4R30A

Structure of human laforin dual specificity phosphatase domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
QAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEKGHIVYVHSNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKRPAVYIDEEALARAQEDFFQKFGKVRSSVCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimeric quaternary structure of human laforin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Laforin
total genus 61
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4r30A00
2G6ZA 3EZZA 1OHEA 2QBQA 4D3QA 3AWGA 2HC1A 2F6ZA 4KYRA 2VEWA 3QKQA 3S3FA 1YFOA 2FJNA 2WGPA 2CFVA 4RI4A 2CNGA 5HDEA 1G1HA 3SR9A 4OHHA 1I9SA 1LARA 3ZMPA 1EENA 3MOWA 1WCHA 2PQ5A 3F99A 3SMEA 5KA2A 1OEMX 1PH0A 2QDPA 1Q6PA 3PS5A 2MBCA 2I5XA 1Q6MA 4OHEA 2HCMA 2HC2A 1P15A 5M43A 2CNHA 1YTWA 4GS0A 1V3AA 3AWEA 1EEOA 1FPZA 3RZ2A 2NLKA 1ZC0A 4KI9A 1YTNA 3QCMA 1YTSA 4PVGA 4H34A 3D1HA 3BLUA 1OEUA 5KA3A 2OUDA 2CMCA 2I42A 5AWXA 5BX1A 2PA5A 2A3KA 2CMAA 2P6XA 4D3PA 2NZ6A 2IMGA 2NT2A 3ZMQA 2GWOA 3BLTA 4BPCA 3V0IA 2BGDA 2BGEA 2CM8A 2I6MA 1PYNA 2CJZA 3ZM1A 2Y2FA 2HNPA 2OZ5A 1NWEA 2H4KA 1I57A 5J8RA 3D42A 2PBNA 4R30A 4Y14A 3V0FA 5I6VA 4ZI4A 3V0HA 2F6YA 3CM3A 1PXHA 3GXHA 5KADA 1WRMA 4QAPA 4J51A 5MMZB 1Q6SA 2HB1A 5K9VA 1G4US 1QZ0A 3ZV2A 2HVLA 4GWFA 2E0TA 4IKCA 2CM2A 2OOQA 2J16A 2QDMA 4JNBA 4NWFA 1YN9A 3CWEA 1KAVA 4S0GA 2VEYA 3V0GA 1C87A 5KA1A 2A8BA 1R6HA 3QCNA 2B4OA 1NO6A 4MBBA 5KACA 2VEXA 4GE6A 3ZM2A 4NNDA 2I3RA 2I4HA 1G1GA 3I7ZA 4JBCA 4RH9A 3QCDA 1ZZWA 2DXPA 1FPRA 2P4DA 4GFVA 4JMKA 3BRHA 1GWZA 3S4OA 3QCGA 1Q6NA 4GRZA 3B7OA 2CNIA 4ZRTA 4NWGA 3S3EA 3V0EA 2CNEA 1M3GA 4WOHA 5K23A 1G1FA 1OEOX 4D3RA 2BIJA 1PTVA 1T4JA 3EU0A 1YGRA 2CNFA 5EHPA 3D1OA 1MKPA 1U24A 1G7FA 1XXPA 4TVVA 4QUMA 5KA4A 3M4UA 1WAXA 5KAAA 3O4UA 4HRFA 3V0JA 1LYVA 2VEVA 1SUGA 1YGUA 4R0SA 5K22A 1QXKA 2B3OA 2I6IA 5K25A 3QCFA 4QBWA 2H02A 5KA9A 4Y2EA 2GP0A 1T48A 4QAHA 4YR8B 5K9WA 2QBSA 2BV5A 2C46A 4QBEA 4QUNA 4GFUA 1ONZA 3EB1A 4OHIA 2HY3A 3BM8A 3QCJA 2F71A 3S4EA 5KABA 3OMHA 1T49A 1OHDA 3NMEA 1BZCA 1NNYA 1OEVA 4WU3A 3QCBA 2I4GA 3D9CA 1C83A 1JF7A 1KAKA 2AZRA 2F46A 1J4XA 1C84A 1YPTA 3H2XA 3EMUA 2NTAA 3RGOA 4R0TA 1XXVA 1D5RA 3LJ8A 3F9AA 3QCKA 2VEUA 3F9BA 1AAXA 1YZ4A 3EAXA 3QCEA 2FH7A 4GRYA 1PTUA 2I6PA 2I3UA 1C86A 2B49A 3I36A 4RH5A 1C85A 1BZJA 4RDDA 3QCCA 4H1OA 2QDCA 3QCLA 1Q1MA 2NT7A 3QKPA 4NX8A 1RPMA 1ECVA 2I6JA 1ZCKA 2H4GA 2YDUA 3D1QA 4GE2A 5KA7A 2B07A 2CMBA 2PSZA 2CM3A 1ONYA 2F6TA 3O4SA 1C88A 1OESA 2R0BA 4RKKA 3S3KA 2OC3A 3ZM0A 4DGXA 3ZM3A 2I6OA 2QCTA 5IBSA 1PA1A 2ZN7A 1LQFA 1PA9A 1XM2A 4OHLA 1VHRA 2F6FA 1YWFA 2B4SA 2Y96A 5IBMA 2QEPA 2C7SA 4GE5A 3RGQA 2QCJA 4OHDA 3QCHA 3RO1A 2F6VA 4KYQA 2JJDA 4WU2A 3GXGA 5KA0A 2F6WA 2I4EA 1A5YA 5KA8A 1I9TA 1X24A 2CM7A 2FJMA 3O5XA 2HNQA 5EHRA 2B4UA 1ZCLA 4NYHA 5BZZA 5LXQB 3U96A 2G59A 2PT0A 4ZN5A 4I8NA 2AHSA 2SHPA 1NL9A 5BUGA 2I75A 1PTTA 4HJQA 3A5KA 4DGPA 2ESBA 4YAAA 2J16B 4ERCA 1Q6TA 1NZ7A 1OETA 1OHCA 1XRIA 1JLNA 3AWFA 3MOZA 3OLRA 2H04A 2B4PA 2H4VA 2BZLA 3A5JA 3MMJA 1GFYA 2H03A 1G7GA 2J17A 1FQ1A 4ICZA 1U26A 4WTYA 1PTYA 2GJTA 3D44A 4HJPA 2QBRA 3N0AA 3QCIA 4AZ1A 2F70A 1U25A 1BZHA 3F81A 4B04A 2PI7A 3V0DA 4RHGA 3O3LA 3S3HA 1Q6JA 1G4WR 2Q05A 1NWLA 4PYHA 1L8GA 4Z6BA 5GTJA 2M3VA 4JMJA 2RF6A 4RI5A 1L8KA 2HXPA 3F41A 2QBPA 1XBOA 2NV5A 4BJOA 5K24A 3O4TA 3I80A 5BZXA 1RXDA 2I1YA 2ZMMA 2Q47A
chains in the Genus database with same CATH superfamily
2G6ZA 3EZZA 1OHEA 2QBQA 4D3QA 3AWGA 2HC1A 2F6ZA 4KYRA 2VOSA 2VEWA 3QKQA 3S3FA 1YFOA 2FJNA 2WGPA 2CFVA 2GCBA 4RI4A 2CNGA 5HDEA 1G1HA 3SR9A 4OHHA 1I9SA 1LARA 3ZMPA 1EENA 3MOWA 1FGSA 1WCHA 1E0DA 2PQ5A 3F99A 3SMEA 5KA2A 1OEMX 1PH0A 2QDPA 1Q6PA 3PS5A 2MBCA 3ZM5A 2I5XA 1Q6MA 4OHEA 2HCMA 2HC2A 1P15A 5M43A 2CNHA 2VTEA 4C13A 1YTWA 4GS0A 1V3AA 4QDIA 3AWEA 1EEOA 1FPZA 3RZ2A 2NLKA 1ZC0A 4KI9A 2Y66A 1YTNA 3QCMA 1YTSA 1E8CA 4PVGA 4H34A 3D1HA 3BLUA 1OEUA 5KA3A 2OUDA 2CMCA 2I42A 5AWXA 5BX1A 2AM2A 2WJPA 2PA5A 2A3KA 2CMAA 2P6XA 4D3PA 2F00A 4BUCA 1GG4A 2NZ6A 2IMGA 2NT2A 3ZMQA 2GWOA 3BLTA 4BPCA 3V0IA 2BGDA 2BGEA 2CM8A 2I6MA 1PYNA 2CJZA 3ZM1A 2Y2FA 2HNPA 2OZ5A 1NWEA 2H4KA 1I57A 5J8RA 3D42A 2PBNA 4R30A 4Y14A 3V0FA 5I6VA 4ZI4A 3V0HA 1J6UA 3CM3A 1PXHA 3GXHA 2F6YA 5KADA 1WRMA 4QAPA 4J51A 5MMZB 3ZL8A 1Q6SA 4C12A 2HB1A 5K9VA 1G4US 1QZ0A 3ZV2A 2HVLA 4GWFA 2E0TA 4IKCA 3NRSA 2CM2A 2OOQA 2J16A 2QDMA 4JNBA 4NWFA 1YN9A 3CWEA 3QCZA 1KAVA 4S0GA 2VEYA 3V0GA 1C87A 2GC6A 5A5EA 5KA1A 2A8BA 1R6HA 3QCNA 2B4OA 1NO6A 4MBBA 5KACA 2VEXA 4GE6A 3ZM2A 2JFHA 4NNDA 2I3RA 2I4HA 1G1GA 3I7ZA 4JBCA 4CVKA 4RH9A 3QCDA 1ZZWA 2DXPA 1FPRA 2P4DA 4GFVA 4JMKA 3BRHA 1GWZA 3S4OA 3QCGA 1Q6NA 4GRZA 3B7OA 2CNIA 4ZRTA 4NWGA 3S3EA 3V0EA 2CNEA 1M3GA 4WOHA 5K23A 1G1FA 2VORA 1OEOX 4D3RA 2BIJA 1PTVA 1T4JA 3EU0A 1YGRA 2CNFA 5EHPA 2X5OA 3D1OA 1MKPA 1U24A 1G7FA 1XXPA 4TVVA 3LK7A 1P3DA 4QUMA 5KA4A 3M4UA 1WAXA 5KAAA 3O4UA 4HRFA 1O5ZA 3V0JA 1LYVA 2VEVA 1SUGA 1YGUA 4UAGA 4R0SA 5K22A 3MVNA 1QXKA 2B3OA 2I6IA 5K25A 3QCFA 4QBWA 2H02A 5KA9A 4Y2EA 2GP0A 1T48A 4QAHA 4YR8B 5K9WA 2QBSA 2BV5A 2C46A 4QBEA 4QUNA 4GFUA 1ONZA 3EB1A 4OHIA 2HY3A 3BM8A 3QCJA 2F71A 3S4EA 2UUOA 5KABA 3OMHA 1T49A 1OHDA 3NMEA 1BZCA 1NNYA 1OEVA 4WU3A 3QCBA 2I4GA 3D9CA 1C83A 1JF7A 1KAKA 2AZRA 2F46A 1J4XA 1C84A 1YPTA 4BUBA 3H2XA 3EMUA 2NTAA 3RGOA 4R0TA 2VTDA 1XXVA 1D5RA 2JFFA 3LJ8A 3F9AA 3QCKA 2VEUA 3F9BA 1AAXA 1YZ4A 3EAXA 3QCEA 2FH7A 4GRYA 1PTUA 2I6PA 2I3UA 1C86A 2B49A 3I36A 4RH5A 1C85A 1GQYA 1BZJA 4RDDA 3QCCA 4H1OA 2QDCA 2JFGA 3QCLA 1JBWA 1Q1MA 2GCAA 2NT7A 3QKPA 4NX8A 4CVMA 1RPMA 1ECVA 2I6JA 1ZCKA 2H4GA 2YDUA 3D1QA 4GE2A 5KA7A 2B07A 2CMBA 2XPCA 2PSZA 2CM3A 1ONYA 2F6TA 3O4SA 1C88A 3HN7A 1OESA 2R0BA 4RKKA 3S3KA 2XJAA 2OC3A 3ZM0A 4DGXA 3ZM3A 2I6OA 2QCTA 5IBSA 1PA1A 2ZN7A 1LQFA 1PA9A 2Y67A 1XM2A 4OHLA 1VHRA 1EEHA 2F6FA 1GQQA 1YWFA 3ZM6A 2B4SA 2Y96A 5IBMA 2QEPA 2C7SA 4GE5A 3RGQA 2QCJA 4OHDA 3QCHA 3RO1A 2F6VA 4KYQA 2Y1OA 2JJDA 4WU2A 3GXGA 5KA0A 2F6WA 2I4EA 1A5YA 1W7KA 5KA8A 1I9TA 1X24A 2CM7A 2AM1A 2FJMA 2UUPA 3O5XA 2HNQA 5EHRA 2B4UA 1ZCLA 4NYHA 5BZZA 5LXQB 3U96A 2G59A 2PT0A 4ZN5A 4I8NA 2AHSA 2SHPA 1NL9A 5BUGA 2I75A 1PTTA 3N2AA 4HJQA 1JBVA 2WTZA 3A5KA 4DGPA 2ESBA 4YAAA 2J16B 4ERCA 5A5FA 1Q6TA 1NZ7A 1OETA 1OHCA 1XRIA 1JLNA 3AWFA 3MOZA 3OLRA 2H04A 3PYZA 2B4PA 4HV4A 2H4VA 2BZLA 3A5JA 3MMJA 1GFYA 2H03A 1G7GA 2J17A 1FQ1A 4ICZA 1U26A 4WTYA 1PTYA 4ZIYA 2GJTA 3D44A 4HJPA 2GC5A 2QBRA 3N0AA 3QCIA 4AZ1A 2F70A 1P31A 1U25A 1BZHA 3F81A 4B04A 2UAGA 2PI7A 3V0DA 4RHGA 3O3LA 4QF5A 3S3HA 1Q6JA 1G4WR 2Q05A 1NWLA 4CVLA 4PYHA 1L8GA 1UAGA 4Z6BA 5GTJA 2M3VA 4JMJA 2RF6A 4RI5A 1L8KA 2HXPA 3F41A 2QBPA 2Y68A 1XBOA 1W78A 2NV5A 4BJOA 5K24A 3O4TA 3I80A 3UAGA 5BZXA 1RXDA 2I1YA 2ZMMA 2Q47A
chains in the Genus database with same CATH topology
2G6ZA 3EZZA 1OHEA 2QBQA 4D3QA 3AWGA 2HC1A 2F6ZA 4KYRA 2VEWA 3QKQA 3S3FA 1YFOA 2FJNA 2WGPA 2CFVA 4RI4A 2CNGA 5HDEA 1G1HA 3SR9A 4OHHA 1I9SA 1LARA 3ZMPA 1EENA 3MOWA 1WCHA 2PQ5A 3F99A 3SMEA 5KA2A 1OEMX 1PH0A 2QDPA 1Q6PA 3PS5A 2MBCA 2I5XA 1Q6MA 4OHEA 2HCMA 2HC2A 1P15A 5M43A 2CNHA 1YTWA 4GS0A 1V3AA 3AWEA 1EEOA 1FPZA 3RZ2A 2NLKA 1ZC0A 4KI9A 1YTNA 3QCMA 1YTSA 4PVGA 4H34A 3D1HA 3BLUA 1OEUA 5KA3A 2OUDA 2CMCA 2I42A 5AWXA 5BX1A 2PA5A 2A3KA 2CMAA 2P6XA 4D3PA 2NZ6A 2IMGA 2NT2A 3ZMQA 2GWOA 3BLTA 4BPCA 3V0IA 2BGDA 2BGEA 2CM8A 2I6MA 1PYNA 2CJZA 3ZM1A 2Y2FA 2HNPA 2OZ5A 1NWEA 2H4KA 1I57A 5J8RA 3D42A 2PBNA 4R30A 4Y14A 3V0FA 5I6VA 4ZI4A 3V0HA 2F6YA 3CM3A 1PXHA 3GXHA 5KADA 1WRMA 4QAPA 4J51A 5MMZB 1Q6SA 2HB1A 5K9VA 1G4US 1QZ0A 3ZV2A 2HVLA 4GWFA 2E0TA 4IKCA 2CM2A 2OOQA 2J16A 2QDMA 4JNBA 4NWFA 1YN9A 3CWEA 1KAVA 4S0GA 2VEYA 3V0GA 1C87A 5KA1A 2A8BA 1R6HA 3QCNA 2B4OA 1NO6A 4MBBA 5KACA 2VEXA 4GE6A 3ZM2A 4NNDA 2I3RA 2I4HA 1G1GA 3I7ZA 4JBCA 4RH9A 3QCDA 1ZZWA 2DXPA 1FPRA 2P4DA 4GFVA 4JMKA 3BRHA 1GWZA 3S4OA 3QCGA 1Q6NA 4GRZA 3B7OA 2CNIA 4ZRTA 4NWGA 3S3EA 3V0EA 2CNEA 1M3GA 4WOHA 5K23A 1G1FA 1OEOX 4D3RA 2BIJA 1PTVA 1T4JA 3EU0A 1YGRA 2CNFA 5EHPA 3D1OA 1MKPA 1U24A 1G7FA 1XXPA 4TVVA 4QUMA 5KA4A 3M4UA 1WAXA 5KAAA 3O4UA 4HRFA 3V0JA 1LYVA 2VEVA 1SUGA 1YGUA 4R0SA 5K22A 1QXKA 2B3OA 2I6IA 5K25A 3QCFA 4QBWA 2H02A 5KA9A 4Y2EA 2GP0A 1T48A 4QAHA 4YR8B 5K9WA 2QBSA 2BV5A 2C46A 4QBEA 4QUNA 4GFUA 1ONZA 3EB1A 4OHIA 2HY3A 3BM8A 3QCJA 2F71A 3S4EA 5KABA 3OMHA 1T49A 1OHDA 3NMEA 1BZCA 1NNYA 1OEVA 4WU3A 3QCBA 2I4GA 3D9CA 1C83A 1JF7A 1KAKA 2AZRA 2F46A 1J4XA 1C84A 1YPTA 3H2XA 3EMUA 2NTAA 3RGOA 4R0TA 1XXVA 1D5RA 3LJ8A 3F9AA 3QCKA 2VEUA 3F9BA 1AAXA 1YZ4A 3EAXA 3QCEA 2FH7A 4GRYA 1PTUA 2I6PA 2I3UA 1C86A 2B49A 3I36A 4RH5A 1C85A 1BZJA 4RDDA 3QCCA 4H1OA 2QDCA 3QCLA 1Q1MA 2NT7A 3QKPA 4NX8A 1RPMA 1ECVA 2I6JA 1ZCKA 2H4GA 2YDUA 3D1QA 4GE2A 5KA7A 2B07A 2CMBA 2PSZA 2CM3A 1ONYA 2F6TA 3O4SA 1C88A 1OESA 2R0BA 4RKKA 3S3KA 2OC3A 3ZM0A 4DGXA 3ZM3A 2I6OA 2QCTA 5IBSA 1PA1A 2ZN7A 1LQFA 1PA9A 1XM2A 4OHLA 1VHRA 2F6FA 1YWFA 2B4SA 2Y96A 5IBMA 2QEPA 2C7SA 4GE5A 3RGQA 2QCJA 4OHDA 3QCHA 3RO1A 2F6VA 4KYQA 2JJDA 4WU2A 3GXGA 5KA0A 2F6WA 2I4EA 1A5YA 5KA8A 1I9TA 1X24A 2CM7A 2FJMA 3O5XA 2HNQA 5EHRA 2B4UA 1ZCLA 4NYHA 5BZZA 5LXQB 3U96A 2G59A 2PT0A 4ZN5A 4I8NA 2AHSA 2SHPA 1NL9A 5BUGA 2I75A 1PTTA 4HJQA 3A5KA 4DGPA 2ESBA 4YAAA 2J16B 4ERCA 1Q6TA 1NZ7A 1OETA 1OHCA 1XRIA 1JLNA 3AWFA 3MOZA 3OLRA 2H04A 2B4PA 2H4VA 2BZLA 3A5JA 3MMJA 1GFYA 2H03A 1G7GA 2J17A 1FQ1A 4ICZA 1U26A 4WTYA 1PTYA 2GJTA 3D44A 4HJPA 2QBRA 3N0AA 3QCIA 4AZ1A 2F70A 1U25A 1BZHA 3F81A 4B04A 2PI7A 3V0DA 4RHGA 3O3LA 3S3HA 1Q6JA 1G4WR 2Q05A 1NWLA 4PYHA 1L8GA 4Z6BA 5GTJA 2M3VA 4JMJA 2RF6A 4RI5A 1L8KA 2HXPA 3F41A 2QBPA 1XBOA 2NV5A 4BJOA 5K24A 3O4TA 3I80A 5BZXA 1RXDA 2I1YA 2ZMMA 2Q47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6Z A;  3EZZ A;  1OHE A;  2QBQ A;  4D3Q A;  3AWG A;  2HC1 A;  2F6Z A;  4KYR A;  2VEW A;  3QKQ A;  3S3F A;  1YFO A;  2FJN A;  2WGP A;  2CFV A;  4RI4 A;  2CNG A;  5HDE A;  1G1H A;  3SR9 A;  4OHH A;  1I9S A;  1LAR A;  3ZMP A;  1EEN A;  3MOW A;  1WCH A;  2PQ5 A;  3F99 A;  3SME A;  5KA2 A;  1OEM X;  1PH0 A;  2QDP A;  1Q6P A;  3PS5 A;  2MBC A;  2I5X A;  1Q6M A;  4OHE A;  2HCM A;  2HC2 A;  1P15 A;  5M43 A;  2CNH A;  1YTW A;  4GS0 A;  1V3A A;  3AWE A;  1EEO A;  1FPZ A;  3RZ2 A;  2NLK A;  1ZC0 A;  4KI9 A;  1YTN A;  3QCM A;  1YTS A;  4PVG A;  4H34 A;  3D1H A;  3BLU A;  1OEU A;  5KA3 A;  2OUD A;  2CMC A;  2I42 A;  5AWX A;  5BX1 A;  2PA5 A;  2A3K A;  2CMA A;  2P6X A;  4D3P A;  2NZ6 A;  2IMG A;  2NT2 A;  3ZMQ A;  2GWO A;  3BLT A;  4BPC A;  3V0I A;  2BGD A;  2BGE A;  2CM8 A;  2I6M A;  1PYN A;  2CJZ A;  3ZM1 A;  2Y2F A;  2HNP A;  2OZ5 A;  1NWE A;  2H4K A;  1I57 A;  5J8R A;  3D42 A;  2PBN A;  4R30 A;  4Y14 A;  3V0F A;  5I6V A;  4ZI4 A;  3V0H A;  2F6Y A;  3CM3 A;  1PXH A;  3GXH A;  5KAD A;  1WRM A;  4QAP A;  4J51 A;  5MMZ B;  1Q6S A;  2HB1 A;  5K9V A;  1G4U S;  1QZ0 A;  3ZV2 A;  2HVL A;  4GWF A;  2E0T A;  4IKC A;  2CM2 A;  2OOQ A;  2J16 A;  2QDM A;  4JNB A;  4NWF A;  1YN9 A;  3CWE A;  1KAV A;  4S0G A;  2VEY A;  3V0G A;  1C87 A;  5KA1 A;  2A8B A;  1R6H A;  3QCN A;  2B4O A;  1NO6 A;  4MBB A;  5KAC A;  2VEX A;  4GE6 A;  3ZM2 A;  4NND A;  2I3R A;  2I4H A;  1G1G A;  3I7Z A;  4JBC A;  4RH9 A;  3QCD A;  1ZZW A;  2DXP A;  1FPR A;  2P4D A;  4GFV A;  4JMK A;  3BRH A;  1GWZ A;  3S4O A;  3QCG A;  1Q6N A;  4GRZ A;  3B7O A;  2CNI A;  4ZRT A;  4NWG A;  3S3E A;  3V0E A;  2CNE A;  1M3G A;  4WOH A;  5K23 A;  1G1F A;  1OEO X;  4D3R A;  2BIJ A;  1PTV A;  1T4J A;  3EU0 A;  1YGR A;  2CNF A;  5EHP A;  3D1O A;  1MKP A;  1U24 A;  1G7F A;  1XXP A;  4TVV A;  4QUM A;  5KA4 A;  3M4U A;  1WAX A;  5KAA A;  3O4U A;  4HRF A;  3V0J A;  1LYV A;  2VEV A;  1SUG A;  1YGU A;  4R0S A;  5K22 A;  1QXK A;  2B3O A;  2I6I A;  5K25 A;  3QCF A;  4QBW A;  2H02 A;  5KA9 A;  4Y2E A;  2GP0 A;  1T48 A;  4QAH A;  4YR8 B;  5K9W A;  2QBS A;  2BV5 A;  2C46 A;  4QBE A;  4QUN A;  4GFU A;  1ONZ A;  3EB1 A;  4OHI A;  2HY3 A;  3BM8 A;  3QCJ A;  2F71 A;  3S4E A;  5KAB A;  3OMH A;  1T49 A;  1OHD A;  3NME A;  1BZC A;  1NNY A;  1OEV A;  4WU3 A;  3QCB A;  2I4G A;  3D9C A;  1C83 A;  1JF7 A;  1KAK A;  2AZR A;  2F46 A;  1J4X A;  1C84 A;  1YPT A;  3H2X A;  3EMU A;  2NTA A;  3RGO A;  4R0T A;  1XXV A;  1D5R A;  3LJ8 A;  3F9A A;  3QCK A;  2VEU A;  3F9B A;  1AAX A;  1YZ4 A;  3EAX A;  3QCE A;  2FH7 A;  4GRY A;  1PTU A;  2I6P A;  2I3U A;  1C86 A;  2B49 A;  3I36 A;  4RH5 A;  1C85 A;  1BZJ A;  4RDD A;  3QCC A;  4H1O A;  2QDC A;  3QCL A;  1Q1M A;  2NT7 A;  3QKP A;  4NX8 A;  1RPM A;  1ECV A;  2I6J A;  1ZCK A;  2H4G A;  2YDU A;  3D1Q A;  4GE2 A;  5KA7 A;  2B07 A;  2CMB A;  2PSZ A;  2CM3 A;  1ONY A;  2F6T A;  3O4S A;  1C88 A;  1OES A;  2R0B A;  4RKK A;  3S3K A;  2OC3 A;  3ZM0 A;  4DGX A;  3ZM3 A;  2I6O A;  2QCT A;  5IBS A;  1PA1 A;  2ZN7 A;  1LQF A;  1PA9 A;  1XM2 A;  4OHL A;  1VHR A;  2F6F A;  1YWF A;  2B4S A;  2Y96 A;  5IBM A;  2QEP A;  2C7S A;  4GE5 A;  3RGQ A;  2QCJ A;  4OHD A;  3QCH A;  3RO1 A;  2F6V A;  4KYQ A;  2JJD A;  4WU2 A;  3GXG A;  5KA0 A;  2F6W A;  2I4E A;  1A5Y A;  5KA8 A;  1I9T A;  1X24 A;  2CM7 A;  2FJM A;  3O5X A;  2HNQ A;  5EHR A;  2B4U A;  1ZCL A;  4NYH A;  5BZZ A;  5LXQ B;  3U96 A;  2G59 A;  2PT0 A;  4ZN5 A;  4I8N A;  2AHS A;  2SHP A;  1NL9 A;  5BUG A;  2I75 A;  1PTT A;  4HJQ A;  3A5K A;  4DGP A;  2ESB A;  4YAA A;  2J16 B;  4ERC A;  1Q6T A;  1NZ7 A;  1OET A;  1OHC A;  1XRI A;  1JLN A;  3AWF A;  3MOZ A;  3OLR A;  2H04 A;  2B4P A;  2H4V A;  2BZL A;  3A5J A;  3MMJ A;  1GFY A;  2H03 A;  1G7G A;  2J17 A;  1FQ1 A;  4ICZ A;  1U26 A;  4WTY A;  1PTY A;  2GJT A;  3D44 A;  4HJP A;  2QBR A;  3N0A A;  3QCI A;  4AZ1 A;  2F70 A;  1U25 A;  1BZH A;  3F81 A;  4B04 A;  2PI7 A;  3V0D A;  4RHG A;  3O3L A;  3S3H A;  1Q6J A;  1G4W R;  2Q05 A;  1NWL A;  4PYH A;  1L8G A;  4Z6B A;  5GTJ A;  2M3V A;  4JMJ A;  2RF6 A;  4RI5 A;  1L8K A;  2HXP A;  3F41 A;  2QBP A;  1XBO A;  2NV5 A;  4BJO A;  5K24 A;  3O4T A;  3I80 A;  5BZX A;  1RXD A;  2I1Y A;  2ZMM A;  2Q47 A; 
#chains in the Genus database with same CATH topology
 2G6Z A;  3EZZ A;  1OHE A;  2QBQ A;  4D3Q A;  3AWG A;  2HC1 A;  2F6Z A;  4KYR A;  2VOS A;  2VEW A;  3QKQ A;  3S3F A;  1YFO A;  2FJN A;  2WGP A;  2CFV A;  2GCB A;  4RI4 A;  2CNG A;  5HDE A;  1G1H A;  3SR9 A;  4OHH A;  1I9S A;  1LAR A;  3ZMP A;  1EEN A;  3MOW A;  1FGS A;  1WCH A;  1E0D A;  2PQ5 A;  3F99 A;  3SME A;  5KA2 A;  1OEM X;  1PH0 A;  2QDP A;  1Q6P A;  3PS5 A;  2MBC A;  3ZM5 A;  2I5X A;  1Q6M A;  4OHE A;  2HCM A;  2HC2 A;  1P15 A;  5M43 A;  2CNH A;  2VTE A;  4C13 A;  1YTW A;  4GS0 A;  1V3A A;  4QDI A;  3AWE A;  1EEO A;  1FPZ A;  3RZ2 A;  2NLK A;  1ZC0 A;  4KI9 A;  2Y66 A;  1YTN A;  3QCM A;  1YTS A;  1E8C A;  4PVG A;  4H34 A;  3D1H A;  3BLU A;  1OEU A;  5KA3 A;  2OUD A;  2CMC A;  2I42 A;  5AWX A;  5BX1 A;  2AM2 A;  2WJP A;  2PA5 A;  2A3K A;  2CMA A;  2P6X A;  4D3P A;  2F00 A;  4BUC A;  1GG4 A;  2NZ6 A;  2IMG A;  2NT2 A;  3ZMQ A;  2GWO A;  3BLT A;  4BPC A;  3V0I A;  2BGD A;  2BGE A;  2CM8 A;  2I6M A;  1PYN A;  2CJZ A;  3ZM1 A;  2Y2F A;  2HNP A;  2OZ5 A;  1NWE A;  2H4K A;  1I57 A;  5J8R A;  3D42 A;  2PBN A;  4R30 A;  4Y14 A;  3V0F A;  5I6V A;  4ZI4 A;  3V0H A;  1J6U A;  3CM3 A;  1PXH A;  3GXH A;  2F6Y A;  5KAD A;  1WRM A;  4QAP A;  4J51 A;  5MMZ B;  3ZL8 A;  1Q6S A;  4C12 A;  2HB1 A;  5K9V A;  1G4U S;  1QZ0 A;  3ZV2 A;  2HVL A;  4GWF A;  2E0T A;  4IKC A;  3NRS A;  2CM2 A;  2OOQ A;  2J16 A;  2QDM A;  4JNB A;  4NWF A;  1YN9 A;  3CWE A;  3QCZ A;  1KAV A;  4S0G A;  2VEY A;  3V0G A;  1C87 A;  2GC6 A;  5A5E A;  5KA1 A;  2A8B A;  1R6H A;  3QCN A;  2B4O A;  1NO6 A;  4MBB A;  5KAC A;  2VEX A;  4GE6 A;  3ZM2 A;  2JFH A;  4NND A;  2I3R A;  2I4H A;  1G1G A;  3I7Z A;  4JBC A;  4CVK A;  4RH9 A;  3QCD A;  1ZZW A;  2DXP A;  1FPR A;  2P4D A;  4GFV A;  4JMK A;  3BRH A;  1GWZ A;  3S4O A;  3QCG A;  1Q6N A;  4GRZ A;  3B7O A;  2CNI A;  4ZRT A;  4NWG A;  3S3E A;  3V0E A;  2CNE A;  1M3G A;  4WOH A;  5K23 A;  1G1F A;  2VOR A;  1OEO X;  4D3R A;  2BIJ A;  1PTV A;  1T4J A;  3EU0 A;  1YGR A;  2CNF A;  5EHP A;  2X5O A;  3D1O A;  1MKP A;  1U24 A;  1G7F A;  1XXP A;  4TVV A;  3LK7 A;  1P3D A;  4QUM A;  5KA4 A;  3M4U A;  1WAX A;  5KAA A;  3O4U A;  4HRF A;  1O5Z A;  3V0J A;  1LYV A;  2VEV A;  1SUG A;  1YGU A;  4UAG A;  4R0S A;  5K22 A;  3MVN A;  1QXK A;  2B3O A;  2I6I A;  5K25 A;  3QCF A;  4QBW A;  2H02 A;  5KA9 A;  4Y2E A;  2GP0 A;  1T48 A;  4QAH A;  4YR8 B;  5K9W A;  2QBS A;  2BV5 A;  2C46 A;  4QBE A;  4QUN A;  4GFU A;  1ONZ A;  3EB1 A;  4OHI A;  2HY3 A;  3BM8 A;  3QCJ A;  2F71 A;  3S4E A;  2UUO A;  5KAB A;  3OMH A;  1T49 A;  1OHD A;  3NME A;  1BZC A;  1NNY A;  1OEV A;  4WU3 A;  3QCB A;  2I4G A;  3D9C A;  1C83 A;  1JF7 A;  1KAK A;  2AZR A;  2F46 A;  1J4X A;  1C84 A;  1YPT A;  4BUB A;  3H2X A;  3EMU A;  2NTA A;  3RGO A;  4R0T A;  2VTD A;  1XXV A;  1D5R A;  2JFF A;  3LJ8 A;  3F9A A;  3QCK A;  2VEU A;  3F9B A;  1AAX A;  1YZ4 A;  3EAX A;  3QCE A;  2FH7 A;  4GRY A;  1PTU A;  2I6P A;  2I3U A;  1C86 A;  2B49 A;  3I36 A;  4RH5 A;  1C85 A;  1GQY A;  1BZJ A;  4RDD A;  3QCC A;  4H1O A;  2QDC A;  2JFG A;  3QCL A;  1JBW A;  1Q1M A;  2GCA A;  2NT7 A;  3QKP A;  4NX8 A;  4CVM A;  1RPM A;  1ECV A;  2I6J A;  1ZCK A;  2H4G A;  2YDU A;  3D1Q A;  4GE2 A;  5KA7 A;  2B07 A;  2CMB A;  2XPC A;  2PSZ A;  2CM3 A;  1ONY A;  2F6T A;  3O4S A;  1C88 A;  3HN7 A;  1OES A;  2R0B A;  4RKK A;  3S3K A;  2XJA A;  2OC3 A;  3ZM0 A;  4DGX A;  3ZM3 A;  2I6O A;  2QCT A;  5IBS A;  1PA1 A;  2ZN7 A;  1LQF A;  1PA9 A;  2Y67 A;  1XM2 A;  4OHL A;  1VHR A;  1EEH A;  2F6F A;  1GQQ A;  1YWF A;  3ZM6 A;  2B4S A;  2Y96 A;  5IBM A;  2QEP A;  2C7S A;  4GE5 A;  3RGQ A;  2QCJ A;  4OHD A;  3QCH A;  3RO1 A;  2F6V A;  4KYQ A;  2Y1O A;  2JJD A;  4WU2 A;  3GXG A;  5KA0 A;  2F6W A;  2I4E A;  1A5Y A;  1W7K A;  5KA8 A;  1I9T A;  1X24 A;  2CM7 A;  2AM1 A;  2FJM A;  2UUP A;  3O5X A;  2HNQ A;  5EHR A;  2B4U A;  1ZCL A;  4NYH A;  5BZZ A;  5LXQ B;  3U96 A;  2G59 A;  2PT0 A;  4ZN5 A;  4I8N A;  2AHS A;  2SHP A;  1NL9 A;  5BUG A;  2I75 A;  1PTT A;  3N2A A;  4HJQ A;  1JBV A;  2WTZ A;  3A5K A;  4DGP A;  2ESB A;  4YAA A;  2J16 B;  4ERC A;  5A5F A;  1Q6T A;  1NZ7 A;  1OET A;  1OHC A;  1XRI A;  1JLN A;  3AWF A;  3MOZ A;  3OLR A;  2H04 A;  3PYZ A;  2B4P A;  4HV4 A;  2H4V A;  2BZL A;  3A5J A;  3MMJ A;  1GFY A;  2H03 A;  1G7G A;  2J17 A;  1FQ1 A;  4ICZ A;  1U26 A;  4WTY A;  1PTY A;  4ZIY A;  2GJT A;  3D44 A;  4HJP A;  2GC5 A;  2QBR A;  3N0A A;  3QCI A;  4AZ1 A;  2F70 A;  1P31 A;  1U25 A;  1BZH A;  3F81 A;  4B04 A;  2UAG A;  2PI7 A;  3V0D A;  4RHG A;  3O3L A;  4QF5 A;  3S3H A;  1Q6J A;  1G4W R;  2Q05 A;  1NWL A;  4CVL A;  4PYH A;  1L8G A;  1UAG A;  4Z6B A;  5GTJ A;  2M3V A;  4JMJ A;  2RF6 A;  4RI5 A;  1L8K A;  2HXP A;  3F41 A;  2QBP A;  2Y68 A;  1XBO A;  1W78 A;  2NV5 A;  4BJO A;  5K24 A;  3O4T A;  3I80 A;  3UAG A;  5BZX A;  1RXD A;  2I1Y A;  2ZMM A;  2Q47 A; 
#chains in the Genus database with same CATH homology
 2G6Z A;  3EZZ A;  1OHE A;  2QBQ A;  4D3Q A;  3AWG A;  2HC1 A;  2F6Z A;  4KYR A;  2VEW A;  3QKQ A;  3S3F A;  1YFO A;  2FJN A;  2WGP A;  2CFV A;  4RI4 A;  2CNG A;  5HDE A;  1G1H A;  3SR9 A;  4OHH A;  1I9S A;  1LAR A;  3ZMP A;  1EEN A;  3MOW A;  1WCH A;  2PQ5 A;  3F99 A;  3SME A;  5KA2 A;  1OEM X;  1PH0 A;  2QDP A;  1Q6P A;  3PS5 A;  2MBC A;  2I5X A;  1Q6M A;  4OHE A;  2HCM A;  2HC2 A;  1P15 A;  5M43 A;  2CNH A;  1YTW A;  4GS0 A;  1V3A A;  3AWE A;  1EEO A;  1FPZ A;  3RZ2 A;  2NLK A;  1ZC0 A;  4KI9 A;  1YTN A;  3QCM A;  1YTS A;  4PVG A;  4H34 A;  3D1H A;  3BLU A;  1OEU A;  5KA3 A;  2OUD A;  2CMC A;  2I42 A;  5AWX A;  5BX1 A;  2PA5 A;  2A3K A;  2CMA A;  2P6X A;  4D3P A;  2NZ6 A;  2IMG A;  2NT2 A;  3ZMQ A;  2GWO A;  3BLT A;  4BPC A;  3V0I A;  2BGD A;  2BGE A;  2CM8 A;  2I6M A;  1PYN A;  2CJZ A;  3ZM1 A;  2Y2F A;  2HNP A;  2OZ5 A;  1NWE A;  2H4K A;  1I57 A;  5J8R A;  3D42 A;  2PBN A;  4R30 A;  4Y14 A;  3V0F A;  5I6V A;  4ZI4 A;  3V0H A;  2F6Y A;  3CM3 A;  1PXH A;  3GXH A;  5KAD A;  1WRM A;  4QAP A;  4J51 A;  5MMZ B;  1Q6S A;  2HB1 A;  5K9V A;  1G4U S;  1QZ0 A;  3ZV2 A;  2HVL A;  4GWF A;  2E0T A;  4IKC A;  2CM2 A;  2OOQ A;  2J16 A;  2QDM A;  4JNB A;  4NWF A;  1YN9 A;  3CWE A;  1KAV A;  4S0G A;  2VEY A;  3V0G A;  1C87 A;  5KA1 A;  2A8B A;  1R6H A;  3QCN A;  2B4O A;  1NO6 A;  4MBB A;  5KAC A;  2VEX A;  4GE6 A;  3ZM2 A;  4NND A;  2I3R A;  2I4H A;  1G1G A;  3I7Z A;  4JBC A;  4RH9 A;  3QCD A;  1ZZW A;  2DXP A;  1FPR A;  2P4D A;  4GFV A;  4JMK A;  3BRH A;  1GWZ A;  3S4O A;  3QCG A;  1Q6N A;  4GRZ A;  3B7O A;  2CNI A;  4ZRT A;  4NWG A;  3S3E A;  3V0E A;  2CNE A;  1M3G A;  4WOH A;  5K23 A;  1G1F A;  1OEO X;  4D3R A;  2BIJ A;  1PTV A;  1T4J A;  3EU0 A;  1YGR A;  2CNF A;  5EHP A;  3D1O A;  1MKP A;  1U24 A;  1G7F A;  1XXP A;  4TVV A;  4QUM A;  5KA4 A;  3M4U A;  1WAX A;  5KAA A;  3O4U A;  4HRF A;  3V0J A;  1LYV A;  2VEV A;  1SUG A;  1YGU A;  4R0S A;  5K22 A;  1QXK A;  2B3O A;  2I6I A;  5K25 A;  3QCF A;  4QBW A;  2H02 A;  5KA9 A;  4Y2E A;  2GP0 A;  1T48 A;  4QAH A;  4YR8 B;  5K9W A;  2QBS A;  2BV5 A;  2C46 A;  4QBE A;  4QUN A;  4GFU A;  1ONZ A;  3EB1 A;  4OHI A;  2HY3 A;  3BM8 A;  3QCJ A;  2F71 A;  3S4E A;  5KAB A;  3OMH A;  1T49 A;  1OHD A;  3NME A;  1BZC A;  1NNY A;  1OEV A;  4WU3 A;  3QCB A;  2I4G A;  3D9C A;  1C83 A;  1JF7 A;  1KAK A;  2AZR A;  2F46 A;  1J4X A;  1C84 A;  1YPT A;  3H2X A;  3EMU A;  2NTA A;  3RGO A;  4R0T A;  1XXV A;  1D5R A;  3LJ8 A;  3F9A A;  3QCK A;  2VEU A;  3F9B A;  1AAX A;  1YZ4 A;  3EAX A;  3QCE A;  2FH7 A;  4GRY A;  1PTU A;  2I6P A;  2I3U A;  1C86 A;  2B49 A;  3I36 A;  4RH5 A;  1C85 A;  1BZJ A;  4RDD A;  3QCC A;  4H1O A;  2QDC A;  3QCL A;  1Q1M A;  2NT7 A;  3QKP A;  4NX8 A;  1RPM A;  1ECV A;  2I6J A;  1ZCK A;  2H4G A;  2YDU A;  3D1Q A;  4GE2 A;  5KA7 A;  2B07 A;  2CMB A;  2PSZ A;  2CM3 A;  1ONY A;  2F6T A;  3O4S A;  1C88 A;  1OES A;  2R0B A;  4RKK A;  3S3K A;  2OC3 A;  3ZM0 A;  4DGX A;  3ZM3 A;  2I6O A;  2QCT A;  5IBS A;  1PA1 A;  2ZN7 A;  1LQF A;  1PA9 A;  1XM2 A;  4OHL A;  1VHR A;  2F6F A;  1YWF A;  2B4S A;  2Y96 A;  5IBM A;  2QEP A;  2C7S A;  4GE5 A;  3RGQ A;  2QCJ A;  4OHD A;  3QCH A;  3RO1 A;  2F6V A;  4KYQ A;  2JJD A;  4WU2 A;  3GXG A;  5KA0 A;  2F6W A;  2I4E A;  1A5Y A;  5KA8 A;  1I9T A;  1X24 A;  2CM7 A;  2FJM A;  3O5X A;  2HNQ A;  5EHR A;  2B4U A;  1ZCL A;  4NYH A;  5BZZ A;  5LXQ B;  3U96 A;  2G59 A;  2PT0 A;  4ZN5 A;  4I8N A;  2AHS A;  2SHP A;  1NL9 A;  5BUG A;  2I75 A;  1PTT A;  4HJQ A;  3A5K A;  4DGP A;  2ESB A;  4YAA A;  2J16 B;  4ERC A;  1Q6T A;  1NZ7 A;  1OET A;  1OHC A;  1XRI A;  1JLN A;  3AWF A;  3MOZ A;  3OLR A;  2H04 A;  2B4P A;  2H4V A;  2BZL A;  3A5J A;  3MMJ A;  1GFY A;  2H03 A;  1G7G A;  2J17 A;  1FQ1 A;  4ICZ A;  1U26 A;  4WTY A;  1PTY A;  2GJT A;  3D44 A;  4HJP A;  2QBR A;  3N0A A;  3QCI A;  4AZ1 A;  2F70 A;  1U25 A;  1BZH A;  3F81 A;  4B04 A;  2PI7 A;  3V0D A;  4RHG A;  3O3L A;  3S3H A;  1Q6J A;  1G4W R;  2Q05 A;  1NWL A;  4PYH A;  1L8G A;  4Z6B A;  5GTJ A;  2M3V A;  4JMJ A;  2RF6 A;  4RI5 A;  1L8K A;  2HXP A;  3F41 A;  2QBP A;  1XBO A;  2NV5 A;  4BJO A;  5K24 A;  3O4T A;  3I80 A;  5BZX A;  1RXD A;  2I1Y A;  2ZMM A;  2Q47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...