4R2DA

Egr1/zif268 zinc fingers in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early growth response protein 1
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2dA00
1KJKA 4X9JA 2DLQA 2EPRA 1YUIA 2VRDA 4F2JC 1A1GA 2CSHA 2YSOA 2CT1A 2LV2A 2EJ4A 2EN1A 2EOSA 2EPZA 2YU8A 1A1JA 4F6MA 1G2DC 2EOHA 2EPUA 2DMIA 1Z1BA 2EM0A 1B69A 2HGHA 2EPCA 2YTDA 2LCEA 2LO3A 1ZR9A 2EOMA 2YTEA 1P47A 2EQ3A 2EM3A 2EL4A 3EPLA 2PRTA 3EPKA 4R2DA 4F6NA 3VHTB 1RMDA 2EMZA 2JP9A 2EM5A 2EOQA 3M99B 2LVHA 2JPAA 2EL5A 2YU5A 4IJDA 1LLMC 1A1LA 1TN9A 2DGCA 1X6HA 2EPAA 1DGCA 4R2SA 3EPJA 2YTGA 1MEYC 5KL7A 4R2RA 2EM8A 2EMGA 2LT7A 2MDGA 2WBUA 2YTJA 1A1FA 2EOYA 2ELZA 2EOZA 1WJPA 2EPPA 4M9VC 4WSGA 2YTNA 4R2CA 1A1IA 1AAYA 2EMCA 1JK1A 2CTDA 1X6FA 2RPCA 5KL3A 1TF6A 2EMWA 2ADRA 1F2IG 1A1HA 2EOEA 2EOFA 2YTQA 1BBOA 2DLKA 1X5WA 2EOJA 2EMYA 4R2EA 2EMKA 2EN6A 2EORA 2A25A 4R2AA 1G2FC 2ENAA 2EN2A 2RSIA 2YRKA 3EPHA 1X6EA 2EMFA 5KL2A 2YTFA 2EE8A 4FK5C 1UBDC 2DRPA 2YTIA 2GLIA 3UK3C 2EN4A 2EL6A 2EN8A 2EOOA 2MKDA 5KL5A 4IS1C 2NABA 2R1FA 3MHSC 1JK2A 2EQ1A 1ZAAC 2ENCA 2D9HA 2EM2A 2EM9A 4R2QA 5KL6A 2EN7A 1NCSA 2WBTA 2YTOA 2EM6A 2M9AA 1YUJA 2EMHA 4GZNC 2WCC3 2EMAA 2J7JA 2EQ0A 2MKNA 2WBSA 2EMBA 4R2PA 2E72A 1ZU1A 2ELYA 2EM4A 2GHFA 2I13A 1TF3A 2EOXA 2YSPA 2EMIA 2YRMA 1X3CA 2ENHA 2EOIA 1A1KA 1UN6B 2EP3A 1YSAC 3MHHC 2EMXA 5KL4A 2EN3A 2EM7A 2YRHA 2EPXA 2YTPA 2EMLA 2BB8A 1BB8A
chains in the Genus database with same CATH superfamily
3JTZA 3ECRA 5A6JA 2L33A 2N3HA 4JI0E 2YSOA 4DV6E 2E1MA 3LLHA 1RQ0A 2EOSA 4X62E 2Q8UA 3JAMC 4F6MA 2LTRA 2F8BA 2EOHA 2EPUA 4BS9A 1UILA 1B69A 2EPCA 4M30A 3J80C 1J5EE 5AC4A 2EQ3A 2PRTA 2V85A 3EQ1A 3EPKA 4F6NA 5A2QC 2EMZA 2JP9A 2EM5A 3M99B 1GZ6A 5IWAE 2JVAA 3T1HE 2JPAA 2EL5A 4IJDA 3ZOQB 4BCAA 4DUZE 2H36X 1HNWE 4NXME 4R2SA 2YTGA 1MEYC 3H09A 4M0VA 2WBUA 2DMYA 4TUIA 4WX9A 4YHHE 2JY9A 4X65E 2EPNA 1X48A 2CTDA 1X6FA 1TF6A 4B3TE 2RTXA 1F2IG 4LF8E 2EOEA 4LF7E 4LF5E 2EOJA 2EMYA 4R2EA 1FJGE 1G2FC 3HQ1A 2ENAA 1IBKE 4FK5C 2EE8A 3TQMA 5LMUE 2DRPA 1QU6A 2YTIA 4NHRA 3UK3C 2EOOA 1X49A 2EQ1A 1WRJA 2HC5A 2EM2A 3C6MA 2UXCE 2MC5A 4R2QA 1NCSA 2EPKX 2N3GA 3C6KA 2WBTA 2YTOA 5LMNE 4DR6E 2VE7C 4RHBB 2M9AA 2RQLA 2GPIA 2EMHA 2RS6A 2EQ0A 5AE1A 5BR8E 2MKNA 4RH8A 2WBSA 2EMBA 4R2PA 1SR9A 3BBGA 2GHFA 2FV4B 1WHQA 1TF3A 2I13A 2KOUA 3LMLA 4JI5E 1PJSA 1N32E 1HR0E 2ENHA 3IWCA 2EOIA 2EMXA 4DKKA 1EKZA 4BHBA 4JI6E 5AE3A 5KL4A 1N33E 2YTPA 4P78A 5AC5A 1HNZE 1KJKA 4X9JA 2EPRA 2EPOA 2BBGA 2VQEE 1N34E 4DR2E 2CSHA 2CT1A 1GQEA 5AE2A 2EWLA 4F9AB 3HPZA 4MLQA 2B7TA 2ODRD 2YU8A 4O5GA 5A6BA 1O0WA 1G2DC 3HTXA 2DMIA 4WXCA 2UUBE 2LO3A 2YTEA 5ADZA 2EM3A 2EL4A 4F9BB 3FIGA 4N4RB 5LL6R 2CPNA 3BF2A 3VHTB 4JI7E 3BIDA 1RMDA 3AUZA 1T4LB 2LUQA 2LVHA 4DV1E 1T39A 2YU5A 4KZSA 1NEIA 2L92A 3L00A 3OMLA 4I8OA 1X6HA 2EPAA 2LRSA 2ODRC 4LFCE 2EPLX 1YFHA 2FGGA 2EM8A 4ZYGA 4JI4E 1L4SA 2MDGA 2EOYA 5DNYA 5F3WA 2N8XA 2ELZA 2EOZA 2LJUA 4B3SE 4HTGA 1FKAE 4DR1E 4DV5E 2WZOA 1JK1A 3J7Yp 2RPCA 5TSEA 2EMWA 4DV2E 4F54A 2EOFA 2YTQA 2B3TB 2K7IA 4BMJA 2EMKA 2L8TA 1I94E 4OX9E 2A25A 4R2AA 2EN2A 2RSIA 4WYQB 3EPHA 2LBSB 1X6EA 4R03A 1KYQA 2GLIA 1EH8A 2JOXA 2EL6A 2EN8A 3HXLA 4JI8E 4B3RE 1ZAAC 4DV7E 2ENCA 4ZYDA 2V83A 2YPNA 1UHZA 3IWDA 2JOBA 4OOGC 2E5LE 2E72A 1ZU1A 2EM4A 2M7QA 4ZYEA 3KZYA 2EOXA 1IBME 4O43A 2EMIA 4LF9E 4AQYE 4KHPE 1YSAC 2KHXA 2R76A 2EM7A 2YRHA 2EPXA 1PKPA 2ZM6E 2DLQA 3J7AG 1YUIA 1YYKA 1A1GA 1T4OA 5T6JA 4WSPA 3THOB 1ZBQA 2EJ4A 2JR1A 2EPZA 1A1JA 4JI1E 4J8ZA 4LTYA 4WXDA 4GKKE 2RSMA 1Z1BA 2EM0A 2YTDA 2RS7A 5A69A 3J81C 1P47A 2LUPB 2I9IA 2L2NA 2M4IA 2V8QB 2VQFE 2DB2A 1AH5A 4P7DA 2DGCA 2B7VA 3ADJA 4WPYA 4BBYA 3EPJA 1PJTA 1BBGA 2V88A 1DI2A 3MSWA 1WXRA 5KL7A 4R2RA 2LT7A 1YYOA 4DV0E 2YTJA 2K4VA 1MGTA 1XNRE 3THNA 4WSGA 4M2ZA 4O4KA 1A1IA 3F6GA 1AAYA 4F9CB 2EMCA 4KWYA 2NUFA 5KL3A 2ADRA 2UU9E 4L8NA 4WFTA 4X66E 1BBOA 4LFBE 1X5WA 2L2MA 2LJHA 3JU0A 4TUGA 3DJWA 2VF1A 3ADGA 4X8WA 2L6MA 5KL2A 2YTFA 1UBDC 4JI3E 4Q35B 2LMZA 3VK6A 5LLQA 2V87A 1WHNA 4HEIA 4IS1C 2R1FA 3VYXA 3AV0A 1JK2A 1HNXE 2D9HA 1J26A 2YZTA 5KL6A 2EN7A 5IXMB 2YT4A 4LF4E 4GKJE 1QNTA 5FLXC 3C4BA 1XNQE 2WCC3 2EMAA 5IT9C 5AASA 3DF6A 4B3ME 2G7HA 1YYWA 2LTSA 4DMIA 3F6HA 2ELYA 2NUGA 4ZYHA 4DR3E 2YSPA 1X3CA 2IHR1 3BGHA 2HHHE 2EP3A 2UUCE 2MC6A 4JV5E 4BC7A 4LU9A 1BB8A 3P1XA 2EMLA 2BB8A 1IQSA 2YWQA 4R8OA 2VRDA 1X47A 4DV4E 3IWBA 3C4TA 4F2JC 2DIXA 2NA2A 3OTOE 1N36E 2LV2A 2EN1A 3T1YE 2UXDE 4GEQB 4JYAE 2JYAA 4MLVA 2HGHA 2V89A 1PJQA 2LCEA 2B9DA 1ZR9A 2EOMA 4NZVA 1XMOE 4LFAE 3EPLA 3KZZA 1T4NA 2NUEA 1STUA 4R2DA 2L2KB 4LF6E 2EOQA 4X64E 5A6KA 4Q28A 2EPMX 1A1LA 1TN9A 1LLMC 1ZBTA 1DGCA 1IBLE 1XMQE 5A6AA 2EMGA 1DQ3A 1PDAA 4YY3E 2HJJA 1A1FA 4K0KE 1EH6A 5IV8B 1WJPA 2EPPA 4M9VC 2YTNA 4R2CA 1EH7A 4BC9A 2MDRA 2JWOA 5CFFE 2M1SA 4DR5E 4DUYE 1N3GA 1A1HA 2V86A 2JXPA 2KONA 3ADIA 2DLKA 5A6BD 2UUAE 2EN6A 2EORA 1IQOA 4L5NC 4DV3E 1T38A 2YRKA 2EMFA 2FTXB 4DR7E 2UXBE 1YPNA 2EZ6A 2EN4A 2MKDA 4O24A 2F4VE 5KL5A 2NABA 3MHSC 4BHCA 1GTKA 4NXNE 1SFEA 2EM9A 1IMUA 3RMPA 2EM6A 2DSYA 1YUJA 3K6QA 4GZNC 2J7JA 3KWRA 3VYYA 4DR4E 2LE2A 3HPSA 4JI2E 2YRMA 1RC7A 3ADLA 1A1KA 3QG5C 1UN6B 3MHHC 2L3CA 2L3JA 2EN3A 1YZ9A
chains in the Genus database with same CATH topology
1KJKA 4X9JA 2DLQA 2EPRA 1YUIA 2VRDA 4F2JC 1A1GA 2CSHA 2YSOA 2CT1A 2LV2A 2EJ4A 2EN1A 2EOSA 2EPZA 2YU8A 1A1JA 4F6MA 1G2DC 2EOHA 2EPUA 2DMIA 1Z1BA 2EM0A 1B69A 2HGHA 2EPCA 2YTDA 2LCEA 2LO3A 1ZR9A 2EOMA 2YTEA 1P47A 2EQ3A 2EM3A 2EL4A 3EPLA 2PRTA 3EPKA 4R2DA 4F6NA 3VHTB 1RMDA 2EMZA 2JP9A 2EM5A 2EOQA 3M99B 2LVHA 2JPAA 2EL5A 2YU5A 4IJDA 1LLMC 1A1LA 1TN9A 2DGCA 1X6HA 2EPAA 1DGCA 4R2SA 3EPJA 2YTGA 1MEYC 5KL7A 4R2RA 2EM8A 2EMGA 2LT7A 2MDGA 2WBUA 2YTJA 1A1FA 2EOYA 2ELZA 2EOZA 1WJPA 2EPPA 4M9VC 4WSGA 2YTNA 4R2CA 1A1IA 1AAYA 2EMCA 1JK1A 2CTDA 1X6FA 2RPCA 5KL3A 1TF6A 2EMWA 2ADRA 1F2IG 1A1HA 2EOEA 2EOFA 2YTQA 1BBOA 2DLKA 1X5WA 2EOJA 2EMYA 4R2EA 2EMKA 2EN6A 2EORA 2A25A 4R2AA 1G2FC 2ENAA 2EN2A 2RSIA 2YRKA 3EPHA 1X6EA 2EMFA 5KL2A 2YTFA 2EE8A 4FK5C 1UBDC 2DRPA 2YTIA 2GLIA 3UK3C 2EN4A 2EL6A 2EN8A 2EOOA 2MKDA 5KL5A 4IS1C 2NABA 2R1FA 3MHSC 1JK2A 2EQ1A 1ZAAC 2ENCA 2D9HA 2EM2A 2EM9A 4R2QA 5KL6A 2EN7A 1NCSA 2WBTA 2YTOA 2EM6A 2M9AA 1YUJA 2EMHA 4GZNC 2WCC3 2EMAA 2J7JA 2EQ0A 2MKNA 2WBSA 2EMBA 4R2PA 2E72A 1ZU1A 2ELYA 2EM4A 2GHFA 2I13A 1TF3A 2EOXA 2YSPA 2EMIA 2YRMA 1X3CA 2ENHA 2EOIA 1A1KA 1UN6B 2EP3A 1YSAC 3MHHC 2EMXA 5KL4A 2EN3A 2EM7A 2YRHA 2EPXA 2YTPA 2EMLA 2BB8A 1BB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KJK A;  4X9J A;  2DLQ A;  2EPR A;  1YUI A;  2VRD A;  4F2J C;  1A1G A;  2CSH A;  2YSO A;  2CT1 A;  2LV2 A;  2EJ4 A;  2EN1 A;  2EOS A;  2EPZ A;  2YU8 A;  1A1J A;  4F6M A;  1G2D C;  2EOH A;  2EPU A;  2DMI A;  1Z1B A;  2EM0 A;  1B69 A;  2HGH A;  2EPC A;  2YTD A;  2LCE A;  2LO3 A;  1ZR9 A;  2EOM A;  2YTE A;  1P47 A;  2EQ3 A;  2EM3 A;  2EL4 A;  3EPL A;  2PRT A;  3EPK A;  4R2D A;  4F6N A;  3VHT B;  1RMD A;  2EMZ A;  2JP9 A;  2EM5 A;  2EOQ A;  3M99 B;  2LVH A;  2JPA A;  2EL5 A;  2YU5 A;  4IJD A;  1LLM C;  1A1L A;  1TN9 A;  2DGC A;  1X6H A;  2EPA A;  1DGC A;  4R2S A;  3EPJ A;  2YTG A;  1MEY C;  5KL7 A;  4R2R A;  2EM8 A;  2EMG A;  2LT7 A;  2MDG A;  2WBU A;  2YTJ A;  1A1F A;  2EOY A;  2ELZ A;  2EOZ A;  1WJP A;  2EPP A;  4M9V C;  4WSG A;  2YTN A;  4R2C A;  1A1I A;  1AAY A;  2EMC A;  1JK1 A;  2CTD A;  1X6F A;  2RPC A;  5KL3 A;  1TF6 A;  2EMW A;  2ADR A;  1F2I G;  1A1H A;  2EOE A;  2EOF A;  2YTQ A;  1BBO A;  2DLK A;  1X5W A;  2EOJ A;  2EMY A;  4R2E A;  2EMK A;  2EN6 A;  2EOR A;  2A25 A;  4R2A A;  1G2F C;  2ENA A;  2EN2 A;  2RSI A;  2YRK A;  3EPH A;  1X6E A;  2EMF A;  5KL2 A;  2YTF A;  2EE8 A;  4FK5 C;  1UBD C;  2DRP A;  2YTI A;  2GLI A;  3UK3 C;  2EN4 A;  2EL6 A;  2EN8 A;  2EOO A;  2MKD A;  5KL5 A;  4IS1 C;  2NAB A;  2R1F A;  3MHS C;  1JK2 A;  2EQ1 A;  1ZAA C;  2ENC A;  2D9H A;  2EM2 A;  2EM9 A;  4R2Q A;  5KL6 A;  2EN7 A;  1NCS A;  2WBT A;  2YTO A;  2EM6 A;  2M9A A;  1YUJ A;  2EMH A;  4GZN C;  2WCC 3;  2EMA A;  2J7J A;  2EQ0 A;  2MKN A;  2WBS A;  2EMB A;  4R2P A;  2E72 A;  1ZU1 A;  2ELY A;  2EM4 A;  2GHF A;  2I13 A;  1TF3 A;  2EOX A;  2YSP A;  2EMI A;  2YRM A;  1X3C A;  2ENH A;  2EOI A;  1A1K A;  1UN6 B;  2EP3 A;  1YSA C;  3MHH C;  2EMX A;  5KL4 A;  2EN3 A;  2EM7 A;  2YRH A;  2EPX A;  2YTP A;  2EML A;  2BB8 A;  1BB8 A; 
#chains in the Genus database with same CATH topology
 3JTZ A;  3ECR A;  5A6J A;  2L33 A;  2N3H A;  4JI0 E;  2YSO A;  4DV6 E;  2E1M A;  3LLH A;  1RQ0 A;  2EOS A;  4X62 E;  2Q8U A;  3JAM C;  4F6M A;  2LTR A;  2F8B A;  2EOH A;  2EPU A;  4BS9 A;  1UIL A;  1B69 A;  2EPC A;  4M30 A;  3J80 C;  1J5E E;  5AC4 A;  2EQ3 A;  2PRT A;  2V85 A;  3EQ1 A;  3EPK A;  4F6N A;  5A2Q C;  2EMZ A;  2JP9 A;  2EM5 A;  3M99 B;  1GZ6 A;  5IWA E;  2JVA A;  3T1H E;  2JPA A;  2EL5 A;  4IJD A;  3ZOQ B;  4BCA A;  4DUZ E;  2H36 X;  1HNW E;  4NXM E;  4R2S A;  2YTG A;  1MEY C;  3H09 A;  4M0V A;  2WBU A;  2DMY A;  4TUI A;  4WX9 A;  4YHH E;  2JY9 A;  4X65 E;  2EPN A;  1X48 A;  2CTD A;  1X6F A;  1TF6 A;  4B3T E;  2RTX A;  1F2I G;  4LF8 E;  2EOE A;  4LF7 E;  4LF5 E;  2EOJ A;  2EMY A;  4R2E A;  1FJG E;  1G2F C;  3HQ1 A;  2ENA A;  1IBK E;  4FK5 C;  2EE8 A;  3TQM A;  5LMU E;  2DRP A;  1QU6 A;  2YTI A;  4NHR A;  3UK3 C;  2EOO A;  1X49 A;  2EQ1 A;  1WRJ A;  2HC5 A;  2EM2 A;  3C6M A;  2UXC E;  2MC5 A;  4R2Q A;  1NCS A;  2EPK X;  2N3G A;  3C6K A;  2WBT A;  2YTO A;  5LMN E;  4DR6 E;  2VE7 C;  4RHB B;  2M9A A;  2RQL A;  2GPI A;  2EMH A;  2RS6 A;  2EQ0 A;  5AE1 A;  5BR8 E;  2MKN A;  4RH8 A;  2WBS A;  2EMB A;  4R2P A;  1SR9 A;  3BBG A;  2GHF A;  2FV4 B;  1WHQ A;  1TF3 A;  2I13 A;  2KOU A;  3LML A;  4JI5 E;  1PJS A;  1N32 E;  1HR0 E;  2ENH A;  3IWC A;  2EOI A;  2EMX A;  4DKK A;  1EKZ A;  4BHB A;  4JI6 E;  5AE3 A;  5KL4 A;  1N33 E;  2YTP A;  4P78 A;  5AC5 A;  1HNZ E;  1KJK A;  4X9J A;  2EPR A;  2EPO A;  2BBG A;  2VQE E;  1N34 E;  4DR2 E;  2CSH A;  2CT1 A;  1GQE A;  5AE2 A;  2EWL A;  4F9A B;  3HPZ A;  4MLQ A;  2B7T A;  2ODR D;  2YU8 A;  4O5G A;  5A6B A;  1O0W A;  1G2D C;  3HTX A;  2DMI A;  4WXC A;  2UUB E;  2LO3 A;  2YTE A;  5ADZ A;  2EM3 A;  2EL4 A;  4F9B B;  3FIG A;  4N4R B;  5LL6 R;  2CPN A;  3BF2 A;  3VHT B;  4JI7 E;  3BID A;  1RMD A;  3AUZ A;  1T4L B;  2LUQ A;  2LVH A;  4DV1 E;  1T39 A;  2YU5 A;  4KZS A;  1NEI A;  2L92 A;  3L00 A;  3OML A;  4I8O A;  1X6H A;  2EPA A;  2LRS A;  2ODR C;  4LFC E;  2EPL X;  1YFH A;  2FGG A;  2EM8 A;  4ZYG A;  4JI4 E;  1L4S A;  2MDG A;  2EOY A;  5DNY A;  5F3W A;  2N8X A;  2ELZ A;  2EOZ A;  2LJU A;  4B3S E;  4HTG A;  1FKA E;  4DR1 E;  4DV5 E;  2WZO A;  1JK1 A;  3J7Y p;  2RPC A;  5TSE A;  2EMW A;  4DV2 E;  4F54 A;  2EOF A;  2YTQ A;  2B3T B;  2K7I A;  4BMJ A;  2EMK A;  2L8T A;  1I94 E;  4OX9 E;  2A25 A;  4R2A A;  2EN2 A;  2RSI A;  4WYQ B;  3EPH A;  2LBS B;  1X6E A;  4R03 A;  1KYQ A;  2GLI A;  1EH8 A;  2JOX A;  2EL6 A;  2EN8 A;  3HXL A;  4JI8 E;  4B3R E;  1ZAA C;  4DV7 E;  2ENC A;  4ZYD A;  2V83 A;  2YPN A;  1UHZ A;  3IWD A;  2JOB A;  4OOG C;  2E5L E;  2E72 A;  1ZU1 A;  2EM4 A;  2M7Q A;  4ZYE A;  3KZY A;  2EOX A;  1IBM E;  4O43 A;  2EMI A;  4LF9 E;  4AQY E;  4KHP E;  1YSA C;  2KHX A;  2R76 A;  2EM7 A;  2YRH A;  2EPX A;  1PKP A;  2ZM6 E;  2DLQ A;  3J7A G;  1YUI A;  1YYK A;  1A1G A;  1T4O A;  5T6J A;  4WSP A;  3THO B;  1ZBQ A;  2EJ4 A;  2JR1 A;  2EPZ A;  1A1J A;  4JI1 E;  4J8Z A;  4LTY A;  4WXD A;  4GKK E;  2RSM A;  1Z1B A;  2EM0 A;  2YTD A;  2RS7 A;  5A69 A;  3J81 C;  1P47 A;  2LUP B;  2I9I A;  2L2N A;  2M4I A;  2V8Q B;  2VQF E;  2DB2 A;  1AH5 A;  4P7D A;  2DGC A;  2B7V A;  3ADJ A;  4WPY A;  4BBY A;  3EPJ A;  1PJT A;  1BBG A;  2V88 A;  1DI2 A;  3MSW A;  1WXR A;  5KL7 A;  4R2R A;  2LT7 A;  1YYO A;  4DV0 E;  2YTJ A;  2K4V A;  1MGT A;  1XNR E;  3THN A;  4WSG A;  4M2Z A;  4O4K A;  1A1I A;  3F6G A;  1AAY A;  4F9C B;  2EMC A;  4KWY A;  2NUF A;  5KL3 A;  2ADR A;  2UU9 E;  4L8N A;  4WFT A;  4X66 E;  1BBO A;  4LFB E;  1X5W A;  2L2M A;  2LJH A;  3JU0 A;  4TUG A;  3DJW A;  2VF1 A;  3ADG A;  4X8W A;  2L6M A;  5KL2 A;  2YTF A;  1UBD C;  4JI3 E;  4Q35 B;  2LMZ A;  3VK6 A;  5LLQ A;  2V87 A;  1WHN A;  4HEI A;  4IS1 C;  2R1F A;  3VYX A;  3AV0 A;  1JK2 A;  1HNX E;  2D9H A;  1J26 A;  2YZT A;  5KL6 A;  2EN7 A;  5IXM B;  2YT4 A;  4LF4 E;  4GKJ E;  1QNT A;  5FLX C;  3C4B A;  1XNQ E;  2WCC 3;  2EMA A;  5IT9 C;  5AAS A;  3DF6 A;  4B3M E;  2G7H A;  1YYW A;  2LTS A;  4DMI A;  3F6H A;  2ELY A;  2NUG A;  4ZYH A;  4DR3 E;  2YSP A;  1X3C A;  2IHR 1;  3BGH A;  2HHH E;  2EP3 A;  2UUC E;  2MC6 A;  4JV5 E;  4BC7 A;  4LU9 A;  1BB8 A;  3P1X A;  2EML A;  2BB8 A;  1IQS A;  2YWQ A;  4R8O A;  2VRD A;  1X47 A;  4DV4 E;  3IWB A;  3C4T A;  4F2J C;  2DIX A;  2NA2 A;  3OTO E;  1N36 E;  2LV2 A;  2EN1 A;  3T1Y E;  2UXD E;  4GEQ B;  4JYA E;  2JYA A;  4MLV A;  2HGH A;  2V89 A;  1PJQ A;  2LCE A;  2B9D A;  1ZR9 A;  2EOM A;  4NZV A;  1XMO E;  4LFA E;  3EPL A;  3KZZ A;  1T4N A;  2NUE A;  1STU A;  4R2D A;  2L2K B;  4LF6 E;  2EOQ A;  4X64 E;  5A6K A;  4Q28 A;  2EPM X;  1A1L A;  1TN9 A;  1LLM C;  1ZBT A;  1DGC A;  1IBL E;  1XMQ E;  5A6A A;  2EMG A;  1DQ3 A;  1PDA A;  4YY3 E;  2HJJ A;  1A1F A;  4K0K E;  1EH6 A;  5IV8 B;  1WJP A;  2EPP A;  4M9V C;  2YTN A;  4R2C A;  1EH7 A;  4BC9 A;  2MDR A;  2JWO A;  5CFF E;  2M1S A;  4DR5 E;  4DUY E;  1N3G A;  1A1H A;  2V86 A;  2JXP A;  2KON A;  3ADI A;  2DLK A;  5A6B D;  2UUA E;  2EN6 A;  2EOR A;  1IQO A;  4L5N C;  4DV3 E;  1T38 A;  2YRK A;  2EMF A;  2FTX B;  4DR7 E;  2UXB E;  1YPN A;  2EZ6 A;  2EN4 A;  2MKD A;  4O24 A;  2F4V E;  5KL5 A;  2NAB A;  3MHS C;  4BHC A;  1GTK A;  4NXN E;  1SFE A;  2EM9 A;  1IMU A;  3RMP A;  2EM6 A;  2DSY A;  1YUJ A;  3K6Q A;  4GZN C;  2J7J A;  3KWR A;  3VYY A;  4DR4 E;  2LE2 A;  3HPS A;  4JI2 E;  2YRM A;  1RC7 A;  3ADL A;  1A1K A;  3QG5 C;  1UN6 B;  3MHH C;  2L3C A;  2L3J A;  2EN3 A;  1YZ9 A; 
#chains in the Genus database with same CATH homology
 1KJK A;  4X9J A;  2DLQ A;  2EPR A;  1YUI A;  2VRD A;  4F2J C;  1A1G A;  2CSH A;  2YSO A;  2CT1 A;  2LV2 A;  2EJ4 A;  2EN1 A;  2EOS A;  2EPZ A;  2YU8 A;  1A1J A;  4F6M A;  1G2D C;  2EOH A;  2EPU A;  2DMI A;  1Z1B A;  2EM0 A;  1B69 A;  2HGH A;  2EPC A;  2YTD A;  2LCE A;  2LO3 A;  1ZR9 A;  2EOM A;  2YTE A;  1P47 A;  2EQ3 A;  2EM3 A;  2EL4 A;  3EPL A;  2PRT A;  3EPK A;  4R2D A;  4F6N A;  3VHT B;  1RMD A;  2EMZ A;  2JP9 A;  2EM5 A;  2EOQ A;  3M99 B;  2LVH A;  2JPA A;  2EL5 A;  2YU5 A;  4IJD A;  1LLM C;  1A1L A;  1TN9 A;  2DGC A;  1X6H A;  2EPA A;  1DGC A;  4R2S A;  3EPJ A;  2YTG A;  1MEY C;  5KL7 A;  4R2R A;  2EM8 A;  2EMG A;  2LT7 A;  2MDG A;  2WBU A;  2YTJ A;  1A1F A;  2EOY A;  2ELZ A;  2EOZ A;  1WJP A;  2EPP A;  4M9V C;  4WSG A;  2YTN A;  4R2C A;  1A1I A;  1AAY A;  2EMC A;  1JK1 A;  2CTD A;  1X6F A;  2RPC A;  5KL3 A;  1TF6 A;  2EMW A;  2ADR A;  1F2I G;  1A1H A;  2EOE A;  2EOF A;  2YTQ A;  1BBO A;  2DLK A;  1X5W A;  2EOJ A;  2EMY A;  4R2E A;  2EMK A;  2EN6 A;  2EOR A;  2A25 A;  4R2A A;  1G2F C;  2ENA A;  2EN2 A;  2RSI A;  2YRK A;  3EPH A;  1X6E A;  2EMF A;  5KL2 A;  2YTF A;  2EE8 A;  4FK5 C;  1UBD C;  2DRP A;  2YTI A;  2GLI A;  3UK3 C;  2EN4 A;  2EL6 A;  2EN8 A;  2EOO A;  2MKD A;  5KL5 A;  4IS1 C;  2NAB A;  2R1F A;  3MHS C;  1JK2 A;  2EQ1 A;  1ZAA C;  2ENC A;  2D9H A;  2EM2 A;  2EM9 A;  4R2Q A;  5KL6 A;  2EN7 A;  1NCS A;  2WBT A;  2YTO A;  2EM6 A;  2M9A A;  1YUJ A;  2EMH A;  4GZN C;  2WCC 3;  2EMA A;  2J7J A;  2EQ0 A;  2MKN A;  2WBS A;  2EMB A;  4R2P A;  2E72 A;  1ZU1 A;  2ELY A;  2EM4 A;  2GHF A;  2I13 A;  1TF3 A;  2EOX A;  2YSP A;  2EMI A;  2YRM A;  1X3C A;  2ENH A;  2EOI A;  1A1K A;  1UN6 B;  2EP3 A;  1YSA C;  3MHH C;  2EMX A;  5KL4 A;  2EN3 A;  2EM7 A;  2YRH A;  2EPX A;  2YTP A;  2EML A;  2BB8 A;  1BB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...