EM8A 2F4VE 4F2JC 2GPIA 4M2ZA 1IQOA 1LLMC 2F8BA 2EMCA 2JOXA 2EPUA 2RSMA 2I9IA 2JXPA 3FIGA 1T38A 3MSWA 2MKDA 1HNWE 1ZBQA 2EPCA 2YTQA 1X47A 4WXDA 1DI2A 4BHBA 2KHXA 3DJWA 4M9VC 2DB2A 4TUIA 1UBDC 3M99B 2NA2A 1X48A 1A1FA 4LU9A 4WFTA 3VYXA 3KZYA 1EH6A 2YTJA 4ZYDA 3JAMC 2NUEA 2EM5A 4LTYA 3LMLA 3LLHA 2L3JA 1TF6A 2L6MA 2L2MA 4DV3E 2JWOA 2EQ1A 3H09A 2D9HA 4R2QA 3ADGA 3EPKA 2LVHA 1N3GA 4BBYA 2EOMA 4WYQB 5LMUE 2MC6A 2EQ0A 4X65E 4FK5C 1G2DC 3ECRA 4P7DA 2JYAA 4OX9E 1QU6A 1WHQA 1XNQE 1J26A 2JP9A 2VQFE 4R2SA 2CTDA 2J7JA 2LUPB 4NXNE 2EN2A 2YTDA 4DV5E 4JI0E 2EMWA 1YPNA 4B3RE 3J81C 1P47A 1ZU1A 2EL6A 4NZVA 1HNZE 1YSAC 2B9DA 2EOHA 4DV7E 1WHNA 4JI8E 2UUBE 2MDRA
chains in the Genus database with same CATH topology
2DLKA 2EMHA 2YU8A 4R2CA 2YTFA 2DGCA 1ZAAC 2EOJA 2EN8A 2EM0A 1MEYC 2A25A 2EPZA 2ENAA 2EPXA 4WSGA 1YUIA 2EM6A 2YSPA 2YTIA 2VRDA 1KJKA 2E72A 2EE8A 2EOZA 4R2DA 3MHSC 2YSOA 2I13A 2MDGA 3MHHC 1NCSA 2HGHA 2YTOA 4R2PA 2YU5A 2YTEA 2YTPA 2EN6A 2EOYA 2YTGA 1A1GA 1DGCA 1BB8A 2LCEA 2M9AA 2EOFA 2EMAA 1A1HA 2EMFA 2EM8A 2ENHA 4F2JC 2EMBA 2NABA 1A1KA 5KL3A 2EL4A 2EMLA 1LLMC 2EMCA 2MKNA 2EPUA 1WJPA 1AAYA 4R2RA 2LT7A 1X5WA 4F6MA 2EMIA 2WBUA 2BB8A 2EOXA 2EMZA 2WBTA 2MKDA 2EPCA 1UN6B 2YTQA 2EQ3A 2EOOA 3UK3C 2YRKA 3EPLA 1YUJA 2EN3A 1JK1A 2EM7A 2DMIA 2GHFA 5KL2A 4M9VC 2EORA 1UBDC 3M99B 2YRMA 1A1JA 1A1FA 4F6NA 2ADRA 1X3CA 2EM3A 2ENCA 2YTJA 1A1LA 2PRTA 2EM5A 1JK2A 1ZR9A 2CT1A 2LO3A 2EMKA 2EN4A 1TF6A 4IJDA 5KL7A 2RPCA 2EQ1A 2DRPA 4X9JA 2D9HA 2LV2A 3EPHA 4R2AA 4R2QA 3EPKA 3VHTB 2EM4A 2LVHA 2EPPA 2EOQA 1A1IA 1BBOA 2EOMA 1TN9A 2YTNA 1X6HA 4GZNC 2EQ0A 4FK5C 1G2DC 4IS1C 2EOIA 2JPAA 2JP9A 2ELZA 3EPJA 4R2SA 2EOSA 2EOEA 2WBSA 1Z1BA 2EPRA 1RMDA 2EMXA 2R1FA 2CTDA 2EPAA 2EP3A 2J7JA 2RSIA 2WCC3 2EMGA 5KL6A 2EN2A 2YTDA 2EMYA 2EMWA 2DLQA 2EL5A 4R2EA 1G2FC 2EN7A 2ELYA 1P47A 1ZU1A 1TF3A 2EL6A 2EJ4A 1X6EA 2EM9A 2EN1A 2YRHA 1X6FA 1YSAC 2GLIA 5KL5A 2EOHA 1B69A 5KL4A 1F2IG 2EM2A 2CSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLK A;  2EMH A;  2YU8 A;  4R2C A;  2YTF A;  2DGC A;  1ZAA C;  2EOJ A;  2EN8 A;  2EM0 A;  1MEY C;  2A25 A;  2EPZ A;  2ENA A;  2EPX A;  4WSG A;  1YUI A;  2EM6 A;  2YSP A;  2YTI A;  2VRD A;  1KJK A;  2E72 A;  2EE8 A;  2EOZ A;  4R2D A;  3MHS C;  2YSO A;  2I13 A;  2MDG A;  3MHH C;  1NCS A;  2HGH A;  2YTO A;  4R2P A;  2YU5 A;  2YTE A;  2YTP A;  2EN6 A;  2EOY A;  2YTG A;  1A1G A;  1DGC A;  1BB8 A;  2LCE A;  2M9A A;  2EOF A;  2EMA A;  1A1H A;  2EMF A;  2EM8 A;  2ENH A;  4F2J C;  2EMB A;  2NAB A;  1A1K A;  5KL3 A;  2EL4 A;  2EML A;  1LLM C;  2EMC A;  2MKN A;  2EPU A;  1WJP A;  1AAY A;  4R2R A;  2LT7 A;  1X5W A;  4F6M A;  2EMI A;  2WBU A;  2BB8 A;  2EOX A;  2EMZ A;  2WBT A;  2MKD A;  2EPC A;  1UN6 B;  2YTQ A;  2EQ3 A;  2EOO A;  3UK3 C;  2YRK A;  3EPL A;  1YUJ A;  2EN3 A;  1JK1 A;  2EM7 A;  2DMI A;  2GHF A;  5KL2 A;  4M9V C;  2EOR A;  1UBD C;  3M99 B;  2YRM A;  1A1J A;  1A1F A;  4F6N A;  2ADR A;  1X3C A;  2EM3 A;  2ENC A;  2YTJ A;  1A1L A;  2PRT A;  2EM5 A;  1JK2 A;  1ZR9 A;  2CT1 A;  2LO3 A;  2EMK A;  2EN4 A;  1TF6 A;  4IJD A;  5KL7 A;  2RPC A;  2EQ1 A;  2DRP A;  4X9J A;  2D9H A;  2LV2 A;  3EPH A;  4R2A A;  4R2Q A;  3EPK A;  3VHT B;  2EM4 A;  2LVH A;  2EPP A;  2EOQ A;  1A1I A;  1BBO A;  2EOM A;  1TN9 A;  2YTN A;  1X6H A;  4GZN C;  2EQ0 A;  4FK5 C;  1G2D C;  4IS1 C;  2EOI A;  2JPA A;  2JP9 A;  2ELZ A;  3EPJ A;  4R2S A;  2EOS A;  2EOE A;  2WBS A;  1Z1B A;  2EPR A;  1RMD A;  2EMX A;  2R1F A;  2CTD A;  2EPA A;  2EP3 A;  2J7J A;  2RSI A;  2WCC 3;  2EMG A;  5KL6 A;  2EN2 A;  2YTD A;  2EMY A;  2EMW A;  2DLQ A;  2EL5 A;  4R2E A;  1G2F C;  2EN7 A;  2ELY A;  1P47 A;  1ZU1 A;  1TF3 A;  2EL6 A;  2EJ4 A;  1X6E A;  2EM9 A;  2EN1 A;  2YRH A;  1X6F A;  1YSA C;  2GLI A;  5KL5 A;  2EOH A;  1B69 A;  5KL4 A;  1F2I G;  2EM2 A;  2CSH A; 
#chains in the Genus database with same CATH topology
 2K4V A;  2RTX A;  4DR2 E;  1XMO E;  1WRJ A;  2YTF A;  5A6B D;  3AUZ A;  2EOJ A;  4LF5 E;  2H36 X;  4F54 A;  2DSY A;  3OML A;  4MLV A;  2E72 A;  2EOZ A;  4LF8 E;  4TUG A;  2LUQ A;  2MDG A;  2HHH E;  1N32 E;  1NCS A;  4LF6 E;  4R2P A;  2M4I A;  4JI6 E;  4BS9 A;  2YTG A;  2DIX A;  5TSE A;  1DGC A;  2UUC E;  3ADJ A;  1J5E E;  5AE3 A;  2DMY A;  4O24 A;  2N3H A;  4L5N C;  5A2Q C;  2FV4 B;  1EH7 A;  4Q28 A;  1WJP A;  4M0V A;  1AAY A;  4R2R A;  3IWD A;  3THN A;  3F6H A;  2UU9 E;  1IQS A;  1X5W A;  4DR4 E;  1PJT A;  3HPZ A;  4ZYE A;  2BBG A;  5IV8 B;  2BB8 A;  2EMZ A;  2LRS A;  2K7I A;  2WBT A;  4M30 A;  3UK3 C;  3L00 A;  5AE2 A;  5FLX C;  1YUJ A;  2EN3 A;  2KOU A;  4DMI A;  2EM7 A;  2DMI A;  2GHF A;  2RS6 A;  3C6M A;  4DV4 E;  1IMU A;  1L4S A;  3F6G A;  4O4K A;  3THO B;  4F6N A;  1T4L B;  1I94 E;  1X3C A;  2PRT A;  2E1M A;  2E5L E;  3HXL A;  1ZR9 A;  2LMZ A;  2LO3 A;  3HPS A;  2JOB A;  4IJD A;  2YZT A;  3VYY A;  3HTX A;  4DR3 E;  2EPO A;  2V89 A;  3J7A G;  1N34 E;  3VHT B;  1A1I A;  2FGG A;  4O43 A;  1YYK A;  4N4R B;  3EPJ A;  2YT4 A;  2EOE A;  3KWR A;  2EPR A;  1RMD A;  2R1F A;  2EPA A;  2EP3 A;  4KZS A;  5LLQ A;  2L92 A;  2ODR D;  2R76 A;  4MLQ A;  4RH8 A;  2DLQ A;  4R2E A;  2ELY A;  4OOG C;  1TF3 A;  5A6A A;  4NHR A;  2EJ4 A;  1X6E A;  1GZ6 A;  2GLI A;  2V8Q B;  5KL4 A;  3IWC A;  3DF6 A;  2L33 A;  2EM2 A;  1N36 E;  2HJJ A;  3C4B A;  2HC5 A;  4R2C A;  4WPY A;  2ODR C;  1IBL E;  1ZAA C;  5IWA E;  4RHB B;  2A25 A;  2V86 A;  1X49 A;  4WSG A;  4DV2 E;  5IXM B;  1STU A;  1KJK A;  3MHS C;  2I13 A;  2L2K B;  2RS7 A;  4LFC E;  2YTE A;  2YTP A;  2EN6 A;  4X64 E;  1A1G A;  4LF9 E;  1BB8 A;  4DUY E;  2LCE A;  5AC5 A;  4YHH E;  2M7Q A;  4LF4 E;  2ENH A;  4X62 E;  4GEQ B;  2EMB A;  2NAB A;  1A1K A;  5KL3 A;  2EL4 A;  2EML A;  2V85 A;  4R8O A;  1RQ0 A;  3OTO E;  4F9C B;  4LFA E;  1T4O A;  2B7V A;  4DV0 E;  4JI2 E;  2LT7 A;  4GKK E;  4F6M A;  2WBU A;  2M1S A;  2IHR 1;  1UN6 B;  4DKK A;  2EOO A;  3EPL A;  4BC7 A;  1JK1 A;  1YYW A;  4X66 E;  2LBS B;  1RC7 A;  2EOR A;  2YRM A;  1A1J A;  2UXD E;  2EM3 A;  1A1L A;  4J8Z A;  2B3T B;  5BR8 E;  1JK2 A;  4B3M E;  3ADI A;  4WXC A;  2EMK A;  5KL7 A;  5ADZ A;  2KON A;  2RPC A;  3TQM A;  1QNT A;  2DRP A;  1DQ3 A;  1SFE A;  3C4T A;  4JV5 E;  4R2A A;  3C6K A;  2UXC E;  2G7H A;  2EPP A;  3RMP A;  3ADL A;  5CFF E;  2YTN A;  1BBG A;  1X6H A;  4GZN C;  1PKP A;  4NXM E;  3IWB A;  2EOI A;  2JPA A;  2NUG A;  4JI1 E;  1PJQ A;  2EOS A;  1WXR A;  2WBS A;  2JY9 A;  2EMX A;  1IBK E;  3JU0 A;  4O5G A;  2RSI A;  1HNX E;  2WCC 3;  4JI4 E;  5KL6 A;  2N3G A;  4K0K E;  2EMY A;  5DNY A;  1MGT A;  5T6J A;  2EN7 A;  4ZYG A;  2EN1 A;  2YRH A;  2UUA E;  3K6Q A;  1B69 A;  5LMN E;  1T4N A;  4I8O A;  2FTX B;  3VK6 A;  1EH8 A;  1F2I G;  2NUF A;  1ZBT A;  2LTR A;  4BCA A;  2EMH A;  2YU8 A;  5IT9 C;  4DR7 E;  3P1X A;  4LF7 E;  4R03 A;  2EPM X;  2EN8 A;  2EM0 A;  3T1H E;  1FJG E;  2EPZ A;  2ENA A;  2JVA A;  4BMJ A;  5A69 A;  2YSP A;  2YTI A;  2VRD A;  4B3S E;  1UHZ A;  2EE8 A;  2LJH A;  2L8T A;  3MHH C;  2Q8U A;  4KHP E;  2HGH A;  2YTO A;  4JYA E;  5AC4 A;  1YYO A;  1AH5 A;  2EPL X;  2VF1 A;  2M9A A;  1T39 A;  1NEI A;  2EMA A;  2EOF A;  4JI5 E;  1A1H A;  2N8X A;  2ZM6 E;  3J80 C;  2L3C A;  3HQ1 A;  2RQL A;  2LTS A;  2MKN A;  5AE1 A;  2L2N A;  5F3W A;  4B3T E;  2V88 A;  2EMI A;  4AQY E;  2EOX A;  1PDA A;  2EQ3 A;  2YRK A;  4LFB E;  2YWQ A;  2LE2 A;  2VQE E;  4ZYH A;  5KL2 A;  2EZ6 A;  4KWY A;  2EPN A;  1HR0 E;  1YZ9 A;  1SR9 A;  2B7T A;  1FKA E;  4DUZ E;  2ADR A;  2EWL A;  2ENC A;  2CT1 A;  4X8W A;  4DR6 E;  2EN4 A;  4JI3 E;  2MC5 A;  4DR5 E;  2VE7 C;  4JI7 E;  4X9J A;  4WX9 A;  2LV2 A;  3EPH A;  1BBO A;  2EM4 A;  2EOQ A;  1KYQ A;  4P78 A;  3EQ1 A;  1TN9 A;  2YPN A;  2V87 A;  4IS1 C;  3ZOQ B;  4YY3 E;  1GQE A;  3AV0 A;  3KZZ A;  2UXB E;  2EPK X;  2ELZ A;  2LJU A;  1Z1B A;  4BC9 A;  4DV6 E;  2EMG A;  4DR1 E;  1UIL A;  1XMQ E;  4HEI A;  3J7Y p;  2V83 A;  1G2F C;  2EL5 A;  1N33 E;  1EKZ A;  1YFH A;  1PJS A;  5A6J A;  3BF2 A;  2CPN A;  2EM9 A;  5AAS A;  4Q35 B;  5A6B A;  1X6F A;  1XNR E;  5KL5 A;  4DV1 E;  3QG5 C;  2WZO A;  2CSH A;  2DLK A;  1IBM E;  3BGH A;  4WSP A;  2DGC A;  4F9A B;  3T1Y E;  1MEY C;  5LL6 R;  2JR1 A;  3JTZ A;  4GKJ E;  2EPX A;  1YUI A;  2EM6 A;  1GTK A;  4R2D A;  2YSO A;  3BBG A;  4HTG A;  2YU5 A;  2EOY A;  4BHC A;  1O0W A;  4F9B B;  5A6K A;  4L8N A;  3BID A;  2EMF A;  2EM8 A;  2F4V E;  4F2J C;  2GPI A;  4M2Z A;  1IQO A;  1LLM C;  2F8B A;  2EMC A;  2JOX A;  2EPU A;  2RSM A;  2I9I A;  2JXP A;  3FIG A;  1T38 A;  3MSW A;  2MKD A;  1HNW E;  1ZBQ A;  2EPC A;  2YTQ A;  1X47 A;  4WXD A;  1DI2 A;  4BHB A;  2KHX A;  3DJW A;  4M9V C;  2DB2 A;  4TUI A;  1UBD C;  3M99 B;  2NA2 A;  1X48 A;  1A1F A;  4LU9 A;  4WFT A;  3VYX A;  3KZY A;  1EH6 A;  2YTJ A;  4ZYD A;  3JAM C;  2NUE A;  2EM5 A;  4LTY A;  3LML A;  3LLH A;  2L3J A;  1TF6 A;  2L6M A;  2L2M A;  4DV3 E;  2JWO A;  2EQ1 A;  3H09 A;  2D9H A;  4R2Q A;  3ADG A;  3EPK A;  2LVH A;  1N3G A;  4BBY A;  2EOM A;  4WYQ B;  5LMU E;  2MC6 A;  2EQ0 A;  4X65 E;  4FK5 C;  1G2D C;  3ECR A;  4P7D A;  2JYA A;  4OX9 E;  1QU6 A;  1WHQ A;  1XNQ E;  1J26 A;  2JP9 A;  2VQF E;  4R2S A;  2CTD A;  2J7J A;  2LUP B;  4NXN E;  2EN2 A;  2YTD A;  4DV5 E;  4JI0 E;  2EMW A;  1YPN A;  4B3R E;  3J81 C;  1P47 A;  1ZU1 A;  2EL6 A;  4NZV A;  1HNZ E;  1YSA C;  2B9D A;  2EOH A;  4DV7 E;  1WHN A;  4JI8 E;  2UUB E;  2MDR A; 
#chains in the Genus database with same CATH homology
 2DLK A;  2EMH A;  2YU8 A;  4R2C A;  2YTF A;  2DGC A;  1ZAA C;  2EOJ A;  2EN8 A;  2EM0 A;  1MEY C;  2A25 A;  2EPZ A;  2ENA A;  2EPX A;  4WSG A;  1YUI A;  2EM6 A;  2YSP A;  2YTI A;  2VRD A;  1KJK A;  2E72 A;  2EE8 A;  2EOZ A;  4R2D A;  3MHS C;  2YSO A;  2I13 A;  2MDG A;  3MHH C;  1NCS A;  2HGH A;  2YTO A;  4R2P A;  2YU5 A;  2YTE A;  2YTP A;  2EN6 A;  2EOY A;  2YTG A;  1A1G A;  1DGC A;  1BB8 A;  2LCE A;  2M9A A;  2EOF A;  2EMA A;  1A1H A;  2EMF A;  2EM8 A;  2ENH A;  4F2J C;  2EMB A;  2NAB A;  1A1K A;  5KL3 A;  2EL4 A;  2EML A;  1LLM C;  2EMC A;  2MKN A;  2EPU A;  1WJP A;  1AAY A;  4R2R A;  2LT7 A;  1X5W A;  4F6M A;  2EMI A;  2WBU A;  2BB8 A;  2EOX A;  2EMZ A;  2WBT A;  2MKD A;  2EPC A;  1UN6 B;  2YTQ A;  2EQ3 A;  2EOO A;  3UK3 C;  2YRK A;  3EPL A;  1YUJ A;  2EN3 A;  1JK1 A;  2EM7 A;  2DMI A;  2GHF A;  5KL2 A;  4M9V C;  2EOR A;  1UBD C;  3M99 B;  2YRM A;  1A1J A;  1A1F A;  4F6N A;  2ADR A;  1X3C A;  2EM3 A;  2ENC A;  2YTJ A;  1A1L A;  2PRT A;  2EM5 A;  1JK2 A;  1ZR9 A;  2CT1 A;  2LO3 A;  2EMK A;  2EN4 A;  1TF6 A;  4IJD A;  5KL7 A;  2RPC A;  2EQ1 A;  2DRP A;  4X9J A;  2D9H A;  2LV2 A;  3EPH A;  4R2A A;  4R2Q A;  3EPK A;  3VHT B;  2EM4 A;  2LVH A;  2EPP A;  2EOQ A;  1A1I A;  1BBO A;  2EOM A;  1TN9 A;  2YTN A;  1X6H A;  4GZN C;  2EQ0 A;  4FK5 C;  1G2D C;  4IS1 C;  2EOI A;  2JPA A;  2JP9 A;  2ELZ A;  3EPJ A;  4R2S A;  2EOS A;  2EOE A;  2WBS A;  1Z1B A;  2EPR A;  1RMD A;  2EMX A;  2R1F A;  2CTD A;  2EPA A;  2EP3 A;  2J7J A;  2RSI A;  2WCC 3;  2EMG A;  5KL6 A;  2EN2 A;  2YTD A;  2EMY A;  2EMW A;  2DLQ A;  2EL5 A;  4R2E A;  1G2F C;  2EN7 A;  2ELY A;  1P47 A;  1ZU1 A;  1TF3 A;  2EL6 A;  2EJ4 A;  1X6E A;  2EM9 A;  2EN1 A;  2YRH A;  1X6F A;  1YSA C;  2GLI A;  5KL5 A;  2EOH A;  1B69 A;  5KL4 A;  1F2I G;  2EM2 A;  2CSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...