4R2WA

X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
243
Chain Sequence
ADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAACVAGVIVNRTQQEIPEVSAVSIVVAAAKKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title High-syn conformation of uridine and asymmetry of the hexameric molecule revealed in the high-resolution structures of Shewanella oneidensis MR-1 uridine phosphorylase in the free form and in complex with uridine.
pubmed doi rcsb
source organism Shewanella oneidensis mr-1
molecule tags Transferase
total genus 85
structure length 243
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r2wA00
1Z5NA 5IU6A 2AI3A 2Q7OE 4TXNA 4R31A 4D98A 4G89A 2OC4A 3BL6A 4IP0A 2AC7A 4TXJA 4QAQA 4M7WA 4TS9A 2GUWA 4WKOA 2QTGA 4F3KA 1Z38A 1Z39A 1PKEA 1JDZA 4F3CA 4F2WA 1RYZA 1JYSA 3OZBA 1A69A 1Z36A 2HRDA 4M3NA 4OGKA 2PGAA 3D1VA 1JDSA 1T8SA 1TGVA 3OPVA 1JDVA 3FUCA 4OY3A 3QPBA 1V4NA 4QARA 1VHWA 3KVVA 2AI2A 1A9PA 2H8GA 1JP7A 5F78A 5CXQA 1K9SA 4PNPA 4I2VA 4JOSA 3UAYA 1Y1QA 3UAZA 3E9ZA 4GLJA 4JP5A 3IEXA 1CG6A 1VHJA 1WTAA 2I8AA 1PW7A 1OU4A 1SD2A 4L5YA 4BN0A 4GKAA 5ETJA 1U1FA 5JPCA 1LX7A 3OOEA 1NW4A 4YMLA 1V48A 3SCZA 1RCTE 1TCVA 1Q1GA 5F76A 4LZWA 1NC3A 3E0QA 4D8XA 2OC9A 1RXCA 4NSNA 4H1TA 2QTTA 4UC0A 3OZDA 1YBFA 3DJFA 5CCDA 1LV8A 3E9RA 4DA0A 1ECPA 3KHSA 1TGYA 1U1DA 1K3FA 3KUKA 1RXUA 4DA7A 3ODGA 3BSFA 4RJ2A 4K6OA 1K27A 1VMKA 3OF3A 3FAZA 1PWYE 3NBQA 5DK6A 1PR2A 5B7PA 5KB3A 4BMYA 5F73A 1JPVA 3DP9A 1ODKA 3UT6A 1YR3A 3ONVA 3BGSA 1OUMA 1JDTA 3FOWA 1OVGA 5CYGA 4ECEA 5IFKA 1ODJA 1ZL2A 4BMXA 3FWPA 5EUBA 4TYMA 3LA8A 2I4TA 2QSUA 1ODIA 5F7JA 4QASA 1Y6RA 4L5CA 1T8YA 1ZOSA 4WKNA 1JE1A 3K8OE 3OOHA 3T94A 1U1CA 4E1VA 2A0YA 1Z34A 1U1EA 5EPUA 5B7QA 5FAKA 5CXSA 1YQQA 3BJEA 3KVRA 4DARA 4OEHA 3EMVA 4DAOA 1LVUA 2A0XA 5C80A 4R2XA 5CCEA 3FNQA 1TD1A 1T8RA 1TCUA 1A9TA 4BMZA 1A9QA 2OECA 1SQ6A 4X24A 1V45E 5CYFA 4EB8A 4F2PA 1ULBA 3TL6A 2IQ5A 1G2OA 1A9RA 1Y1RA 3PHCA 4LNAA 1PR5A 1RR6A 1XE3A 3INYA 1OV6A 3OCCA 4GMHA 4LKRA 1FXUA 1RSZA 3DDOA 1OTYA 3OZEA 4LDNA 1YRYE 2QDKA 4WKPA 5F77A 3PNPA 4LNHA 1Y6QA 4MCHA 4OJTA 4M1EA 1PK9A 1Z5PA 4MARA 3GGSA 3U40A 2HWUA 3PNSA 3P0FA 2A8YA 2XRFA 1PR1A 2QPLA 4DANA 4TXHA 1T8WA 3IOMA 4TXLA 4NY1A 1RT9A 4YNBA 4F1WA 1Z5OA 3P0EA 4QEZA 4PR3A 4NS1A 4QFBA 1PBNA 4TS3A 3KVYA 4KN5A 1YQUA 4D8VA 1C3XA 5EFOA 4TXMA 2ISCA 4FFSA 1ULAA 2B94A 3MMSA 3NM4A 1V2HE 2AI1A 3OZCA 3LBAA 1U1GA 3MB8A 3K8QA 1I80A 5I3CA 4DA8A 3F8WA 3NM5A 2HSWA 1Z35A 1Z33A 5K1ZA 4G8JA 5F7OA 1PR4A 4R2WA 3UAXA 1N3IA 1PK7A 4TTIA 1A9OA 2P4SA 3NM6B 5B7GA 4OGLA 3C74A 1Y1TA 1VFNA 2OXFA 2HN9A 4MCIA 4QATA 4L6IA 3LGSA 4U2KA 1CB0A 3ENZA 4D9HA 1SD1A 2BSXA 1OTXA 1V41E 3EUEA 4GLFA 1ODLA 4P54A 5F7ZA 1NC1A 1PR0A 5F7XA 4DABA 1RFGE 1PF7E 4DA6A 4YO8A 3UAWA 2ON6A 1M73E 1Y1SA 2A0WA 5B7NA 3EEIA 1Z37A 1RXYA 4G41A 4WKCA 3DF9A 1B8NA 3UAVA 1PR6A 1B8OA 1V3QE 3DPSA 1T0UA 3PHBE 4TTJA 4EARA 1SJ9A 4L0MA 4WKBA 1JDUA 3O6VA 3EUFA 4JWTA 1A9SA 4YJKA 3FB1A 4L5AA 1RXSA 3O4VA 3GB9A 3KU4A 4DAEA 1QE5A 4D8YA 1JE0A 2RJ3A 4OF4A 4TTAA
chains in the Genus database with same CATH superfamily
3KB6A 3IUMA 3TXXA 2Q7OE 3STTA 2PWAA 1KR2A 3F46A 1LLQA 1T5HX 3RVSA 1X7ZB 1C0EA 2Y1CA 3GGGA 4IQ8A 1XFAA 1REQA 2Q2NA 2IZ6A 1ZM9A 1LEHA 4IUYA 1J6UA 1I6LA 2HXSA 3MZ0A 4L4UA 2X86A 3EVGA 3HA3A 4P32A 4R31A 1YHYA 1YZYA 2OENG 5JS6A 2VDJA 1SQGA 2Q62A 2VQ3A 1V2GA 3HJCA 3O26A 5F9MA 1SZPA 2MYPA 4NPHA 4PZZA 4TS9A 4NYJR 4Y2PA 2AN1A 3OPYB 4D9IA 3OWXA 3H3JA 4M0UA 1XZKA 2AHRA 2B3DA 2VK4A 1Z7BA 2PAAA 1YTUA 4LCBA 2G67A 4GUDA 1RM4A 4X94A 3DZIA 1VHQA 4PO8A 1OXUA 3WNVA 5LKAA 2AF4C 3GAZA 4LJSA 4M3NA 4GZLA 1U90A 1XCPA 4GWKA 3FM9A 4JB2A 4AZSA 3D1VA 1LSJA 2V55B 3U3MA 3E9YA 1YE3A 4J4BA 1DG1G 1JU3A 4W7HA 3ZZ0A 1QU2A 5GV7A 1DO8A 1BH2A 2FFQA 2VYCA 2JIZA 1FRVA 1NMZA 2I33A 4OHVA 4WZZA 1KEEB 5DTQA 3V8NA 3FHJA 5IF9A 5G1OA 4ZYWA 4JSYA 1EIWA 1RI5A 1RI3A 2YVKA 1MB3A 4YXWA 1FSZA 4F0JA 3NAGA 1LPAB 4GOXA 3U4IA 4H15A 4LF4B 2ZETA 4RF4A 5FA6A 1FJHA 2X77A 4YJDA 5HDQA 2NSDA 4DHEA 3WAGA 3FR7A 3TR6A 2FYTA 5KTSA 3T1NA 2QJFA 1KMQA 1W25A 4CMHA 3G8YA 5DV9A 1VL8A 3NC1C 4O4IF 4Y6SA 1JPNA 1NZJA 2CVHA 4BAZA 4EMSA 3KPUA 2NGRA 1Z7EA 2A1UB 4KWTA 2JJQA 1WZEA 2OXTA 4S04A 4AWAA 1CUVA 3CWZA 4OAOA 1JHAA 1NMYA 5FQOA 4NG5A 3HVRA 5H16A 4YAKA 3LWBA 1EE2A 1V7ZA 3P27A 3OURA 3ITDA 2VFAA 4TUYA 3BTUA 4ASUA 1OIWA 3BVPA 2AMLA 4G56A 3O21A 3GDHA 1NXPA 4LXXA 4X7MA 5TIIA 5KQPA 4BO3A 5CTJA 1VHJA 2NQ2C 3GNQA 1NR7A 1PL0A 1T9GS 1PW7A 3ZY2A 4EPXA 5H7XA 3N6VA 4L5YA 1BW9A 3H5WA 3P9IA 1RNLA 5CNJA 1ISIA 3IMKA 3GLFE 4QREA 3RI3A 2NPOA 2Z2IA 4YCMA 3BJRA 5EVJA 4WBNF 1Y37A 1ZOPA 3CF4A 3W3AH 5COAA 4LFBB 3LXUX 2F1IA 3ORRA 4KVAA 2C7PA 3E9EA 4PONA 3E27A 3TRIA 5EJ8A 2YJZA 3G0IA 4ZOQI 1Z8DA 3A1WA 2D5LA 1Z4OA 3GK3A 1N57A 3KYBA 3P20A 3ZH2A 4ZHQA 1SR8A 2PVSA 5JAZA 2FX2A 3EZGA 4DBLC 1MP0A 3LE8A 2QE7D 2E1PA 2ORED 3ETJA 4UC0A 4HMPA 3KT6A 3ZGXA 3VFDA 4YIKA 5IJ0B 2O8FB 1OZGA 2H59A 3VYRB 3UJ9A 3SMVA 1WKBA 3ZGOA 3HKCB 3O4IA 2C9DA 3E5NA 2G8NA 3CMCO 3NORA 3PKZA 4TV9B 4WE3A 1QLHA 1CS0B 4DA0A 2NAPA 1PE0A 3C3WA 2R6R1 1K8XB 4WVLA 1HV8A 1OROA 4HB2A 5JYDA 1GPMA 5KYXB 4G1BA 4E33A 1QHXA 1OLXB 1G4HA 2C1ZA 4RV4A 3T7DA 3WKEA 5CG1A 3J81A 3BWEA 4QGGA 2FZVA 2J41A 3KXLA 1AOXA 2ZJ3A 2QN2A 2YFHA 5IVPA 2CCJA 5JZMA 2AW3A 1CZOA 5FAXA 3TR5A 2C92A 1E5QA 3LQ1A 1K27A 1E7MA 4I9HA 2W9XA 4QSMA 3HRHA 1M2GA 4AJHA 3JW8A 4GMKA 4UM9D 4X63A 3QE9Y 1C2YA 1TYEB 2PT9A 3PRJA 1G7SA 2GI4A 3CB2A 4LDPA 2D2FA 5LDDC 4JI4B 3LBYA 4B0OA 7YASA 2FPWA 1ODFA 3WWOA 4ZZ3A 1ZQ1A 1K7FB 1Y8RA 3GFBA 3K0FA 3RS3A 4B6PA 1T8UA 3M4ZA 4CM1A 4EO9A 1J97A 3ETHA 4AN1A 3T5CA 5DKFA 2J8ZA 5IEBA 4U63A 1K7YA 1D04A 4D43A 1I32A 1EP2B 4W1SA 1ZJWA 4J90A 3X1YA 1JDTA 1QKKA 1KAMA 3O03A 2JLWA 2PL9A 1X7GA 4Y1RB 3P97A 3SLRA 5CYGA 5KQRA 1QIJA 4RKEA 1KOGA 2Z2XA 3HWWA 2JAUA 4MMYB 4MWDA 4YUWA 2H0RA 2QTFA 4Y7DA 1GIAA 4CFSA 1DU4A 3M1AA 3PRHA 1B2LA 3FWPA 4MGEA 1A98A 1NATA 2YL2A 3B2EA 3VR5A 3ZY3A 4FT2A 4B43A 4CM3A 1UJ2A 4OGWA 3GZNA 4KXXA 4YR7A 3ZQUA 3CA8A 5GMOA 4YAEA 4FR5A 4IEFB 4IQFA 4CW7A 4LMAA 2DG2A 3SXPA 1NXTA 2ZU0C 4FGSA 2FPOA 2KQUA 4MINA 1Z4QA 4PLYA 2IEIA 2Y1WA 2H2GA 5FTMA 3SM3A 3MTBA 2PZMA 5EJ5A 3DKIA 3EVZA 3DR5A 2HIGA 1XWWA 4J9VA 4TZ6A 1KYTA 1G4AE 2HA6A 1PCXA 4YO7A 4XQ0A 1X0VA 1VG9B 2V0NA 3NFYA 2Q99A 1POWA 3W5VA 2IPNA 4CODB 4DV5B 1O9BA 4V38A 4FYYA 1SQFA 4G97A 3K35A 3L7DA 2QDXA 4WK4B 3BWXA 5AVKA 1K89A 1LI5A 1KJYA 2DOKA 2WVGA 3F2VA 5AK4A 3N2KB 4Q9DA 3ZBPA 3GRUA 3WZ2A 3UWDA 4F4CA 1COZA 1IQ0A 1P6XA 1J8VA 3AI1A 2Y76A 3DCJA 2D1TA 4M9SA 4OJNA 4D3XA 4LV5B 5IT4A 2HT6A 1XJ5A 1RBZA 4WECA 4G5SA 4LNUB 3SBDA 3D59A 4ARIA 1DJLA 3IVAA 3GJXC 1KHHA 5SICE 1GRCA 2Q1UA 4Y0NA 4XPIA 1YB1A 4RORA 1NV8A 4QYSA 4EG7A 4DMFA 2E6UX 3DSRA 2VP2A 4I50F 5CX4A 1XU7A 2B7CA 4XIFA 4FU0A 4IGAA 1BCSA 1R10A 3C4JA 4AUEA 4MS3B 1GEGA 1F8GA 4L51A 3DYVA 1M0TA 1IH8A 2CJXA 1OTHA 2FQYA 4GXRA 4J0IA 3NWJA 3EGOA 4YMGA 1T5DX 3TLGB 3K53A 1BU8A 2GSDA 2WW8A 3RRZA 1U1IA 4GIBA 4DY6A 3UM9A 1NG9A 3ZNQA 3KV3O 1Q0PA 3KJHA 3Q0IA 4DB4A 1QC5A 4ER5A 1GNSA 3VJLA 4HI0E 3FOCA 2BELA 4E22A 2Y2VA 3F6SA 1FLDA 2FZ5A 1WD7A 1YOBA 4FHEA 1VA5A 4PEVA 4DM7A 3ESYA 2GYWA 3UMJA 3PT5A 4BNVA 2O59A 1NE7A 1WLYA 1ESEA 4KQFA 5AKKA 1LU9A 3TOXA 5FWYA 4HY3A 3OM8A 1EP9A 1NW3A 4OQXA 4TX1A 4YUAA 1F0KA 1XD9A 2ERYA 4RQUA 4B7AA 4HDNA 1V5FA 4C2UA 3KB2A 2D0PB 2VP9A 1RAGA 1OKKD 5GZ6A 1QVAA 4YN3A 4PLGA 3UMVA 3PA6A 2PM8A 1YC5A 3EWIA 3S8EA 1E5XA 3ED5A 5AM2A 1GRRA 3IKTA 1S8FA 3U40A 4QUDA 2D7JA 1Y5RA 1DHTA 2P11A 3CGWA 2BEJA 4FGLA 5DWVA 3T7CA 1L5HB 4QQNA 2JIZD 3EDQA 3IBCA 3E5MA 1K7EB 3AWDA 4XXHA 4C1BA 5TGDA 2UUAB 2QPLA 3KHUA 4FILA 5EZ6B 2ZPUA 4YXWD 3JVUA 2VF8A 1QVZA 3NXSA 1RT9A 2MINB 3GCXA 3WLAA 1NVAA 2OFWA 3HJBA 3SR3A 3V7YA 1DGQA 5ADUS 5CU7A 4L7QA 3I52A 4JNKA 4ZVQA 2W0MA 1KVTA 3I05A 4PFJA 3MINB 3DXXA 2E4WA 1RDFA 1ZUHA 1AXEA 3QPDA 4UJ3A 2ZJ2A 5K0SA 3VTFA 1ZU4A 5JARA 3IVXA 3QHAA 1F8XA 4OQZA 1GRQA 3MJHA 3RARA 1PHPA 3AF4A 5B4VA 1LBQA 2RC6A 4ICIA 3PQ5A 4LYFA 2X5NA 1RVDA 2Q5JA 2GPTA 3FVRA 4O4JB 1NOKA 3KVYA 3FOZA 3O8QB 3U44A 1TZJA 2XXBA 4JA2A 3W7VA 1CUSA 1ZJ5A 1C9KA 2O8DA 2WJAA 1GPYA 4TWAA 1PV1A 2VZ9A 4J0FA 1C3XA 3PVZA 3G49A 1LB1B 3HJGA 3IQDB 4KDEA 5HMLA 1VE1A 5IDWA 1DTWA 7ADHA 3IBYA 4KMMA 5E8JA 3RVRA 2D2XA 3UYLA 2YWBA 3I0MA 5JZ9A 5ICGA 5CURA 3CN7A 5IT0A 4OL9A 1HL3A 1NQUA 1X7YB 4E70A 2Q6IA 3HVHA 1N2GA 2UDPA 4L3VA 3TPZA 1DPFA 2WTNA 2DSTA 3V33A 4TL9A 2O5RA 2R1VB 1TD9A 1DDGA 4PG6A 4UNQA 5E6UB 3UXEA 4TROA 4EHJA 3LO8A 5F98A 5ICFA 4JB8A 5E4TA 4WOKA 1OY1A 1UOQA 2GN9A 4QL3A 1CY8A 1OGYA 1FP4A 1ZN9A 2A59A 1N1GA 2VRWA 3CM0A 3LUKA 2HSWA 2MSLA 3RRMA 3U7HB 2GM5A 4NCHA 3A2NA 3PDUA 4YP0A 3U81A 4DIKA 3ZJTA 5CFZA 2AMJA 4F04A 2PQ6A 2XWPA 3LDFA 1BXKA 3KDAA 4CL3A 1JXAA 1F2UB 1E2LA 1GRNA 1PL7A 1TQDA 3HPRA 2F43A 1LA2A 5CW1A 1IK6A 4MXDA 1PFYA 1ZC3A 3OBIA 5KKAA 4LN1A 3NIDB 4K9RA 1SUFA 5I6DA 3LOUA 1CVRA 2QSZA 1H5UA 5EHIA 1K06A 5C8YA 4L15A 4P7GA 4E4TA 2YC4C 1DAMA 4LMBA 3P9QA 3F96A 1Y6FA 1HURA 2ZYTX 2HD4A 4HLUA 2HW8A 6AT1A 2ZRJA 5CK4A 2I65A 3KWFA 5J4VA 2WVHA 1P0FA 3FMPB 3C74A 4O4LF 4BQOA 5C8XA 4I14A 5JCJD 1JLLB 2WJZB 3PDHA 2MDTA 5KNDH 3D9QX 3PPXA 1UXKA 621PA 1K7SN 3EY4A 2R6CA 1G2QA 5EVCA 2IUSA 4IXMA 2R2GA 3AR3A 2PH3A 3P9NA 1P17A 2ZWOA 2CF5A 1EM8B 1VRCA 2JJ1A 4PPYA 4Q7MB 2RE8A 3MMNA 1WD5A 3DL4A 3CWCA 521PA 1UBTS 4H6PA 4P93A 3C7KA 3KOYA 1H1LB 1MEEA 1AKWA 1L4FA 2JEOA 3DHVA 4NU6A 5FUVA 5A9SB 1KBQA 4QDUA 4RK0A 4GECA 4HF7A 3SSMA 3URKA 3RKSA 3V48A 3K0AA 5J2UB 4ZICA 4JU9A 2QBYB 2BBSA 3HU1A 1CDZA 4HDRA 4J7CA 1J2UA 3C24A 2VSOA 3Q3CA 4I8XA 2QXYA 1XL0A 3QEMA 4WNCA 1QLJA 3F5DA 4FDAA 2R97A 4I55F 5EJIA 2O06A 3ZV5A 2GAOA 3A1TA 3OLCX 3L77A 5TV2A 2CSXA 1VZ2A 5CNMA 1V0JA 2A7QA 2P3LA 2PSEA 3SY8A 4B9AA 1QG4A 2X23A 3OIWA 5T3YA 1O8BA 1TTPB 4KYVA 2DX7A 4XQGA 5LZ7A 2BONA 4DC9A 1BTOA 4GLOA 4REQA 1V3VA 4E03A 1PL6A 3SC2A 4G0PA 4G9EA 1DJQA 1Z12A 2ZFUA 1PZNA 3RIEA 2Y1XA 4AK9A 2Q1SA 3OLVA 3IR7A 4BKQA 3U09A 1QIGA 2ONKA 3LX6A 3VR5D 5ARBA 3LTEA 3L4SO 1YBVA 4XGKA 1FP2A 4D92A 4GAEA 2AQKA 3EGWA 4RF3A 1FPMA 3SBXA 4YAIA 3KBOA 4DBVO 2LR0A 4PNHA 2VDRB 3IHWA 3M8KA 4TT3A 4IYJA 1H65A 2D5IA 2ZE7A 2XQFA 5DYGA 5EJMA 1B6TA 3PFKA 2VUUA 4AXBA 1SUBA 3BIXA 1ES9A 4MV8A 3O8NA 2J46A 1U02A 2CLDX 2IS2A 4Y6OA 4ZYLA 3BB1A 1GGFA 5H9WA 4BKPA 1B8NA 2WF5A 1PUXA 3FFWA 2N1MA 2C96A 4K9DA 1BOFA 3KO8A 5LYJF 1PWHA 1XDSA 4PX3A 1NBMA 1EFLA 3PFFA 1YZVA 5K8CA 5IS2A 2LRHA 4HQLA 4CI9A 5A9RA 5HFAA 3UA4A 4HSEA 4N76A 2BGJA 2ONYA 1T43A 3O6VA 4JWTA 1WAMA 2FNAA 3TGLA 2OHXA 3ZVNA 1F2VA 4Y9TA 5T4HA 2YMPA 5ALZA 5LUAA 2HEGA 3ROPA 1MXHA 4NJMA 3FGPA 3WVNA 4MO2A 1K68A 4Y0VA 1E1LA 1YI8A 1R9MA 2OCBA 3JASB 3DNMA 4B7ZA 3C3PA 4AP5A 3RG2A 5IAKA 1E1CB 2PU5A 2FSVA 4XR4A 2Z6QA 1WXXA 4PG8A 3B6MA 4RTJA 5FFNA 3ZS8A 3SR0A 2JFHA 1X8XA 2C1XA 1YR1A 1BEZA 1LVGA 3NETA 1JAXA 3R5XA 4G0ZA 4KNVA 4NHOA 4QE3A 2XCSB 4CWAA 1UKZA 1AQIA 3G02A 5JNSA 4IEIA 4NBWA 5HZKA 1Y3IA 2IE8A 1D4ZA 1EI9A 2BBOA 2EZ8A 4JC5A 3B52X 1FNBA 3DEFA 1N6PA 4ZCIA 1CUDA 3L0DA 2EVWX 2HZBA 3OU6A 3RHFA 2PZGA 1N7HA 2TMYA 1C81A 2XB4A 3M7IA 3OKPA 1W2GA 4D98A 3G5AA 5CGQB 5ALPA 1V9LA 4MHOA 3U7GA 5D85A 5EKUA 1CRWG 1U9IA 3PZRA 3U3XA 3DEHA 4LRTB 1MX3A 4M7WA 3C6BA 3KJQA 2QUHA 5B58C 5C18A 1T1IA 2X4IA 4JLVA 2HMWA 5M3BA 3D2BA 1BQ3A 1YS6A 2QTGA 2WHEA 4BU1A 3LKVA 4K8OA 1GGNA 1PKEA 4YLEA 2GA8A 5AJWA 3ZH9B 3FLAA 1OX4B 3ANYB 4OXIA 2IPXA 1T2NA 1TZ2A 2G1KA 3AMVA 2FWMX 2HBYA 3ND6A 1Z36A 3CXRA 4MICA 2Q07A 2PGAA 4B3DA 3WWEA 3O47A 2X5XA 1BXRB 1MIOB 5G0VA 1FDSA 4CG0A 1VI6A 1GZSA 3CZQA 3GNSA 2E18A 2C7RA 1XROA 2OV8A 5DN6A 1G6OA 1AUXA 1P7ZA 4KQIA 3RTDA 3UT5B 5IZ4A 3W5AA 1OLUB 4QUEA 4TV8F 1XRSB 5LOVF 3F73A 1XD8A 3N76A 2RFLA 2D00A 4IXWA 3VR0A 3HE3A 4EH1A 2YZNA 4HTFB 2H8GA 5ES3A 3C7TA 3FR8A 1DZIA 5F78A 3MJTA 3U3DA 1HWYA 2VDOB 1U0LA 1L7XA 1A9YA 4UFNA 2O1WA 2O2EA 2ZBVA 2KWIA 4QBIA 5H0IA 1XZFA 5K8TA 1FU4A 3DZJA 3RG8A 2FPPA 2PYDA 4TWJA 4QGBA 5L40A 1QO0A 4PC2A 2JASA 1UAAA 3H19A 4QYXA 3B3AA 3DVLA 1FYEA 4L07A 2OZLA 4YV2A 1BXGB 2Q5QA 1TZKA 3OQIA 5G2OA 3FYSA 1CY2A 3RS9A 2AOTB 3UANA 1QZTA 3UICA 1TO1E 4Q9KA 2YHSA 2BMDA 4Z1OA 3WOVA 2N9UA 4UBMA 4ZTZB 1E64A 4W99A 3L4JA 4X8MA 3AQIA 4PPFA 2QLFA 4BMOB 4HYEA 4ZGWA 3AIOA 3P45A 4BFWA 5IP5A 4BO0A 1F2TA 1IBRA 2RGDA 2R8YA 4H7DA 4HGQA 1WNFA 5I7OA 3GFQA 4IFBA 4J3NA 3H9BA 1GY8A 3RSSA 5A5EA 5AW1A 2EX4A 1ZEJA 2XDAA 1S2IA 1HDYA 3C3KA 3KPYA 1PZFA 3B5EA 3M9LA 4J0KA 4OAQA 2AWNA 2QU7A 1A9ZA 2NUBA 1QTNA 2ECKA 3FF4A 3KCQA 3N8NA 5DHQA 2RGEA 5F76A 1W30A 4KK3A 4PRKA 5G4LA 3TQOA 5F9HA 2EJCA 3I39X 3UMSA 4P7BA 2YS7A 3SEQA 4QSHA 2PMEA 3HYCA 1A2BA 5HTKA 1LDBA 3RQSA 3LCJA 4NDNE 1XXLA 3LD9A 2Z6UA 4ABYA 1FJ2A 4MP6A 2O05A 4GX1A 3CF2A 4BMVA 3P2JA 4J0JA 4P6VF 4CLEA 4P0PB 3D3KA 1OU0A 3WWYA 1OPRA 4DC1A 4ZANA 1W5TA 4IW3B 1UC5B 2NZ8A 3FE2A 3FDZA 2YN4A 3K32A 2QVZX 4LRYA 3V7NA 3W34A 4CTMA 3LPDA 4AP6A 2QM0A 1KDVA 5IRCD 2YFQA 5TPWB 4AY5A 1WMFA 4P3YA 2P9ZA 2JIBA 1PR9A 3A9WA 3PQ2A 2HNBA 2QN9A 5AUPB 1CJKC 5K0FA 1BD3A 3PEFA 1TECE 2YOFA 2OV4A 1QO9A 3AESA 5PNTA 3S1AA 3ZI4A 4HWPA 4LECA 5CB6A 2ZJ1A 2PANA 1HETA 1XTIA 3MAGA 1QNLA 1FOEB 2R1UA 3NCHA 2XCLA 3O92A 1U7UA 1GITA 3PXUA 1W4CA 2OD7A 3CG4A 4GGPA 2FW9A 4HZIA 3B1YA 4JOBA 1JYFA 2YHAA 3MHPA 5EZYA 3ZGLA 5JYCA 1DIBA 3K6RA 5J43A 2Y1LA 2GJ4A 3R7LA 1H2RS 5NLLA 4X3CA 3AUFA 4DZZA 4YJ3A 4AJ9A 2C9ZA 3A3NA 3ANMA 5AH0A 3RJ9A 1QWSA 4R1NA 4RWZA 2AOUB 3FUWA 3ZQ4A 3IQZA 3NBFA 2H2HA 3LK6A 2EJWA 2MJLA 1P1BA 2RBGA 3PNKA 2Q6OA 4YDSA 1IMJA 3MT0A 3LF1A 4BBJA 1CJCA 2EF0A 4YRCA 1KK1A 1GNRA 3P0RA 3ZD6A 2WTEA 3F74A 4RFVA 4CQMB 3IQIX 4D5EA 5HZHA 3KD2A 5EJ4A 1JFFA 1G59A 1ZUNB 1ISHA 1LGYA 2IH2A 3PXEA 5FI5A 1GQRA 4EVQA 3QX3A 4YBRA 5MN6A 3FBGA 4NI5A 5ICMA 3UHPA 4UDYX 4E7OA 3MRTA 3NWPA 1QZUA 2QRLA 2PCLA 5EUBA 3DA8A 1QFMA 2I2CA 3IQWA 5ALKA 3B2QA 5A1TA 2Y99A 1XQ9A 3IKMB 4TT3D 4YCBA 5CTAA 1GV0A 1E9AA 1Y9ZA 4FZJA 5ENDA 4JR0A 1P6QA 1Y4AE 4ENQA 1ACMA 1Q1NA 1V16A 2WF8A 1W8DA 1U0TA 5EGNA 5IEJA 1AO3A 1U2RA 3UMCA 4HNSA 3DE7X 3H0CA 4DRZA 4RS3A 3UW3A 3I6IA 4GNRA 1MUUA 3QIAA 2KE5A 5BN1A 3CTPA 3H3XA 1VSTA 2J5BA 4LFCB 2LP4Y 2IHYA 3L7CA 2RIRA 3HA2A 1RRCA 1X87A 1TIBA 1N8KA 1SBQA 1U6KA 1AQUA 2OXRA 5BSUA 1G41A 1YSCA 2A0YA 5KYYB 2I3ZA 5AKYA 3VYUB 3B12A 1NLYA 4TV9F 2AOXA 2CLLB 3AF0A 3V1TC 2PDAA 1U9YA 1BNCA 4GRAA 5DFAA 1FFAA 3BF7A 4OXYA 3WA6A 2DQZA 3IULA 3QMWA 1ENPA 2ZAMA 4LTNA 3ZHBA 2ZRHA 1EFAA 1D2GA 2WT8A 1I7LA 2CZGA 2D3TA 2DT5A 3LPNA 1X94A 4XASA 2YIDA 5DTJA 4E5VA 5KHLB 4BIMA 5JWRA 1YCHA 5DJ5A 2GYVA 4B3SB 1OWOA 2YYAA 4TSFA 2V7VA 1U5CA 3V1LA 4CR6A 1XX6A 4WZBB 3KXPA 3V3KA 1E6UA 1GKUB 3Q10A 2QTHA 5CVDA 2B4KA 2WJGA 4X1YB 4QGHA 3DOIA 1H42A 4R83A 3OZFA 2EKBA 3KWMA 3NBXX 4H7KA 3TTWA 3N8DA 3UJDA 2QRGA 3NVDA 5FO1A 5LQUA 3BGIA 3ITNA 1ZI6A 2B2NA 4GE3A 4K6HA 5TGZA 4F2PA 3AUXA 5FJIA 4QRIA 3HBFA 3DXYA 5IJXA 3MCAA 1B0ZA 5AVVA 3U7JA 3FSJX 2IQ5A 1M9NA 3HMQA 3V46A 4UHFA 1A5AB 5FR1A 5IBRA 1NW9B 1Y1KE 1Z08A 1QCDA 4QIHA 1AB5A 3LNCA 2O7QA 5GAJA 2OHGA 3G0OA 1CXZA 3JX9A 1EVKA 1RR6A 2EDCA 5DHSA 2R7AA 3GELA 1OV6A 5A7GA 2ANCA 1DZ3A 1CY6A 1FXUA 3BSYA 3CR7A 3FNGA 2R7LA 4HMQA 2C9YA 2HF8A 4PZUA 5CFNA 3RC1A 1QXSA 1PV4A 5I48A 2A67A 5HS6A 1OLOA 5BSEA 2X3FA 3LWDA 4TOIA 1SIUA 4RLSA 3SYLA 2E4AA 3UUEA 4FD2A 4OB6A 1SCIA 3OQ1A 3T4XA 3A4IA 3UXHA 4F5ZA 3VXKA 4BC0A 3RGGA 1GZ4A 3P2YA 1A7JA 2RGXA 3DMDA 1UWKA 4RH0A 1PSZA 3ZDYB 5DN6D 2GHRA 1VBMA 1W4ZA 1P2GA 4DXHA 5B30A 1FJGB 1QUFA 1W49A 3IE0A 4NQZA 1J0EA 1NMEA 3PX3A 1FS4A 3MWGA 2VJPA 4N7MA 3VU0A 3IOEA 2ES4A 4N4AA 3INRA 1RLTA 3DEYX 3WIVA 1L7EA 1YOVA 4GS5A 1BYIA 3WDKA 2QNRA 3GJ5A 4E7PA 3LP5A 3QHPA 4ON9A 5C0OE 4L28A 5IM4F 2QQGA 4ALMA 4CM8A 3VPHA 1NM5A 3PD1A 2HA0A 3F7NA 3VZBA 4D0LB 3CW8X 4L4ZA 3P2OA 4D0NA 5LD2C 3SJCA 1EWQA 4HQNA 1RWVA 1G21A 1QO0D 2WZQA 1N5OX 2VTBA 3ORHA 4JKOA 4D9KA 4P92A 2WYUA 5F51A 5KYTA 3VOAA 4ZEWA 2N42A 2VKQA 4QBTA 4D9EA 4Q4AB 2GB4A 5LL6P 4G5XA 1D4FA 3WP0A 1GNLA 1E2EA 2GCGA 3DEJA 4DLYA 1CE8B 2XE8A 3QOFA 3B85A 5CVEA 4EFLA 1XTTA 5AW0A 4KW7A 3R6DA 4F06A 4JKYA 4YBZA 3RUAA 5DYWA 4FJ2A 4CEIA 3MMSA 3RYIA 3HJFA 3DG9A 5IKXA 1RS0A 2CBXA 2A9FA 3FTPA 3CX3A 4PTZA 2D06A 2FPIB 4WY8A 4EKDA 5HDBB 1UUFA 3I4FA 3DV9A 4WBXC 2O0KA 4CIVA 2J5RA 1UFVA 4CV3A 1ECLA 1GKLA 3BWVA 4BO9A 1VC2A 2FRDA 1UXJA 2QVLA 1CEEA 4UEJA 4JEUA 4P5DA 5AOBA 3QIVA 2FMFA 4NIMA 1Y1LA 4H3KB 4ZEVA 1X70A 2IDJA 3E35A 1ZIYA 2I22A 4IOLA 5SYMA 1T6ZA 3N9IA 3ITEA 1EWTA 1Z16A 2PR7A 2QKYA 3GLHB 1H0KA 2XRMA 1ZOLA 1D4OA 2W22A 3BULA 3E1SA 3PUWA 4I19A 2Z8YA 4J75A 3FWHA 2AQHA 1EP3B 1RIIA 3FXAA 2FTKE 4LY0A 4X9XA 3DO5A 1P5JA 1YRAA 4A26A 4A9AA 4J0GA 5EE1A 1W0CA 3C1AA 4DV3B 2RJNA 3CIOA 5HUHA 1H3FA 1SHZA 3KEQA 3TTYA 4DSNA 5I7RA 1CZKA 2F00A 2VA8A 5ITVA 5KTRA 3CVUA 4LRXA 4HUQB 1PFWA 4G81A 1FFXA 1IMOA 1M6WA 3EGXA 3A1CA 4FKBA 4JLNA 3NM6B 2JB9A 1L3CA 3RFVA 3WL7A 2YNMA 1IU9A 3ZK8A 1WHTB 3I72A 3FCYA 3AILA 2AG1A 1A4XA 3IPXA 3GJ4A 1L8QA 1WR8A 2AR7A 2OOKA 3H0KA 4E1AA 1WJGA 5A4MS 2XT0A 2B83A 3NHYA 5DRYA 3RFTA 1QB8A 2QHXA 2X6TA 3Q7TA 1H9BA 3SQWA 4EGFA 4GH5A 2Z5VA 3SSOA 1T29A 4UARA 3ZDBA 1G1AA 2JHGA 3S2UA 3EZ7A 3MYYA 4C07A 1XB2A 2RD2A 3IIMA 3ZLUA 3QJYA 3PZBA 3PUYA 1AGPA 1B3BA 1U0BB 2O2XA 2XBMA 3NWEA 4RVSA 2RGAA 1OYOA 1ZXBA 1YRQA 1KOFA 4C29A 4BLSA 1VJDA 4TTSA 1CZNA 2V7QA 3AOEA 4O4JF 5UKDA 1DKNA 3TD2A 4RIEA 3A1UA 4JBGA 4OH1A 4CNQA 2V96A 2V7WA 3CTMA 1MN6A 4KV7A 1LRJA 2BJHA 4HLDA 3W5SA 3PBKA 4QU0A 3ZD7A 1E0AA 1JLRA 2ZCUA 3NX4A 4YGXB 1XDDA 1HZZA 4FZ3A 3JAMA 1W5EA 3UO8B 3KPJA 2BR4A 4P80A 5DYYA 1UM9A 3KKMA 1FPQA 1BGWA 1OAOA 4OI0A 3NKFA 1QIDA 4C0XA 1LZLA 4JHXA 3G1UA 1GILA 2ENUA 2FPUA 2CFIA 3IUYA 5E6RB 2JS7A 3RS2A 4DG8A 3C15C 4KXFB 1MB0A 1VOTA 2VP0A 1P7WA 3JR3A 4HNQA 5DTEA 1ADFA 2QWXA 1E6LA 4YO8A 3RS8A 4HT3B 3JZAA 4RL4A 1M73E 2VWPA 4B3RB 5TJHA 3X2SA 4FT4A 4CG3A 2VLIA 1YS9A 1Z17A 3EEIA 4CHTA 2FOIA 2ZUCA 2DPHA 3LH5A 3BIJA 4N6NA 3M89A 3NPAA 4YJFB 4LWPA 1Y89A 3KUCA 3NV7A 1G20B 3T0GA 5E3HA 4EHBA 2R48A 3HGQA 4JLSA 3HV2A 4BVGA 2OV1A 5FPYA 3QV2A 5K8VA 4JI8B 4EA7A 1I51A 1CQIB 1XLVA 2WAXA 3BCHA 4RO0A 4BNDA 5C32A 3BH0A 2H4JA 2HHCA 1DX4A 4HLQB 2O4CA 5DULA 4DIMA 3IHTA 5EIBC 3RE1A 1KA9H 4D81A 4IIHA 2HQBA 4B7UA 4P4TA 5LIPA 4LFAB 1SUWA 2NMVA 4MR9A 4ZVRA 1M0EA 1E2BA 4EQ6B 1JB1A 1KJNA 2B5WA 2NZWA 2PBZA 3BBPA 4BVFA 5KX5B 1OILA 5EN4A 4MRVA 4WCFA 2XOXA 5BSRA 1WZUA 4F2HA 1T4CA 1QX4A 1SG0A 4IO1A 3LHFA 1NFQA 1ZJJA 2XE7A 2OLKA 2E2WA 4LSGA 1TW2A 2UZ0A 3HDHA 4TRRA 4HJRA 4RFLA 2JHPA 3M82A 3VKWA 2QN3A 4FFWA 1WCYA 1PT6A 3SHTA 2FEOA 3UC9A 2ZUFA 4DEVA 4FDLA 1P0MA 4WA8A 1T1GA 1GKIA 1KIMA 1Y80A 3QELA 5FTNA 1ZISA 2PXHA 4FR2A 1FFEA 4JR2A 2YRFA 1QGYA 2EHDA 2WG2A 4B3TB 1G7CA 3QKRA 1BRTA 4Z9FA 1R27A 4AZVA 1F7VA 4JYZA 2GKGA 1LS1A 2ZB7A 3GA7A 3HV0A 4P5PA 3YASA 4KR3A 1EFVB 1QHSA 3DJYA 3LQQA 3I73A 1O96A 5J2UF 4TMWA 3L1VA 1E1RA 3C39A 4C22A 2MR5A 3WC4A 1B23P 4PTYA 5LQAA 3BCRA 1E9VA 4L0CA 3RRJA 2VSQA 5I4BA 1R9JA 1ZPDA 3OVMA 1M2EA 3K1AA 2CLKB 4WUVA 5F2KA 4YMVA 4ZCRA 1GU7A 2CB0A 1UJBA 3LK7A 5TEWA 3NIGB 1QCYA 1R4MA 4M83A 1EGAA 4AF6A 2WI8A 1DG3A 2XTMA 1I1QB 1XEFA 4D45A 4WERA 4UU0A 5BV0A 4K6MA 5AJZA 2JH9A 3IXQA 3MWFA 3K1YA 2CJPA 2IYTA 2RHBA 5G53C 5TARA 3BGWA 3EGDB 1A0OA 4BHTA 1QS0A 2JI9A 1GEEA 2PX8A 4O0MA 4Q3AA 1GKKA 5C9ZA 4LOAA 3RANA 3ADOA 3TBHA 4C89A 1UZLA 5BOSB 4F3CA 2QQ0A 4FCCA 1C3JA 3QVKA 4F2WA 4V1CB 1P1RA 1O9GA 1MVNA 3QXHA 1Y6JA 3NFRA 4H59A 5H70A 2MIIA 4OGKA 3L0SA 2QD2A 2R4QA 1OB5A 2XHZA 1N34B 1JDSA 1T8SA 5E7IA 4K88A 4JP3A 4JASB 4M0CA 2REQB 3EYAA 1GG9A 2PKRA 1KERA 2A84A 3LSTA 4S0ZA 4D5GA 1SVWA 2DFKB 2FUG6 2I62A 3T1HB 1A9XB 1TJNA 4G01B 1KSHA 4YI3A 1IB6A 1UFOA 4GXQA 4Q05A 1ABBA 2I1QA 2GAAA 2ZJ7A 1IVYA 2G06A 1ORRA 2I1WA 4O2AA 1E3SA 1WXQA 2OCAA 1F3LA 1TUBA 4ND4A 5CB4B 5IVHA 4ZOAA 3A6KA 2XB6A 4AB1A 2PX2A 2Z3ZA 4IZIA 5C37A 5JZOA 1LVHA 4FHDA 4QXAA 3L7YA 1M2VB 1ST2A 5HE9A 4U7JA 4M37A 1Z6PA 1TB4A 2JNWA 2Y93A 1JR3E 4J1SA 1X14A 1JTFA 3EDOA 4BVAA 4DBLE 3KP1A 1V7QA 3H9UA 4P1ZA 2E5FA 5DLPA 3V1YA 5JASA 4OXRA 5LJIA 1DJOA 4GI1A 1RPAA 3NXKA 3ICOA 4ZT7A 4CLRA 5LU8A 3VPDA 4K86A 2W6IA 2P67A 4UMEA 4G2NA 3TUIC 3TE7A 2R0QC 2AGVA 4IY1A 4W6ZA 5JSKA 1JQEA 1XTSA 1H4TA 2I4LA 3AUUA 3KAPA 4TSRA 3ELUA 3W1WA 5JS8A 4TL6A 5EJFA 5KYUA 3UK0A 1K86A 1CQJB 2Z5FA 2RHJA 5KJFA 4GKAA 3RU7A 1HYBA 5JPCA 1GWNA 2WIDA 2WJPA 1XHLA 4KWIA 3PX2A 4E09A 2AEFA 2ZIGA 2J32A 1II8A 1QMGA 4ALLA 1PYDA 5ICEA 3Q5DA 1EUYA 1L5RA 2AUNA 4MQ6A 4BMDA 4YDQA 2BMJA 4OLFA 4R9RA 1LH0A 4YUYA 3WX0A 3PJEA 3SHOA 4ETWA 2WIAA 5K6RA 3VVMA 3EQ7A 1GL9B 3RYFB 3NRCA 1US8A 3D0RA 4OA5A 5DBFA 5JV5A 1CS4C 1T2VA 3OZGA 4ED9A 2NWQA 4PAMA 1IG0A 5DO9A 3SDZA 2Q0SA 3ZWDA 1ZN8A 2AFHA 5BNFA 1Q20A 1GUYA 4MYUA 1JKIA 1QM5A 2HUPA 4WAUA 1J99A 5FBKA 3CT4A 3MGBA 2QLLA 3IQEA 1ICEA 1YL5A 4J6EA 1M83A 2EX0A 4PHCA 1PS9A 2GASA 3ANLA 2VKTA 3Q72A 2V7BA 1XL1A 1NN3A 4N5IX 1W5AA 4MULA 1T9HA 1ZZGA 3BXPA 4XYEA 4TM8A 2RH8A 3AX6A 4XIIA 5K0EA 5NULA 2YNMD 2D74A 1C1XB 2QLNA 3MILA 4MVJA 3SXUB 1V5WA 1JEOA 3KLBA 4UU8A 1WCIB 2NYVA 3KJIA 4Q39A 2Q27A 3AP3A 5BWBA 1G0NA 4RM2A 2ZBPA 5K3OA 1E6MA 4L5IA 3E9CA 1YUBA 4MUXA 5PGMA 4DMKA 1RE1A 1X13A 3BK2A 1RQLA 2HA5A 4F8JA 5HR5A 2BGMA 3JQBC 3L4BA 1COWA 1X2BA 3G0CA 1N7GA 3OF3A 4Q1BA 1N6IA 3OMXA 5KOHB 1YO6A 1FYVA 3BQ9A 2AB0A 3ICEA 4B6SA 5DK6A 3TFQA 1CERA 2VDKB 2ZVJA 3O0TA 1Z6AA 4EMTA 2V7QD 1NNLA 2W4IA 5F73A 2ICAA 3N0VA 1VBNA 3I92A 4V0LA 1I2AA 2L69A 1B42A 2ZG6A 3GVCA 2P9EA 1U7ZA 2FUNB 3PC8A 2YV2A 3H9CA 5GOTA 3QMMA 2PLAA 3WE7A 2PRSA 1KI2A 1R74A 3BE4A 3BGSA 4H4EA 2EZ4A 4YRFA 4ZVTA 4F2GA 3T5AA 3JSXA 4M98A 2VNKA 2R65A 1KO1A 1RWNA 3C5CA 3EXG2 2X9NA 3RUFA 3UZUA 5MHTA 4X62B 4NEQA 4KIGA 4YPVA 4RDCA 1W19A 3ZV3A 4TLDA 1ODJA 3HSKA 5KJ6A 2OFXA 3NIWA 5CB8A 3R7FA 3ZV7A 4OUDB 4GE0A 2H7YA 4PAOA 4DJEC 3JQPA 2P9JA 2YW9A 3TW8B 3WB1A 1HNZB 3HU5A 1KFBB 3L6RA 2O7RA 4LRWA 5DXFA 1JDJA 5G41A 4WY5A 3OTOB 1Y8ZA 2QR2A 4JI2B 1QVRA 2WAMA 2XGOA 4PRZA 1MABB 3K8OE 2QZ9A 4AF7A 3D4LA 3BORA 1N0VC 3GMIA 3IPCA 3W5DA 3AL0C 3VA7A 5K0TA 2A4KA 5CGZA 2ZSAA 1HMYA 4R8SA 2RC5A 5HS4A 1O6FA 2C2KA 1NZDA 2FPGA 3EIEA 3ABZA 3L46A 1JG1A 2X15A 1ISRA 2X7HA 2VAVA 3TO5A 4ZGBA 3AVPA 2GBFA 3GAMA 2JAOA 4NZNA 1JEEA 2YBDA 1O6GA 3ZE8A 4NRDA 3G5TA 5GZ3A 4MPRA 5K4AA 1JA9A 3FSEA 4XH9B 3O93A 4HB3A 2XUFA 2OSVA 2FSFA 1EK1A 1NLMA 3T3NA 3QUCA 2XE4A 2B78A 2HB6A 2WDZA 4RY0A 5E1OA 4AYTA 3LOPA 3D64A 5L7TA 4LXTA 1T9ZA 2IU3A 1OGIA 1UPUA 2PSFA 2P4QA 2X1LA 4KE9A 4LYAA 3QXGA 2Q46A 2QG4A 5KAPA 4C7OB 3B13B 3KKNA 3LLMA 4A0SA 4RJJA 2OECA 3VI4B 4GQIA 3HR8A 1J70A 2HCTA 3TNFA 4Z3OA 4MWEA 3C5VA 1WY5A 1ZK0A 1JFLA 3V7WA 1X7WB 1E1RD 1D2MA 3ZUPA 1AZSC 4CDGA 5DP1A 1XKTA 1EVZA 2QLBA 1MB9A 2OCXA 1SBYA 4G0MA 4Y2VA 3DFFA 5FKJA 4UASA 3KAJA 1WF3A 1BDMA 4CN9A 4C0LA 1YS4A 3JRNA 4P4GA 3RTBA 3TM4A 3FNHA 4F46A 3RYCA 1G6HA 4GL4A 1Y1RA 3E3OA 3U39A 3KJFA 2XGGA 4PC3A 1OXSC 3U2QA 5A5VA 1QBGA 3CLHA 2OQIA 2LTAA 2OFOA 1MA0A 3K4PA 4LY6A 4U7PB 1YFLA 4WK6A 2UZIR 3OTQA 2ZBGA 1QAQA 1ZU5A 4B83A 4EZBA 3EX7C 2QDKA 5TJ9A 4YQZA 2Q6TA 1Y6QA 3IVCA 3WTCA 5L51A 2G3YA 4M1EA 2DKNA 3TOCA 4WJZA 2XW6A 5KWVA 3HYSA 4Q3OA 4R1LA 5FWDA 2KI5A 5J63A 1RHUA 2DSNA 4EI8A 5KUTA 2WSYB 1QKJA 1P77A 2QY9A 2G1PA 1U7TA 2X7JA 4L4XA 5AJHA 3L7OA 1WPGA 4LHEA 5L4LA 4FFVA 3KLNA 3FW1A 2Y8EA 3IT0A 4RETA 1K7XB 3NR2A 3WGQA 1JAZA 5CJ2A 4ZT4A 3LYAA 4IKEA 3IALA 5AVRA 4AS2A 3IOMA 9LDTA 2IX3A 3II6X 4PINA 4UNNA 2XA9A 3KHKA 4GPBA 1TVKA 3ICVA 1R5OA 4KK4A 4RXMA 4A6PA 3AEQB 4Z9AA 3HYTA 4BUJA 1DPGA 3A6DA 2W6ZA 3W6OA 4BVKA 2VXOA 4FQ5A 5TQ0B 3C4QA 3OWHA 1F1BA 1A4UA 3VR2D 1RW4A 3TZCA 3UV7A 4ZYXA 4QZVA 4H08A 1JG2A 1R3UA 1Q17A 3GFTA 5I9BA 5TT0A 4BQIA 4DNFA 5TS2A 1EP1B 1MENA 1YFJA 2VAMA 1RKXA 4PGGA 4PYRA 1RMYA 4KDRA 4NMHA 2G76A 2TSYB 2Y1OA 4W1RA 2P8SA 2AMYA 4D3YA 1G5HA 1YK0A 2ZJBA 1L4YA 1ZRMA 2W6ID 5LZ2A 1SO8A 2Q3MA 4I9NA 1HE5A 3AB7A 3V4VB 3DOEA 5JSZA 5L95A 1DBPA 3THOA 3GGOA 1JG6A 1SHKA 2PQ0A 2NG1A 4YROA 3SP1A 2YHIA 1PLKA 3GLTA 3SZRA 4PN7A 3QBTA 3NHPA 1REQB 1H2EA 2CFOA 2VH2A 1AUPA 1V2HE 3REOA 1M33A 5E2AA 4KQKA 1VLLA 4ETIA 2WP8J 4BQQA 1FSPA 3CBQA 1JLKA 3GOQA 4OU5A 2C57A 4BLTA 5CHEA 2KMLA 2RHHA 1ZC4A 2J4DA 2PQMA 2IEGA 2TMKA 3QEKA 1O97D 5AHXA 2UUCB 5BWMA 5I3CA 4O0LA 5DLQC 1L5NA 2F67A 4OMFG 3CV3A 3PLRA 2YMLA 4BNGA 2ZS8A 1RQ2A 4WMLA 1QJCA 1FFHA 3ZW8A 5ECDA 2I29A 3BGVA 5JXWA 4HQFA 4INZA 1CDEA 2YWGA 5EA2A 2GT1A 2VJYA 4YRSA 2Q2VA 3H1GA 1E2DA 1QFYA 4TMVA 2LZ0A 1W4RA 3WBKA 4OMCA 4B4VA 3KEGA 1HY3A 3MTAA 4EOGA 2JC3A 3CUVA 3BYZA 3RSZA 1YCDA 1M3SA 3TAHA 4F4FA 1IPEA 3IA2A 4REOA 1QQAA 1ZN2A 3MLBA 3C41J 4UU7A 2WR8A 2AH5A 4AY4A 4HD8A 3R20A 3EAFA 3LX5A 3I04M 4KV9A 1P18A 1EDEA 3OPQA 3NWBA 4MVJD 3RTCA 5EMMA 4FW8A 1RKQA 5LCXA 1VKHA 3MWKA 3AFHA 2ACKA 1L4LA 2B4RO 2G4VA 2Q45A 5F5XA 3RIXA 2YOGA 2X0RA 2Z95A 4Q9IA 3F90A 4XWOA 2LGJA 4R81A 1CF2O 3KQNA 5JAMA 2HFJA 2APJA 1PVDA 1Q1AA 1R0CA 3EPLA 1K9VF 2ISSD 3ETDA 3L8MA 4KVGA 4Y67A 4CG1A 5JCOA 2YFYA 4II2A 1F20A 1QHIA 5CBKA 1ZICA 3QOYA 1CB0A 2X4LA 2H08A 4TUYB 1XVIA 3VOBA 4OYYA 4WY2A 2BJWA 4WI1A 1J5EB 2HQRA 1GN9A 1RACA 3KL4A 1XWFA 1KY4A 1LW7A 3PNQA 1LPSA 4H1UA 4TYPA 5C7LO 1WPXA 3IBGA 3PG5A 2GWHA 4UQPA 5EEGA 5BW6B 4FP9A 1QO7A 4B1FA 4BQPA 1BW9B 3EA0A 3NEAA 2OM6A 3HCPA 4HPWA 4NU5A 4GLFA 5ERXA 3R7WA 4EATA 1JTVA 3L5KA 3BJIC 1VB3A 3SYNA 5F35A 4NE2A 3VTKA 1ODLA 1IY8A 3MERA 1VP3A 1K4YA 3V1NA 4M53A 3BEOA 2YRWA 4D26A 5CUQA 4NOJA 1Z3CA 3OM1A 4I4NA 1ZNXA 4OV6B 4KSBA 1YJ5A 3TR0A 3WNZA 3ILXA 4DLXA 1UFQA 3V8QA 4OHWA 1Z2CA 2I80A 3GN2A 3PWZA 4KB5A 4B4UA 4DABA 2IY7A 4BKUA 4N5DA 3B82A 4LUCA 2G5CA 3COYA 1Q0UA 1TLFA 2GRUA 2ON6A 3EH2A 3OFKA 4P4LA 4LGVA 4UHKA 4B17A 1Q12A 4F4UA 1XZQA 2A0WA 3S81A 4PSKA 1C3VA 3JYPA 2C2XA 4E12A 4BV2A 3TDMA 5JS7A 1YJ8A 4P3KA 1DTEA 3ESXA 1RP7A 3VNVA 1U28A 2R87A 3DVQX 1S4MA 2IEYA 3LDHA 3L41A 4Q24A 4A0QA 4E2FA 2GN6A 3BCSA 1PSDA 2IU6A 4BASA 4OXKA 3NO4A 4FGWA 1AMNA 3I9MA 3E9DA 1J8DA 4NV3A 3TSZA 3P5SA 5D86A 1IPHA 2Q3HA 2Z6VA 2LIVA 3QG5A 1MJFA 1AIPA 1THZA 3H8WA 3IOCA 1P9RA 4OOEA 1P33A 2I3AA 5TE9A 4E5SA 3HXMA 4L6AA 3TL3A 3ZXYA 4KI0A 2W6PA 3A4LA 1MOQA 1VBKA 1WXWA 3Q98A 3S8MA 4C0BA 5C8ZA 1V8FA 4BNXA 4K28A 1O94A 2J3KA 3ANXA 3I09A 2QR3A 2HPVA 4JY7A 4NPAA 1HRDA 4G9GA 2D13A 5HFJA 3G8AA 2VHXA 1BKDR 3H2BA 1WMAA 2P9CA 2VEDA 3C3EA 3DH0A 1RXSA 4N1AA 2WB2A 1YMUA 2OILA 3URMA 1B76A 3MXTA 4C4PA 2HL6A 3FWYA 3WKAA 4Q1CA 1BEUB 1FXWA 2Q9CA 4L02A 1ZAYA 4KN6A 4PCLA 1L4MA 1MT0A 1Y8RB 1N0IA 1DRVA 2ERCA 3K0FB 5EIFA 3ZD8A 4B46A 1Q15A 4IFEA 5FNZA 4RZHA 1CR2A 4HB4A 3CLVA 1N5LA 1AJEA 1KIAA 1NJ2A 1AXRA 1ZI8A 2IHZA 3D5TA 1BHO1 4J1NA 4MVYA 2AC4A 3SGLA 3LDUA 2ZDHA 3OFNA 4JS0A 1SG6A 1Z4IA 4RD6A 5T41A 3S29A 3UK7A 4E51A 4YX9A 4BQFA 1L3BA 1YZNA 2CDCA 2FN4A 2VH5R 4OPMA 3MMZA 3HUUA 3L8CA 3FOFC 4I1UA 4WACA 2NU8A 3JARA 2XRYA 4HX9A 2ZYVX 1SCUA 4KQCA 1N9GA 1TCCA 3SE0A 3ZXIA 1H6DA 1FLVA 1U3FA 1U3CA 2JCYA 2OO3A 1GU1A 3L7LA 4HFJA 4MLPA 4O2BA 1PEYA 4OFBA 3R0XA 4OX9B 2VA9A 3E8MA 4JQZA 2WZDA 3CGGA 4TZKA 4BFZA 4CZ2A 5CEJA 3FYCA 1SHJA 3K70D 1T3SA 2AXPA 4RPCA 4EVIA 4JX8A 3GZNB 5A0VA 1P74A 2FR1A 1UQTA 4B3FX 1V43A 3KKEA 4IV0A 3L8EA 5CA0B 2H3HA 3HEAA 1CEYA 2GKSA 4IPTA 5J5AA 2WV9A 3WMFA 4BZQA 4WXYB 1A69A 1V35A 4HPJB 3KQUA 1AK1A 3HBNA 4A6EA 2BGTA 1Q0SA 1SVUA 1M0SA 1P2BA 1ZNQO 2I5PO 4BVBA 1H1DA 3PA8A 5K9ZA 4UBIA 1XQWA 3K8YA 3GEHA 4HPXB 1VM6A 5JAQA 3SHFA 4F6RA 1LTQA 4KXNA 2I1VB 3IAUA 1T1SA 2OVFA 1N8TA 3QFHA 4FYMA 5CM2Z 3E5RA 3L8GA 4OLHA 2C4WA 1V1RB 4XFDA 2ZR9A 3E81A 5FCDA 5FLYA 1LPBB 3R76A 6REQA 2DCUA 5B64A 3LY5A 3IL2A 2PUFA 3IOYA 4EJFA 5DLEA 4CCYA 1WU7A 1U80A 3DWGA 4D57A 1CY7A 2ZRAA 3WYGA 1GPBA 3QE3A 4H0CA 1W581 4BJ6A 2VPXA 3IPLA 4NH4A 4KJZA 3DXZA 3SS8A 2CDAA 2RHTA 2R79A 4S1WA 1IXYA 3E23A 3TX6A 1TO6A 3K0HA 2CSUA 5KX5F 2I7XA 2GHQA 2JI6A 4XPIB 5L3RA 5IN5A 4P4SA 3W9UA 4CL2A 4K05A 1ZR4A 4IUCS 1OYWA 4JOSA 1E6EA 2EGUA 1CUEA 1N6RA 3CURA 3EZNA 4IVRA 1AB6A 1VJGA 3Q6IA 1BCSB 2HA3A 1XZGA 1YT5A 1PJ2A 3CHYA 1RAIA 2ESRA 3ACDA 3DBOB 3RU2A 3H1TA 1TUEA 3QENA 1TTHA 2ZXEA 1PL8A 2Z4TA 3DDHA 2C9MA 2ZWMA 3AUYA 4XVUA 5AVYA 1O0BA 1HX7A 2AD5A 3LCCA 3EGIA 3R3XA 2O6LA 4U6SA 2WQ6A 4LVOA 1M66A 4RTMA 2VSXA 1IG3A 4PSVA 1I4TD 4PQGA 1QC5B 2FDRA 4IDOA 2HHLA 5TVGA 2A5YB 4WEQA 1GFSA 2DUUA 3HI4A 2FWBA 4RADA 2H5EA 3LT1A 7MHTA 2JZOA 3ZLJA 3PEEA 4HADA 2C5LA 1OR8A 4AJNA 5D84A 5EMHA 5FWYB 4X8OA 4DR3B 1JRLA 4H31A 1R6UA 4YMIA 5CFQA 1XG5A 1E9EA 1ZRNA 3GRPA 3R0JA 4JJZA 5DHRA 5HKOA 3L84A 1KJ8A 3V4RA 4HDNB 1T1RA 3F9IA 1GGVA 4JYMA 2XKKA 1Z6YA 3W2EA 2F1JA 4GPAA 4KIUA 2IHVA 1Z83A 2Z04A 4IRXA 4BLPA 3EOBI 1KEZA 1CUUA 5EJ7A 1AK9A 3OZDA 3AJAA 1SB8A 2WOOA 3HA7A 4JP8A 4Q15A 1M8GA 1HDRA 1SVLA 2PMWB 1VPEA 1NLFA 2ID9A 4MQBA 3IR6A 1BAPA 4S12A 2V7GA 1FTNA 3AH8A 4DLLA 1YR2A 2J9RA 3OLZA 5DW0A 4BP9A 2W4MA 4FPXA 4EA6A 1GA1A 1F5SA 2WTUA 5KSZA 2QP3A 1RAHA 2V6FA 1GGJA 3IUJA 3VZDA 3ZY5A 1DFHA 3KB8A 1JLSA 3AUTA 3E8XA 4Q48A 5BT8A 3T54A 9LDBA 2P62A 3Q3JB 3KC2A 3HN2A 3IP7A 3TB4A 3H4TA 4M0EA 4RJ2A 5TQVA 4G0VA 1DEXA 1FVFA 4XSVA 3UPUA 1XA3A 1F9EA 2BFBB 3IEUA 3OWOA 3D1LA 1YAHA 1T13A 2KLBA 2JFXA 4EG1A 5CB4F 5ITSA 1IZYA 5JD3A 4H9GA 5IKOA 3R6TA 2ONJA 2J3DA 4DCPA 2YV3A 3AF6A 2OD9A 4KIWA 1E61A 1V8PA 3U44B 4KPFC 1UZUA 2R8ZA 1K75A 1Z0DA 1G9XA 1Z8FA 2P1RA 1N5MA 3IJEB 4GOND 2WT9A 2O8DB 5E7QA 2OO5A 2OP0A 1SY7A 2DR2A 1KKMA 1YB4A 2CFSA 4ZC1A 4B7CA 1A77A 3DHEA 2Q8PA 3IP1A 5ED0A 4BFLA 1WPRA 2IYRA 2E6KA 1FYDA 1LBTA 1DTWB 2RK4A 1Q83A 3DKVA 4QGFA 2VHWA 4YRMA 1C29B 1P9LA 4KGDA 3TSAA 1KDTA 1BE6A 4G1VA 3GXBA 4RHEA 4LJYA 5EXEA 5HG0A 2OBMA 2CXSA 4GEKA 5KTTA 1HLPA 3ETNA 5DU2A 2CZCA 3UKDA 2PUHA 3KAQA 2IW3A 5ALQA 4B3BA 3A4NA 3HZZA 5IFKA 5IANA 4MDHA 4ZXFA 4LQLA 3W3AA 4C0QC 3IAS1 3GBPA 3GCZA 3AOGA 4GT1A 3CPSA 1FP4B 4IRMA 4XUGB 5E9AA 3LT4A 1DBQA 3W9SA 4TYYA 4DLPA 3RSHA 1OX6A 1QYVA 3OICA 5A06A 2RK3A 3BFXA 3FFAA 1Z4KA 1WETA 1B8PA 1PGNA 4ODIA 4RS4A 1I5OA 2QT0A 1ZO8A 2ZSUA 4FFBA 4A8JC 1WQ1R 1D9XA 2F43B 2H4FA 1DKOA 3NALA 2O50A 2YZMA 4EDHA 4EUNA 4YJGA 3O84A 3TPCA 5ALSA 3DAFA 1WMBA 1W6UA 4M9UA 5C8YB 2JJ8A 4KNWA 2UXDB 1LBEA 2ZUDA 3I45A 3N8IA 1W29A 5EIWA 3AONB 1NA5A 3RSCA 3SC4A 1VIYA 5CDHA 3OX1A 3A6HA 3H5VA 3BD8A 4IHQA 2JLCA 3I9V1 4E30A 4EF4A 4EHHA 4UHCA 4JYCA 1O94D 5CXSA 2C0PA 2X8JA 1YQQA 3LLCA 4MRAA 3EY9A 4M87A 1ZVVA 1XZPA 3HDQA 2PFSA 3JYOA 4TKUA 3I5YA 4OEHA 1P1KA 2R60A 1FJXA 2ZROA 2PRYA 3HVJA 1USKA 4LRUA 2GRAA 1JHUA 5A5GA 3QLUA 2RGYA 3BMOA 1FMTA 1LJ8A 2Q4DA 2VDNB 3CLSD 3W4IA 1T5SA 2EU8A 3C3BA 1P45A 2Y92A 4WOBA 3PWTA 1MC1A 2XB2A 1FFBA 2ID4A 2HWXA 3DMPA 2EJBA 4HDSA 1S1MA 1KY5A 2BM0A 3EMDA 4BLUA 5E7MA 1YQXA 1KP2A 1IOLA 5FOWA 1A50B 4S1VA 2WU8A 3IEIA 5K3AA 4HDRB 4TTAA 3K96A 5CB0A 4ID3A 5C1PA 1ZBQA 3QEMB 1GNTA 3N58A 3E22A 3LVFO 1LDYA 3GUUA 4PICA 1U0JA 3N2NA 1GN8A 3G6WA 1A71A 4DIUA 4IDPA 4EJSA 4FKMA 4KQ9A 2E5WA 5AUNB 4X6YA 1GFZA 4Q4LA 4WH0A 5HF8A 4RA9A 1HYEA 2GR9A 2OV6A 4I36A 4REQB 5D5HA 3RAJA 3SC2B 5MFZA 3NUZA 1BCRA 1C7RA 3AU9A 1A9RA 4LC1A 3TLBA 2YJ4A 4K9QA 2HRBA 4RQBA 1TO2E 4Y0AA 3SFZA 3D81A 1ZN7A 1HMPA 3BSWA 3Q2IA 2GYUA 3HR7A 4OATA 4ZYVA 5I7VA 3VR3D 1UK9A 1JIIA 1KO5A 2WB4A 4MHTA 4RXTA 4GMHA 2CXXA 2ZRGA 4HMOA 3ONNA 3UHAA 3KQVA 1NVMB 1PZEA 1AGXA 4GUAA 3TKYA 1DRWA 2JF0A 4HH3C 3L82B 1HKHA 4ENTA 2EYQA 4Q5IA 3TZEA 4CMBA 1KRWA 2DHRA 1DBWA 3SFTA 3UW1A 5DMXA 2OV2A 1PJ8A 2OGSA 1JEQA 4IGEA 2VTKA 4IIUA 1N5DA 4D0GA 3C7AA 1XO1A 2PY6A 2FRVA 3U4QA 4ZU1X 4PLTA 3DBRA 4M0LA 2AFIA 2EFCB 3GLGE 1NXSA 1I3MA 1PN3A 1WIWA 5JH7B 3WR5A 1F8FA 4TXHA 5LNK1 1OAKA 2ZJ8A 2ZT8A 4RHFA 4WNAA 4D02A 1BIFA 1EX7A 4LI3X 2C7QA 2O1EA 4O4LA 2BRUC 5IH7A 2EOAA 2WMDA 1SKMA 4YV7A 3F67A 3QU5A 4ZYTA 3H2SA 4Y6QA 3LLUA 4WASA 4JGBA 2V54A 4MV5A 2QUKA 4H2DA 3VZPA 5JRDS 4BKOA 1HYGA 2CMKA 5AM4A 3ZZ1A 1PBNA 4TS3A 4K1LA 1PWXA 5JBNA 3JAWA 2Q5EA 2QZSA 1JQAA 4B48A 3V8BA 1L8LA 2H57A 4D8WA 4Z4FA 2J3JA 1EGVB 4NAUA 4Q7QA 4MWBA 2JFNA 1T1EA 3PE3A 1OX5A 4I4CA 4JXXA 4YRNA 4RA6A 2M98A 2CV0A 2Q3FA 4MX8A 4F71A 1JU9A 3MMXA 5JY6A 4JWKA 5WRFA 4YA6A 4KLAA 5AHWA 4IX9A 2DPXA 2FWAA 2C1EA 3FPEA 1X9GA 2R9VA 3NGXA 4M1YA 2NX2A 1C9EA 5CDYA 4KE6A 4Q3NA 2IYWA 2IZOA 1GR1A 3CC8A 3PPIA 4C88A 2HWYA 3H84A 2VDLB 3NDRA 1I4LD 4KDCA 4Q1EA 2BTOA 2L82A 3CZ5A 5J58A 4IIGA 1VJ0A 1QHEA 4NCAA 3NM5A 3OX2A 3EDYA 2QM7A 1D7AA 2WLSA 1IWPB 1RHJA 2BPOA 2WUFA 4DDKA 2I3BA 3IEPA 4ZRMA 4E5MA 3DZGA 4G9BA 3VC7A 4YRBA 3I9KA 4F45A 3ZK7A 1USWA 4CI0B 1RM0A 4BB0A 4LX0A 3C3JA 4LF5B 1J9EA 4KN8A 4M36A 1N6KA 5M2QA 2HV8A 4BATA 2WWHA 4L85A 3R75A 2DTEA 1Y98A 4PR0A 3T0IA 2OBXA 4E2YA 1XRMA 2C2ZA 2P4SA 2VPQA 3ABQB 4PFQA 3SQLA 4AL4A 5LWQA 2Y77A 4G26A 1VSVA 3ZXSA 2ORIA 3CO5A 4RIIA 5H4GA 2HYIC 3QW4B 4OSOA 4RPLA 3SQDA 2ORYA 2CJWA 2HQ1A 3RBAA 2ZYGA 3MCTA 4I5GA 4RZ2A 4UU1A 3EGVA 4DOMA 2NLOA 4JL6A 5E7JA 2BFDA 1Y5MA 2FPPB 1U8CB 3FPAA 1IN8A 1TOAA 1B26A 3EPRA 2QRPA 3R44A 1CY1A 3AW8A 3AB8A 5ENVA 3RSGA 2AYYA 1DMRA 3T7RA 1R16A 1T25A 3VI3B 3L6OO 3ZJUA 3MTEA 1Q7BA 2OB1A 2OZLB 3AR5A 4KMRA 3OQIB 4K9PA 4ZO4A 4BVLA 1CZHA 3ENZA 3N0WA 1IUNA 1VLJA 3PDJA 1E7WA 2W2MA 3D2AA 5DOZA 4FYKA 4N47A 4D3FA 1K6MA 2VT7A 1BQ4A 4OQNA 4D1YA 2ZYWX 1L1EA 3IB6A 2Q2OA 5HQJA 2GF2A 1LQUA 1NOJA 1VG0B 2FA9A 3EF1A 1R6TA 3CQ9A 1F2TB 1FC0A 3L2OB 4MRNA 3SWWA 3E6AA 4S2UA 3CR3C 1LW6E 1E63A 2IKQA 3G2IA 1FEZA 1OT5A 5ALWA 3NBUA 3ZZUA 1VYUA 1YS2X 5KU7A 4XI9A 4LCJA 4OAPA 1W9HA 4JMPA 1EAYA 3PGJA 5I9MA 1HQCA 1EX9A 1SOVA 2VHZA 4OI2A 5CIWA 3DWEX 4V02A 1NR1A 3QH4A 3TH5A 4IJ6A 5H83A 2ZS7A 3RIHA 4RABA 4LVNA 3VTZA 4YT4A 3IEVA 3NTVA 4NOMA 3GQBA 2YYZA 7REQA 3JWJA 1EH5A 3VR5H 2OCDA 4F84A 4Y2GA 2WICA 1LQ2A 3CF6R 4FE4A 2RHOA 2IYVA 2CJYA 3IT2A 1UDCA 5F3RA 4CJXA 4G41A 1FTYA 2P5UA 3LKDA 1VGQA 5AKIA 3F3SA 2B4QA 2IFTA 2JGNA 1FE8A 3Q3GE 3FDZB 3UUGA 1NF9A 3LRPA 4G5OA 4EPVA 2PL3A 3TX2A 2I7VA 5FPPA 1R9NA 1IHDA 2B36A 5HBGA 4RSHA 2ZP1A 4DHWA 1B8OA 3ON5A 4OGFA 1N2EA 4LPSA 3S1AB 4AMVA 3AESB 4EG8A 1FCJA 4OI1A 1AQYA 2JZNA 4KO2S 4EUEA 4H3SA 3WLRA 1R3DA 3CB4A 5GGXA 5JT1A 2FR0A 4KQ2A 5LOVA 1CNFA 3TXAA 3RJMA 2QMUA 1CUGA 3PGLA 5IAEA 4HGOA 1KVUA 4P4NA 2VH1A 4BNJA 5A7FA 4N3BA 5EIXA 3UV6A 1DJMA 5EZYB 1J9ZA 2RGUA 4TTVA 2O2GA 1HEIA 1CHDA 3OJOA 2NP7A 1HG1A 1IIBA 1OWNA 3O4VA 2V6MA 2IF0A 3FCSB 3R4VA 4Q3CA 4FYJA 4UD2A 3MIIA 4EHKA 3RREA 5GINE 4C08A 1RBYA 1QE5A 3AU8A 4I81A 4OOFA 3M6UA 2PMFA 4YH1A 1I0IA 3UNXA 2R6DA 2O0HA 2OFPA 3GUZA 2J4FA 2I91A 2W6QA 1U2GA 2PUCA 1QGZA 4XRRA 5E9JA 3MAAC 4IH1A 1TUGA 5FPQA 5BT9A 3VJRA 4TUYF 5IU6A 3LPMA 1N2HA 4B8ZA 3QOXA 1E4EA 1ZM4A 2EIXA 1JFFB 3BWMA 3P26A 4NHEA 3RJ5A 3RHZA 1L1RA 3NW9A 4FI3C 2PKQP 4LZLA 1KDZA 1JEYA 1ZMTA 2MYUA 3R5FA 1SKUA 4XCXA 4RVDA 4DSTA 4M8NE 4PZLA 1T0HB 2AC7A 1PQ4A 3CNHA 1X7ZA 5C1OA 1SHTX 4Q4HA 2JPDA 1BS9A 3H5RA 2IWHA 3T1YB 4ER3A 4INPA 1XPOA 5AJVB 5KQSA 3HQ4O 3MJFA 3RSFA 1V16B 5IAOA 5JEEA 3D6MA 5H8WA 1R0ZA 1WOYA 3CW9A 2W6JA 1OXXK 1NVFA 2TYSB 2BGLA 3GRZA 1IDN1 1MC8A 4LJLA 4QFCA 4CEHA 1PRYA 3V34A 4AECA 4IUDS 3PDWA 1JDVA 5I5GA 4OY3A 1O57A 2D1QA 4MWZA 3NTLA 2Q3EA 4FHCA 3AG5A 3VYTB 3PE4A 1SKQA 4AKTA 1LV7A 4XJXA 3VU8A 1Z0JA 3EDMA 4KXVA 4O33A 5FYDA 3G2MA 3GW8A 5DX1A 1FP7A 4CM4A 1Q3TA 4NG4A 1SM4A 5AUQA 1D1QA 3WL5A 3UH1A 5CVUA 5JNUA 4EB3A 1EXMA 3MWLA 4TZTA 3DTVD 1Y5NA 3BEDA 1P61B 3IDQA 3PUHA 3V3TA 1YB5A 1P2DA 1T9BA 1WL8A 3RIYA 1NBAA 3D6UA 4I1SA 4U0KA 4HQKA 2POCA 3VR4A 3WL3A 3WNQA 2Q3CA 5L6LB 4GL2A 2IU0A 4ARAA 1QAMA 4PG4A 3DO8A 3AVOA 3TJRA 5M04A 3UAYA 1PFVA 3KIPA 3ESDA 3J7TA 1J09A 2E1RA 1K7CA 1PJTA 2NTVA 2ZYIA 3G0BA 3OQ6A 4FCTA 3RRFA 3TDKA 2UYGA 4BWGA 3IEXA 1ID8A 1ZHHA 1CG6A 1KZYC 3K5HA 1N3YA 4ZA2A 3F1KA 2QVBA 2AJDA 3PJFA 2VK2A 3FNIA 5EIHA 2M6LA 1U2SA 4AX8A 3IT3A 3U4CA 2BGUA 4HFNA 1T9CA 3T3MB 4BN0A 5G1PA 1GPJA 1XTQA 1YB6A 4HAYA 3B6IA 4M6WA 3ES9A 3PUZA 1NI3A 1TVEA 1SXJE 2I87A 3ZWWA 4YMSA 3G7NA 3RVOA 1XZ8A 4QUIA 3ZDFA 2Z3VA 3Q3VA 4IQ4A 1KR5A 3L07A 1FSFA 3OZAA 5IBPA 3RPEA 4EO7A 5IVKA 2O1SA 4KR2A 1PG5A 4X45A 1TCVA 2OWDA 1Q1GA 2R84A 3ZKAA 4YALA 1EBUA 3PL1A 3R0ZA 3B38A 5KTMA 2Y71A 1LS6A 5AKZA 4UEKA 2GPYA 3PR2B 4NAVA 3T0FA 2F2TA 3PRKE 4GPEA 2DECA 4J4HA 2FN9A 4PW0A 3FHTA 1U6JA 3I2HA 2WYOA 3OX3A 2O8EA 4P81A 1G2PA 2CUZA 3QPUA 2JKZA 2NYRA 4S35A 4Z1MD 5JJLA 3H6KA 2PX4A 5CA0F 2X1MA 3RRXA 4CG2A 1RYMA 1NMXA 3NTRA 1AF4A 1JAHA 4ZDJA 5CDFE 3O83A 3NHAA 2FI1A 2XMBA 1QONA 2CN1A 3AUAA 2AG0A 4U2DA 3P9SA 3I9OA 1OFUX 3KHSA 2QNBA 1SC1A 13PKA 5HCIA 1D0IA 1YOVB 2D1RA 1Q0RA 2DUMA 2IUYA 1NUSA 5F2OA 3RVJA 2XKJE 1GLVA 2PPLA 2QRHA 3V8RA 4CM8B 1SXQA 4GM1A 1YRWA 2W8BA 3V80A 2WK1A 4TM7A 4J0EA 3EHEA 4P53A 1SEPA 2TMGA 4GVPA 3OEHA 5K3FA 1G21B 3RK0A 2VTBB 1OLXA 3O3OB 4XGQA 1UDWA 1BU5A 4GZMA 4LOKA 1GLGA 2WSSA 2ZYAA 3KX2A 3MCVA 1D5WA 3VISA 1Y7IA 4ZGGA 4BBPA 2ZIUB 5FV7A 1A1VA 4LGMA 2DB3A 5CBPA 1YZKA 1JZSA 2IZZA 3A4MA 1ORVA 2Q3LA 4KDFA 2FU5C 4UOEA 2CD9A 2OHOA 4UHDA 3UOAB 5TMPA 5EWMA 1PQYA 3Q7SA 3ICPA 4UVDA 2PE5A 6Q21A 3RYIB 4L50A 2RI1A 2HBRA 4MEAA 1HR0B 1UODA 2XIQA 4AMYA 1E79D 5E4JA 3A4YA 4MS1A 1I2DA 3H1AA 2CGEA 5BVHA 4MA5A 2NN3C 1KJZA 2WIKA 1G8SA 4TLMB 5CH5A 3J81k 3Q3HA 2BM9A 2FEWB 3QGMA 3Q40A 2I0FA 5IPFA 4R1OA 3SZ3A 3OHSX 3ZN2A 4UHEA 2EYUA 5JR3A 2GAJA 4TYMA 2FSPA 3QYPA 3THXA 1RVV1 3G68A 1PIWA 4YFYA 4EG6A 4NF2A 3QX7A 4DUYB 2ZYSA 1JA0A 3PPWA 4II3A 5C31A 2G5GX 3O75A 3REQB 3HYNA 4DG9A 3AVQA 1QGOA 1L4GA 1J9GA 4OJKA 2HCRA 4QYMA 3ZIAA 4FKZA 1JE1A 2IITA 2V5UA 2AZDA 1XI2A 3MT7A 1L7PA 3OOHA 4KI7A 4NFSA 1Q2UA 4UVHA 4WXRA 1K6JA 3QXJA 2NNLD 2ZSHA 5J4KA 4JI6B 3R9XA 3VH2A 3H4VA 3A05A 3G6KA 4CIWA 2W90A 4XZ3A 3T3DA 5M7EA 1FFXB 1G8YA 1QIIA 3EGXB 3KCNA 2AK3A 4P38A 5DNDA 5ENZA 2CNNA 4MQ5A 5BUCA 3BWBA 3PENA 5G0TA 5IKPA 3UBTA 2O2JA 3KVRA 2XUHA 4XFJA 1S02A 1T2CA 4C4YA 1HT1E 1S3GA 1S2MA 2VJAA 5FA5A 4DAOA 2Q29A 1KI8A 1YA4A 3GJRA 1X7HA 2GPBA 3ORQA 1LSSA 3B7PA 1XCGB 1IK4A 1C30A 2XD9A 2YQZA 2G36A 3TPFA 1I6MA 1PEDA 4O1MA 4RC9A 4X71A 4ZALA 3WRWA 5ISMA 4M7PA 4UUAA 4EHLA 4UDOA 1PNVA 1CUCA 3M49A 3PVCA 4WLOA 4R5HA 4JC8A 5BSKA 3I9FA 4FYIA 4HDMA 4R1PA 5F5LA 1AQJA 4H16A 4R8VA 1PDWA 2DYKA 3MWEB 4TPKA 3VU1A 5I47A 4BCBA 1RABA 1S3SA 1V9SA 1ZIXA 2A9VA 4G1CA 2R96A 2OCYC 1XNGA 1AKQA 3AV0B 4PGHA 2Y0EA 3BM5A 1N2BA 2EZ9A 4TLCA 5ALMA 5EJ2A 3W9YA 1Q0TA 4ZAZA 2P9TA 4IMJB 5CPFA 1GA6A 1YHZA 2EW8A 4NBVA 3ELYA 5ILOA 2XB9A 4MGZR 2PS9A 1TZCA 1W34A 1X38A 3IUEA 4MS3A 5DTRA 2I8LA 2HA4A 2BE7A 4UCQA 4CMEA 1M8JA 3GRYA 5IBQA 1O4VA 4ZC8A 1LSOA 1CNMA 3KKQA 4DSUA 1I6KA 1KY3A 1C4WA 4IRUB 2C7BA 4QRHA 4KVZA 3RVKA 4AMZA 5FPKA 2YZGA 3B7GA 3KYDB 3V42A 3DB2A 3PTLA 4Z49A 3WJ7A 4NCIA 4QDTA 1EHIA 4I08A 1O2DA 2V4ZA 3P9YA 3U37A 1P4RA 4XPZA 1D2EA 3M1IA 4IS2A 3TRKA 3KXDA 1N2ZA 1Y0BA 1JLHA 3AJ9A 1M34E 2G07A 3FZQA 2GCIA 4M9ZA 2FE1A 4MIEA 3GGSA 1X1TA 4CEJA 3WHLA 2JKVA 4X7BA 3DC7A 1F3OA 2FSIA 4BJHB 3HABA 4BNDB 4ZQGA 1PVOA 5KYKA 5AK6A 4NBLA 2WFMA 1KU0A 2OY0A 1GL6A 4XFKA 1VRWA 3AG6A 5A03A 1QH0A 3QKSB 4P9NA 4KKVA 4MR9B 5C8YF 3SLGA 2GO1A 3WIBA 4WSOA 1VKNA 5HOQA 2VK1A 2C58A 3P1JA 3RKRA 4D9BA 4WCFB 1J24A 3U31A 3G9XA 4EW6A 1T4CB 3WLHA 1DRKA 4K6GA 2I34A 4XRGA 5LSAA 2GZ2A 1M8KA 4DLKA 3BPSA 1VJ1A 1AQ6A 1H2FA 3H8JA 2MINA 4GYJA 1EFHA 1BFKA 4JQSA 3ZNNA 5AVJA 4BVEA 3TCXB 2WYWA 4IKPA 2VYVD 3I8OA 2I6QA 3QELB 3VR4D 4D6YA 2C95A 5G1NA 3Q3EA 5C5EA 2FDCA 4C2TA 4HH0A 4KN5A 1UR5A 5H02A 1J2JA 1P7CA 2OGUA 5JXGA 2FLWA 3G7UA 4KFUA 1JT9A 1O6BA 3BFKA 4JLJA 5ALUA 1C1DA 2HV9A 3PCTA 2CLCX 4GMGA 1V1JA 2OR3A 1R00A 1O96B 1NVDA 1W94A 1ZOIA 1JDBC 2A30A 2EGGA 2PUJA 4O4JA 1SKYE 1U0RA 2PL5A 4A5SA 2I4IA 3A28A 2ODBA 2ZOSA 3K1AB 5EIOA 1C1HA 3RUHA 3AF3A 3RS7A 1IAQA 2ABWA 4M7OA 4XIJA 3TW4A 4NCBA 3AFMA 3BE5A 1FTGA 1R4MB 1Y82A 2D8MA 1CUWA 3EPPA 1XLTA 1Z4NA 1X74A 1B6GA 3HB7A 2OT3B 2P5SA 2CDNA 1CFJA 4D9GA 1WXFA 4AKGA 3U26A 1J2EA 2D4AA 1VCMA 4C7XA 5BYAA 1QS0B 3A25A 2DQYA 1I80A 4MJLA 4BNZA 1I2MA 3M6IA 4G37A 2WFZA 3PNLA 4UNPA 1JXMA 4IHKA 4O5OA 3T7SA 2H2WA 1ENZA 2Q3BA 4UOQA 3WGHA 5CEFA 3SVTA 1NG1A 1P0IA 4HTAA 1VDZA 3FOEC 3HDVA 1DXQA 3GJ3A 2J6CA 2X42A 4QJBA 4B2IA 2H0AA 4W7IA 3REGA 4W9RA 5F7OA 5JZVA 1I1OA 1NY5A 3ZKWA 3P9RA 4UTZA 4KTVE 2ZUEA 2VHVA 4M49A 4N41A 3OHMA 4QUKA 3VNSA 2HJ9A 4YECA 3SJZA 1PW5A 2ETVA 2IXBA 1SQ0A 1NE2A 1BSVA 5B1EA 1A9OA 5L7WA 3ZDEA 4PPGA 1OF1A 1EPUA 3VSBA 3BGDA 5H3LA 3TIVA 5KS2A 4O2AB 2C59A 3Q85A 5D3KA 3H75A 1TUBB 3FTQA 5TMBA 2NSLA 2FEXA 4YQEA 4PU0A 4S1OA 1G5IA 3R41A 3K5PA 1QRRA 4MB2A 5FPHA 1N5JA 5JH7F 2EBUA 3UKJA 1VKOA 1KL7A 1IJEA 5KQGA 1O87A 2IIQA 1T6NA 2WSSD 2AXQA 3TRHA 1X3LA 4I5EA 4INJA 1KVSA 1KTIA 3PR3A 2L18A 2XODA 1Z5GA 3RW9A 2GEFA 3DDSA 1SGWA 2MOKA 1T34A 2Y1EA 3M70A 2RK6A 4OHUA 4U2KA 4CLRB 3I6QA 5JS2A 4GXTA 2ZRKA 1P4JA 2I55A 4UTXA 2VPZA 2DP4E 3S2SA 3O8CA 1H0RA 1Q84A 2AN4A 3JYHA 1NONA 3QI7A 3NIBA 1SD1A 2OYRA 1JLMA 3NYIA 3ASZA 1XZEA 3OY2A 1O0SA 2BSAA 5KYUB 1K63A 4B40A 1S9DA 4OLBA 2RGBA 1JIVA 4JOQA 1FY2A 3MSCA 4RU1A 1TEVA 1JJAA 1KRHA 5DYNA 3TDNA 2AS0A 4U1RA 1W76A 3H11A 1KEWA 1II8B 3SAJA 3Q7QA 3BE6A 1FRQA 1LF0A 2HJSA 3W06A 1USIA 3EYWA 3HCOA 2E55A 3QQPA 3DWIA 4G1EB 3QWHA 4L8VA 1M54A 4BRUA 5F7XA 2BKLA 1EMDA 3L6CA 4GR9A 3COSA 3ORYA 4HDCA 1JF8A 2XZDA 3HN6A 1EJ6A 3DE5X 1RFGE 4AQYB 3O2QB 4TVBA 1ULTA 5JZBA 2PZFA 2XOEA 3ZOKA 3OY7A 4XVHA 2YWCA 5H1YA 2Q1YA 2CVZA 2HNKA 4KEAA 4Z4GA 3ZHVA 3L7BA 4AKEA 2AFHB 2R25B 3RJTA 2PO5A 4FINA 4Q66C 1XDZA 3SZUA 1D1TA 1VPDA 1EHYA 2FQXA 3A6ZA 3ZIAD 4JEIA 4B4OA 4DV7B 3DDWA 2QNIA 4OU4A 3NC0C 1Z82A 4PPQA 2QU8A 3CUKA 4FFDA 2WT4A 4A0RA 2ZVQX 4KQ6A 4RHTA 5DEOA 3Q6NA 3H0EA 2FXIA 1GQOA 1ZIDA 2Q4EA 1GUFA 1OAAA 2ATEA 3NBZC 4QQKA 4C30A 3TN7A 3UAVA 4EA8A 1OI7A 4TMKA 5EFZA 2ZI5A 1Y7LA 1WCXA 4JUDX 4ZO6A 3IKJA 3T38A 3PV0A 4KIFA 4X20A 5BV8A 4DV4B 4S2EA 1VKRA 4FB5A 4PAWA