4R2WA

X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
243
Chain Sequence
b'ADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAACVAGVIVNRTQQEIPEVSAVSIVVAAAKKLLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title High-syn conformation of uridine and asymmetry of the hexameric molecule revealed in the high-resolution structures of Shewanella oneidensis MR-1 uridine phosphorylase in the free form and in complex with uridine.
pubmed doi rcsb
source organism Shewanella oneidensis mr-1
molecule tags Transferase
total genus 85
structure length 243
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r2wA00
1JDVA 4GKAA 3EEIA 3ENZA 5F73A 1N3IA 5KB3A 1V3QE 4L5CA 3GGSA 1Z5PA 1PK7A 4WKBA 2OXFA 4NS1A 3D1VA 1JPVA 3BGSA 4G41A 3DP9A 1ODKA 5EFOA 1K3FA 1ZOSA 4TTIA 2A0YA 4DA0A 3ONVA 3QPBA 1JE1A 4TTJA 4NSNA 3K8QA 4R2WA 1RYZA 1NC1A 1Z38A 1VMKA 5C80A 3OZCA 3DDOA 1WTAA 1TGVA 4L6IA 5I3CA 4BMZA 3O6VA 3T94A 1G2OA 3P0FA 4YO8A 1OUMA 1RXYA 4DANA 1ODJA 1T8WA 5B7PA 4P54A 4MCIA 2HWUA 1RXSA 2AI1A 4R2XA 3NM4A 5F77A 4WKOA 2A0XA 4QATA 1A9OA 5F7ZA 1B8NA 1Z35A 2ON6A 5F7JA 5B7GA 3OOEA 4IP0A 1NC3A 1JE0A 3DPSA 1RT9A 1NW4A 4YJKA 3KHSA 5FAKA 2A0WA 1JDSA 2OC4A 3KU4A 1Y6RA 1Z39A 2HSWA 4OY3A 1PR1A 1Y1RA 1QE5A 1Y6QA 3UAYA 2GUWA 3KVRA 1V41E 3DJFA 2XRFA 2HRDA 1PF7E 3PNSA 5CYFA 3TL6A 3EUFA 3OCCA 1K9SA 1FXUA 2H8GA 1PR4A 3LGSA 4DA7A 3OOHA 4BN0A 4K6OA 3OZDA 1A69A 3EUEA 1RCTE 1SD2A 1A9RA 3E9ZA 5F76A 1Z34A 1XE3A 1Z5NA 4TXJA 1PK9A 5F7XA 1RXCA 1LX7A 2I8AA 1PR6A 4R31A 1A9PA 4EARA 1RXUA 1T8YA 1CB0A 1Q1GA 1U1FA 1Y1SA 2Q7OE 1U1DA 4G89A 3DF9A 3OZBA 4ECEA 4WKCA 1PWYE 4BMYA 3LBAA 4QEZA 4KN5A 3C74A 1PR5A 1ULBA 4TXNA 4M3NA 4MCHA 5EPUA 4E1VA 1ODIA 2QPLA 5CXQA 1VHJA 1OU4A 1LVUA 1Z33A 3FOWA 4TS9A 1RR6A 2HN9A 1JDUA 4MARA 2IQ5A 4DAOA 3IOMA 1M73E 1OV6A 3LA8A 3UAVA 4U2KA 3E9RA 1OTXA 1OVGA 4NY1A 1PR2A 4WKPA 1C3XA 4DA8A 2I4TA 4D8VA 4F3KA 4LZWA 4M7WA 3KVVA 4YMLA 1JDZA 1YQUA 1RFGE 5B7NA 4OGKA 5IU6A 3ODGA 1T8SA 1PBNA 2P4SA 4TXMA 4TS3A 4LKRA 4D8XA 4DARA 1VFNA 4DAEA 3UAXA 1TD1A 1SD1A 1TCUA 4LNHA 3UT6A 4WKNA 1ZL2A 1ODLA 3OPVA 5CXSA 4G8JA 3F8WA 5IFKA 5ETJA 4RJ2A 1T8RA 5F7OA 1YRYE 4PR3A 4TTAA 1U1CA 4QFBA 3BSFA 3IEXA 1T0UA 1Z36A 4H1TA 3BJEA 3UAZA 1V45E 2B94A 2QTTA 1A9SA 4F2PA 3SCZA 3FWPA 4M1EA 4QASA 3MMSA 4QARA 5CYGA 5K1ZA 4FFSA 5CCEA 1V48A 3MB8A 3O4VA 4JP5A 3U40A 3PNPA 5EUBA 1I80A 1A9TA 4TYMA 3KUKA 4TXLA 1YQQA 5B7QA 1Z5OA 1YR3A 3NM6B 4OEHA 4PNPA 1SQ6A 4OJTA 4JOSA 4D9HA 1JDTA 1PKEA 4QAQA 2OECA 1ECPA 4D8YA 4OGLA 2AI2A 2QSUA 4GMHA 4F1WA 1CG6A 3OZEA 4BMXA 1K27A 4F3CA 1PR0A 2ISCA 3UAWA 1YBFA 3FB1A 2QDKA 3NBQA 2QTGA 2AC7A 2AI3A 1A9QA 3FAZA 1ULAA 1Y1QA 4TXHA 4UC0A 4OF4A 4I2VA 4X24A 1TCVA 1U1EA 3KVYA 3OF3A 1RSZA 4DA6A 3PHBE 3E0QA 4D98A 1LV8A 5CCDA 2A8YA 3PHCA 3FNQA 1B8OA 3FUCA 3P0EA 2OC9A 3INYA 3EMVA 4L0MA 4LDNA 1V4NA 1TGYA 3K8OE 1V2HE 1Z37A 5DK6A 2RJ3A 4DABA 1PW7A 3NM5A 4LNAA 1OTYA 1JYSA 1U1GA 1JP7A 1SJ9A 4EB8A 1VHWA 2BSXA 5F78A 4GLFA 4JWTA 4L5AA 4GLJA 3GB9A 4L5YA 1Y1TA 3BL6A 4YNBA 5JPCA 2PGAA 4F2WA
chains in the Genus database with same CATH superfamily
3GZTB 3U3MA 4HXGA 5L4NA 1LVGA 1I2BA 3AWDA 1D1QA 3TLGB 3THOA 2GAFA 4B32A 4JP1A 4AJIA 3UPDA 2BBTA 3I0ZA 3CX7A 4OQEA 3PXGA 1HE5A 2YFKA 1SBCA 3KUXA 3ZCPA 3NDRA 2H2FA 3TECE 3ZTWA 1KR5A 4YGXB 1ODSA 3ZTTA 4ZK6A 5JI2E 4MGEA 2IDZA 5HR5A 3FZQA 3TQRA 2OMKA 2POCA 4YDHB 1BD4A 1NI4B 1RWMA 2VSYA 3ISJA 2GAAA 4LFAB 1P7VA 2EQ5A 5C53B 1ZC3A 1WULS 4IDAA 1RBYA 1VGQA 4X9XA 3SS8A 3EXEA 2D62A 2QS9A 5HQTA 3RYCA 2QZZA 4HDSA 2WUDA 1GPWB 2IYTA 1I24A 3NFRA 3DW3X 2C2ZA 4FD3A 3WLEA 4NLLA 3S27A 1TM7E 4RZUA 3ZI4A 5EHZA 1DARA 4LJYA 3RBXA 1KBOA 7GPBA 2HX1A 4IIEA 2C42A 1JW9B 3AEQA 1EK5A 5G53C 2NO9A 5I47A 1DJNA 1ZUWA 3K94A 4TTIA 1VA5A 5DLEA 4OX9B 3VO8A 3DL2A 1WSDA 3FWYA 4UFNA 3F9CA 3ZW8A 4Q4AB 2NVWA 3N0TA 3RWBA 1RYZA 2DT8A 4ZAVA 2A9VA 4MMYB 2AJDA 1N3BA 4INOA 2PL1A 3D7RA 5D5PA 4RENA 1QR6A 1P2FA 2VJNA 4Y2QA 4KQJA 5CH3A 1M33A 3UXHA 2ZKLA 2JIZD 4KMRA 1AS0A 1L5LA 4RVSA 1USKA 2GFIA 5M5BA 3VZCA 2IYEA 3BZWA 2Q9UA 1AQYA 4J94A 5IDXA 1I5OA 1TTHA 2IPNA 3MWDB 4I1RA 5KX5A 1DXYA 1NW7A 2GHIA 2P5TB 5FO0A 1G3RA 4PSCA 3LCVB 1VDMA 3T1QA 3UMBA 1JBKA 3K2BA 1XELA 3FXAA 1TJ3A 1PWHA 2ZANA 5JNSA 4Y6GB 5ALOA 3ST7A 4EG8A 2XBLA 5M7EA 2VZ0A 2KS6A 1AV7A 1II9A 1CC1S 1LDMA 1NM5C 2AI1A 2Q5QA 2QT9A 2DR3A 1RJFA 4QBTA 4O4LF 4B3TB 2A0XA 2FPGA 5AK3A 3PDHA 2BCJQ 4NEQA 5LWHA 1WB5A 1VJDA 4AK9A 1GUZA 2NO4A 5BV7A 3DGEC 3GRUA 1WHTB 3FPHA 1NXSA 221PA 3KAPA 1OR8A 2GD0A 2C2KA 1DV2A 5FTJA 4CGZA 4IWNA 2BHNA 2QL7A 1NYTA 2XMRA 3HVHA 3ZTYA 5SY4A 3BERA 4BMVA 4ZDJA 6Q21A 5LKAA 4CM9D 3ETJA 3R75A 1AK2A 2AW5A 3WDKA 4MVYA 3WL4A 2VAPA 3OIYA 3QMPA 3CJTA 4C05A 4BO0A 2IY9A 4I14A 1RT9A 4W6ZA 3AV0B 3WGKA 4EG3A 3P2IA 4D4JA 3VR6H 1EM8B 4BNTA 4B0PA 2FMIA 2IYXA 3VVBA 1BWRA 4X84A 4GI3A 1KFBB 2HO4A 1HY3A 3SNHA 3WYEA 3ZHRA 4O8ZA 4G81A 4GX5A 1E3JA 1OLUB 2NU9A 4BVFA 2UUCB 3A4LA 1GT6A 2MDTA 2OUKA 1JVBA 4JEHA 3RLIA 4CLOA 2ODQA 5K3OA 1PBTA 3KQWA 2VP6A 3E4CA 2DR2A 2P6MA 1XHLA 1EJ2A 2HSJA 2I76A 1QS0B 2RH9B 5CX4A 3KEQA 3OQ6A 1S8FA 1DE0A 4G9BA 4PG4A 3NWBA 2JGDB 3I6YA 2Y1KA 3Q9SA 4IZ6A 5C51B 2FQXA 5CURA 1B26A 1C81A 1FNCA 1N5MA 5DBFA 5BW6B 2C2HA 5EJFA 4AIIA 3UK1A 1K2WA 3HA5A 5HNKA 2H8KA 3JARA 2FX5A 3LUPA 1AG9A 3MS7A 3WKAA 3UQZA 1J0XO 4MVJH 1X7YA 3C2QA 4UEKA 4XJVA 3N07A 5A7GA 2ZWOA 1OFUA 2YZ2A 1S6YA 3K0FB 2WSYB 3V1MA 1E9RA 3NV7A 4EA7A 3IS3A 3BMCB 5F23A 3PJRA 1ZSVA 4XCVA 1PQPA 3BULA 3M1IA 1E2GA 1JHOA 2XMSA 5I7AA 1Z7BA 3ABSB 4WVFA 3J80A 3P9PA 3PFKA 4GMKA 4EENA 1LWOA 2I66A 3LGSA 3G3EA 3WSWA 1Z0KA 1ZH6A 1O94C 4HDCA 4P7BA 4URFA 1KXJA 3DWEX 3WKCA 1L6IA 5CBKA 3GQBA 3DLBA 5AM3A 2ZJ3A 1NU8A 1W2WB 1WVGA 2OOKA 3MUEA 5I4CA 2HMUA 1OFVA 1E79A 2B99A 2JCYA 5C31A 2IP1A 2XT6A 1OH7A 1EDZA 4V0SA 1OX4B 1X9IA 1TVCA 3IA7A 5G3YA 5F76A 2FE1A 4EHAA 4O02B 1FRQA 4O2RA 4IOJA 4FYYA 3U3KA 3PPWA 3HKDA 4TN5A 3VR6D 5I7FA 1U3WA 3F6EX 4JYZA 1W34A 3NZEA 1USGA 2FLVA 1N8TA 2C20A 2QMYA 4FUTA 4UKDA 1ZSNA 1V26A 1KDZA 3I05A 3SZGA 2ZUEA 1I0LA 1HR0B 4RMJA 1RI1A 1TKBA 2FJUA 4C6RA 3BMOA 2CSXA 1ZUHA 1TJNA 5LP6A 4TV8A 3V9PA 3QYAA 1APBA 2GNOA 3E27A 3L1VA 3R0JA 4TPKA 1MIOB 5K0EA 5H3HA 5ICGA 2EQAA 3BD9A 1UJ2A 4LDRA 1JAHA 3A58B 3RKRA 2E4AA 4TYQA 4ZICA 4ZYWA 5J4HA 1AKEA 4B3SB 4MUNA 2PVCA 3AETB 4KV9A 4TL7A 4QYIA 5FIUA 1V7PC 4CCAA 2C07A 5B1DA 3MBKA 5K0FA 4ABTA 2HCJB 3G2LA 4BO4A 3DD1A 2MR6A 1JJIA 2HAEA 3OIDA 1AJEA 1EQUA 4MVJD 1BD3A 1Z83A 2NXEA 3Q3VA 1OD6A 3OLCX 4YB8A 2WY2D 2WIKA 3HHPA 4M54A 3WHIA 1P5RA 3H1EA 3L5KA 3NNDA 1IXKA 1JFFA 4K6FA 3FVWA 1QTNA 3ZDFA 3BMNB 5BSGA 1F7UA 2Q2OA 1IE3A 3UXMA 4Z49A 1ZD2P 2O2HA 2O1XA 1ECBA 3T5TA 3LIIA 1RAIA 1RM3A 4B8WA 3OESA 5BSFA 3O3MB 1M5UA 4B6OA 4PIMA 1N7GA 3C7CB 4CFSA 2VRBA 5K0ZA 3BRWA 2AH5A 3JQFA 5KSYA 1EI9A 1FSPA 1X1QA 2LNDA 5GQSA 2X8JA 3WRYA 3KUUA 3TOVA 4YRJA 4OHUA 4BGVA 4A1OA 2CT8A 1O8BA 4NPAA 1LCIA 2NAPA 5JG7A 1IN1A 4MI3A 4BNVA 2DLCX 4DJAA 1J6UA 4RVHA 3CZRA 1LVHA 2DAPA 3FDZA 3FAKA 1L5VA 4DNFA 2ZM6B 3EXFA 3WQBA 1NVMB 1HE4A 4OAPA 1BHO1 5GV8A 2IE8A 5SYMA 1SUCA 2Q5CA 3RREA 1DHTA 4F85A 4WXPA 2GD2A 2YDXA 1GPJA 3T7SA 1YL5A 4RJIA 1A76A 1OC2A 5ALJA 2E85A 3RC8A 1GRQA 3AXSA 2J5KA 3S7TA 1GILA 4R2HA 1RYYA 4EY3A 1EVEA 1H6AA 1N6OA 4MKZA 3QLJA 1PTJA 5E3JA 3EXAA 1LQ2A 3OTQA 4LZWA 3S29A 2PU7A 4ISBA 1NBMA 2P4QA 2ISQA 2R85A 2Y66A 2ZRHA 1M2VB 2HQ1A 1NKTA 4PVDA 5B1SA 4ASUA 5IRCD 3EFBA 3JVIA 5ALGA 1L6RA 1S2MA 1NIPA 2CCGA 4WD3A 3WBFA 3JQGB 4KIUA 3FTPA 4KPFC 2B5WA 2NXWA 2O7VA 2VSNA 5TS2A 4BHTA 1J7JA 1G55A 1VFPA 2EV9A 3LUCA 1C7IA 4S04A 3JW8A 4G1UC 1Z0JA 3W0LB 4D9EA 4XGKA 2AD1A 4XUGB 5DX0A 1IL0A 2DPGA 2QNIA 2ZTLA 4R3UC 3IESA 3NX4A 1ZM7A 4ZMSA 3CZ4A 3CF0A 1FZQA 4EHJA 2G04A 3IBYA 4GRIA 1IXSB 5DYWA 2BE9A 4Z3DA 1U6KA 2VBIA 2PLWA 1JEDA 4D9JA 3W7VA 5EZYF 5ITSA 2PGDA 3I3OA 4HQOA 3GFFA 1BC5A 4Q9NA 3A6JA 5EIOA 2I2WA 4ZI7F 5J2UA 1KO5A 2XQVA 5A03A 3WYFA 2NXNA 3A4NA 1LV7A 2HK6A 3CRRA 5BORA 4L75A 1FMFA 2ZVQX 4J0FA 3H9CA 1VP3A 1QANA 3KEGA 3HM9A 1Z0IA 4QQ8A 1N5KA 4NQRA 5ETJA 5FTWA 2FOIA 2OESA 3T7IA 3DCIA 4AJOA 4W9NA 1O95A 2FEMA 3NH6A 1JXAA 2AG8A 2JD0A 4XLTA 5EIXA 2D8MA 3ACDA 1PZMA 3LLSA 1WR8A 4ISCA 3TVDA 5DCUA 1RKUA 3HMQA 3K70B 3I37X 4L2IA 4A27A 1QNFA 3T3DA 3UC9A 4JT2A 121PA 3CSSA 1PZHA 5HZGA 3DBOB 3RRJA 4Y2VA 4LMBA 3BJEA 3W4JA 1LRJA 3U4MA 3DXXA 1JR4A 3ZD7A 1QDUA 1TCCA 4FHGA 4RV4A 4NARA 1PK8A 4CM6A 3CG0A 3W3AA 3VO2A 5MN5A 1JAXA 3ZU2A 4P0PB 5IKXA 2YWJA 2VJKA 3SVTA 4J2TA 2PNJA 2P3SA 1WPXA 3FWZA 2QMHA 3EIXA 5CNMA 3MLAA 2EW2A 1CUUA 1K63A 4GZMA 2OGUA 1ECLA 4P7FA 4D9MA 4L8YA 3A3OA 2WU0A 1CUVA 3FFTA 3STYA 4AP6A 2A1TR 2R6R1 3G49A 3U40A 1A95A 3JR7A 5LDHA 3RC3A 3AJ9A 4KAXA 1V9CA 2I3AA 4XUCA 5BSWA 1KIFA 4NYJR 3VYWA 1GQSA 1QWOA 2GCGA 3PI6A 2VNIA 2ZJ7A 5E8JA 2FEOA 4JMLA 4EQ6A 3ACBA 3B38A 3RW9A 5B3LA 3E22B 3UO8B 1C7EA 1JL3A 2NZJA 2SKDA 4FX2A 4OKNA 3I5YA 2D1SA 1AKYA 3EYAA 1MB4A 4GKBA 1N57A 5E9AA 3O03A 3HL4A 3LX5A 1CUEA 4G0VA 2IK8A 2RGWA 1PX2A 5KNDH 1GYQA 4US2R 4WZBE 3CFYA 2P9GA 4L5JA 4P36A 4DR7B 2ID4A 3TMKA 1JR6A 4PAOA 4I19A 5JBQA 1LLQA 3RUDA 4F9GA 2A7XA 1R0RE 3DUFB 4XYEA 3CISA 3EVDA 2VYNA 4G07A 4EMBA 5IT0A 1QZTA 2VLBA 1R8XA 3IQEA 5IM5A 4WGGA 2HCRA 3IKMB 1N0VC 4Z4QA 6ABPA 4AJNA 4HB2A 4LF7B 4OSPA 4Q7MB 4OFZA 1GV1A 3SSNA 2OK7A 1FQOA 1J09A 2B8NA 3E7XA 1Z5UA 3QHQA 1IEVA 4AXBA 4ND7A 4DSZA 1IMJA 1E96A 2R97A 3IP8A 5IC6A 3ND8A 3ROXA 3NBQA 4S0ZA 4EEZA 4E4RA 3IUMA 2JLQA 4GP6A 4KP7A 3NHUA 4E5PA 4LFBB 1RCUA 4FILA 1K2VN 2FH5B 2YWCA 3N3AC 3FBTA 1ZSYA 3MWEB 4ALMA 5AESA 4I1SA 2OWEA 4RACA 2EJBA 2PUFA 1RWKA 1P19A 1XQ9A 4P80A 3TNDA 3UA3A 1LBTA 1BE6A 1RJEA 4WKGA 4ZAWA 1NNEA 4AMZA 2HEGA 3NH9A 4FZ3A 4G85A 3PTLA 3AHHA 2Q29A 4C4ZA 3D64A 4DMHA 4Q9DA 1SC6A 2XKKA 5FTKA 1DBQA 3UJDA 3QKSA 4J0EA 3HNOA 3TSCA 4XJSA 3L5OA 1AUOA 4KJXA 3A6FA 3DBVO 1E64A 1EAYA 4CM1A 4YUZA 2FN7A 3DL7A 4ZK2A 2UZ4A 1D4AA 2I33A 3CKLA 1E6EA 3NFYA 3QBJA 4GPZA 3RSGA 3I8OA 2DPMA 3DVLA 1Q7GA 3IJEB 4QUIA 3M5DA 4Q4JA 3H3XA 3ZGLA 3H0KA 1M2JA 2HYDA 4EMTA 4BBAA 1RHQA 5BXYA 3PXEA 5KNDD 3S1LA 4ZA2A 5I7SA 4PRYA 1KZ4A 5JD5A 5K4HA 1Y7PA 4JOBA 4U9UA 3EIFA 5ALYA 4EYQA 3KSAC 2DEUA 3O3NB 2D6FA 3NVMB 2V0CA 4RXUA 4MWDA 3N2KA 1CUJA 1JP7A 2B0JA 4M86A 1KMQA 4ND6A 5F5LA 2NG1A 3CEPB 1F2DA 4JU9A 1JDNA 2PEYA 4DR5B 4DS3A 3JQEA 4IZHA 4XASA 4DZZA 4PY2A 1CEXA 4PTLA 1KYWA 3ORRA 2ZTMA 3AEUA 3CBQA 5DI3A 2GO7A 3OOWA 1IHUA 1P6XA 1XQ6A 2WKPA 3SMQA 2WAYA 5JU6A 4ENTA 1SKBA 2EJVA 1V8PA 4QOFA 2G88A 2NQ8A 3UJ3X 4GLOA 5LNK1 4W9MC 2ZBVA 3I4CA 2H18A 4A36A 3T15A 2V4MA 3PHHA 1GOTA 3TNFA 3BX1A 1IEQA 2VK8A 5A71A 4FHEA 4EPYA 5JQGF 2E82A 2JA2A 1SCIA 3QV2A 1J8DA 3DSRA 3ZCRA 1O9GA 4CQMD 4UPEA 1Q7CA 1KSFX 1Y9AA 2X19A 2Z4SA 3GB9A 1IIBA 4ZALA 4PGGA 1JU4A 3KYDA 4TTPA 2ZUUA 3SC6A 3VUFA 2PS9A 4ZZ3A 4FN5A 5C8XA 1U5AA 2XPCA 4UHFA 4JEUA 4GI5A 2OP0A 1B6GA 2B8JA 3ZWPA 4C14A 4U5XA 1ZOIA 2HCFA 4G1EB 1R4AA 2BGKA 4R2MA 5DX8A 3KHKA 3C3AA 3N6RA 4OQFA 1Q11A 3KQPA 3BDVA 4MV8A 1VYHA 1JFLA 2OT3B 1XVAA 4R83A 4DV6B 2DSNA 1K7YA 3DVQX 2VJCA 3KQSA 4FW9A 1W19A 3M5CA 3WQHA 1SIBE 1ADCA 1NMSA 3LWNA 4HAOA 2GYYA 3RB8A 1N2JA 1SHTX 1Y33E 2A58A 3TJRA 5A4DA 1E98A 2C7VA 1MDBA 4HLNA 4LV5B 3SQNA 2XVAA 3GDHA 4JI3B 5T3YA 4YYEA 1TT5A 5F73A 4M6WA 1GTJ1 3HWX1 1CZKA 1Q3HA 2NYRA 1X8JA 4F1JA 1QPZA 3T0FA 1T9ZA 3AM5A 3RRXA 3N2YA 3PE3A 5L40A 2GZ1A 2WWWA 3H6GA 1JGTA 3VYRB 2IYYA 1ORTA 2V54A 1Z5PA 1WZUA 5DHPA 1YAHA 2ZB3A 1NLYA 4E31A 2C58A 5BN3B 1JEYA 3NT2A 5CLIA 1JIIA 3R3WA 5I9SA 1P1IA 2VNHA 2XCRB 1EUQA 1DWPA 4F9EA 4ZTZB 1GAWA 3MGCA 1I2MA 5I9TA 4LYAA 3M6MD 4AY5A 5IUJC 4DIDA 1KDPA 1FVXA 3FPAA 1AKVA 4DA0A 2HV8A 1P6UA 1H2WA 1P7WA 4A0QA 1JWLA 1F60A 4X6YA 3U48A 2GASA 2WD8A 3M6XA 1N6HA 3WY9A 4D8UA 1IY1A 4RIEA 2O5EA 4WLUA 5TEVA 1IUKA 3SQOA 2O5CA 5EHIA 1P1CA 1UBOS 1NN5A 1WXEA 3CE9A 1Y8QB 4RSHA 2PZEA 3RHTA 4WESB 3NHJA 1XEXA 1X92A 3DFUA 4HAUA 3BT7A 4CIVA 1UBNA 1JZQA 1FSZA 2C2OA 2EGUA 1XTJA 3A05A 4AL4A 5K01A 4MWOA 4N7RA 5B6PA 4JLUA 3TB4A 3LVBA 5BV0A 2P4EA 3L6RA 5KNBH 1EFDN 4QWWA 2BGNA 2W6PA 2QY9A 3NU1A 4RZ2A 1E1NA 1YR1A 1ILEA 3FOEC 3HB9A 4CV2A 3ZV7A 1H5NA 1P18A 4DLYA 5CG1A 2HTEA 3WLIA 5DEIA 2HWUA 4UAJA 1FJHA 3K96A 1Z2DA 2IU3A 3CJQA 2PMCA 1WPGA 1DPGA 4DLBA 4WKOA 4DWJA 1T1SA 2JAXA 1LI4A 2WA1A 3G8CA 4MULA 4UXHA 3WJ2A 5IX8A 3CZ9A 2DHDA 2PZBA 4KHZA 4GQAA 4JYBA 4Y9DA 1D4ZA 5DTIA 3TUJC 4DTIA 4PZZA 4UZSA 5FA6A 1JZSA 5L4SA 2HU7A 4X3CA 4YJ3B 3TSOA 3F73A 4TWZA 1QO0D 2VP0A 3FRJA 3OPYI 1P60A 3VYUB 4KQ9A 3OO0A 1RE1A 1JUDA 2ZIVB 4RGVA 4IP0A 4AJ4A 2OG1A 3T5GA 1V3UA 3ETGA 2QE6A 1ZJ5A 3MAGA 3VJKA 1G21A 1JILA 1EK2A 5EJ8A 4LSGA 4PYIA 3VR5H 2OK8A 2OGZA 1SC3A 3GG2A 3SQLA 3GMDA 1M2FA 3O4GA 5D7NA 4BL5A 3TGPA 2FMTA 3IP1A 3AY6A 3ZY5A 2PUCA 2R6FA 3NTQA 4C6TA 3ZE1B 2QK4A 3HEAA 1C7JA 2CL0X 2G8LA 4JBXA 4LVUA 2WU3A 1PJTA 2YN4A 2WYUA 3FCAA 4JQSA 1KYVA 4P22A 1GT91 3HWRA 1BMDA 3BSSA 4ROTA 4U8GA 4D3ZA 2F55A 3BH6A 3LVRE 3LDFA 1CUDA 4B6QA 4EI9A 4TM8A 4NJMB 1Y6QA 4QECA 4GSYA 1T4GA 2DQZA 1PJZA 2PG3A 2Y05A 1JF8A 3KTDA 4G25A 3F5MA 3JATA 2CF5A 5FUMA 4FT4A 1OJ7A 3HCNA 1M9NA 3R9WA 3P0JA 2JAWA 4XEUA 4BECA 2OYCA 1WW3A 1CJKC 5KNBD 3O8RA 3AVWA 1ZGZA 4NAHA 5FWAA 5MN6A 4DG9A 3LZ6A 3FTCA 4TYPA 2PD4A 1DEOA 4R3WA 3IP9A 2PLNA 3EUFA 2WIBA 1L4NA 3U9SA 3T1TA 3R9XB 3VZDA 4NF2A 2CC2A 4Q9AA 2PMFA 1V5FA 1HLDA 2XXBA 1ZHFA 3LG2A 2BT4A 4BQSA 3NJ8A 1E1CB 3ROEA 3K4PA 3ZLVA 3TEJA 1GLVA 2D1RA 1R66A 3LD9A 3M3PA 1BVHA 5L3VA 2H1CA 1CUFA 4JNKA 1FUKA 3SM3A 2QTCA 3U0BA 2CV2A 1Q0TA 5DM2A 1E2KA 1TA0A 2ZR7A 3UFXA 4W5WA 5CW2A 1QP7A 1W4ZA 3QQ5A 2OZVA 4E5MA 1C4XA 2E5WA 4L5IA 2IZ6A 2QIPA 2CDBA 2XMDA 1JNXX 3HS3A 5FAXA 3RSOA 4D4KA 2I7XA 3L8EA 1BE1A 3I73A 3VR5D 4FOSA 3A1UA 1EJ6A 1T2DA 2P6NA 4EY7A 3NT5A 2FUKA 1OREA 2VDMB 4ZC1A 2MU1A 4GSKA 4P58A 2I5PO 4RKQA 3VNSA 4ILEA 1H1LA 3ZD9A 4YRRA 5IJ9A 3L04A 4JHLA 4Q19A 2WJGA 3REFA 3OD1A 2BI7A 2IOYA 2PFGA 3D5EA 5FOXA 2PFKA 3K7EA 1WF3A 2AYYA 3OHSX 3AR6A 1P91A 2HBQA 1KKMA 2KLBA 4RSMA 2A94A 3AUXA 2H7VA 3DFKA 4WTOA 1KHTA 2Y4OA 3EZFA 4FW8A 4ND8B 3HL0A 3P9NA 4UCFA 4XR4A 3B3GA 4MYTA 2CXQA 3QSGA 3L1IA 3ZPXA 2QRPA 2O7SA 3B6IA 4IF4A 5FQOA 4YAEA 1UJ5A 3X1WA 2ZAOA 1I2CA 2JFVA 1ISJA 2PUBA 3HLTA 3Q6NA 2O2CA 4HNAB 2X86A 2QAGA 2X1VA 2X7XA 3RGGA 5EQJB 3RSQA 1Z4LA 4ZCRA 3UJNA 1DHRA 1BH2A 1XPJA 5H70A 1RRCA 1E2UA 2ORYA 3OPQA 1Q3KA 3KJNA 3ZHYA 1SA0B 5FWXA 1BE0A 3WL5A 1QRAA 1ULBA 1BIFA 2JGFA 4Y6LA 4Y6SA 5ALUA 3EIWA 1XBTA 2F6RA 2GCOB 2PFSA 4IMRA 5A6SB 2JRCA 4ZYTA 5CXQA 2P30A 3ND5A 5L3QA 1V1MA 3UB2A 1KQOA 1VHJA 3B6JA 4ZPXA 4IDHA 1BQEA 3UJ6A 3V8MA 5M29A 3QW4B 1E60A 1YDHA 3EA4A 5CDHA 5LJIA 5BSEA 5AD1A 1L7AA 4CG3A 4JCCA 5C37A 1P0PA 2ADOA 4EG0A 2XMGA 2CMKA 2EKPA 3AP1A 2Q28A 3PC3A 1QRSA 4B3RB 4YT5A 3I39X 2IWRA 1NUHA 3WVNA 3F4KA 5EMNA 4DR2B 4QWMA 2QN9A 4L74A 2C95A 5AKZA 4MW6A 3H2YA 4ERNA 3VHXA 2HDHA 1W0CA 1X8LA 3A06A 3TLBA 4MDYA 1XEFA 1G8HA 2H00A 3KNZA 2H4HA 1YZYA 2Q6LA 3DMDA 3R77A 5BO5A 3UAVA 1ZJWA 3L4EA 4LJ8A 1DT3A 5FORA 3KFVA 4W7SA 4PHFA 2ERYA 2GZAA 1S9HA 3EEBA 3BCHA 2X9QA 1Z6GA 2ZJ6A 4IYJA 1VIYA 1XTPA 3MXTA 5AO9A 5JASA 4CMEA 1ZRNA 3WNCA 5KQSA 3T38A 1D2CA 2GUGA 1U28C 1UL1X 3M6FA 3LT5A 4ZGBA 2D3TA 4YJDA 3X3HA 1NMZA 3ZUGA 1C0KA 2AK3A 3AL0C 2W4QA 5CB8A 1G6OA 4YMLA 1K89A 6NULA 2RHLA 2FMKA 3NG1A 4UMVA 3LOQA 1QK3A 3TGLA 1XMIA 3K9CA 4OXIA 4MJXA 3D7LA 3ZWVA 1T26A 2B4YA 3PWZA 3UAOA 2GZRA 2CXOA 1EE1A 2NU6B 5CLQA 4Z7JA 5LWQA 5B6JA 1QVRA 1K8YB 4LZLA 1X14A 4GX2A 1DKUA 2BF7A 1KYTA 3GYGA 1QK5A 1G0NA 2SNIE 1YONA 3SYMA 3HJTA 2HK8A 4X66B 5HK9A 3W5AA 1D2MA 3U1BA 1LLUA 1P9OA 3TLEA 4AICA 2O05A 5JLJA 3TLZA 1NF3A 3EPRA 3M82A 5BQOA 4Z4GA 2W71A 5ALLA 2DPXA 2ZYUX 4CKWB 3H9JA 1VSBA 4JBYA 4QZVA 3QWIA 3FR8A 2CKMA 1YBHA 2GM4A 3ERCA 1H1DA 1KVQA 4PGMA 1KEPA 1KWGA 3U56A 1XYYA 5IJXA 4BVAA 1NN1A 1GPH1 2E89A 1OAOC 2JLBA 3ZDBA 5D3MB 5I01A 3D0KA 2F3TA 2IHUA 5FX2A 4YV2A 1NJFA 2C94A 1ZN9A 4X0EA 4BAGA 2YZ7A 4YRIA 4C87A 1DXHA 1TZMA 1YDWA 1ZGHA 1LNQA 1KYQA 4JXJA 3BEDA 3KHTA 1C1XB 3V8VA 1BVYF 1T5LA 2R8PA 4GOXA 2P6RA 3NI2A 1ZK0A 4L78A 2B8EA 4OV6B 3BE6A 2EL9A 4Y9RA 3O8DA 2WOJA 3HZOA 5A06A 3PEYA 4W7IA 2QYSA 1P9NA 2WKWA 1B0ZA 3H5LA 3ZJ4A 4JEMA 1GPMA 1NW8A 2WPDA 3G8DA 4KLCA 4QOEA 4R51A 4YLEA 1P44A 1R4NA 1RXEA 1SK8A 3DNMA 2Z08A 2W00A 1VM6A 1I8TA 3PBKA 4D9CA 3IEVA 2QN2A 1M6HA 2HA7A 5EQTA 4JHXA 3S0JA 1W1UA 2FMHA 2WSSD 3VMFA 3CCBA 2E3JA 2VTBB 2Q1XA 4J4BA 1GNVA 4LMPA 2YMQA 4BU1A 1VKJA 3HPQA 3O8LA 2R9VA 4CEJA 2W11A 3H8VA 5ENZA 3M4ZA 4UASA 1HDCA 1QSGA 1ZK3A 1SUIA 1YOVB 2J1LA 4OD0A 3SEFA 3WICA 1XD9A 3EGDB 3MB8A 5KHLB 1GNQA 4JP5A 5FFFA 4CRWB 3KYBA 1OT5A 3L0ZA 3ZDRA 1U9ZA 1B4DA 2O06A 2O3JA 2P91A 1Y6FA 4WLOA 2CV1A 4TYMA 1YJ8A 5BXQC 3UK6A 2AOXA 2PO5A 4X92A 2V8BA 4FJ1A 5IWAB 1RAGA 2Z30A 5JZVA 1II0A 1N8KA 1YQQA 3CUVA 3UHFA 4PAMA 1AHHA 2G7MC 1PR9A 1ZGJA 2C5AA 2CLLB 2XDQB 2BM9A 3PA6A 1W96A 3ZGOA 1CD5A 4GKJB 3RTEA 3ZV3A 1E3LA 3RU7A 5BOVA 2R62A 5T4BA 2BJWA 2YVUA 4DV1B 1M8KA 2H17A 3KOYA 4ZANA 7AT1A 2AK2A 3MIIA 3ANSA 4QJ5A 5E9QA 4Q01A 1RMTA 4N7MA 2O3TA 1VJTA 3Q0EA 1XPOA 4UU8A 4BVGA 4MW0A 1GFSA 5BNTA 1W49A 1OMOA 2VJAA 1KI6A 2YWGA 3ZY4A 3BPSA 3CT4A 3N58A 3OLQA 4LDAA 4D9HA 2IBTA 4KR2A 2H5JA 3E2IA 1GJRA 2HJHA 4KQ6A 4NCJA 4TMZA 2ZBFA 1CJUC 2PGLA 2GZ2A 1JHZA 2XB9A 1WZCA 1SO8A 3JSAA 2SKEA 3U7IA 2QSUA 3ZWDA 3O93A 2CXSA 2XD9A 5ISMA 4DLWA 3CLKA 1FQWA 1S8OA 5EIBC 2OY0A 1KDVA 4B3XA 1K27A 1TLLA 3B2EA 2FFJA 1JH8A 4MYCA 5FD8A 5ALRA 4RZ3A 4GWGA 2AMVA 3A04A 3L84A 4K87A 5KX5F 2HUNA 2NUPA 3JAKA 5ELLA 1RWXA 2IIPA 5DYYA 4JJ7A 1SIWA 1UOPA 2ERCA 3BE5A 4ZVPA 4KPYA 5A3RA 2O8DA 1Y1QA 1VLHA 4EG1A 5EXXA 2PKEA 1U0NA 4YS6A 1EXWA 1UOEA 2OV8A 2R68A 3I1YA 5JR3A 3K05A 1WA5A 2YXDA 4UNPA 3R0VA 521PA 5I9NA 3C8ZA 1I5RA 1T4CB 5ER6A 1U2RA 3GBVA 3OM8A 1UC8A 9LDTA 1D0SA 1PHPA 2YIMA 4GMGA 4M88A 3DP7A 4NPHA 4Q9KA 1I32A 4HQ6A 5LQRA 1YQDA 2YV1A 3P1JA 4JJIA 3OAAD 3CX3A 4IRUB 3T5CA 3NAMA 3MG9A 4OYLA 4YQZA 4OQDA 3RK1A 1H42A 2FRXA 3V42A 3E1KA 4P3PA 4YA6A 1TU4A 5KS2A 4L16A 4AXXA 1WY7A 3IR7A 2VK4A 1MOPA 1QF7A 4G24A 3QX7A 2RHTA 3K0KA 2VZLA 1DP4A 1S96A 1ZN8A 2HPHA 3AEKB 4IXDA 4OGGA 4N0MA 2VRCD 4LE2A 4MQMA 3Q2KA 4WMLA 4RK4A 3U4GA 3UAGA 4C9BA 3VNUA 3UFBA 3EULA 4MR8B 1K8XB 3G13A 2WWVD 3NNSA 1UPCA 4K6CA 1ZKDA 1GAQA 4FFVA 4H77A 1AVTA 3ZIUA 3A7DA 1J99A 4TSFD 3PWSA 4Z99A 4YRCA 3RKSA 1NMXA 2EKQA 4GNRA 3KYJB 4ZDWA 3TQSA 5IT5A 4R81A 3GW8A 3SX2A 4URHA 1LGYA 3VKUA 1Q6YA 3BVPA 3LUHA 4AS2A 3SF0A 3K72B 3T7RA 1G6Q1 5FUXA 1E62A 3I6MA 2HXSA 4OA8A 4A6EA 4FB4A 3L8DA 4R84A 2X76A 3V1YA 5DGCA 5B58C 1A1SA 3DDHA 3ETHA 4JBNA 3V4PB 3G8BA 1DAEA 2FSFA 4GFDA 1JDBC 3K4QA 2GN9A 2ZYHA 1CUBA 1WSBA 3UUFA 2DWUA 9MHTA 1C41A 1FSGA 2RHCA 3PXAA 3JQ9C 3CF6R 3V7WA 2CL7X 2CLOB 3E8SA 4GKAA 1N9GB 4K1LA 5DTMA 2ZJ2A 3EIQA 4K3VA 2CVZA 3P4UA 2FUNB 5LC1A 3LHDA 3CVVA 1JVNA 3V5NA 1JEJA 3DCYA 2BUCA 1FFXA 2QX6A 4DIUA 2HJGA 3MMPA 4IJKA 5CNIA 5IKMA 2V6BA 4HGPA 3BD6A 4PF1A 4CLEA 1ZRMA 5ITZA 3SHFA 1KI1A 2ZYRA 2H7CA 4N49A 3FFBA 3TJZA 1PFGA 1PNRA 1M7GA 2Y4NA 4EATA 2J3IA 2J6BA 5HF6A 5ADVA 1GRNA 3ZKWA 1JSZA 3G2HA 1SNYA 3LT2A 1VI6A 1PK7A 4L50A 1QJCA 1VGRA 3VRHA 3F6CA 3GJYA 1I6KA 4WACA 5FBLB 1JPVA 4H0NA 5EIHA 1G8MA 2C1EA 4DJDC 5LP6F 3OZSA 4HEHA 4IG4A 3GUYA 4JA2A 2R79A 2QLTA 2Q0XA 4DCTA 4X8MA 3QPBA 2DBZA 4M46A 4TTJA 2G40A 4MW7A 4WLEA 4FYHA 4NSNA 3RQSA 4YV1A 4MSUA 4KSCA 3EEOA 1ZEJA 2ZRCA 1TC1A 1WMAA 4DSAA 4CXMA 1V1RB 3B9BA 3GD5A 4HDRB 3FI9A 1PNVA 4WNAA 5ES3A 2OV3A 3DO8A 1R0YA 1UDWA 3ZW7A 1DAHA 3UHPA 3TUZC 1TGVA 3MQFA 1DIBA 3ESYA 3IT2A 4DCPA 1Y6ZA 2YWEA 1PZNA 3QG5A 4WGFA 2FR0A 4L6IA 4YN3A 2A9RA 4KZKA 1L5YA 2QN8A 4V2UA 4KQCA 3TAUA 3T94A 2QM8A 1URPA 3X1JA 3NBMA 3FHJA 4IRMA 2XYGA 3KJQA 4YFVA 3R7SA 1EP3B 5SYAA 5JALA 3MB5A 2C92A 3NIWA 2QM7A 4RIHA 4CTOA 4TTTS 2OMEA 5CB6A 9ATCA 2JCVA 1JIXA 3WDMA 1FW6A 1C0LA 4LXIA 3O9VA 3ZWXA 1FBTA 1VYUA 1RXSA 4R6XA 3QP9A 4PX5A 3KTFA 3T3NA 1VG1A 3UV3A 3H05A 3RHZA 1QPBA 3RUIA 2P75A 3DCNA 3MT0A 1QNLA 5FPHA 4F04A 1BRTA 2DWQA 3LP6A 4LTMA 2ZW9A 4V1CA 1ZH8A 2YUTA 4AG5A 4II2A 1CY6A 4JI1B 1VHLA 3GEBA 4KK4A 1JFTA 3EOAI 3JASB 3KLPX 3MGKA 3F7OA 5HF9A 3M3HA 1OXBB 1XUOA 3WGHA 1DRWA 4B31A 2O50A 5LDGA 4WUTA 4BWGA 5CGZA 3O3CA 4COKA 4TUYA 1E2BA 1U2EA 3C4JA 1F2TA 2QRZA 2QB5A 3SFTA 4KE8A 2H1IA 2LR0A 3QE2A 2BAGA 1X6VA 1DAOA 3DDZX 4ZXFA 2KE5A 1FDTA 3Q85A 1JFSA 8AT1A 4HSGA 1ODCA 2VDKB 2AZMA 2UYYA 1E1YA 4KIJA 2EZUA 3LPDA 4F5DA 5L6MB 2O4CA 3NHZA 1YRWA 4C3OB 4M7PA 3FZYA 4H7DA 4RHXA 5AVKA 4ZT6A 5HK8A 4C7VA 2VK1A 4RD6A 3WK9A 5B4VA 2II6A 1GDDA 1HOTA 4PRKA 5AVVA 1YS7A 4LK3A 1PQYA 1IATA 3STHA 1OX4A 2VPZA 3KJEA 2O20A 3MPUA 3KVRA 4RPKA 4TVOA 3TLMA 1Z88A 4TKVB 3M3DA 1W6RA 1KOGA 2AKYA 1J5PA 1XROA 3UXEA 1NTOA 3M0EA 4BLOA 1PFVA 3MWFA 4AROA 1FFCA 2Y68A 2C5EA 2J5BA 4NE2A 1FTGA 3BE4A 3OKCA 1KF0A 1PDVA 2BJHA 2POQX 1PF7E 1P62B 1QONA 1TTPB 2JC3A 3AB8A 2Q5OA 1UP6A 1PJBA 3DZKA 2CMGA 2J6CA 2RJOA 2Y71A 5E7MA 3S1SA 1YIOA 4KVZA 5F3DA 2E37A 4EUHA 2XMBA 1PFUA 2HTFA 1MIOA 2H9YA 3GQVA 4UHDA 4DCJA 4BO9A 4Z7QB 4CKEB 2AR7A 1KJIA 1J7KA 5U9CA 1WV1A 4F86A 5G40A 1DO8A 4CL0A 3R4VA 4DA7A 4B2YA 4D92A 1ZLXA 1T91A 2IEDA 5AI5A 1F12A 5JJ5A 1A69A 1XT6A 4JR1A 3COVA 4NG4A 1U8AA 3RVMA 4M1KA 4U2BA 2W2MA 4YDSA 5JNWA 4XWKA 1SD2A 3M81A 1GLGA 2CHQA 1M1YB 2NNWB 5LQKA 3K71B 2X5KO 1IOVA 3KXIA 4C0WA 3LSYA 1G8AA 3WK6A 2ZDQA 3Q7EA 4EFNA 3WV5A 4ZP1A 4N39A 1O97D 2PXCA 3IVMA 3NCTA 1HC7A 1TMOA 2M32A 5GIPE 5E3IA 2X4LA 3EWNA 1JJAA 1U81A 4EECA 2EC5A 1UODA 4W1PA 5FEUA 2I62A 4OUKX 5F7XA 5J2TA 2I8AA 5IYZF 4YPVA 4R31A 5A5VA 1E18A 3D7SA 2HK9A 1OE0A 5L4LA 4EARA 4JLSA 7MDHA 2JI6A 1SC9A 3KXLA 4M49A 1NVFA 3CUEF 5G2OA 4DLZA 2ZBUA 4EB3A 2YASA 3KEFA 4R1TA 3RVSA 1C8BA 3OZVA 2GTIA 4NR0A 4QM6A 4M0PA 3ICWA 1G3QA 1KPHA 4MVXA 4N9QA 4QUHA 3EGOA 4QDJA 2IYOA 1X0VA 2P90A 2Q3DA 4H6XA 2ZVPX 1SFRA 5CXXA 4ZT4A 3IT0A 3WB2A 4DPMA 3IAEA 4AZ3B 4Q3EA 3W79A 4OHVA 2V7QD 1G4AE 2LCFA 3FPFA 2V5UA 4HAVA 4JSTA 3SC4A 4E13A 1N0IA 3FUXA 2CNKA 2IUFA 4KGDA 4DQ0A 4QULA 3PNYA 3UMRA 2C78A 5C8YB 3I23A 2ORWA 2CJPA 4TXNA 4HXFB 2WDZA 3SXPA 2H2IA 4YP5A 2BGUA 4UTRA 1EB8A 5E4JA 4TLEA 4DLKA 1EUDA 4BIIA 1EFAA 2DR0A 5K09A 1T2AA 1G6HA 5MF6A 1M2VA 2Y67A 5IZCA 5A5GA 1XTZA 3VHQA 2TRSB 2YRXA 3HBMA 1BHSA 4Q24A 3MWKA 5MDHA 4EG5A 3LY8A 4F12A 4HV4A 3MQ2A 2V58A 2Q7XA 1RPTA 1KOFA 2ENWA 4DADA 3AFHA 3BGOS 4P32A 3CPEA 1TPZA 4G97A 2GN1A 4CFZA 3GLFB 1IOLA 3QPDA 4G23A 4OSEA 3V46A 4MHOA 4UM7A 5JAHA 1J2YA 2XRZA 1WCXA 3JALA 3D2AA 4II7A 1UFRA 4R9SA 1HT3A 2VWGA 4WKPA 3WBBA 2F2TA 1Z6TA 3AHIA 3KT6A 3QYPA 1EAMA 4IDDA 4JC4A 4U2DA 4RC9A 2EG9A 4UM9D 5KQMA 4C0HA 1UXHA 1JT9A 3I01A 4ZU3A 5CFPA 3NW9A 1WXXA 5J63A 1IU9A 4ZOLA 4BU0A 1J20A 4ZVVA 1GNPA 3ZDEA 2O8VA 1TW2A 1VIVA 4TQAA 4LSMA 2WNHA 4EGAA 4ZT2A 5FH9A 4RF2A 1Q6ZA 3ZCVA 4U7WA 5C9ZA 5I7HA 1YQUA 1Z62A 1KMHA 1J2EA 1N9KA 2D7DA 3E3MA 5ARBA 3A3PA 1XJWA 3LK6A 4D3SA 1XQYA 3KAJA 3BWBA 4Y9TA 4EUEA 5AH0A 2WJ6A 4QHTA 4HX9A 2VOJA 5DXJA 2O0LA 2I3ZA 3AZOA 3KJFA 4L4ZA 4U2FA 3V8BA 3EN0A 5AUOB 5SICE 1U2SA 2WEKA 3REOA 1WCYA 4PCAA 2GMWA 5TVGA 3EIUA 4G5GA 1M5RA 3VKHA 2VJOA 3MRVA 3RYTC 1Y9ZA 1FUEA 4EO4A 4NX2A 4X1IB 1Z06A 2AEJA 4RMHA 4XVRA 4F9TA 5BT9A 1I4DD 1W5SA 2A9KA 1JMKC 2C4HA 2IQIA 2J45A 2P9ZA 1Z45A 2QA5A 3AI1A 3IUEA 4MA5A 4WKNA 1RWOA 1OBOA 2D5LA 2O2DA 4ON9A 1ODLA 1U2PA 4R1NA 2ZTVA 3TLXA 4DUYB 1QIMA 3P9SA 1NDQA 2ECPA 2DUMA 1NY6A 4RYLA 4YJ2B 1CNEA 2VYVD 3CYFA 1KJ8A 3G85A 4EA9A 3F6YA 3ETLA 3VDMA 3SF8B 3DBLA 3K92A 1SWWA 4PU0A 5CK5A 5FNZA 3KK0A 3D3JA 1NR5A 1VBMA 3K32A 4R0MA 1V1JA 1PRYA 2Q2NA 4LXTA 3HN6A 4D0RA 2YXLA 2XW6A 1NNSA 2J7PA 4F38A 4OIFA 1DTEA 4AMBA 4E12A 4HPWA 2BZGA 2Q1TA 4HI0E 4FGKA 5A4FS 1EE9A 4OYRA 5KSPA 2IXTA 2H4YA 3EJ6A 5JYEA 2A4MA 4GPIB 4HXYA 3A1DA 2QTTA 1Z13A 2FEAA 4HS4A 4MRSA 1OROA 1QCCA 3IQFA 2I2BA 2O3QA 2D8AA 3DFFA 3IYLW 4CR7A 2QG9A 4MW5A 1ZD4A 4C04A 1Q12A 3UJ9A 3C5WP 1JT2A 1SCAA 4OJQA 4I4TA 4UUBA 3WDSA 4FN4A 4YMUA 4RXTA 3UMJA 3MHTA 2GF2A 1J5XA 1KWKA 3ZLJA 2QYHA 2BM8A 4N0EA 3KHUA 2Z2IA 2WT9A 2NU8B 3DV0A 4BVBA 4NHOA 1I80A 4IFBA 4QODA 5C8ZA 3SEAA 3SYLA 2BGMA 4ZKEA 1M0TA 1A7AA 3CRQA 5BSUA 3WDLA 2EKLA 2GHQA 1T9HA 2PZMA 4F2GA 1YUNA 5DKFA 2ONJA 3PZRA 1Z8FA 2BY4A 1IYZA 3FCXA 5IK2D 4FEEA 1KPIA 3FYSA 1Z17A 2F62A 1OIVA 2X9LA 3OM9A 5U4QA 4IIJF 5I9LA 2BTOA 3ROMA 1B14A 3EQ9A 4L3WA 4GM0A 3F78A 3MCTA 5IVHA 1U02A 1C3VA 1UF9A 3A4IA 3NTVA 1QV6A 2G25A 4CYMA 1FDRA 2J0EA 3P9RA 3I04M 1U0EA 2QKYA 3AGPA 4YWJA 1XRPA 3AUKA 5J5VA 4A0SA 4POAA 3VI3B 1J56A 4JN6B 4O8CA 4CGYA 2FR8C 1VRCA 2DT5A 4N82A 4GUDA 4RO0A 2P9CA 1X7ZA 2ZYVX 1PLLA 1KAEA 5IJWA 4RWEA 3TQTA 1R5NA 2BMDA 2VBGA 1BX1A 4FMDB 4IFTA 1TRKA 3KETA 2WSIA 3LI2A 2AX3A 2FV8A 2IHZA 2Y9PB 3FX2A 3I1JA 3NHYA 3PFBA 4HF7A 5F5NA 4FB5A 3HKEB 3IEIA 3OX3A 4GMHA 1SKUA 3VAYA 2XMCA 1RI4A 4WUVA 4BFLA 3IC5A 4BRWA 4DNQA 1I7SB 3IIMA 4FTWA 2VP3A 1GHTA 1VSTA 2ISCA 2J7KA 3HCBA 1G9SA 1HXHA 3OE7D 1XA0A 4G5XA 3UW3A 4BIMA 4EAAA 3SR0A 3IUSA 4ENPA 2XUPA 3PNVA 2PL5A 3X1YA 3A14A 4A16A 2G28A 2WUFA 5CLFA 4AWXA 3NS7A 4NCAA 5LDDC 2J3HA 1TDJA 3RRBA 1RS0A 1N6KA 3I3SR 4EELA 5HXAA 3PYMA 2ACEA 5KCMA 4KLAA 2OA0A 4RTPA 3JVVA 5ICEA 3I1IA 1L1EA 2OXCA 1SGWA 2G9UA 3NHMA 4GMFA 4OF4A 4QFMA 2KWIA 4UD6A 4F72A 1UBSB 4HYYA 1T6BY 2J4FA 3D6UA 1FMJA 3L9XA 4WNYA 1QH9A 3E70C 1XI2A 5HJ7A 1ECGA 1DIRA 3KL2A 3BK7A 3BRSA 3KQOA 3QLUC 3R20A 3PGLA 5GWXA 2JGNA 4BLTA 2BHTA 5ECWA 4F3YA 2G1AA 2AUMA 1UJNA 3ZU4A 5BPHA 3WLMA 5M2QA 3REGA 4B5KA 3EAGA 3A10A 4KO4S 1HRDA 3LX6A 3OLVA 3CJRA 2FQQA 4MS4B 3HNRA 3HUTA 3I64A 3NHKA 3PK0A 4ZO8A 1U0OC 2PH1A 2HREA 2PT5A 3WRVA 3K8OE 4NONA 3I0NA 4QO8A 5B64A 1EA7A 4Z51A 4GOMD 3RS0A 2GGSA 4MZXA 5DNUA 4FNMA 2XGSA 1EVLA 2EFDB 4OSOA 4FDUA 3WL8A 4V3CA 1YOBA 3U1TA 2BYTA 2IUEA 2XNDD 2FKAA 1GV0A 1UPFA 2HO5A 2WI8A 4NZYA 4OUDB 2NT4A 1M2WA 3IUPA 3B13B 1L4HA 2BGJA 2HKIA 1I13A 4GX0A 2ZWIA 4HYTA 3C7TA 4JQYA 5I4IA 5KNCA 1BX3A 3RE1A 5KJCA 3H04A 1B1CA 1YUBA 1R2QA 1Q22A 3DGFC 3IHKA 3LBNA 4IH4A 1TKCA 3U4AA 2FR1A 2J08A 5KYUB 4U2CA 4BKRA 1FP6A 1FU7A 4GX1A 5GADl 4NXMB 1EWTA 1KORA 4LXQA 4JWTA 4OOEA 5EIEA 1T5HX 2LTAA 1G0OA 5DNCA 2O2YA 4HQRA 4S3MA 3D7MA 3GLGE 5BN3A 3TK1A 1PL8A 1T0BA 1M6WA 1M34B 1FJGB 1GKUB 3VI4B 1PFWA 4CCSA 1K68A 1UADA 4YJGB 1SHLA 3B9QA 2W8BA 3VU3A 4AS3A 1JFRA 2HHHB 3ORFA 2FWPA 3UOGA 1U4SA 3GLIE 1EGHA 3K2QA 5DM4A 3DEIA 2OCGA 3QSYA 3U44B 1PP4A 3JU3A 3DAHA 3N86A 1VBNA 4WZ6A 1NJSA 5B1EA 1EFRD 1EVZA 4UHBA 4BUCA 1T2FA 5TX7A 2NAFA 4LGVA 2FWIA 3GEEA 1YL6A 3LC1O 4WESA 4AUMA 1CE8A 2B5VA 5DHAA 5KSZA 1NFQA 4MPRA 2EFGA 1E2LA 2Q8PA 3RT1A 6PFKA 1KHHA 3D7NA 4C0SA 4DC1A 1M75A 3NXKA 1GDTA 2GLXA 3HUUA 1G8YA 1Y8CA 3E61A 5JQWA 1LDNA 3OX4A 4BUZA 3U09A 3ZHZA 4X1YA 1QQBA 3C6KA 3QUBA 1R6AA 5AKJA 3WL6A 5BV8A 5EJ4A 1H2BA 1OAAA 3OQOA 5A0TA 1IAQA 3RWMB 2VKQA 1RBZA 1Z28A 5IDWA 4L8VA 3AR5A 1N2EA 3I5AA 3P19A 4I6JA 4TRRA 4DBLE 4DIFA 4E1AA 2WG2A 4YI5A 3TFWA 1ZOSA 2FF7A 2NZ2A 3GUHA 1E61A 2CB9A 3KLBA 4J0DA 4OYHA 1WW2A 2FUG6 2O0HA 3O26A 4FFOA 3TIVA 4I3FA 4U8HA 1Z38A 1VMKA 4MRRA 4AF6A 1HYGA 1ZRHA 2BFDB 4BBJA 3GO4A 5CCBA 4YJ3A 3WS7A 3RUCA 4CFYA 4UTVA 1XCMA 3DDOA 3DLAA 2OQIA 1A5AB 2F64A 4RVNA 5M04A 2BI4A 2NXJA 3VKWA 2VHZA 3O31A 5LUAA 2F90A 4DQUA 3QVKA 2NUBA 2XEDA 1SZJG 3LW8A 1UZAA 1EWVA 3QK7A 2J9RA 1CV2A 1MORA 5JH7F 1KZYC 2F8LA 2QZ4A 3OQIA 2EDAA 3ZVRA 4DPLA 1SULA 4IQ8A 4DANA 1Y3FE 2WDPA 4BLSA 1T36B 1RNLA 4WK2B 2RD2A 4WEQA 3GT0A 3LC7O 1K4MA 1H22A 1YHNA 2W6MA 3PFNA 1P0QA 3AW8A 4K6GA 4LOJA 1C9DB 2Y1EA 3LVFO 3LX8A 3F90A 4MUFA 1UIRA 2NN3C 3KUDA 4JB8A 1MFPA 4NJMA 3S2SA 3NQ41 2UZ3A 5JYDA 2ZS9A 3MXOA 4AJ2A 1N77A 4DUZB 4A10A 1TFUA 3O0TA 3CUWA 4JR0A 4M8KA 4Q03A 4DL9A 4JI8B 3GRZA 3HDVA 1Q0QA 3TMAA 3KPJA 4R7GA 4TLCA 4C03A 4YRZA 3C41J 4O29A 1GCOA 3HXKA 3R0QA 1BXRA 3HBJA 3EGVA 1E89A 3CXRA 1L5NA 4B44A 4QVKA 3HGMA 3LCRA 1Q0ZA 4GP9A 4CTJA 4DLSA 1JDBB 3BGVA 3OE4A 4YMGA 3ZWBA 3ZK8A 2WHXA 2ZATA 5G0WA 3DPSA 2H7XA 1P9WA 3R9XA 4YBRA 5EJIA 1NOKA 3RSHA 2B83A 5ERGB 3HYSA 4E70A 1YJBA 1ZR2A 4KGXA 3SFZA 3C85A 5KWVA 2K4MA 3FWHA 5BN4B 3Q15C 2DSTA 2CHEA 1E1CA 3RIXA 3R7FA 3JQAB 3H5VA 3V8EA 1T8UA 2DUUA 1Z18A 3CR8A 3HVJA 3E7FA 3I9V1 2X6RA 4FYWA 2P9JA 2PR7A 4YJFB 3JVDA 1WMFA 2AV6A 1YNSA 2DGDA 4Q1CA 4WNCA 3R7DA 2ZYSA 8OHMA 2G9QA 4AYXA 4MS3A 1YBMA 1QU2A 2ZTHA 1KJJA 2PUGA 3B3FA 3F49S 1JXMA 3DE3X 5FYQA 2GUWA 1JHMA 2YIDA 3BREA 3H9GA 1COWD 3INNA 3JSXA 1OYYA 4Y2RA 2YVKA 2AA3A 3KQTA 4DRYA 4P8RA 4GOJA 3F6SA 1ZVMA 4FX5A 1AE1A 4GGMX 3JX9A 4V24A 1UBEA 1QHEA 2RCNA 2Y1FA 3DMGA 5TPZA 3WG9A 4AKEA 4CPDA 4EJSB 5ITVA 1NM5A 5HBRA 3IE1A 1HE3A 2DUJA 2O5VA 1CQJA 1H2EA 4X6XA 3PIDA 1RIFA 3O2JA 3S8YA 2NLOA 4X61A 3BCRA 4LBYA 2WF9A 1H3EA 1L5OA 4I5DA 4DLPA 1SCJA 5JT1A 2XQJA 2VI5A 1NJ5A 4IO0A 4LWPA 1T2EA 3WJ1A 4D82A 1YCFA 3WZMA 1BTOA 2CVHA 3L7DA 4YCLA 2BEKA 5FUBA 4M8SA 4M22A 2O8FA 5MGNA 2CDNA 2JW5A 4ZV4A 3MAJA 5THQA 1MJGA 3K9BA 3OOHA 2W6IA 1YZFA 1YE8A 2QTVA 1XD2A 1BA3A 3D6VA 5IAGA 4TQGA 3RKUA 2BN4A 1KC3A 1IN4A 4JD5A 1EXDA 1YZLA 4UBKA 1CZUA 1G66A 3UG6A 1T1RA 5E6UB 4WOJA 1SA0A 1VLVA 1VCNA 4N0QA 4TKUA 1P4HA 1YI0A 4DBVO 2YFYA 1DMRA 2GWRA 1KZGB 1BXGB 2NTNA 2RKWA 3H6KA 2IYLD 3BEOA 4KXXA 1IBCA 4I7EA 4PZDA 2PRSA 1WW8A 3H1BA 4RTLA 2EDCA 4TMVA 1X42A 5I7OA 5MHTA 4KWCA 1X9GA 4U6SA 3ZG6A 1L7BA 4XX0B 2NSJA 2Z57A 1V3TA 5B3KA 4FU0A 1EESA 3K70D 1S2LA 1ZLYA 3DHEA 1X1SA 3UFXB 3GPIA 1CB0A 4Y7CA 2OQVA 4N4AA 4A8JC 1XZDA 2QYOA 5IKEA 1B41A 4LECA 4AFNA 2CDAA 1IJEA 4HNTA 1U1DA 2DCUA 4MMZB 2L19A 1IG0A 5D8DA 3HWSA 3VYTB 2BISA 1ZONA 3OICA 3AVQA 5C8YF 4AKGA 1QAQA 4I6GA 1W7AA 4CM4A 4D5GA 4OREX 1KJYA 3L18A 4LWZA 4A6XA 1L4BA 1IUPA 4IIYA 3IVRA 1R4ZA 4QEZA 3RDPA 3MERA 4KMMA 5EN4A 3T1OA 5IC4A 4JL8A 3AOEC 3L8GA 3N3BC 4UXIA 2JFWA 5CMLA 2G5PA 3X2SA 5IUKC 3T4UA 2EBWA 1TZJA 1VSQA 4K88A 5GY7A 2UXDB 5A6VA 3I4LA 2X5OA 3SJ7A 3U3XA 1O94A 1BMTA 1BFKA 3FYHA 4N0DA 3TS1A 1I36A 2ID9A 2VF5X 4AY4A 1IOWA 3HMKA 5AJTA 1OU4A 2I34A 4KFUA 3SDZA 4V0LA 1L2TA 3HP4A 4I4LA 2PVPA 2YVQA 4N9WA 1FP2A 1LVUA 5F9MA 4R8VA 2Q1SA 1F38A 2VJBA 4GICA 5EGNA 2V9ZA 3TD9A 4AKSA 5BMVA 2V7VA 1E3TA 1XDBA 2JCXA 3VPFA 4WOCA 4QRIA 3ZE8A 5LQDA 1AKMA 1I0ZA 4MARA 4TKLA 3ZDAA 3QHAA 3KZCA 4I9GA 2NU6A 1Y4AE 1ZU4A 2ID7A 1N2CA 2UZAA 3NDIA 4HDKB 3RVDA 1XIVA 4PX9A 3H6HA 4N5HX 2FWNA 3OZGA 2HMWA 3GXOA 3HE3A 4PQFA 1LRKA 4R0VA 2PANA 2HLDA 4OQNA 5T41A 4E5VA 1QRUA 3U61B 2IDMA 3TIIA 4WX2B 1OTXA 3G2KA 2EW8A 2GAIA 2NUAA 3U7HB 3IMCA 5BQ5A 4OAQA 2VXCA 1K75A 3WBKA 4F84A 4C76A 1T6XA 1NXOA 2GZ3A 3ZWCA 4H18A 1ZI9A 1HEUA 2L17A 4XFDA 3QE0A 5K2OA 3AF2A 3HBFA 1ZH2A 3P2KA 4HN4B 3WA7A 5DN6D 3RADC 1Y6JA 4QJBA 1WXWA 1IHYA 4OI4A 3ZD6A 4MVJI 3ABRB 1RM5A 3CKKA 4X6LA 3VJMA 1GAJA 4I0WB 5FPPA 1ZIYA 4OYYA 1R0CA 5IEBA 1Y9DA 1ZCZA 4Q02A 4KO3S 4D57A 2EZTA 4YC7A 4NV1A 4E2ZA 1SHZA 1Z4IA 1SVNA 4R9NA 3CZ5A 5L3SB 5DBOA 5IEJA 2BFWA 3AERB 3A6LA 1PSDA 2C97A 4GZ3A 5E3HA 4XSGA 1G9XA 3DF7A 1WKVA 5CFMA 5KKNB 4GG1A 2CGEA 1NBME 1ZD1A 1L5ZA 4P83A 2QN3A 4OQ4A 1FUUA 1P1FA 1P7CA 1Q77A 2E18A 4KC0A 1PJRA 4Q15A 4UOQA 4WN9A 3GNTA 4DLLA 3KB8A 3LUBA 1DWUA 4Y6RA 5TQVA 2QRVB 4JVSB 1XDWA 4NU8X 3DVRX 4A2PA 4MLDA 5TR9A 4ATNA 4Y7DA 3RABA 1GFIA 3RT7A 4LV8B 3FY4A 3DT9A 3PZBA 3ZD8A 1UDBA 2IYQA 2VTBA 1I3CA 2RH5A 3QZUA 1G1AA 1QC5B 3EUAA 4PV7A 3DZBA 1DAKA 4RNDB 4L95C 1OWPA 2MOKA 2OVFA 5SZIA 1D6SA 1JQDA 1S5PA 1KYYA 1LQTA 5KC8A 1WX1A 1Z0SA 2TSYB 4RJ2A 1MMFB 5D1NA 2ODBA 3RF6A 1K1EA 2ZB7A 2FG7C 1JAIA 3N0VA 5CX1B 2P9HA 2A0UA 2NV2B 4S05A 2IKQA 1VB5A 3FSGA 4B87A 4YQEA 1A2QA 5KDLA 3TSAA 5BV2P 1JIJA 1Y82A 1EMDA 2GKSA 2FDRA 1L5HA 3KT8A 4CLDA 3Q8KA 2JK1A 3IEXA 3VSDA 4MLCA 4HNUA 1YR2A 2GETA 1YE5A 5M3BA 3AFMA 2X1LA 4OBBA 1MXHA 1O4WA 2W2PA 3CTMA 1H8EA 2JFYA 3IPCA 1DIAA 3A36A 3KKEA 1X7DA 2FK8A 1R0LA 5CB0A 1VLMA 4G0XA 1S02A 3WHLA 4DV7B 4IGFA 4LS3A 5AOVA 3BFPA 4WCFC 3LCCA 3NHPA 1DOHA 3SDSA 4K6HA 3IV7A 4BP8A 2FJPA 4DMUB 4E03A 4FDLA 2LKCA 2PA0A 3WMXA 1GA6A 1HUQA 1NUAA 4TMKA 3LO8A 4RFVA 2GVNA 1B00A 2F3UA 4NDNE 1R37A 3PX7A 3QW2A 3PNKA 1BXKA 1NUQA 3LYLA 5CRIA 4N47A 2JVIA 3OSZA 4PW0A 2QU8A 1NSFA 4TTSA 1SR8A 3ZIAA 4R68A 4I1UA 1HWYA 2LCQA 4AYWA 1RZRA 4RVUA 4WK4B 2MYPA 2ZUBA 3TTWA 3WKEA 4JJ8A 4LJ7A 4WIAA 1RABA 3RBAA 3TKAA 1XF9A 1DG9A 3TO5A 1JSXA 1EVKA 2ZT6A 3UANA 2NPOA 3KKLA 3TINA 1ORIA 4B2PA 4U02A 2FW1A 1Z6XA 1MX5A 2NTEA 4MUMA 3KG2A 1BEEA 2QW8A 1RVV1 1CQWA 1TJ4A 4PYKA 1K0UA 5E7QA 3UG7A 3VX3A 2R8YA 4MHTA 1GD1O 4D4HA 1F8FA 2AF4C 2PQ0A 1J0AA 3A4MA 1O8CA 5JSHA 4FNGA 1JDTA 3T5AA 3NNNA 2PX5A 2I3BA 2OECA 1SH7A 1TAQA 3O0DA 2H57A 4OPMA 1J9ZA 2QQFA 2B92A 1UJ6A 4Q7QA 5KINB 2X1MA 1W0KA 4NH4A 1R3UA 4X91A 2W2KB 1NAIA 2FWAA 1PR0A 2GESA 2I2DA 1OX6A 4P4SA 4XB1A 4EDFA 3ABQB 2BKEA 1YBFA 3IA2A 3L2OB 3OJLA 2JFUA 2VQDA 5DGXA 3GPLA 2WUVA 5FFMA 2XXAB 3AJRA 5DF1A 5J58A 4ABYA 1OOEA 1DKMA 4F4DA 2H2DA 3DPUA 4R71A 1UXOA 2AI3A 3UTCA 4L51A 4MTLA 4NCBA 3R2JA 3TX2A 1ENOA 2PH7A 3ED5A 3H1TA 3GLUA 4KN9S 3G2QA 1JPNA 5HE9A 1ULAA 3OQJA 3OOYA 4PYOA 3VC2A 4EWLA 3NDBB 2GBCA 5AJZA 2F67A 3P0IA 4MKXA 4MR8A 5DLPA 3ANNA 1EZ4A 1RZVA 4G4IA 2KI5A 2Q62A 3DEZA 1AKTA 1SBYA 2HWYA 1YQWA 3V2GA 4B9EA 4FNAA 1RSZA 1U3CA 3ZK9A 5KTRA 2GTHA 2YNMD 4OXXA 4BVKA 1SG9A 3DKKA 1MIHA 4X8LA 4XVHA 2D5BA 4LKOA 3PEVA 1XZHA 3PFWO 2RHDA 2CW5A 1V6SA 2WUWE 3H11B 5CCDA 3UEOA 3UYKA 4CG0A 3K6SB 2GZMA 4ZMBA 4ZVUA 1G4HA 1TA9A 4O4HB 2FN9A 3UB4A 1V6AA 1MPTA 3BRWD 4E94A 3NGMA 4URUR 1JBQA 5EOVA 4K6KA 3LQFA 1V2HE 3NWJA 1NPTO 3HCDA 1BE8A 2WU8A 3LF1A 4TUYF 1LDYA 2F43A 2DE0X 3DEJA 3L6BA 2PTHA 2WZQA 1T5SA 3GEGA 2ETXA 3NM5A 4HZIA 2GXUA 4HH0A 1OTYA 1UEIA 2EIHA 2EKBA 2MINB 2QM0A 4KR0A 4MWSA 3U7QB 3DZHA 3S2GA 1ZR4A 3IXMA 3VR0A 5EKUA 5K51A 4YJHB 4EB8A 3ZCTA 5IKOA 2R1UA 3G5UA 4DLRA 1PJQA 1KKLA 2JD2A 4GBJA 4B3HA 4ZJUA 5JCJD 5JIBA 1EBFA 1XP5A 4E5YA 1UAGA 2WQ7A 5HKBA 1GN9A 4CQLB 2NO5A 2ZLBA 2YJGA 1JS1X 3P97A 5DBEX 3VH3A 1N1DA 3LP5A 4RORA 4HATA 5BQ3A 5K4AA 1KAHA 2CJWB 1CUSA 1PG2A 2VHWA 3CE6A 2BFCB 1UFOA 1U94A 4JXXA 4ARCA 2X8AA 3ETDA 1PUJA 3SE7A 4ENSA 4ZKDA 1LJ8A 2WUGA 2X3FA 1NBMD 3HKBB 1Z4QA 4MQBA 5TJ9A 3E9NA 1L9KA 3UJBA 4BNJA 1LBSA 3G0BA 1K7EB 5F64A 2B4AA 5K0JA 5LBTA 3L0OA 3W3AH 4Q1EA 2B1QA 1E2QA 3AXTA 3V55A 2REBA 4CCYA 4YNBA 2XI4A 4IBOA 2PKYX 2D3WA 3EVBA 4L72A 3TR6A 1F4LA 3PPXA 3BFJA 3EB9A 3IE0A 1P61B 1W25A 3KKZA 1RC8A 1JG4A 2WMDA 1JLLB 5FAKA 5LL6P 1YR8A 2I54A 4BFUA 4FOTA 2ZE7A 3GUZA 1NNI1 3IUYA 5DGDA 1CJVC 3ZX5A 1CP2A 5C81A 3KZKA 1PO7A 2OAEA 1U7DA 1NF2A 4GP7A 2UV8A 1VCIA 4QTZA 2KB0A 1M5TA 2IEYA 2IV7A 4PN3A 2VA9A 2V45A 8ABPA 4K9SA 1B43A 1OI2A 2J8ZA 2VPPA 1V3QE 2AR0A 3D9QX 3IULA 5T4FA 1NN0A 1HDRA 3GWZA 1Z7GA 3DLTA 3QV1A 1U8FO 3OTWA 2H5LA 2JGEA 5JTTA 1TAUA 3S28A 1VKZA 2OCIA 2M6KA 2QJFA 4TRJA 1AKWA 4LXYA 1GA1A 4M9XA 4FXPA 4ZDIA 4J29A 3HFGA 3ILXA 4S0XA 3GPDG 3TZCA 1IN6A 3UB3A 2CYBA 1JIKA 3LX4A 6ADHA 5DHUA 1V4BA 1ECCA 1K3FA 3ETEA 3L7IA 1PG0A 4I2NA 5EFOA 3GAZA 3EWSA 1XVUA 3ID6C 2WF5A 1HZZC 1CRPA 1LDGA 1V8ZA 4HEQA 1R9NA 5C5DA 1DCTA 3NAGA 3D43A 3R8XA 1MW9X 2ZWPA 5FWDA 1V47A 3LWZA 1AK9A 1I5EA 3JASA 3M6WA 3ZNQA 3O21A 4MB0A 3A6PC 2IPLA 3ECSA 4MZDA 3UNXA 1PW5A 2XE6A 1EGQA 1X80A 1XYGA 2IOQA 2X8BA 1B6SA 3ORYA 1MJ5A 3CMCO 3GJ5A 3TPZA 4ZQBA 1U4OA 2J0UB 4ZVSA 3ZEAA 1T4BA 1PYDA 2AQ8A 1J2JA 2G63A 3ODPA 1OUMA 4MRAA 4QYWA 1ZQ1A 1G38A 3VGJA 1CS4C 3MLEA 2I29A 1ODJA 5DBIA 1UDAA 4MAFA 5HJ2A 3A6DA 3ILHA 1EP1B 2LDXA 1NURA 4MAMA 1EUZA 1OLSA 3T3IA 4EVSA 5C7OO 2C9ZA 3FW1A 1EXMA 3EVEA 1D1SA 1EWQA 2XV1A 2W2LA 5KOYA 1F3OA 5F7ZA 4S1PA 1UKZA 2K2QB 3EFOA 2NW6A 2DHQA 3N05A 4D6PA 2CV0A 2ENUA 1MA0A 4QICA 3ZWKA 1U1IA 2LIPA 3PC2A 5EIWA 5L7WA 4CKCB 5HM8A 1EVIA 2Z2JA 3OIWA 5E9JA 2RBGA 4IH9A 2WP8J 1PUIA 4A73A 1XZNA 5KTMA 4ZARA 3KDSE 5MGBA 5D85A 1VE3A 3I72A 3PQ7A 1GZHB 5JJKA 4FFNA 1U8XX 4IS2A 4I3HA 2DKFA 5CEFA 3RRNA 4YUYA 2V59A 4GDFA 2EWVA 3FVRA 3Q3IA 2VCHA 4BNLA 1S0UA 1Y42X 1JDSA 2YWRA 1UWVA 5CB4B 3GP5A 5TQ0B 1LLDA 1Z2NX 1ZN2A 3EQ2A 1MUUA 4KRGA 5H5JA 1LSUA 2GZDA 2RHOA 3ONFA 3PFFA 3L7MA 2B61A 2FPSA 1QVVA 3C14C 1J2TA 4TKZA 3DBIA 1G21E 2GN8A 2GYUA 3M9WA 3WRWA 1E1RA 5CVJA 4YGYA 5K6AC 2OLJA 4I08A 2NXCA 3UAYA 4BRSA 2D2IA 2BPOA 6LDHA 3QVXA 4HNSA 1W0JA 5CYPA 1GPKA 2V4ZA 1EP9A 1L4FA 1R74A 2R96A 3DJFA 3QFHA 3U4QB 1TUEA 3KPYA 3W77A 1Z5WA 4JP8A 2F1KA 3L0BA 2JRLA 2H54A 2ZBQA 2RDMA 4I55A 4LY0A 3UA4A 1T8TA 4DTCA 5DX1A 1O77A 4BO1A 4NE9A 3JXEA 2HJRA 4IW3B 3AIMA 3KELA 3URKA 5T4EA 1E66A 1VIAA 2V9CA 1W5EA 3TW8B 1DXOA 1C29B 1QVAA 2C9MA 2WM9B 2WV9A 4QBKA 5AVQA 4Z9FA 4R41A 5BRAA 1ENPA 4YUXA 1BSVA 3DAGA 3MMXA 1W36B 3SNKA 1PKXA 3ZU6A 2BWJA 4XRGA 2G6BA 2GEUA 4CNQA 1SBHA 3O8CA 2Q9CA 4LRWA 3NAZA 1SPBS 3RU3A 1DBRA 3ZBTA 3DDUA 3QELB 2WF7A 2XUKA 1FFEA 2PS3A 3VX4A 3VJRA 3RJ5A 4BZXA 2X22A 4S35A 2I6UA 4O6VA 5DM70 5THXA 4JUDX 1D2GA 2K6GA 1CUYA 3IAHA 1UM8A 3EXHB 4IXTA 2F1JA 3RC7A 1G1MA 3HVIA 2RCYA 2JVKA 3Q98A 5HOQA 1L8QA 1ZXLA 1SM4A 1X8KA 2P62A 3K35A 3WTBA 5CIYA 3E53A 4Q3NA 4CODB 1XZGA 1NUSA 3NRJA 4QDXA 2H2HA 3II6X 3A3YA 4MW2A 4O4JB 3LU1A 1G5PA 4I4TF 5AVRA 2JLXA 5C46F 3SQMA 2PH3A 3OFVA 3FYUB 4JDUA 5FB3A 3GLFA 2FP3A 3E2MA 4B8ZA 1KO1A 4ARBA 2YY5A 2XKAA 2JD1A 3BAFA 3B6EA 4BMYA 4F4JA 2QTMA 4I9NA 2XDAA 1DRJA 2NZWA 1KI3A 2IHKA 2O6HA 3BB3A 3K0CC 1ENYA 3LBAA 4MUIA 2PV7A 4PANA 1SCKA 2RH8A 4EGQA 1YVDA 3HJHA 3CUSA 2FI1A 2F9MA 2OCDA 3OKPA 1S1CA 1T4MA 2B7LA 1WQ4A 3E5HA 1PJ8A 1C3JA 1O6ZA 3QVJA 3ZUPA 1MRZA 3CWZA 5AKGA 1D04A 1JHAA 3WZLA 4EB0A 5JRJA 3EZ7A 1NWHA 2CZGA 2O8CB 4DWVA 5JAMA 2P4UA 1Z7EA 2ECOA 3C3PA 4S1TA 4EUSA 2HN9A 3RHFA 3L1HA 2PRZA 4GHWA 5YASA 3FHOA 4LX8A 3AR3A 4QIHA 4JBIA 3NYRA 4XOIA 5HF8A 1RU3A 3ZXUB 2G0AA 4IMIB 3WGGA 4BZZA 3O7MA 3JTEA 2BELA 1QZUA 3I58A 3KQQA 1ZRSA 4M83A 4C0AC 5KMGB 1VOTA 3AJDA 3HO8A 5JS6A 1T9CA 5H68A 3T3EA 4PLWA 4ZT3A 5G1OA 3CNOA 1TC2A 3K9QO 1F14A 4WXRA 9LDBA 4ED9A 1GPBA 1O9BA 2ICAA 2Q7DA 3RYFB 4CM5A 3ES9A 1TYDE 5C5EA 2O1SA 4W5HA 1UPTA 3HRIA 2M1XA 4Z86A 1J4AA 4HLDA 4U9HS 5HUQA 3AT1A 3OP4A 1UBHS 1L4KA 3HZRA 1X1CA 2JIOA 4NMLA 3TLAA 1P3DA 5JZSA 1WZIA 3GFSA 1TFRA 3PPIA 2OHFA 3DB1A 3DW1X 2RC5A 3O4JA 4LWOA 2GCEA 3D4IA 3DPIA 3I6BA 3T5DA 2I87A 5IDQA 2R751 3C1OA 5EY5B 4YJ2A 1U0FA 4LE1A 5EJ5A 1U98A 1ZM4A 2ZI3A 5COBA 4B7CA 2ZRAA 4UQLA 5KVSA 1K66A 1VL6A 4J4TA 2UYHA 2GRAA 1Y63A 3IIJA 4HS9A 1X13A 3RO7A 4PLVA 1SQFA 1LB1B 3NHAA 1ZD3A 1HKUA 3IB6A 5AXDA 2O8EB 4YVFA 3TZLA 1FMCA 1NLZA 4BQPA 1OB5A 1PJ2A 3RG2A 2P4SA 2UUOA 2V1XA 4ZT5A 4FQ8A 5JHHB 3WGLA 1GFZA 4M0LA 1ZVQA 2VTDA 3Q7RA 3O82A 4IHAA 2VPTA 1M2HA 2DB3A 4KITB 1VFNA 1ZY2A 4UEOA 5H0IA 3UHJA 1JHRA 1NBOA 2AUNA 5IT9A 1PJ4A 1T1GA 3QUQA 4P7KA 1TCUA 5AVZA 1XZPA 1TQ2A 3LQ4A 2FOLA 3FUVA 1JQKA 2ZETA 4PTYA 3BRCA 3W78A 4DY4A 1MXFA 2A9FA 3AY7A 3GMTA 2AEFA 1XZAA 1IIRA 3UOAB 2ACWA 5MN4A 2ODWA 3KDPA 1F0PA 3M7IA 3VR4H 4MQFB 5JJIA 2VF4X 1R1DA 4FM9A 1T8RA 1K7FB 2Q49A 4BLQA 2FUCA 2IUTA 2Q4DA 2FPMA 1PS8A 3EFHA 4CVNA 2ACVA 4KODA 1L7VC 1Y8AA 3EPKA 1U28A 4QFBA 1GM5A 5A4IS 1LPAB 5FLEX 5IBRA 2H9AA 1BYUA 3SK0A 4NAUA 421PA 2IUYA 1L5FA 1J2RA 3KD2A 5CEJA 5L3RA 3AR7A 1O7JA 1E2MA 2NO7A 3B1ZA 3FUWA 3OPYB 4LNUB 1DAIA 2I80A 3H5OA 4AJPA 1JX6A 3MTGA 3WLHA 3RUHA 3K73O 4M0CA 3NRCA 1O87A 1ZD9A 3BE8A 2VNSA 1P74A 3PGXA 3OF2A 4KE7A 4BMCA 3PEWA 3PQ3A 3ND9A 1IXZA 1HMYA 2WLTA 5AW5A 3BZBA 4KK3A 3VZSA 1Y34E 3VR3A 2FW7A 2CVFA 3DXZA 4DR6B 1P2UA 3GGOA 3NVAA 4LJ4A 2JATA 3QX9A 5DDIP 3ESXA 2JGAA 4DEYA 1X7WA 1OH5A 1VC2A 2W93A 4ARIA 3FJYA 3MFQA 1TQ6A 3O4VA 1QIHA 4FMPA 5DNDA 4BPRA 5C8DA 2I6GA 2SKCA 1AGPA 1BNCA 1EWYA 1G98A 3F6RA 3HKEA 3LLVA 1ZMBA 4M0UA 3I6ZA 4B3IA 3D6TB 1U0GA 3GLHA 3LLMA 2VCEA 3DMFA 1XDGA 3JZAA 4G0UA 5CFZA 1LBEA 1A4UA 3ACCA 2WFMA 4GBMA 4TL8A 3IKJA 3W8DA 4XW2A 5CW1A 5EPEA 2WKQA 4I3GA 5DM60 1OAOA 3Q40A 4IICA 4LZOA 4F2HA 1XNJA 1I4WA 4AP9A 1GSAA 4D45A 2D0PB 2OCAA 1PFYA 4LUCA 1UMKA 2JIPA 2W0SA 1DI0A 3R3XA 3EZ2A 2VC2B 4OEHA 4OHXA 3VR4D 2AOTA 3HDYA 4DHWA 4FHDA 4NC9A 4ACBA 3CVYA 3MOIA 1BW9A 4RJLA 5DTJA 4EZIA 2W6JA 3WHPA 3ESRA 5C4MA 1AU9A 3LH5A 1DCMA 1FW8A 4F5YA 3UM9A 1J9EA 2QNBA 5A4KA 3AOGA 4OQYA 5C18A 3LNTA 3WYDA 3UY4A 1QCYA 1S3FA 1YD7A 3ENNA 2ZVJA 2C1ZA 3VH1A 2B1GA 1DFGA 1A04A 2JASA 2UUPA 1YA4A 3T9EA 4D74A 3RNOA 1C3LA 4QU8A 3B6KA 5TPWA 4KQKA 5AK0A 3HDHA 1U2GA 5IWCA 5K5EA 1PZFA 3A8TA 2Q4OA 1D9XA 1D8TA 2ZJYA 2F9LA 3TI7A 4BO8A 2GK3A 4Q1FA 1JALA 3REQB 4CT4B 3U7RA 3GT3A 3L1UA 5REQB 4MS4A 3WGTA 1WBDA 4AJHA 1QH8A 3PHIA 3RYIB 1HE1C 4J16C 1AC5A 4JQZA 3WK7A 3BJMA 4UHCA 2Q8NA 2GBPA 4I5GA 5DRTA 2GAOA 5GJWC 3L82B 2VA8A 4WECA 2VLIA 5FA5A 1HRKA 3NALA 2VJDA 2D2VA 4B3FX 1P72A 2MHCA 5CLLA 3C3DA 3Q7PA 1DU4A 1L4GA 1SCUA 4JUFA 4PLYA 4QGBA 3PX3A 3T35A 4BUJA 3FIJA 4WINA 5JRZA 1R6TA 4KRFA 2KHZA 5BT8A 3MJEA 1JR3D 4ZPJA 3GELA 3SKVA 2QVBA 2HPVA 5KTSA 2QRMA 2A3NA 3P2JA 2X0NA 2XTZA 4HVAA 3W1EA 1ZA2A 2B8TA 1E8NA 4XPIB 4D9IA 5JYBA 4GYJA 2HZBA 2PKXA 2R6CA 4H4CA 4W5NA 4O4HF 3SYKA 2XQGA 1U0SY 3UXYA 5DXAA 3RPEA 3FPCA 1P1KA 5DEOA 1MR3F 4TQUS 5E1OA 1X7XB 4ZT7A 3FDXA 2PPVA 4FYKA 4OKSA 2FN3A 3P0EA 5EQDA 1TEVA 1WUIS 1UT6A 4QREA 3WSVA 4E11A 1FP1D 1UP4A 3LWDA 1EFPA 5TMBA 3AVUA 1JEQA 3LOPA 4YJGA 4JK3A 4K9NA 2YRFA 1SN7A 2BEJA 4UTOA 4DWOA 4IVNA 3DKIA 2H5EA 4G8DA 4A4DA 4RF3A 4CHTA 4WOKA 1T9BA 2A5LA 1IJFA 4TWAA 1SHJA 1AHIA 3KO8A 5EE1A 4AJ1A 3KBOA 2PA3A 4DDVA 1D09A 5JWOA 1ZHOA 3LDUA 1GGKA 5A0FA 4PG5A 1NY5A 2VIIA 4EABA 5K8VA 3KYCB 3THRA 2OUIA 3IJ5A 4P0QB 1N33B 2REXB 4FSDA 3TRDA 3LHIA 2BFEB 4V0MA 3T3HA 1C3OA 4W5OA 3N8NA 1KGSA 3CEAA 4RPIA 3VPGA 3FPBA 5A1JA 3JD0A 4L3OA 4AO7A 4PYMA 4W5RA 2FZVA 2ZSJA 3AZPA 4J7AA 4EITA 1XK7A 1XLVA 1GUBA 1DQPA 1JFVA 1N3YA 2CB0A 2N1BA 5GAJA 1SXJE 5T64A 3KKOA 1GZDA 2PRJA 3D2CA 4V0KA 4BRUA 4ZOCA 4D4GA