4R2WA

X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
243
Chain Sequence
ADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAACVAGVIVNRTQQEIPEVSAVSIVVAAAKKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-syn conformation of uridine and asymmetry of the hexameric molecule revealed in the high-resolution structures of Shewanella oneidensis MR-1 uridine phosphorylase in the free form and in complex with uridine.
pubmed doi rcsb
source organism Shewanella oneidensis mr-1
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 85
structure length 243
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r2wA00
4TXMA 1OU4A 1JDTA 1JDZA 4TTIA 1Y6RA 5DK6A 4LDNA 4D98A 4MARA 2A0XA 3K8QA 4MCHA 4WKCA 4YNBA 2I8AA 4BN0A 5C80A 5F77A 3KVRA 1ZL2A 1Z37A 1Z5PA 3LBAA 3F8WA 4M1EA 3OOEA 3PNSA 3E0QA 4L6IA 4I2VA 4QATA 1Y1RA 3LGSA 5CXSA 2HN9A 2OC4A 3OF3A 1ECPA 2OC9A 1PR4A 4D8YA 1PR2A 4D8VA 1N3IA 3E9RA 5B7GA 4DAOA 3DP9A 1OVGA 2QPLA 1LV8A 2XRFA 2OECA 2HRDA 1RYZA 4OEHA 1V2HE 1ODJA 4PR3A 4QASA 2RJ3A 3OZCA 3UT6A 1Z36A 4BMXA 3KVYA 3GB9A 5F7JA 4BMYA 2I4TA 3UAYA 4R2WA 1U1GA 2P4SA 1YRYE 1V48A 4H1TA 4X24A 3ONVA 3NM4A 1A9TA 3E9ZA 3T94A 5JPCA 4F3KA 3EUEA 4EB8A 1A9QA 3OZBA 3FNQA 1JYSA 3C74A 3P0EA 3SCZA 5B7NA 1TCVA 1RXCA 3MB8A 2QDKA 4YJKA 4GKAA 5F7XA 3DPSA 1WTAA 1OTXA 1PKEA 1PK9A 2HSWA 5B7PA 4KN5A 3FUCA 4L5AA 3BL6A 3ODGA 4L0MA 1YR3A 1Q1GA 3KHSA 4L5CA 1Z5OA 1Z5NA 1FXUA 4E1VA 2IQ5A 3O6VA 4NS1A 3OOHA 4DA8A 1PK7A 1T8RA 1RCTE 1SD2A 5EPUA 1U1CA 3FAZA 4R2XA 5CXQA 4LZWA 4U2KA 3DJFA 2ISCA 1K27A 3OCCA 1VFNA 3EUFA 4JOSA 4G89A 2A0YA 1OTYA 1ULAA 4TXNA 4WKBA 4OGKA 3EMVA 4NSNA 1YQQA 1Y1TA 4P54A 4TS3A 1Z38A 1SQ6A 5F78A 1Y1QA 4DANA 1TD1A 1RXUA 1U1FA 4F2PA 1SD1A 4M3NA 5KB3A 3D1VA 5F7ZA 4YMLA 1Y1SA 4JP5A 4DAEA 4FFSA 1V41E 1K9SA 5K1ZA 3OZEA 1Y6QA 2AI1A 1A9SA 4JWTA 1T0UA 3K8OE 1RXYA 4RJ2A 1PWYE 4GMHA 1LX7A 3PHCA 4UC0A 3INYA 5F76A 1CG6A 4G41A 1A9OA 4LKRA 1ODIA 4F3CA 3FB1A 1G2OA 4TYMA 2PGAA 3FOWA 1RR6A 1V45E 3NM5A 5F7OA 1K3FA 1M73E 1JPVA 4F2WA 2OXFA 3IEXA 4NY1A 4D8XA 3QPBA 4DA7A 4BMZA 1YBFA 3BJEA 1XE3A 4OY3A 1NW4A 1TGYA 1YQUA 4MCIA 4DA0A 1SJ9A 4ECEA 5EFOA 3UAVA 3EEIA 4WKOA 3NBQA 1Z39A 2BSXA 3PNPA 2HWUA 1OV6A 1V4NA 4F1WA 1VHJA 1PR6A 5CCDA 1JE0A 1B8OA 5F73A 2A8YA 3DF9A 4TXHA 1RFGE 5CCEA 4M7WA 4WKNA 2H8GA 1JDUA 4QFBA 1JDVA 1OUMA 3OZDA 1A9PA 1RXSA 4QAQA 1U1DA 1VMKA 2ON6A 4PNPA 4K6OA 3GGSA 1U1EA 3KUKA 5IU6A 1T8YA 4QEZA 1PBNA 1PF7E 1CB0A 1NC3A 4IP0A 3ENZA 4R31A 3BSFA 4G8JA 1QE5A 4L5YA 4OJTA 1T8SA 1VHWA 1RSZA 4DARA 3BGSA 5EUBA 4EARA 3IOMA 1ODLA 3OPVA 3FWPA 1PW7A 5CYFA 1TGVA 4QARA 4DABA 3U40A 5I3CA 5FAKA 2AC7A 5CYGA 3DDOA 3KU4A 1I80A 1JDSA 1A9RA 1RT9A 1JP7A 2A0WA 4TTJA 2AI3A 1JE1A 1PR5A 1PR1A 1ZOSA 5IFKA 1C3XA 4OF4A 2Q7OE 4GLJA 1Z34A 3UAZA 2AI2A 2GUWA 3MMSA 1NC1A 4WKPA 4TTAA 1T8WA 1V3QE 1Z35A 4DA6A 4GLFA 3UAXA 1B8NA 4LNAA 3P0FA 4YO8A 4TS9A 2QTTA 1ULBA 4OGLA 3NM6B 4TXJA 3O4VA 1LVUA 1ODKA 2QSUA 4LNHA 5ETJA 1TCUA 3PHBE 4TXLA 3UAWA 1Z33A 3LA8A 1PR0A 4D9HA 5B7QA 2B94A 2QTGA 1A69A 3KVVA 3TL6A
chains in the Genus database with same CATH superfamily
4GP6A 2XMBA 4OHKA 1H5NA 4PINA 2AQKA 1MZVA 3BWMA 3WX0A 2XCSB 3OZVA 4HWGA 1X8LA 4PHGA 3IUMA 4PF1A 4YAFA 5CPFA 2CVHA 4GOMD 1XZEA 5K0CA 2CB9A 1G98A 4G0XA 2NO9A 4OJYA 3RUDA 4ZI3A 1TJ5A 1HDYA 1L4EA 3I01A 3NCHA 4JB3A 1MD9A 1ZMTA 3M4YA 4MB6A 3Q2IA 1NVKA 1N2XA 1TTPB 5EGSA 3W04A 2K7ZA 3ZHTA 1Y4ZA 1B6RA 3IKLA 4CL8A 3A4YA 5BW8A 1U31A 4UUBA 5ILQA 3WAJA 2FQWA 2K2QB 6ADHA 4IOMA 1T3GA 5FUBA 4I4CA 3QVSA 1P5HA 3BX1A 3LQYA 4L07A 4EW1A 5ED0A 1VPDA 3P5SA 2W22A 1Z0ZA 2C42A 1TA4A 3RT9A 1NI4B 1V5EA 3DC7A 2K4MA 2XT6A 3H1GA 3I6QA 4BCCA 3AUSA 3EDRA 1D2AA 4M0PA 3QU4A 4PS0A 3ZTWA 1XD2B 3EB9A 5AVYA 1NU8A 4DSUA 1NXXA 3N8DA 3TQIA 5EIHA 1E0DA 1V26A 2FW7A 4OFWA 1BG6A 4HY3A 5EUMA 2O7NA 1FP6A 2O4UX 4YEDA 4BGIA 3QVXA 1FS4A 1J09A 2JFWA 4B34A 4I2VA 1FFHA 5KQLA 2IOHA 5MF6A 1NA5A 3A6FA 2NAPA 3CVUA 3FNGA 3SU8A 3VNVA 2QRUA 1YQGA 2AJDA 2LKDA 1H8HA 5G0UA 1L6RA 1RYDA 3GVXA 3IAUA 5DGCA 3ZD9A 4RK5A 5F9HA 4CLXA 2V7TA 2P91A 4TYNA 3NJRA 5JJIA 3L1KA 4DT1A 4O8CA 3JZFA 1E1QA 1DAFA 2BFEB 1BQ4A 2QP4A 1FMCA 4KMOA 2P35A 4B9AA 4UEKA 4YBZA 2JLAA 4TKMA 4RMGA 1GUFA 1U9IC 4X60A 1ARZA 5IKPA 3GX1A 2AKEA 4XX0A 5F12A 1EKXA 2A57A 4KE8A 7YASA 5CGQB 4WD3A 5C7LO 5J5CA 3ICEA 5B2ZA 4N8EA 4F4FA 3H19A 4MUHA 2QTMA 1RYZA 2FN3A 3ND5A 4GPTA 5ER6A 2V9CA 4KODA 2XYPA 1UR5A 3L18A 4OEHA 5IAJA 3WKDA 5CA1A 5IHXA 4YIKA 1ISMA 1QCDA 4MMYB 4Q7JB 1JEYB 1A3CA 4EHIA 4KVZA 3U1BA 2XXJA 3T54A 2C00A 5AXBA 4PRLA 1GQFA 5KZMB 1ZHHA 3BFXA 1A77A 3L0PA 5A0FA 5T5QA 1KVRA 4BGVA 4F8EA 4LHSA 4W5RA 3TMKA 3DBLA 2PA3A 2C9CA 3ICVA 1C81A 1N1EA 3KVYA 3GB9A 4CLOA 3FSEA 1KVQA 2GJAA 3F6RA 3LHDA 3PKZA 3UJ6A 1VIAA 1DWQA 5T57A 4A10A 2PUWA 2QXYA 1KI2A 1XTSA 1PUJA 1HTTA 2OP1A 2P4SA 4R7GA 1N6IA 5IARA 1VLHA 3MD0A 2VSOA 2IKQA 1N0IA 2RKWA 2UUOA 4GH5A 3AM5A 1GD1O 4B48A 2HT6A 2BGWA 3OG9A 3NHZA 2DLNA 4GKJB 1A9TA 2SKDA 4WN3A 1JU4A 2GR9A 4LDZA 4I4TB 5HF8A 2F3RA 2JB9A 1P4JA 4M0CA 4JP8A 1CDDA 3KT8A 1N1GA 1A9QA 2VRCD 4OHCA 3UV7A 2P40A 2ZPTX 5TS2A 4BNDA 1TRKA 4QVGA 3E03A 3EIFA 3QOXA 3X1KA 1GDTA 2RHJA 4HQFA 4R68A 3HLYA 5EQJB 2Z1MA 3IOCA 4PEVA 2PMKA 1DIBA 2Q7XA 5BWMA 1JEJA 1WMBA 4H1VA 2RHBA 5G4KB 1NU6A 1ENOA 2IELA 3UUFA 4RSMA 4D97A 5CFMA 4H0FA 5CW2A 1WUKS 1W36C 2KLHA 1ZJYA 2O05A 3EQ8A 1IN7A 2OKGA 3EZFA 4G4JA 4D4IA 2DLDA 3CB2A 4JD5A 4RQTA 4OI0A 1IWOA 2POQX 2OPBA 3LGXA 4FWIB 5CT8A 4U7JA 3NEYA 5H5JA 3S5JA 3TM5A 2B83A 2QROA 2F17A 3GW8A 3TKYA 2IZ5A 1HDXA 1L5KA 2X4IA 3CLSD 1RPNA 3TIVA 4O2LA 2ZUSA 2VJOA 5DTMA 4IVPA 2GN8A 5F1KA 3TZBA 4OQXA 1T9KA 3L6CA 4FFVA 4DY4A 3KL4A 1HFEL 1QCZA 3KHSA 3KS9A 4QOIA 4BO7A 5FX2A 2I54A 2BFNA 3B85A 3D6VA 1M72A 4GPIB 1GIAA 3A1WA 2H4ZA 3LVFO 1NRWA 3CIOA 5KHAA 4E2ZA 4EI8A 5J4KA 3ZBTA 4NS1A 5DNUA 5AXCA 4ZO7A 2RGAA 1VE1A 2REQA 2VDMB 2H1CA 5DFAA 5IAGA 3QVUA 2IDKA 4ZVKA 2PMBA 1QJCA 3OLCX 4V0MA 4BKQA 4C6TB 2D7DA 2XMGA 3I2HA 3E7WA 1BYIA 1UM9A 3QLUA 4L51A 1M6NA 3FVTA 2NSDA 3DE5X 4P4NA 1CW2B 2ODBA 5JO0A 1FW8A 4R2XA 3MWLA 5AVUA 3ENNA 3BHNA 2LUOA 1JXMA 1XNHA 1EVKA 4PLTA 2Q5OA 3ESZA 3T6KA 1XALA 1EX1A 3L8YA 3GZTB 4N5HX 4NF2A 1RKVA 4TX1A 2ZQ5A 3HDGA 3OCCA 1YVRA 2HZBA 2MSCB 3RVOA 5FWYA 3P4YA 3DM9B 3ZLUA 3P2KA 3T0GA 1T2NA 2OTCA 4Y6QA 5FA5A 1MEEA 2KPOA 3OHMA 4IDPA 1Z2NX 3WYNA 1Z06A 3TJZA 3LT2A 2OY0A 3I5AA 3KQUA 2A0YA 3DH0A 3GLFB 4GI5A 2GM3A 5LIRA 1U0EA 2REOA 3OZGA 3AH8A 4U2CA 4Z49A 1TEZA 1DIAA 3QMWA 3QVOA 4MRSA 2J48A 1Q91A 2C5FA 1ZOOA 3ZVNA 2QI9C 3VU9B 3CGGA 1ZCBA 1R2QA 2CL0X 3SQNA 2OXEA 3NIWA 1A0OA 1Y3BE 3TEMA 4ZQGA 2JDIA 4XR9A 3EFHA 4RTKA 3JASB 3E1SA 1Y6FA 4B84A 4O59O 1MQSA 1ZGCA 3F6YA 2O9JA 4AKHA 3L46A 2HQBA 3TYXA 3RSLA 3MLEA 4B73A 2ID8A 2GBLA 4HT3B 1TEHA 3L9WA 2Q1WA 1MRNA 1JPNA 4UBMA 3AP1A 1YFJA 1B8UA 1C8LA 3ABQB 2NXJA 3EARA 4P5EA 4R05A 3E2MA 4XGQA 3WYDA 5SY6A 3QTBA 1U7PA 3AHFA 3MCWA 4PZ0A 4IDBA 1QS0B 3DL7A 3B3AA 1CJUC 2P7IA 4QAJA 1DG3A 2VCEA 5AVZA 1FYWA 2C5SA 1HE2A 1K5HA 1AKUA 1PJCA 1SCBA 1JG3A 4FFSA 3W9SA 1RQRA 4EFLA 2HCTA 2GBPA 3ZY2A 4AIRA 2QJRA 4BQIA 1WD7A 4QO7A 1K9SA 3LL7A 1C8KA 1RM3A 2R6DA 4DR1B 2CL6X 2NUAA 2POCA 3O21A 1O0SA 3AESB 4TVKA 5JNRA 4LSWA 3HP4A 3RSOA 1F1BA 3TIFA 4JI6B 1A7UA 4NBSA 5HJ2A 3H8SA 3UQYS 4PBTA 1V5WA 3FKJA 4NZYA 1T26A 2BKAA 3F7TA 4ZVVA 1PZHA 5EJFA 4RA9A 1Q0PA 1P4AA 4MGYR 1B0PA 4P7JA 4RY9A 4COOA 1TT5A 1SCQA 2A5YB 1V7ZA 1D2RA 2BONA 5EJ9A 2WB2A 1E3JA 1E5LA 1YHYA 2VF5X 1X94A 2ZJBA 3L77A 2PZKA 3RIHA 3O3OB 3ZGVA 1V1MA 1UWVA 1ST3A 4IDOA 1KC1A 3AR7A 2I7DA 2Y0EA 3BICA 4MYRA 1UXGA 4PO3X 2OZLB 1O6ZA 3QTTA 4LWZA 5HUHA 5LLTA 1J4AA 2Q2OA 3SP1A 4CQMB 5KVSA 3IP6A 1OBOA 3MEQA 2ZANA 3GNLA 5E9QA 1GAEO 1PT8A 2VF8A 4I50B 3K1YA 1TPZA 1S1MA 4F3CA 1Q6ZA 1FFYA 3LQ4A 1E6EA 1RBYA 1SPXA 1IK6A 3UWPA 2ZBVA 5EXEA 4BX9A 2IW3A 3G8CA 1G21A 4O4IB 4IEEA 5J2TB 1Q12A 3CUVA 5K99A 3LHKA 1KJZA 1K63A 3FDFA 3IUBA 4FYKA 3KD3A 4UE3S 4P8RA 3KZKA 4DDUA 3ZVRA 3I72A 3KJFA 1KQ3A 1QGZA 4I66A 1PL0A 3D2LA 1LBEA 2FRDC 4QXAA 1YMQA 2CNBA 4WK0B 5AD1A 1KO7A 5JEDA 1I0LA 1XZAA 3G82C 4MV0A 4J2HA 2ZOSA 2JFUA 5EE9A 4PFJA 3T7JA 1MQ8B 2PUTA 5KQRA 5CFPA 2F3QA 1KZ1A 1SVNA 1XE3A 1RKQA 3FJYA 4XUCA 4LYGA 3KJIA 4WXPA 5JZSA 3MTJA 1QPZA 4WL0A 4RZ3A 3IVAA 2Q45A 3KKPA 1IQRA 3V4FA 3I04M 1IOLA 3BMNA 2RH4A 2PUDA 4KW7A 4XSHA 3UV6A 1RAIA 1DADA 1T5HX 1Z4KA 3RREA 1C7JA 5I4IA 4EHKA 3FYUA 4YQEA 3CVOA 4UVDA 1EGAA 2RB4A 2Y77A 3KKZA 3WIVA 2C9BA 2NQTA 3D1JA 2AF4C 5A4KA 3C16C 5JXGA 3RFUA 1Z26A 3K94A 4KMRA 4ZGBA 1XNRB 4JLWA 2UAGA 2I1QA 2IYTA 3R76A 3RTBA 4F85A 3JVIA 4LWPA 4ZO9A 1A5SB 2PVCA 2HRRA 3IDAA 1OI7A 4A0SA 4DG5A 2VWPA 3GUHA 3EBLA 1WKVA 2ZAMA 4OMDA 1KRXA 3FOZA 2R66A 2PT9A 3I05A 3PC7A 2RIRA 3WA6A 5G4KA 3OE5A 2GZSA 5LZ7A 4HDNA 3S3TA 4EW6A 2NQ2C 3Q5EA 1RFGE 4JS0A 2DH6A 5CCEA 1I2MA 5LQCA 1H8EA 1AXEA 3T9FA 4BE4A 1XTIA 3EHDA 3BRCA 3ZVLA 4D7AA 4E3WA 4QFBA 1FFAA 3WFZA 1VG1A 5CLJA 4XUDA 5CU7A 4D3XA 5JS8A 1PJ3A 2FGKA 2Y2VA 4B80A 4KWCA 4LBWA 2GERA 1ZK3A 2Q9AA 4BBAA 1YQTA 2GRAA 4MI6A 1WVGA 3HDYA 2PGXA 3D4PA 4OB7A 3TZEA 3VDQA 1C4XA 3ZG6A 1SUEA 1Z6AA 2HI0A 1BQEA 5T64A 2W8BA 5IDQA 3CH5A 1AHNA 2BM1A 1GA1A 3GFFA 5C3MA 1RWPA 5K0GA 4BNWA 2ZU0C 2Q3BA 3UJ9A 3I9FA 1N6OA 3IAM1 1E79A 3NRCA 5EC8A 3UG6A 1HL3A 4ARIA 2C20A 4AS1A 4Q7MB 1JFLA 4PRZA 4QUHA 1GR1A 1U1EA 4J6FA 1FDIA 3CY6A 4P3NA 1XK6A 2J3JA 1DE0A 1JB1A 1UJMA 2FGJA 1RLUA 3IA2A 3TLZA 3U7QA 1PF7E 3OJLA 4TKVA 3HYTA 4A36A 3U7IA 3OZAA 1MPTA 1WEHA 4NJMB 5EIOA 5FH9A 4WLNA 1ENYA 1S9DA 3K9NA 4R31A 2IZ6A 4ZOQI 3DVRX 5T4EA 4NESA 1NWCA 4Q47A 4HRYA 3OF2A 1RADA 2O6HA 3CWCA 4KYIB 2XR1A 1F3LA 3ZW7A 2ZIZA 3G2HA 1BWRA 1JAYA 4FE4A 4YO7A 2HPZA 2HSGA 1XF9A 1XKLA 2BFEA 2PKCA 5DLQC 1MMFB 1NASA 4WLFA 4KR3A 4X62B 2E5FA 5EUBA 5C1PA 2XUAA 5DSXA 3RFTA 1K86A 5BRAA 4RSRA 2XYHA 5H59A 1H85A 2Q1UA 4JT2A 3UUGA 2YWJA 3A25A 2YHIB 1FW6A 4OL0A 4ALIA 4RTQA 4J0DA 1D4ZA 2Q3FA 3AVYA 2X19A 3HXMA 2COKA 3IELA 1QQTA 4V0QA 3WBJA 2GYUA 5FAKA 4FQ7A 4PLFA 2BBOA 2ZJ1A 4WCDA 1LDNA 4X97A 1A96A 4FSXA 2VUUA 5REQB 2IYNA 4CDGA 4PV7A 5CFZA 5EKSA 3RBZA 1PLKA 2YJTD 2BH2A 4A03A 4BFLA 4FOPA 2GLXA 4F8JA 1CDZA 1R4NA 3MT7A 5TMPA 2F3PA 3OT5A 1DIRA 5FUWA 1NI4A 2WPNA 3RTEA 4AROA 2WQ7A 5LLDA 3G88A 1ICIA 1TM3E 1U7XA 1SC9A 3S1LA 4GX5A 4NYJR 1GPDG 3MTDA 1Y5IA 3GDGA 1GRRA 1XXHA 3AY6A 3L6BA 1SOAA 3EBPA 3MGKA 5CMLA 3WO0A 1I7LA 4B3IA 4ZYUA 1O54A 2XVMA 3AFNA 4M1OA 1WHTA 2QJTA 3L1JA 3MJEA 2CVPA 2WHPB 3E9CA 3KYDA 3U1VA 2F1IA 2JEYA 4JJEA 5EEHA 4D82A 2ZP1A 4GLFA 4YT2A 4UOZA 4LNAA 3JR7A 4N49A 4K6GA 3N0RA 2CK3D 3DA8A 3L0CA 3MFYA 1JZTA 3VR6A 1DC3A 4RHYA 4LTMA 4F3YA 4PSDA 4HS4A 3JZIA 2QZPA 2D06A 2GYYA 1KZ9A 2JHCA 3NM6B 1OFVA 1GZUA 3O8BA 3QLJA 4FGZA 3N2YA 1E8DA 3GV0A 3CUYA 3B6ZA 5DRYA 4EB3A 3QVKA 1TJ4A 4MKGA 2FQXA 3TBKA 3BMCB 4HDRA 1V6SA 4EF6A 2BJVA 2G8NA 4J7XA 4ZRMA 3FMIA 2IXTA 2HPVA 2XYGA 1BKSB 5DNVA 1F2TB 1KAEA 3HBAA 3BVPA 4N4AA 5EPOA 4W7SA 2Q2VA 3T3IA 1XWIA 2J9GA 4MWCA 1CQXA 1NXWA 1ZK2A 3KVVA 5CB4B 2AZDA 3I0NA 5E6SB 4AXBA 1T15A 1LS6A 4V0NA 1WXFA 1RXIA 1JDZA 2IDZA 4GVXA 4GR4A 2E9SA 5JCXA 1TF7A 2R8ZA 1E4VA 4LDNA 4YCBA 1EDBA 4LHWA 4ER7A 5EQTA 3QI7A 4CLDA 1Y80A 2YL2A 2NSJA 3CN7A 1AKVA 1U6KA 4FCVA 4K3UA 3AB7A 2DFVA 3V7NA 1CLEA 3QEMB 2BWJA 3C2QA 5AW6A 3Q87B 2DT5A 1OX6A 2J30A 3G5UA 3ZLVA 1V7QA 1UZLA 3M4ZA 4YMVA 1K5DA 1SVIA 3JAKA 1P77A 3SJZA 1FLVA 2GAJA 1KMCA 1UJ6A 4TMFA 4XUGB 3TCKA 3CCCA 4EUEA 1D1TA 2B6NA 4DYHA 4ZANA 3BIJA 3OD5A 3EZ2A 2D59A 5MN6A 1QH8A 1CF2O 1FYEA 1AO3A 3MWKA 4NCXA 4ZC8A 3JQGA 2IGBA 3OQIA 4YS6A 3VYVA 4RGQA 3OBIA 4A0GA 2XBUA 1VBNA 2QVCA 1HEIA 5EHIA 1F8FA 1PG2A 2CVFA 2VNKA 3E0QA 2ORWA 2CLLB 3NATA 4QD3A 2FSSA 3LAWA 5EQDA 4B6OA 2MHCA 2JIBA 4HRAA 2MSDB 4HBZA 5AICA 3LZDA 4M8IA 5TPZD 9ATCA 2Z3WA 1EU1A 3T1HB 5IDXA 1KSGA 4BJHB 4QC2A 4N3GA 1DEOA 3P2YA 3I8SA 4DZZA 1AQLA 3E27A 2CMFA 3BZWA 1GPAA 4GPD1 1E6LA 4Q3BA 4DCVA 1U2SA 4CDNA 1TD9A 4C14A 1A2BA 3FYTA 1REQA 4WK6A 2WHQA 4QU9A 5AQ1A 4JV5B 1NBAA 1YB6A 4BXOA 2GJSA 2UDPA 4MWTA 5DGIA 4C5AA 5ELMA 3GJ6A 3OICA 4HEHA 2OZEA 2PANA 2A9QA 3E58A 1R12A 1DQYA 5SY4A 3ZV6A 1ABEA 1L5VA 3RAGA 3ZGXA 3QVWA 1GZ5A 2FR0A 3TQRA 1RAGA 4I9HA 2IQIA 2F64A 1NSFA 1BFKA 4FYIA 3E15A 4EF5A 5JWRA 2JW5A 1U0NA 4DG8A 3QUQA 3PLRA 3LG2A 4DLYA 3KXLA 4OGWA 2WTBA 4G1VA 5HS4A 4PSVA 5D8DA 1ODJA 1JLLA 1ISPA 3FZYA 5TF4A 1XJ0A 2NYUA 4U2EA 5DB4A 1YZFA 3H05A 4RLFA 2HCRA 3QF4B 1RE1A 2AS0A 2IY7A 4JQYA 2GUGA 1CFZA 3AERB 2EBWA 1RVDA 1JKJA 3CQ9A 3K96A 3NAZA 4HWPA 4RPHA 4B76A 4UMDA 3D8RA 4L16A 1LI5A 1PIWA 1X1AA 2ZAYA 4BO6A 4KFSA 4N7JA 4FGUA 4YUVA 2H2IA 3ANYB 3H2YA 4G8CA 3THSA 1G41A 1E1CA 4IKEA 4MI1A 1H9CA 4PLPA 4HZIA 5DV9A 1ND6A 1PJ8A 4HFRA 1S8AA 2HSZA 3M89A 4UZFA 2FK8A 3CGWA 3HUFA 4II3A 4WXEA 4L8YA 4GLLA 3IB3A 5ICFA 3AG6A 2J7PD 3PQ5A 2ZS9A 3EVTA 2COEA 1H93A 2LNDA 2P78A 4M98A 4BO2A 4M0LA 2PXHA 5I9MA 3EZYA 1HE3A 1IHPA 3OIUA 5HA5A 4ZHQF 1SVUA 1FS6A 5J4LA 3FNQA 2P3OA 3OE7A 2R1ZA 1GQRA 3JWIA 3OQHA 4GZ3A 4K9NA 3A1VA 1W88B 4RGVA 4C7XA 5GOZA 4F6RA 2XUHA 4ZO4A 3FSGD 1CUDA 2PFSA 4XWAA 5F1PA 5TMEA 3U4CA 3ZNQA 4PAGA 4EI9A 4GXQA 3JD1A 4U4AA 1U9JA 2E6KA 5LL6P 1DTSA 3ZC3A 4HCJA 4M0DA 3PITA 1P1BA 1Q17A 1NHGA 2FEMA 3OKCA 2CLDX 4XX1A 4GKAA 4AKEA 3DPSA 3QLEA 1GLGA 1Z8FA 2BM0A 2FFAA 2MYPA 2X0JA 5JAMA 5B7PA 1AN0A 2G9UA 3VC7A 3I5YA 1NZJA 4KQIA 4C4XA 1CP2A 5KNCH 2H1RA 2FV8A 2BFMA 2Y1XA 4IUYA 3L0IB 1RAHA 3DCIA 3TW6A 3FPEA 3NOOA 4YPVA 4QHTA 4C7OA 3ZGZA 2HWXA 4S3MA 3OQNA 3RRNA 3FLEA 4YC7A 2G63A 2VA9A 2OXTA 1G20E 3A37A 5HKKD 2FZCA 4RHXA 4PO1A 5ES3A 1SC3A 2XJ4A 4M8SA 4IQGA 2YWEA 1GXSB 5AM4A 2A5JA 4CT0A 1RMTA 2CBZA 1IFXA 1YVEI 2OCXA 4FFWA 4A91A 2G3YA 5BT8A 4LRUA 5KYWA 4NU8X 3KT6A 5HEKA 3RUIA 2DWPA 1ADFA 2JKZA 3CX6A 2EU8A 2GXSA 4MVJD 3PUVA 1FJHA 3DNPA 4XR4A 1TM5E 2C7PA 4LI0A 1Q19A 2GPJA 1QQ5A 2ZT7A 3DWEX 2GEFA 3GDOA 3KWJA 4HQ6A 4IDDA 5HJ5A 3O1IC 5DYWA 3MWYW 4D3DA 2CLCX 2QGNA 3EIHA 2ZTHA 3G2IA 1EFTA 4IZHA 4PGFA 4IG4A 4RWEA 3QPCA 2Y1EA 4NH0A 4IV8A 5TEVA 1V47A 1NMXA 1KO8A 2ZRJA 1ZDMA 1JFRA 1PUIA 3EFOA 4WKGA 5CX4A 2YICA 4LFBB 3SSOA 1H0RA 1EJ2A 1O2DA 3L7DA 1J0XO 3WLEA 1R0KA 1ISIA 2GRJA 3RSSA 3T1NA 2CK3A 2G36A 2V9PA 4XGIA 3JTMA 3T7IA 1OAKA 5K05A 4Q9DA 3IP8A 1NKVA 4CM3A 1N7GA 1IY9A 3OFKA 3OY7A 4JB0A 5E3JA 3A32A 3LUDA 1JI0A 3W2GA 4YX9A 5CB4A 1W0CA 4X66B 1KEWA 3F73A 2UYOA 3ESBA 3LLSA 1YXMA 1Q0UA 2J3LA 2FUCA 3AR5A 3N5KA 5LBTA 1UJ5A 5LZ2A 1ZD3A 5B4UA 1K3UB 5JMPA 3PWZA 2C78A 2NTNA 4HVCA 4EHHA 1CE8B 4NMLA 2NV2B 3AKDA 3GLTA 3UTDA 3ZDQA 4Y2QA 3V8QA 3W0LB 1EHIA 4Q5IA 5DYGA 4BN4A 3E8SA 3DHEA 1G8MA 5D87A 1A2OA 3ZQKA 3H86A 2GK7A 2ZYGA 2FPGA 4EFDA 2VQSA 3CXRA 3PNBA 5EIXA 1BDIA 1EGHA 4EG4A 2JGDB 3AUFA 4AF7A 4OXIA 1OA0A 4MGEA 5I45A 1VIYA 3QU2A 4LGCA 3K73O 3T9EA 6Q21A 1RIIA 2HBQA 3MAGA 3KQMA 1UC8A 2G28A 3MYRA 2AGVA 4ZEWA 2NZ2A 1AG9A 2H1SA 1VGQA 2X6TA 5L7TA 5CH3A 1SCUA 4R2KA 1ORRA 2PRSA 1E2JA 4PZUA 3F71A 3BHMA 2V8BA 3FCCA 3VOAA 3WFJA 1M75A 4OK6A 4CCYB 4ZDIA 1C1DB 3L7YA 1MOSA 2ESRA 4I50F 3JQ8A 3O8QA 2GASA 1A5ZA 1ADGA 1VECA 1XRPA 2RAFA 4CETA 2C7GA 2CNKA 4W5QA 5LMUB 3K35A 2C94A 2GXQA 3WMEA 1QHFA 3P9XA 5IVIA 1DAPA 3QVGB 4NWIA 3KT0A 4L4YA 1ORVA 2Q4DA 4MV6A 1YQ9A 4J76A 3ASZA 3AIKA 4X3PA 4IZ6A 2E18A 4S04A 1D2GA 1H4QA 1E1YA 1DJQA 1P0IA 1I6KA 4M37A 1FNSA 2WKQA 5D1NA 2ZQYA 1UL1X 3GOHA 3G7NA 3QU5A 4CIDA 3H99A 1DMRA 1ZMRA 1N3LA 4XB1A 1NW6A 2P5UA 2XAUA 3TG8A 2IPNA 3OPNA 3CSUA 4LMRA 5BSGA 4BGDA 2DKFA 1RJ9B 3FWNA 2V6FA 2UV8A 3NRJA 4RO0A 3STWA 4B43A 1FP1D 1BXKA 3H1FA 4UHDA 1AA9A 3LYLA 3TVTA 3UKOA 2FSFA 4WBNA 4IJKA 3BD8A 2O3UA 2EGUA 3A6EA 2O3TA 2QRZA 4DJTA 3SSNA 4DS3A 3IQGX 1PYDA 3VNBA 2I80A 1U8XX 4LZPA 1ZK0A 1IVYA 3T5PA 2PMCA 3GJRA 3UA3A 3MT9A 1Z63A 3AVOA 1Y82A 3EE6A 1J9EA 2HJVA 2B21A 1B2RA 4MVCA 3ZV5A 1DSSG 3DVQX 3IXMA 2JD1A 1H1LB 3R0JA 4N0QA 1N2CE 1R15A 2G40A 1A72A 1FMTA 3KSDO 3Q6IA 4KDFA 3R5TA 5FUYA 3R9KA 3TVYA 5I9IA 1LNSA 1HYGA 1P17A 4S2UA 3C1TA 3JAWB 3UJPA 4EJ2A 4J2OA 2UUAB 1FRVA 2PWAA 3F6CA 1KBOA 1BCRA 1LWOA 2GNOA 3LPNA 3UT0A 1C8BA 4LEIA 4YP1A 3UHJA 2ENUA 2FSIA 3KBBA 3T41A 1TU4A 4WFJA 1SVOA 1XRMA 3QPBA 5IJ0A 3D6HA 3MWEA 3WMFA 1RQGA 2FYTA 2WU0A 4NJMA 1JQLB 1DXYA 1E4OA 1VL5A 4A0HA 1M2EA 5B57C 3CNNA 1QFXA 3A31A 3BJEA 1H8ED 1XZDA 2F6RA 3MWDA 4PPFA 8OHMA 4OQDA 2H3EA 3CW8X 4HUQB 2VH1A 2OFWA 4GPZA 2C7BA 5IFLA 1I01A 4O0LA 4KO2S 4RK0A 2B9EA 1LRJA 1MB9A 5EFOA 4ZQFA 2RC5A 2E1RA 1C7RA 4KZPA 3MRVA 2D1SA 3BAFA 1KL7A 4NZNA 4MVJM 4WKOA 2FSUA 2VXOA 3OTHA 3JYOA 1B6TA 4Y1FA 2NU6B 5FD8A 1GKKA 3D9QX 5B4VA 1AO0A 2WZDA 3PNPA 5ADWA 3U7FB 4ZHSA 2HJHA 3ELBA 1LPOA 5JBQA 1PLLA 1XQWA 1C14A 5GPBA 4X64B 4F1WA 3D5TA 3RYHA 3CN9A 4TTSA 3QI2A 4GI3A 1SXJA 2P6UA 1QIGA 4FEEA 1U8AA 1P80A 2GQ0A 3OTOB 1EG2A 1O96B 5IJXA 3ZXSA 4NJOA 3GRZA 4KV9A 1KIMA 1Q0QA 2UZ4A 4NL4H 1SCDA 1TADA 2ZTUA 4ZI7B 2VLBA 3I8XA 2O0HA 4ZJZA 3R7AA 1JJAA 3GJ3A 5D3MA 1ZY2A 4JP2A 3KQSA 1FFXB 3S1AB 3VR2D 4DILA 4TRRA 4XIGS 1EFVA 1Z5GA 5DJ5A 4F3RA 1Y3DE 4NLLA 5CVTA 3P1JA 4N01A 1XTRA 2SECE 1QP4A 4MUGA 1WX1A 1EVLA 4R1UA 3DBHB 1NJFA 5EHQA 1V8BA 1NP6A 3FUXA 4Q19A 3VTZA 1SXJB 4L0QA 4W9NA 2GZRA 1G8KA 3ABRB 1O08A 4XD7D 4B7XA 4TYWA 4HAWA 4FHEA 3QVMA 3ZK8A 2EEZA 2ENWA 4CMKA 1YI1A 1YA8A 3N0WA 3NTRA 2NLOA 3W6NA 3HVHA 1PTKA 1RYYA 3I92A 3HRHA 4FNMA 4BBJA 4IRUB 1Q50A 3H5RA 3LDFA 5KSWB 1SOMA 4YP7A 1NLFA 5BQ3A 4W8GA 4K6OA 2O8VA 1JLMA 2O4CA 4WUTA 1Y9DA 5FBHA 4BLTA 4L3VA 4XWOA 2NIPA 2A67A 3REQA 1XEWX 2LGJA 2G6BA 1TJPB 5BSMA 1WHSA 2JCXA 5CB8A 4M0KA 5JZVA 3DB1A 4BUZA 4CMEA 3F8TA 3NWOA 6NULA 1Z08A 4DKJA 3M6LA 3LQKA 3NLLA 5EMJA 1EWKA 3V4LA 2YXNA 3DPIA 2EV9A 2IHJA 1L9KA 4ECAA 4L4RA 3H9UA 3BSFA 1YVUA 3MGBA 2KLBA 1JAXA 4N5LA 2BTQA 1T0HB 2BE7A 1D6JA 1DQRA 1QE5A 1LJ8A 2R11A 3QXGA 4OQZA 3R0ZA 4YLGA 4A8PA 4X85A 2AG6A 2R62A 2WTMA 4OIMA 5KKNB 3Q3IA 1KAMA 1MR3F 1PZGA 1ZUD1 4J0FA 5KYXB 5J2TA 2I91A 1W46A 1FDRA 3SDSA 2WUFA 1T5DX 1X1BA 2PLWA 3AUJB 2A33A 3K8YA 2J31A 4MYSA 1AQJA 4C5CA 3SIWA 5CM2Z 4OX9Y 2G25A 1E9BA 1E6CA 3KJZA 5EKDA 3Q8WA 3OPVA 3ROEA 4CMEC 3CEPB 1AJEA 1U65A 2J32A 4V2IA 4N6GA 1HETA 3O8LA 5CFQA 1B6GA 3QELB 1EK0A 3O94A 1QDEA 1SUBA 2AOWA 1VYTA 4DLUA 2LZ0A 1T8TA 3KUCA 4I8DA 3TMYA 3OOJA 1PFGA 5IANA 3MRSA 3KB8A 4PNZA 4CDMA 2FOXA 3UJBA 1XLWA 2IUYA 2NYRA 5JC8A 2ABWA 3TUZC 1VSUA 4WN9B 5KHLB 4YJ2A 2QJOA 1OWLA 2A14A 1FXWA 3NWPA 2YRXA 3QBTA 4LJ4A 3SHTA 2OWDA 3VPCA 1I3KA 1UEIA 1JIQA 2W9XA 1A9RA 3ANXA 3EQ9A 1DBVO 3GLSA 3C3KA 1P1IA 4QXMA 5D2CA 1WQ4A 2P0EA 2QX6A 5FHQA 4IZIA 3TOVA 4H60A 1LPMA 4CNBA 2O06A 4J0KA 1SBYA 2Q3LA 2Q7OE 4MUEA 1KEUA 1TOAA 3CVVA 2G06A 2DHDA 3LFUA 4F8YA 3CNHA 3UAGA 4IFIA 1JIUA 1PHPA 1U8UA 3A6HA 4HYEA 2ERXA 4RSHA 3WKBA 1DL5A 2Y1LA 1E7WA 5D3KA 4ON9A 1RAAA 3QIAA 1JPJA 1VJ5A 5DBEX 1V0JA 1VCHA 2A9PA 3JVEA 4LXXA 1OZ0A 1KMHA 3KG2A 3EVFA 3TJRA 4HMQA 4TXJA 3BREA 2PH7A 1QHEA 2JGDA 2V59A 1Y6JA 4KACA 1IEWA 1E58A 4B31A 2QSUA 3BIWA 4TWJA 3N74A 1B3BA 3V8BA 3WGJA 5G0WA 5BW6B 2XQJA 1QO0D 2PX2A 1TCUA 2JIZA 3FVVA 2XI4A 4EQZA 3V4RA 2B30A 4J1TA 3AEQA 4XWYA 4UMEA 3ZS9A 1BNCA 3M1IA 1J5XA 4EENA 5C1IA 3RS0A 1AIPA 4J9VA 5L4LA 1AH2A 2ARKA 2QTGA 2JATA 3QG1A 1YIDA 1YMUA 3KUUA 4ZV4A 4M9ZA 5DT9A 4HN9A 4JC4A 3KB6A 2GCPA 3OPMA 5FTJA 3CF2A 1R5OA 1U9YA 3COPA 4KJZA 5DM0A 3CKKA 3FTCA 4EKIA 3C98A 4FINA 3AUUA 2WHRA 1WMDA 1EFLA 3NYWA 3G02A 4MW2A 1ZRHA 4TSFD 5JWOA 4O5OA 4CF7A 3NHAA 1GPUA 3DLHA 2JGRA 2R4UA 2K2WA 2ILTA 4Y0NA 1YS9A 1O6FA 3AT1A 1EUZA 3COVA 4E30A 1AMNA 2LWIA 3PKIA 5CX1A 3TTUA 5PGMA 1T1EA 1XCPA 5DYYA 1E69A 1ZIPA 2OORA 4E2WA 5A9RA 4TV9B 1UBCA 4X90A 2D13A 2IC5A 3NBMA 5C52B 5COQA 3HH8A 1J39A 1IUPA 2RSLA 2C2OA 2JVIA 3WWYA 1X9HA 4PC7A 1RP1A 1UM9B 4TOIA 4NENA 1GRCA 3EZ9A 1QYXA 1Z37A 2CDNA 3PRYA 1VJ0A 1M7GA 5IULC 1DOZA 3OOSA 1GXSA 3A1UA 3LJKA 2V7WA 2G1AA 4TWZA 4ALMA 4E21A 3QYJA 1QXSA 1YS1X 1NR7A 2OCPA 3QZUA 4HNUA 3UC9A 5ICCA 3DZCA 4UMFA 4G01B 3B6MA 3Q40A 4GX2A 3PPYA 2MCFA 2FEOA 2GMWA 2VRCA 5TXGA 5JU6A 4JC8A 5D85A 4KYUA 2PJZA 4HKTA 5JAZA 1Y42X 2WIFA 3FNRA 1HYEA 3Q9SA 4MEJA 4MQ5A 4ZAXA 3RJ5A 2EL7A 3EVDA 4GECA 3KDSE 2GJ9A 5DTQA 3ROKA 3TECE 4MMXB 2C5EA 3C41J 4KRXA 4FPXA 2CFRA 3ROTA 1VMIA 2P3LA 3QH4A 5G40A 3R7WB 4WZAB 1F20A 4MQFA 1PR2A 2RBKA 1RC1A 2QYHA 2EIXA 4BNGA 3HVIA 3KQKA 3BK1A 1QK4A 2ZIWB 4KZKA 1P18A 4UHKA 1ZBDA 2QE7D 4ZI5A 1KU0A 2DQSA 1YSCA 2HB6A 3P52A 1R0BA 1UKBA 1L2TA 2J07A 3EIWA 4LY9A 4U7PB 1Z68A 1AUQA 1ESDA 4M8KA 2NVWA 1U3WA 2WM9B 2FMKA 5BWOA 3O2SB 3SXUA 2JIMA 3C3PA 1GL9B 1GY8A 2J59A 2Y0DA 2CEKA 5EUQB 4FT2A 4E08A 4EJMA 4X54A 1Z0SA 5I7RA 5K0EA 3TN7A 2IJGX 3IBTA 2B7BA 3C8MA 5CFOA 1IIRA 4TZKA 1EZZA 1X7ZA 1TMGE 2HU2A 3CPEA 4TVOA 3LCMA 4FE7A 3EDQA 4DQUA 1CETA 1KTVA 1A88A 3AEYA 3PICA 4BMYA 3EZLA 3LDUA 4DNXA 4MUJA 5CG2A 4XJSA 3PNQA 1EVJA 2I4TA 4RDXA 3PF8A 4KO8A 5DWDA 2I4LA 3JQFA 1M6YA 1SHLA 3F4KA 3P0RA 4GRAA 3QP9A 4CLOB 5BSHA 5LIPA 4N76A 4X24A 2PZLA 1EZ1A 1O94C 1FNMA 4B3FX 1KDOA 2PS3A 4V39A 4C1NA 3LTNC 1DDGA 5AVOA 2AXPA 2IYWA 1F4PA 3LGAA 3JWGA 4LV8B 4CM8A 2QT0A 2JHGA 2XRMA 1WF3A 3AVTA 4AO8A 5H02A 3RC3A 3L6OO 3OOWA 2WB4A 3VR4H 1I6MA 4MVXA 3HR8A 3B8HA 4KSYA 2XCUA 2ONJA 1DB3A 2ONCA 5LKRA 5E7JA 3C74A 4GEGA 4N40A 1GPKA 1O95D 2L69A 2PJUA 4HAVA 3B7PA 3WNBA 5DEOA 1VL6A 2C3PA 4KO3S 1NFFA 2XF8A 5LQDA 5DGTA 4Y0AA 4YAIA 1OT3A 1UC5B 4MR9B 1G63A 2Q29A 1R50A 2QJFA 3F67A 1NONA 3IQZA 3F7MA 2DPLA 1O96A 2DUJA 2CYCA 4RVUA 5DULA 5BN3A 2I66A 2YIJA 4KO1S 3GUCA 2XUDA 2J46A 2WP8J 3C1OA 1SB8A 5JNSA 3SZLA 1IXYA 3ER9A 4DWOA 1GTVA 4JSYA 2X22A 3JWJA 1A9XB 4MUIA 5DCYA 3IPLA 1U8FO 4ITUA 2DUMA 1CX9B 4I1SA 4IQ8A 1RQPA 3M6VA 3DP7A 2B6HA 4YREA 1DBSA 3IEIA 5MGBA 4D0SA 2HSEA 1Z5OA 1NDQA 1C9NA 1YB1A 2VXCA 3IRUA 1PGOA 4LPKA 4LZZA 4R8LA 3LUFA 1E3QA 1ONOA 3W1VA 1KE2A 1Q1ZA 1ZINA 2YXBA 4HUQA 1SH7A 1XMXA 2C54A 3C6BA 3MRTA 1BDJA 2Z5VA 2JHPA 4R9SA 4TTRA 4ER5A 3QKSB 1L7VC 1PDVA 3IAM6 3EVCA 4BTEA 1I8TA 1NW9B 2ZIXA 3V4PB 1YQEA 5JG7A 2YY7A 4FMBB 4KV7A 5JAOA 3LI2A 5CIWA 4X00A 4YHBA 1NUAA 3H2KA 1CUBA 3CG0A 4PYLA 3HBFA 2BMDA 4HPWA 1C1HA 2PRYA 1L7PA 1ZM2A 3AU9A 1EUYA 1TK9A 2HX1A 4JODA 2BDUA 4MWEA 2REXB 1TKAA 2ZRBA 1PNRA 3OM1A 4O2AB 1YR9A 1XLVA 3IHWA 5EZYF 2IU6A 3LDAA 4LE2A 1UPUA 2Q99A 4E13A 2YQ4A 3GRUA 1G8YA 4J03A 3OPYB 3FNHA 5T67A 1NR5A 1TJYA 3EG9B 1I4WA 4N8SA 3WV5A 3X1JA 4E5YA 3TFOA 4LVOA 5AKHA 2C1XA 4Z5XA 2C1ZA 4J0GA 3CZCA 3ITEA 1AF7A 4YQZA 3ACCA 2PQ0A 4BEBA 5HRAA 3RQIA 3RC8A 3IP5A 4C0XA 4XFKA 3V4VB 2I4RA 2IV7A 2WSIA 3DVAA 4N6NA 4MK4A 2C4VA 3AEUB 4BP3A 4CMAA 3WNZA 1M8PA 1P9LA 3ZNOA 2RAUA 3L0BA 4DSTA 3JQBA 5DOZA 1RZUA 1LU9A 3WQSB 3R7SA 1SQ0A 2O8EA 2ZVPX 1IN8A 3GAZA 5KYUB 2QRHA 3V1KA 4ZKDA 4HAXA 2WC1A 3WYGA 3AB3A 5TQJA 4NBKA 4B4UA 4EMSA 3GEMA 4XEUA 4PQGA 1Z13A 1NNUA 2W6OA 3D2BA 2EF0A 1AHIA 1KZ4A 1EP9A 1V8DA 1T4CA 3BD6A 5A2GA 4RA6B 5E7MA 1DHTA 3K2QA 3P32A 4P7GA 3NNNA 5TC4A 4AZWA 4CM4B 4C2BA 4CCYA 3L4SO 2Y4NA 4IG9A 3PUJA 1X13A 2VJMA 4URWR 3M81A 1BGVA 1Q1QA 4ND4A 1KDVA 4G5XA 2MR5A 3DV0A 4OTZA 4REMA 4HXGA 5GVRA 5BVHB 1SWWA 2QR3A 3BMXA 3ILHA 1MIHA 2QV0A 1E0AA 1T4MA 5IEJA 3LVRE 3LK6A 1YBMA 3KKNA 3ENVA 4JXJA 1X7WB 4BYMA 2C2BA 3AX6A 3N6XA 1PLJA 4YYZA 1CEYA 1AC5A 2PSFA 4CKBB 1YZVA 1CE8A 1FDTA 4GWGA 4UD2A 1HX7A 3ZDAA 4F2HA 2FPRA 3DZJA 3R44A 5GMOA 5KIAA 1X7HA 1HG0A 1HOXA 2ICAA 2V74B 3MS4A 3PHGA 4EG8A 2G82A 1YB4A 3INYA 3RJMA 2DB3A 1MC8A 3A4NA 2NNLD 3CLSC 1VJGA 4H17A 4GXTA 3HVRA 3IQHX 1F8GA 4A2WA 4RM3A 1SCJA 1Z2AA 4RVSA 4LGMA 3VO8A 3DEYX 3TPZA 2J3HA 3N3BC 4KFTA 1N7HA 5FV7A 2JFYA 5CTAA 3WWEA 4ETMA 2QYOA 1H22A 1C3OA 1M34E 1W1IA 3HR7A 3D4IA 1YVPA 2FSVA 3V8MA 3L79A 3L8FA 1KDYA 3EVBA 2GOYA 1B1CA 1P72A 3BEDA 2XMPA 2ZYAA 2R4QA 1HZZC 3C4QA 4O4LA 4B3JA 5B30A 1EH5A 3A2MA 4NYMR 4A6DA 3G8YA 2YBDA 4HXYA 2MSNA 2P9EA 4NBRA 3K6SB 1K6EA 3T3MB 2ODNA 4LHXA 1Y8RB 2J8ZA 3UO8B 4Z54A 3LA6A 4RFSB 4AF6A 1YONA 2PUAA 1B0AA 1HDCA 4H15A 1HGXA 4I3HA 1XZNA 2C7VA 1CZHA 3CISA 3R1IA 4UNSA 1V5FA 4HS9A 5BN4B 5LXTF 1NBMA 3N2EA 2RARA 1R5BA 1YDMA 4LUCA 3VVLA 2C31A 2Y9MB 4OY3A 4ML3A 3ADPA 3H5TA 1UKYA 2QOEA 3ETDA 4MA5A 4JOQA 5C4GB 5BMVA 5LDHA 3SR4A 4GL2A 3LUAA 2Q21A 5A4JA 1S5PA 2YKGA 3BWDD 2BRUA 4YCSA 1W44A 2WUDA 1P4SA 4RK4A 3TSCA 4I19A 5EIWA 1C0IA 2JIPA 1QVAA 2HEGA 2I3DA 5K0LA 4AS3A 3K05A 3KSUA 2GHIA 1UJ2A 1KERA 2XNJA 1Y8QA 1NG9A 4AKIA 2J67A 1Z5WA 2BSXA 1UJNA 2BZGA 1KK0A 2Y6UA 3FR8A 5F5XA 5KSOA 3HY4A 4AQ7A 1Z3IX 1EXNA 3JVDA 3ZBQA 2OCAA 2BH9A 5M29A 4IAOA 3NBAA 3PA6A 1SXQA 1M1XB 4K3VA 4W9RA 4L9WA 3VRHA 1JLSA 1C9KA 2P9TA 2YWBA 1RWWA 1MH1A 3A2LA 4RH0A 1JXAA 4D0GA 2J1LA 1I9GA 4AZSA 4QECA 1ULSA 1Y63A 1QYIA 4JZYA 1ZIDA 1NF9A 4MUXA 4CG2A 2PTHA 5JYCA 1X15A 3PCXA 1Y3FE 5I9NA 1APBA 1D1QA 1WXEA 1MVOA 1PFQA 4GHWA 2IH2A 3WL7A 2N3ZA 1L4BA 1QZXA 4H7JA 1EX6A 2QUBA 2VTEA 1S6YA 4PIPA 5JASA 4ND6A 1UEJA 1OTHA 1EA7A 2X0NA 5LP6F 5HMMA 1NBOA 4Z4HA 3LIIA 3UWMA 1NT2A 3DXFA 3P94A 2OBBA 1BFDA 5I8PA 5BYJA 3WGQA 3B6KA 1NXPA 1PFVA 1XEXA 3G5MA 3N58A 1J8QA 1UZUA 4AUEA 3IT2A 5LOVB 3K70B 1F7UA 4P92A 1SBZA 3IQXA 4CGYA 3FNEA 2RAPA 1XDBA 4HDSB 3FYUB 2QTWB 1NY5A 1Z2PX 3FKQA 4RV4A 1E32A 1DBWA 3EXHB 3GGSA 3S2UA 1Q1BA 1NUUA 2VHUA 1Z8DA 3N2IA 2GHRA 2DWOA 1XYVA 5DTEA 1EM6A 2N0SA 3EEYA 4OKIA 3H1BA 4OM8A 1UKCA 4Q3EA 1JLLB 2OM6A 3ZHBA 2NTJA 5A9TA 3VR0A 4HMPA 4LNUA 1M5TA 1XHEA 4RACA 5HMLA 3OMWA 2H06A 3THWA 2JAPA 1IWBB 4TQGA 2B7LA 3DTNA 3SEFA 1HLFA 3C3WA 4R16A 1PS8A 1OU0A 2B4TO 4V1CB 3UVEA 4L5BA 1EQ2A 5TDHA 2O5EA 4DDHA 2I2CA 3CLTC 3GJ0A 4NMMA 1XC7A 2OMKA 2JJ1A 2AJ8A 4A5SA 4MI9A 3ESYA 1YA6A 1XTJA 4D74A 5A3VA 1BGXT 4QQFA 1P9NA 2X1VA 4O4LF 2DULA 3CZMA 4FOSA 3WZMA 4E03A 1HFWA 3D6MA 2H2HA 5J23A 2XZPA 4EEZA 2P2YA 2P2ZA 4IYJA 4Z3KA 4CTOA 4FW8A 1E98A 1ZAYA 3VPSA 1VLJA 2G70A 4FN4A 2PX4A 5IT9A 1KJ9A 3GXOA 1ZD5A 3A1DA 2P9HA 3D7KA 2WR8A 2NUTA 3ZHRA 5KMGB 4M88A 4RKRA 5IBRA 1NXOA 1OFTA 1UFQA 5B3LA 1E2DA 2C99A 1C7QA 1KQNA 2BM8A 3ONDA 3N86A 3EZ6A 1H3EA 3FPJA 1DRKA 3V8VA 2CMKA 1XCGB 2AJTA 4MS1B 3PNYA 1TQHA 4MWBA 2WMYA 1PD1A 3GPBA 3A6DA 4E4YA 3DXYA 4DPKA 4AT1A 1QHYA 1QQ7A 1RT9A 2GAOA 3NAGA 3SQDA 4ZJPA 2CDCA 2ATEA 1R6DA 4JGIA 1BEUB 3FUVA 5HF9A 1J8DA 5CH8A 4IXMA 1C1XB 2JAHA 3DHNA 4DNPA 5BSFA 5H8WA 2AFIA 4P32A 1F2DA 3ZU3A 1MC5A 4CMHA 2AI2A 3AVPA 4B5LA 4Q9HA 5CD9A 3HCNA 1B76A 2P11A 4BFUA 1ZUHA 2CVZA 2HWWA 3GQVA 4BUJA 2DFDA 4BY9E 1H2BA 1AD2A 3L0YA 1LZLA 1G4AE 2H29A 3G49A 1BKYA 5K3DA 1XX6A 4BOYA 4CQMD 5DYIA 5CD1A 4P84A 1L4LA 4IHQA 2FZVA 3SC2A 1N2EA 4C7JA 5ALGA 1TXGA 1A8PA 1WVIA 2C5HA 3KCNA 4NDNE 3CXUA 4QBIA 4TKUA 3G2JA 3O4VA 1DU4A 4JOCA 4TV9F 2QB5A 1ODKA 4BFZA 2IPLA 1MC1A 2AOTA 1YRHA 2ATCA 1G7TA 1GITA 1QOPB 2CXXA 1ZN7A 2XIJA 3PUZA 3H4MA 1DBQA 1ZMXA 5JARA 1FRFS 1UC4B 3A4VA 1QFMA 2B1JA 5A62A 4Z9FA 1NVDA 3G23A 4AI6A 4ZYLA 5L45A 2IRWA 1RJEA 2Y1DA 1M9NA 3UJ8A 2XKKA 3C3MA 5IN4A 1UJCA 4NHEA 2CZQA 3OU2A 4KIJA 2BUAA 3K0EA 4FYJA 4OUDA 4R81A 5L6MB 1EZ4A 4Y2HA 3E35A 1V3UA 1MC4A 1UZMA 4M1KA 3VR5H 2CNOA 2JG3A 4PQFA 3O2JA 2GSDA 2PRKA 2VP4A 4ZTBA 3Q3VA 3A8TA 1CRWG 1VLMA 4XQEA 3I1JA 4PTYA 3IE0A 1FTSA 4DCOA 1RJFA 3ZXYA 1WHTB 5ECWA 3O8RA 4O1IA 3BDIA 4R6XA 3ETNA 3UGTA 3VNRA 4BX8A 4DQ0A 1P33A 1EJBA 2I8AA 1F8UA 2JIDA 2V3VA 3LCCA 3PC3A 4E09A 1SO8A 3OPYI 2PVPA 1O6GA 1P1KA 4QYWA 4LF6B 2H1HA 4FNGA 1VKZA 1EMDA 3N9IA 2LCFA 4OP3A 3HXQA 5EZ5A 3KJNA 2V58A 3MSCA 4HWSA 4KB5A 4YDRA 4MQ4A 1W4CA 4RIIA 3H6GA 5A3RA 3CC8A 4UHCA 1K98A 2PS9A 4GFDA 3G3EA 5EP2A 5IC4A 5ISMA 2BYTA 1FB5A 2RDMA 4S1TA 3II6X 3FZGA 1CIVA 5REQA 2O8FA 3JQ9A 3GFTA 3NP9A 1DRWA 1JLRA 1L5QA 2VPQA 3ICCA 2FU5C 5JCJA 2D3TA 3ZHUA 1CJBA 1R8QA 2H31A 1CNMA 4QATA 2DBRA 2OD2A 1IZ9A 3DFKA 4MVJI 1XXHE 1SIBE 3AP2A 2GO7A 1QO7A 3VPHA 4QPZA 1D0VA 2HN9A 3U80A 2O8BB 4RD4A 2B8JA 2OC4A 1O94D 3QY0A 4ZT3A 2IIBA 4BASA 4YV0A 5K8IA 3ZCSA 2OC9A 2PX3A 4IV0A 4ZU3A 3ZUPA 4BVBA 3JYLA 5F5LA 1G7RA 1KJJA 2VYCA 4XRGA 4L08A 2C8KA 5EIBD 4IIBA 1WETA 2WNSA 2QPTA 3BHIA 4DAOA 3IYLW 1I3LA 2Y1GA 1OJLA 1QE3A 3RVSA 2CV1A 1JJIA 2AUMA 2ZT5A 3U81A 4CLRA 2L19A 1ACJA 2PSSA 1TF2A 4BPRA 3E84A 3GLIA 2DWQA 1RKXA 4BV9A 3AV3A 1RE0A 2B7CA 1MB3A 3SKVA 1GILA 1U5CA 4ZOBA 2H1IA 1LA2A 5JVDA 3M9WA 4L73A 5DTIA 3GBVA 3L5KA 4F4DA 2GNAA 3LTEA 3DHWC 3WWZA 2CJWA 3CO0S 3GBSA 1B6SA 1MQAA 1YDWA 4FZ5A 2XGSA 4MRVA 3BDVA 4WLVA 3ZWPA 1E2GA 5B36A 3N2ZB 3OT1A 1QTRA 2IP1A 3D0RA 4BMXA 4K0KB 1AV7A 1PQPA 2B1IA 2J3KA 2FPLA 3HCWA 3P0JA 1NMEA 3IDOA 5EXSA 2E7ZA 3PWSA 1HXHA 3SYRA 4LF9B 1LLDA 3REOA 2WJ4A 1L5ZA 4R1TA 4Q7LA 1EE9A 1P0CA 3K0KA 1BX1A 1MB2A 3VMMA 4ALNA 3DDUA 1XTVA 3EA0A 1BA2A 2P69A 3I6BA 3LBFA 1PAUA 2Z3VA 3ROGA 3KXPA 5EIAA 1JEYA 2I87A 1SKAA 4O2RA 4M1QA 5AUQA 4FEYA 4BAUA 1ONBA 1G2IA 3BH0A 2EX1A 4L02A 4EELA 4I9GA 1WNTA 5K3AA 2WHYA 3A9TA 4UKDA 4CDRA 2VUSA 1P2FA 1I0ZA 2WM2A 3R5FA 1JDNA 1BH6A 4I9FA 1KEEA 1OW3B 3DV9A 1H2FA 3WTBA 3P0EA 3HU1A 2HU7A 4HI0E 2DX7A 1YBVA 3HY3A 2BPOA 2FW6A 1OWMA 3RS4A 5AJYA 2RJNA 4Z99A 4ZT4A 4G0NA 3ZNPA 2X13A 1R6UA 3T7TA 3RKSA 1EFAA 1ZEMA 3NBFA 3ZWKA 5CFLA 2P4EA 2ZRGA 1PG5A 2H0AA 3KZVA 3RYTC 1O0CA 4XSVA 2M32A 4B79A 5ALDA 1VE3A 2CFSA 4W5JA 1UMKA 4CUZA 4BQFA 4JLSA 4KAFA 1KF0A 2FWMX 1VBFA 1UBHS 2IXAA 4MVJF 1R4MB 2QGZA 2WYVA 1DUVG 3BL6A 2IU4A 1CRPA 3KFVA 4X3CA 3ETJA 2OCLA 3PQ8A 3VR6H 1YR3A 1NOIA 2BMEA 2RK6A 4Q0MA 5ALIA 1TFUA 1XVAA 1S3SA 4U6NA 1FOEB 1LLFA 3H2JA 4J4HA 5ALXA 1D5CA 5JSZB 3CURA 1GPJA 5AJTA 4RY0A 1P2TA 1VM6A 5I7WA 4B3TB 4TWAA 1OZHA 1SD2A 3ZZ1A 1M6VB 1D07A 4UQLA 1CY8A 2VHTA 2DTDA 4URVR 2ZXFA 1YHZA 5DI3B 1P0FA 1D03A 1SELA 1PZMA 4MUYA 4UASA 1OYWA 5AW5A 4FDUA 5A7HA 4BGUA 7ABPA 2NV6A 3K0AA 4FU0A 5FFNA 2R97A 3A6JA 4PZ9A 4OFBA 2FZ5A 4QEKA 3Q1KA 5K3FA 3NRBA 2QD4A 2VOJA 2MIIA 5B1IA 4F4UA 3NDRA 3EPPA 4K1LA 1TYDE 4UNQA 4ZD6A 3W90A 4Z51A 1X7YB 2UXBB 1G291 3PEVA 1NJSA 4YGYA 5LA6B 1P5JA 4F84A 4X91A 5F3RA 4DLSA 3E70C 1DAIA 3CX7A 3JAMA 1M74A 4DFDA 2RGYA 4Q4CA 3BK7A 4PTZA 1FP4A 1XDGA 1PJLA 3MTAA 3C7DB 2N1BA 4LAFA 3GWGA 4D9MA 4WKBA 2IHKA 1WV1A 2A4KA 2BGTA 3HNOA 2HA0A 4KQ2A 4KXYA 4AULA 1U7OA 3N07A 4NSNA 1ZNQO 3QW4B 2ECOA 3HWSA 1KZGB 3FZQA 1NZFA 3W6PA 3B7GA 4ZEXA 2O3SA 4LZJA 5LDDC 1C29B 5HBGA 4WINA 1JA9A 4OXNA 3WXMA 1U63A 3SN6A 2A5FA 2V6JA 2EW1A 3Q9UA 1U2DC 3A10A 3NQ41 4DV5B 3FCXA 3AESA 4BQEA 3IJRA 4OIFA 2OCYC 5GV8A 5D1HA 4C0HA 5HZHA 1QO0A 3R3UA 1L4FA 4LW8A 3SC2B 3KOMA 4BMDA 1SVWA 1GPMA 1SD1A 3PIDA 5AK0A 3DSRA 4CKYA 1CRZA 3TX2A 2I1WA 3SR0A 2ZBQA 5JBIA 4DXAA 1MA3A 2RBGA 2EJVA 3BCUA 4RHEA 2Q50A 4CG3A 5AKGA 1WXDA 1TQDA 2FEXA 4C6SA 4NU6A 3A2KA 1QC5B 2R44A 3G68A 4L95C 3GGCA 2D2VA 4HNAA 3Q5GA 1E7RA 6PFKA 2HLHA 3BB4A 3WXBA 1MGPA 4WNCA 3QG5A 2E5WA 4CHTA 1E61A 2BZSA 2R1TB 2YXEA 4YALA 1GCAA 3QQ5A 1EIWA 1H3NA 2E21A 5ERGB 1EESA 2O2EA 4P0TA 3WWPA 5AVJA 2C8JA 4LGVA 3WL5A 3ZD8A 1BVUA 4H16A 5K6AA 1QRSA 1K2WA 4DC9A 4ANFA 2JJYA 1IN4A 4OHWA 5C51B 2VZ8A 3TTVA 3U39A 5G3YA 2OGUA 1MX1A 4I4NA 2C2KA 1KKUA 1QIIA 1LX7A 4BV2A 3SQOA 1KDTA 1DAMA 2ZULA 1BHO1 1VJRA 3FCSB 4EYKA 2W2TA 1R6TA 3D3KA 4MPPA 1G7SA 2IZZA 5FTKA 1WMEA 4JN6B 4GOKA 5D00A 5JAUA 4U63A 3SNKA 1EP1B 2IEIA 2Q9UA 2WPDD 3L0SA 1EWRA 2FPPB 4FCTA 4JY7A 3L4JA 1HG1A 1YUBA 2WWHA 3DL0A 2YFKA 3BM5A 3NNDA 4B82A 4TTVA 3W6UA 1EGMB 4FYHA 2XXAA 2EBFX 3VNQA 3QA9A 4EYSA 2EP5A 1RRMA 2P30A 5C5IA 2BEVA 5IN5A 4C0JA 2Q2NA 4FM9A 2FPIA 4BU1A 5SYAA 3GH1A 4FR2A 1VGRA 3R8FA 1ODTC 3THOA 3NMUF 2XLCA 2UZ0A 2NTEA 3DT9A 2JAXA 1SG6A 1G9SA 5GP1A 1WF6A 4V1CI 1BX0A 1Y3IA 1FFEA 4GZMA 1IZ8A 3DLCA 4IIJA 3F9CA 4L57A 3M82A 3WZLA 2C83A 4DDWA 4ZTZB 4AZVA 4C4RA 3I76A 1WB9A 3WGLA 3THWB 2CMGA 2MWMA 5JAHA 3C5HA 2REQB 1N1DA 4EKEA 1VPWA 3A7EA 1D4FA 1A98A 2JFZA 3JS5A 2C2ZA 2NZYA 2PUVA 3HJFA 1SJ9A 4ERNA 3TTYA 2X77A 2OVFA 2GYWA 1DVRA 4PCLA 3T3HA 4A15A 1RKBA 3OPXA 1TU3A 4MOWA 3PFFA 1YNSA 3OI7A 1ZIXA 4EYGA 1IVNA 1AUOA 3I73A 3NOVA 2E4YA 2G1KA 4B75A 1FIUA 2ZITA 3OEHD 4RD0A 3BA1A 3ILVA 1GSAA 3S55A 4OGGA 3TZCA 3ZTYA 3K9QO 4KLAA 4UQOA 2AR9A 1BMDA 4N3BA 4WOBA 4DM7A 1EX7A 1T35A 1L1FA 1XUOA 1ZU4A 1J1IA 2RKBA 1FP2A 4H0NA 2OT3B 3NEJA 2FWNA 4X93A 4DJJA 2RHOA 4RD1A 1K6MA 2F8TA 4OQYA 2WYOA 4RZIA 1N5RA 2CFCA 3SE7A 1HUQA 3PTZA 3V2GA 3NHWA 3WK7A 1P81A 2GVZC 3QHAA 3VH2A 3HCRA 2VAXA 5JOQA 1EXWA 2ZI9A 3DF9A 1ML3A 2HD4A 4OB6A 2OYCA 4LQDA 3OM9A 4W1PA 2B4YA 1FFDA 3T12A 3RYCA 4MV7A 4CPDA 1IWPB 3MBOA 2EQBA 1MDFA 5K6AC 3ZWQA 3D43A 4DLRA 2I65A 4GI1A 2RGCA 3WGIA 2V6MA 2WNIA 1BXRB 4DXDA 2Z9CA 2EFJA 5ELLA 4XDYA 3LCUA 4EF4A 2D1YA 1G66A 3G85A 4JP3A 1PV4A 4EW2A 3FMVA 3MJCA 5B1SA 1M2NA 2ON6A 4GDFA 3FGPA 4PNPA 4JI5B 3SIPA 3WAKA 1YZQA 4GOOD 4HWKA 1JFFA 4C05A 5JSQA 4B45A 3BD9A 3HBLA 1H6DA 3IMFA 1YR8A 3WIDA 3DBLB 4RY8A 2CWWA 3DUFB 1N2CB 1OI3A 4L8WB 3R8CA 3AFOA 3ONFA 3DE3X 3OQBA 1XHFA 2DUUA 2B3DA 3F5SA 5LMZA 3ELWA 2LDXA 3EGVA 3NC4A 5LZ5A 1YQXA 1T4BA 3C43A 4UU1A 5EJ2A 1Y6GA 3C5CA 4RDCA 1TK2A 4IH4A 4UTVA 4H4DA 2BFCA 3IQIX 1J2YA 3IOYA 3RBAA 4QELA 3IOEA 2D1TA 3FFXA 1QYVA 3WI7A 4B4DA 1NJ6A 3FCUB 3OP1A 5FF9A 5JT1A 4EY8A 2DUWA 4Q02A 2QRNA 4L5YA 4ZPXA 1XMSA 4QSMA 4MQ6A 1ZVJA 2AWOA 2Z2ZA 3VH4A 4BVEA 1MJHA 1OJ7A 1XJ5A 3LKBA 2QLBA 4RDIA 1PZXA 4DSZA 1NQUA 3G0GA 1AGNA 4EX7A 1ZI8A 1F14A 4JEIA 1OAOC 1XCJA 4G4GA 3OA2A 3VZDA 4BO3A 4EGSA 1Y81A 2IIVA 2QXTA 1RHRA 2XTNA 3PQ6A 1ZOLA 3LC7O 4IICA 3ADDA 2Z8YA 5AKEA 3ABIA 1YIOA 3PT5A 1NSTA 1P73A 1CQJA 1BE8A 4CM6A 2PPVA 5BN1A 2OLKA 1N0WA 2XGJA 4OAQA 4JVLA 1EFRA 5A7FA 3AU8A 2IUTA 5TEWA 2QDXA 2HF2A 4HAZA 1TVKA 2JA2A 1SIWA 3Q2KA 1BZYA 5E4FA 3NHUA 3RKUA 1QVZA 5DMHA 4F71A 1BJRE 3R09A 4ESEA 2ZWIA 3ZCPA 4EHFA 1P7CA 2IE0A 2RK3A 3LX6A 4B8ZA 4IFEA 2ZXUA 4Z2AA 1YK1A 3LP6A 3CZAA 1J00A 5LBIA 3CMMA 4UFNA 1GZ7A 2QN3A 5TF0A 1O87A 1USGA 4AZ3A 4CIXA 5GVSA 5HX7A 1IM8A 3T4PA 3NGLA 5EXDA 2AI3A 3WJ7A 4QVKA 4FFPA 4MV9A 3IMKA 4GOND 4YROA 4ASUA 2F00A 4TLMB 1DINA 4FUQA 1ZKMA 3UAZA 4IJ6A 2XYVA 3ORHA 4PQYA 3PHLA 4TTAA 2XJ9A 5KNCD 2G9VA 2E4ZA 2UZ3A 3D6NB 2AH5A 1V3QE 3GRKA 4ID9A 3UHPA 4A6EA 1AMUA 3GDFA 4RA6A 4GRDA 3TZKA 4OI1A 2O8DA 4FMDF 1ATZA 1VI5A 4NATA 4DUGD 4E5MA 3FD8A 1GNQA 3R4VA 5JO9A 5C31A 5BNTA 4TS9A 5KCZA 1KHHA 1DCMA 3D4OA 2WIGA 3R7FA 2BT4A 2H65A 4DBLE 5GJBA 1Y1KE 4OGFA 2O8EB 4BNVA 4NMWA 4XYGA 2ZWVA 3AOGA 4IYRA 2IEZA 2RMKA 1JMYA 4J49A 4LXYA 4RNDB 4MUKA 2ZSIA 3DVAB 4TXLA 2EFGA 3UAWA 1HV8A 2IH5A 2Z2IA 4EH1A 1ZJJA 5ALJA 1E3EA 5B12A 4QJ5A 2WZBA 2Q5LA 1XXLA 3G2NA 2BR4A 5KTKA 1ZR2A 5EZ6B 4TKUB 5JI2E 3ZJTA 2XHZA 3CZPA 3IO3A 1QE0A 3P45A 4WI1A 4ZT5A 1UXIA 4OOFA 1T9GR 2QP3A 1Z82A 5CIQA 1CZRA 4WNAA 4X8LA 2Y76A 1GKYA 5DGDA 4ASUD 3BN3A 4X71A 1KP3A 4RU1A 4TKLA 2CFOA 1NVMB 5JNVA 1U7DA 3CX4A 1Z7EA 5B5SA 2JLQA 1NBMD 3HYRA 1SUFA 3D4BA 3T1VA 1Y5LA 4LOHA 2BEWB 5DLPA 4PC6A 2KX7A 1BCSA 1FXWF 3G1TA 4QX6A 2O0LA 1DRVA 2IS2A 3X1YA 1NVVQ 3P19A 4HGNA 4URUR 4NPAA 3SHQA 3ZU2A 3GYGA 4IPTA 2XGMA 3AR6A 3K53A 4B3HA 4EQ6B 1F8YA 2E4UA 1E9VA 3FB4A 1QV7A 5U9CA 1VZ2A 3H5VA 1NJ2A 2YJ4A 4D6YA 1GYQA 2WA2A 3O1JC 4NDZA 2IYSA 3CT4A 1DC6A 3TI9A 4GQIA 1QP7A 1IBLB 1POWA 1FUKA 3ZK9A 4QHSA 1IEVA 1AQIA 1N5LA 3C5WP 1CUAA 2JJMA 2W2LD 4OVKA 5FHRA 2Y1FA 1EG7A 3AETA 3FSRA 2WIJA 4GR5A 4IXDA 4C3OB 4BMSA 1C3JA 1WB6A 3W5JA 1WCIA 1XP8A 2E85A 4JSTA 2O0KA 1E1NA 3J80A 4F04A 4FUTA 3KZNA 4NJEA 4U2DA 4AS2A 4YCJA 3JALB 1VIDA 3EEFA 3HUDA 2CF6A 1P2BA 4D4GA 1I3MA 1JJFA 4OLHA 2L82A 2D2FA 1LTKA 5EQFA 5AW2A 3K9FC 2I3ZA 3I1IA 1CEXA 1W75A 1DO0A 4KHPB 1U7UA 2QYSA 2ZJ5A 2WWTA 4AQDA 2Q1SA 2LRHA 2X23A 3CYFA 4LRQA 4BCDA 4RL6A 1P1RA 1YDFA 2X15A 1BSVA 3PEEA 4HV4A 1XKTA 5JXWA 4JJ4A 5HKOA 4S0XA 4EO4A 1TUBB 3IAAA 2F8LA 2GBCA 5LZ8A 3TEFA 3HJNA 4ZYVA 3HB0A 4UE6A 4KGVA 2FF5A 5DH9A 2WY2D 4YH1A 3ZY5A 3EXAA 2ZAGA 3C3DA 4NKRA 2B99A 2DFTA 3F6PA 2O5CA 4RHCA 2XQFA 3EHEA 1L3CA 4MVJH 3UMYA 1Z2DA 3HGTA 3VQTA 2NADA 1Z22A 5FOVA 2RJ3A 5JDCA 3NT5A 2ZRHA 3DLIA 3LZ6A 2PV7A 3EF3A 2RHLA 1D0SA 1ZZGA 2WF7A 4ADSG 1C0KA 3A6LA 4C03A 2VPWA 5K0BA 4CEIA 3I9LA 4UUQA 4O4JF 3U3DA 1JTEA 3FMFA 4D96A 1QORA 3O0TA 3SXJA 1GTMA 2R68A 3IPXA 2B1GA 3WGYA 4MLDA 4N9WA 1IXKA 2K7FA 3OE1A 3DO6A 2W6JD 3IEPA 1IBCA 4Q3KA 4PGAA 5NULA 4Z9YA 5ALZA 2XDWA 1K4KA 1TZJA 2PZEA 3NVAA 4NBUA 1H0SA 4JI8B 4CMBA 5C32A 4EHAA 3VZRA 3L7CA 5FIUA 1YZYA 3UB2A 2P0YA 4MVJE 3I0ZA 4PHFA 3G2LA 2HIGA 3GEIA 5J47A 1MXFA 4LOJA 5ABPA 2OBFA 1MW8X 5B7NA 1RC8A 1N6NA 1O6BA 4KUHA 1M0WA 4AL4A 4C43A 2FRVA 1C3VA 1GLVA 2KJQA 2XWSA 1FQJA 5HE8A 4ZRNA 3PPWA 4B1FA 2VXYA 1NM5C 2YYSA 5HE9A 3KEQA 4IOLA 4CNQA 2OGSA 1TUIA 1WMAA 1ZCZA 1J22A 1WTAA 3PX3A 5HOQA 1DJNA 1EB8A 3PRKE 1SULA 1IZZA 2DZDA 1LTQA 2DQZA 2NNWB 4Z86A 4KC0A 4FCWA 1DCKA 4DWWA 2R7AA 4BFWA 1XAHA 3WQBA 5FRDA 4OA5A 1DUIA 3JQEA 2ASEA 2PT7A 3WB9A 4TTPA 3O03A 1WPXA 3GLUA 4NZ9A 3UMSA 3IEUA 2WM3A 2QRVB 2GK4A 2JZNA 3UUWA 1B26A 1F6DA 4IDHA 4YCDA 1WD5A 2V45A 4HGZA 4X5OA 5BMVB 4KXNA 3M6XA 3LS2A 4WY5A 1T8RA 1C7ZA 2Z6VA 4RCVA 4NTZA 5FJJA 5BN4A 5K20A 4Z1MA 1TKBA 3BXZA 1X0VA 2Y0CA 3M3PA 1FMFA 2OD7A 2W4QA 3IMGA 4DOMA 3KTFA 4JFRA 1TLFA 4N9QA 3U44A 4OJQA 3AOEA 1QB7A 3BMQA 4YJ3A 4ZCRA 1YZLA 5G0VA 5EESA 5EJ8A 2OEPA 3I12A 3MQFA 4WOJA 1GV1A 4W7HA 3DW3X 4ZN6A 3RV3A 5EI5A 1ZLXA 4HGYA 2GBLC 3MIIA 5BV1A 4N39A 1COWD 2AMYA 2JAOA 3EBOA 3RSFA 1OGYA 1IAQA 3H2HA 1KR2A 4E70A 4B3GA 4DEXA 1BTOA 2D8AA 4LZOA 10MHA 5I51A 3RJZA 1VXOA 3INNA 3W34A 3GD7A 4DIUA 1BS2A 4P4SB 4YWJA 4ZVTA 1J0DA 2EG5A 3C5VA 3D8UA 1TYEB 4MRMA 3N75A 2QA5A 5E0KB 1F2UB 3BTOA 1W0KD 2BEUA 4QBKA 5GV7A 5E95A 2FSGA 2QIPA 2XTAA 1GG9A 4AO6A 3RR2A 2CN1A 3VKUA 2EKQA 4CKBA 1BYUA 1UBSB 1ULHA 2IVFA 2P0AA 4DM3A 2ZRNA 5KYTA 3PYXA 4HDMA 3DM5A 1GZ6A 2IYLD 3PBKA 2Q5CA 5BOSB 1U9IA 2AZMA 3PG5A 3CKLA 9ABPA 1GOTA 1KQPA 1YZ3A 1EFPB 1G0OA 2BFFA 1LX6A 1SVSA 1ZGBA 1OLOA 3OLXA 5TGDA 5LWHA 2OENG 2VWGA 1OAAA 1XQYA 1Y7PA 3DV0B 5EINA 5CHEA 3LFHA 2WVGA 2QSZA 1HSZA 5KOYA 2Z4TA 1RWQA 1W5FA 1RYEA 3A0UA 4L2IA 1MB0A 2CD7A 3O92A 4KK3A 5EWLB 1M83A 1OFUX 4OQPA 4EA6A 1NXTA 1ZWLA 2UXCB 2NU7B 2A7QA 1XROA 2J0UB 4HH1A 3ZY4A 3N2KA 1HNWB 2CLKB 2GWHA 4RADA 5I48A 1RPTA 4L72A 4MDYA 4CJXA 1QZ3A 1WPRA 4N5DA 4QRDA 5FLYA 3QLVC 4DR5B 3OZEA 2GNPA 4E94A 2HJGA 3NZEA 3T7CA 3ZWCA 2ZTMA 1W48A 4LTDA 1Z8HA 1PZEA 3KEFA 3OFVA 1M6HA 4AX8A 4QTYA 3NFRA 3BGWA 4Y1EA 4ESHA 4HAUA 2JGJA 1GQQA 1QLJA 3JQ6A 2EARA 2ZVJA 4H9GA 2GTIA 5EPEA 1N34B 5CNIA 3HYSA 5TV2A 2CF5A 4Q34A 1XELA 4ZIRA 2G4LA 2EZ9A 4O4JB 4NPHA 2NXNA 3GRPA 3NHKA 4I8XA 4EAQA 1QYRA 2A59A 4R40A 2PL5A 4GWLA 3SVZA 3EG9A 3B12A 4DMGA 5DTJA 4QYTA 5BT9A 1XZLA 4QUGA 1U0RA 2XA2A 2H00A 3ZEIA 5B6JA 3LUGA 4ND2A 3FMPB 3QELA 4NQZA 2HM7A 5KJ6A 3MMZA 4U2BA 4DCPA 1ODIA 1WMFA 1DZIA 1P0MA 3TLXA 3EYAA 2CXTA 4OU4A 3FRHA 1KDRA 4KBGA 4JIGA 4GP7A 1F4VA 2P7HA 1FE8A 2WOJA 4INAA 4Q3OA 3W79A 2X2FA 5FTLA 3LLCA 3GARA 3PRHA 1W1WA 8LDHA 1H2RS 1V8FA 1CUSA 1MNAA 4Q9NA 5FUVA 2PZ8A 5B53A 3WHLA 4M86A 2ZUDA 1C9JA 2Y66A 1WA5A 1GPWB 2JA1A 3F5DA 1FJXA 1Q16A 4UEJA 4ZQHA 2A5GA 2BTOA 3M49A 1FS5A 1J97A 1WUYA 4MS3A 1KZ7B 2ZIXB 3LYAA 2X0DA 4MS4A 1RQNA 2HK8A 4G1EB 2OE2A 3Q1LA 4LJLA 3GFBA 5AM1A 4J0CA 5D86A 1WG8A 2IHVA 1ANKA 2BMWA 3LSTA 3Q12A 1QKJA 3QGMA 4JKIA 3FRJA 4KG7A 3R75A 3REQB 4BB6A 4EJ0A 3IUSA 2UUPA 1S3FA 3DOFA 4NCHA 5CLFA 5FLXA 3CINA 3KYCA 3OWXA 3EEIA 1PJBA 3BORA 3WDLA 4RVHA 1QF9A 4G5RA 2WAMA 1W581 3DMYA 1E79D 1OV6A 1RWNA 3DYBA 1PTJA 5CA0F 3FPFA 2Q28A 3DAHA 4AG3A 1SKYB 3MD9A 2C07A 4MIYA 1L7DA 2WWWA 1AKTA 5IUKC 3TRJA 1WWKA 1KFBB 3NG1A 5EMMA 1EWYA 1F6WA 1W6RA 3NWJA 2GBGA 3L07A 3IBFA 5MN5A 1AUVA 1SK9A 1DHRA 2GS9A 2ZJ7A 3AVQA 3LC2O 3FSJX 5CNMA 4CEHB 3ABOB 2FP4B 1MG5A 2V96A 1T2DA 4MVJG 4D4LA 4LYHA 1C9EA 2GESA 1QAOA 4YRFA 4UBNA 5B58T 4MEBA 4JC0A 4PLHA 2XMDA 2FZGA 4URFA 1N2JA 3OZWA 1ABBA 3FF1A 4O02B 2PUBA 2JLSA 4LMPA 3VSCA 4JAVC 1L5NA 1RHQA 4ZCMA 4TLDA 5A3QA 2IYRA 2JF0A 2ZW9A 1UFVA 3RUCA 2HV8A 4P22A 2JZCA 4KPUA 2ZS7A 3EN0A 3MAAC 2FW8A 1U8CB 2AKAB 2GN0A 3FKSD 4UBLA 3RJTA 1JVSA 2BBTA 3BCRA 1GAJA 3TW4A 3RRFA 1R6XA 1VGVA 3IPRA 3NB0A 4LDQA 4C6HA 4DLLA 3L4KA 2XGGA 4PGMA 4DQKA 3M4JA 4R1QA 3RSGA 4DZRA 1BMFD 4FILA 3ZU6A 1PDOA 1YL5A 4ZZIA 3RVJA 2IEAA 1X7ZB 5BV7A 3NBZC 3ROZA 5LB2A 5AM0A 3KUKA 1MENA 1IHOA 1V71A 1EFCA 3ABZA 3AGQA 1WUIS 4QEZA 2CBXA 5THKA 1SXJE 2YFYA 3NYQA 3I2FA 4V24A 1CB0A 5JAQA 2VZLA 2W43A 4MO2A 4MS3B 2DHQA 3JQBC 1C7IA 4MDFA 1RRGA 4YMWA 3ZHQA 1BCRB 3T7RA 5BR4A 3SJAA 1UK6A 5JCOC 2HGSA 4PYIA 1I2AA 4ARBA 1HKHA 5F52A 5SICE 5HOEA 3R9XA 3MJTA 1P74A 5I9TA 2DY1A 2GFQA 1DLJA 4S35A 1C4WA 2WJ3A 3H1EA 1V5GA 3BGSA 4V0OA 3LRTA 3PYMA 1GU1A 3R7WA 3TQSA 4EMTA 5GZ3A 3RFVA 1ZCAA 4PFSA 1GZ4A 5E9AA 1A8HA 2CNDA 2G9NA 4FKZA 1UPCA 5JJKA 3HO6A 1QFYA 1S01A 1YUNA 2CDBA 2GD6A 3IEVA 5D5HA 3M83A 2AIRA 3IIKA 5A5VA 4GRIA 3IH5A 1ZFNA 1WXHA 4I4LA 2QTBA 4NE2A 2FR8C 2NSLA 1NJGA 3U40A 4F93B 3G7UA 3KOXA 3JQQA 2VDNB 3BHJA 3IP1A 4C2UA 1VHDA 3CE9A 3QYPA 4O4JA 1OWOA 2AC7A 4C0QC 4ENSA 1EDDA 2ZK7A 3T1YB 1SOUA 3OJFA 5A3JA 3WYEA 4FFOA 4J0QA 1TCAA 3LUJA 1GG5A 4KRYA 1J8VA 4UBJA 4EK9A 1XPOA 2LE0A 4GGOA 4JQOA 4URHA 2GARA 4K9QA 2QMHA 4UHHA 1F4LA 1Y98A 1KO5A 1XNJA 4GWKA 1UDBA 2X5OA 4TTTS 5TARA 5JV5A 4TTJA 1DXHA 1AU9A 4RXMA 5DLEA 1N9GA 1RAFA 3ISJA 1PDWA 3KL2A 3Q7PA 4NULA 2JEOA 5E2IA 3GVHA 4F3NA 2QQ0A 3HY6A 2AHRA 2GPYA 2J0UA 1NP3A 2AMJA 2O7RA 1OZGA 3ZIUA 2CFTA 3I6ZA 4AJ4A 4BECA 4B4VA 4I6JA 4W6ZA 2QQFA 3S68A 4AY2A 2R1VB 4MZDA 3MTGA 1R1DA 1TM4E 1MHPA 2VEDA 3HRKA 2BI8A 1Z4MA 3UH1A 1ZLYA 1EJ6A 2PL9A 5C37A 1E5XA 3DAOA 1PYOA 1EFPA 1TMYA 3QE2A 5GWXA 1LB1B 5LXTA 2FN8A 2PUJA 4EPRA 4KKXB 3NNSA 1KQGA 3DBOB 5BOSA 2MSEB 2X4GA 4KXFB 4UXHA 4X1OA 2INGX 4MVYA 4H7IA 4HEQA 4WX2B 4C4YA 4C4OA 1GP2A 3HV2A 4QFCA 2WG1A 4NBNA 3K0CA 3RWBA 1X14A 1W47A 3RTDA 2NYAA 4FK8A 1W2HA 3B1XA 4R1LA 1NQXA 4F56A 1UBTS 4HUTA 5EIBC 1NSYA 2WIBA 2XB4A 5CJPA 3PLAE 1QZUA 3ZE9A 5ALMA 3CSDA 2R84A 3G6KA 3L9XA 5KYNA 4NNJA