4R33A

X-ray structure of the tryptophan lyase nosl with tryptophan and s-adenosyl-l-homocysteine bound
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
384
structure length
384
Chain Sequence
GDFVLPELEDVRAEAATVDTRAVLALAEGEEPAESRAAVALALWEDRSIGTAELQAAAEARCGARRPRLHTFVPLYTTNYCDSECKMCSMRKGNHRLDRKFSGRKEITEQLEILYHHEGVRGVGFLTGEYEDKHTRLASAFRIGWAIRTALDLGFERVYFNIGSMEQDEIDVLGEWIGREDPVTMCVFQESYDRETYRRFMGKTSVGVPKADFDRRVVSFDRWLDAGYRYVNPGVLVGLHDDLSAELVSLVAHGDHLRSRGATADLSVPRMRPAMKSRDTTRVGDDDYLRLMSVVAFTCPEQRLVLTTREPQEFQDVALGLAGVISPGSPDVAPYRAGCEARNDEKSSQFLVADLRRPRHILGRIEASGTPVDHFVNPAGEASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NosL
publication title Crystal Structure of Tryptophan Lyase (NosL): Evidence for Radical Formation at the Amino Group of Tryptophan.
pubmed doi rcsb
source organism Streptomyces actuosus
molecule tags Lyase
total genus 148
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06968 BATS Biotin and Thiamin Synthesis associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4r33A00
3LERA 1W3NA 1SZNA 3SECA 3TC6A 3N19B 4JGDA 1H5YA 3MJYA 3W86A 2NV2A 3PSVA 2FQIA 3W7RA 3M5VA 2E6DA 3DZ1A 4UMCA 3LV6A 3W07A 1I45A 2A0NA 2EAWA 3G22A 2J9XA 3S1XA 2ZTJA 4IPIA 2E6YA 5E93A 1LBLA 4MY1A 3EXRA 1VQTA 4N02A 2VKZG 3P61A 5AHEA 2B7PA 5DCDA 5AC7A 3TK7A 2E77A 3N2XA 3TV8A 3Q94A 4AF0A 2O7QA 4A21A 2QCDB 4IMFA 1H60A 4YXGA 1W5OA 4CLMA 4XKYB 5SWUA 3G0UA 3TMQA 3KX6A 3TCEA 2X1SA 4N9CA 5AC8A 1RZMA 4QAIA 3I7QA 4JYFA 1DQWA 1PV8A 3UPBA 4HNTA 1EUAA 3S6DA 3PB2A 3DENA 4WOQA 3EWUA 3WK0A 1W0MA 1F7BA 2RDUA 4AEOA 3FA5A 4IX2A 4MFEA 5EYWA 4Z1BA 2Y61A 3BG5A 1GG1A 2Y7FA 1KM1A 2QAFA 3LM7A 5BRBA 1KTBA 3KXQA 4N4QA 2WSQA 1XFBA 4NJGA 4PFMA 3W1TA 3BG3A 3QW3A 4D2JA 3W1UA 1JULA 5IBXC 3B0UX 3MBFA 1JCMP 3LLDA 1W5PA 3TFXA 3LLFA 3UWYA 3MBDA 3W7DA 1VLIA 4U4MA 3W72A 1AG1O 3V75A 1JCNA 5C5YA 3LRKA 2WSYA 5DLCA 1F74A 1V5XA 3IV3A 1GVQA 3DFTA 3PM6A 4OWGA 4JDBA 3IIOA 1TYGA 4RKAA 3HGSA 3W2KA 4A2RA 1TPUA 2VEMA 3GIYA 4GRSA 3S42A 3A24A 4O28A 4PA8A 2V8ZA 5CZTA 1JUKA 2A2IA 3FYPA 1WYIA 1TCDA 5KINA 5F4SA 3LV5A 3THQA 4BK9A 4NVTA 4A22A 3LI0A 4FHAA 4NXSA 3SR7A 1FDYA 4O8RA 4YL2A 1Y0EA 4RV8A 5A5WA 2XN1A 4FNUA 3CB8A 1YDOA 4CNPA 2YX0A 3LHUA 5MHBA 4DXVA 3SIZA 1M6JA 1XUZA 2LLEA 3LOTA 2A21A 2Z6JA 4M7SA 4MFDA 1IF2A 4LC6A 5TQLA 3TDFA 2QR6A 3M47A 2AQWA 5F2IA 4CCEA 3IVSA 4WXZA 5CPLA 1K3UA 1R2TA 2F84A 4O18A 3DXIA 3CWNA 4JTEA 2YFNA 2ZZ1A 3KVMA 5LNRA 2DJLA 3GDMA 3BGGA 4DF0A 3QSRA 4IPJA 3VNDA 4RK8A 3TKFA 3GNDA 4FXSA 1A5CA 3KVJA 4JX6A 4UNKA 3W1NA 5FESA 5KTLA 4O19A 3O1NA 1BTMA 3EWWA 4TU1A 4UTTC 1KM2A 1L6SA 2VFDA 3TROA 3HMJG 1O94A 3IVUA 3WK2A 1EP2A 1YDNA 1F6PA 3QMTA 1ICSA 3AO0A 4FB7A 1W54A 1LZOA 1RQEA 3NAVA 5CSSA 3KOFA 1K7XA 1KM5A 3TMLA 2D73A 3MI6A 4HN4A 3W6YA 5EY5A 4OGZA 5LGZA 4A29A 1G4PA 1LYXA 2QF7A 1OF8A 3QMSA 4XZ9A 5FEZA 3NR0A 3NQ2A 4RZ4A 4IXHA 4UNLA 1WBHA 3W7LA 4ZQPA 3L67A 3E9AA 1UBSA 1LOQA 4X9SA 2JKAA 2Y88A 5CSRA 1XBVA 1EEPA 2PCQA 3MHUA 3GR8A 5T26A 2HS8A 4UFMA 4KWVA 3INPA 3BVJA 3LTYA 3BLFA 3LHVA 3E0IA 1KFLA 4H3DA 3TQKA 2NZLA 4Q4KA 3W71A 4YCOA 1DJNA 1H62A 1GVSA 1O95A 2YDAA 2R94A 3RF9A 3DFNA 3W7MA 5HNRA 3BG9A 1DOSA 5AHFA 4E2DA 3UYCA 5EBUA 4UTWA 3LXCA 5AHMA 1EB3A 2GPTA 4BWLC 5KITA 2TPSA 1KFKA 4QNWA 2C6QA 1YYAA 1PCWA 2VEPA 5K9CA 1J4EA 3JR2A 1O5XA 5DBTA 3PB0A 1A53A 5HWNA 1X1ZA 4CNNA 1SUXA 4MLJA 1VRDA 2CZ5A 3IIPA 2EHHA 2Q3RA 4FNQA 4HPXA 4AHOA 5D30A 4QNEA 5EMUA 2NXHA 3SJ3A 1VCVA 1UUOA 3G1VA 4LT9A 3NQFA 3QMRA 4RZ5A 2QDHA 3W7GA 1WV2A 3R8RA 3UXDA 3L21A 1K8ZA 3C2VA 5LNUA 1LRTA 2X1TA 2QCNA 3QZEA 5LNSA 3QSTA 1W5MA 2OJPA 1B4EA 3QPZA 4NNCA 5HINA 1I4NA 4KFPA 3UY8A 3RLUA 1AL7A 3CM4A 1ME9A 3L5AA 3P5ZA 3CU2A 4K8EA 2RH9A 5AHLA 4RZ6A 3I68A 1BEUA 2Y70A 5A8GA 5C6MA 1JJKA 1WBJA 2ZBTA 2J24A 4M6QA 4UFJA 1I2NA 4B5NA 3UZ5A 1YXDA 2WNQA 4O13A 4DPPA 1SO5A 1M5WA 5K9DA 2A7RA 2E6FA 4O0ZA 3N9RA 1OYAA 2H3DA 1GPWA 1QOPA 3MHGA 3BV4A 3CTLA 1XC4A 3A5FA 5FI8A 2NX1A 1PHQA 4JEQA 4MZ1A 3G1YA 4X2RA 4CNOA 3W9ZA 2E68A 4BI6A 1SFJA 1QFEA 3CC1A 1B9BA 4O1DA 3CEUA 4N2YA 4Z0SA 4YCPA 1HUVA 2A6LA 3A5VA 1YLVA 2BXVA 3A9IA 1FWWA 1KV5A 1I2OA 2FPYA 1JR1A 3N2MA 1TPDA 2V81A 5EA9A 1Z48A 5EKYA 2GUUA 4O10A 3TQVA 3G1SA 3KRSA 3ATYA 3UQNA 4N9DA 1FDZA 4O14A 2YW3A 4AVFA 4Y6GA 1VH7A 2NV1A 2CWNA 4HPJA 2NXIA 5AYYA 3TJLA 1JQVA 1XM3A 3UWZA 4HSOA 1IXPA 4IWWA 3HJZA 4XTDA 1FX6A 4FX7A 3LCHA 4AWUA 3U8GA 2GQ9A 3R89A 3MP3A 1LCOA 4K7YA 4OV9A 5DBUA 2XN0A 1TQJA 3H55A 3G8RA 3W2UA 3IGSA 3IGXA 1K8YA 2CFFA 2W79A 4I7UA 1TJPA 1NEYA 4MOZA 3RMJA 5D2XA 3N9SA 3THAA 3IIXA 3E49A 1VYSX 1F2JA 4ZQMA 2V2HA 2ZZ5A 1VLWA 3EX1A 4PH6A 1IXQA 4JICA 1IGSA 3TX9A 4QQ3A 2VC6A 3E02A 3NG3A 3C0JA 3F03K 1R46A 3ATZA 2QKFA 1A5AA 2ATMA 4WD0A 3NQ7A 2TRSA 3UWUA 2C13A 4LTSA 2Z6IA 1YTDA 3OBKA 3TAKA 1EIXA 4E0CA 3Q58A 5D32A 3G8EA 2Y6ZA 3OIXA 4UTHA 1OX5A 1LOSA 4BFAA 5CG7A 4R33A 3LCIA 3M1ZA 1MEIA 1T99A 3IEBA 1VCFA 3NL6A 3NPWA 4AXKA 4PL1A 5HUOA 1LLZA 3GLCA 3G1HA 4UIOA 1AW5A 4UMAA 2GJNA 4TMBA 3O6CA 2CLHA 2DZWA 2WNZA 5IBXA 3O6DA 1H7WA 3FFSA 2JKEA 5LNVA 2JGQA 3P62A 4CQ8A 1VHCA 1CX9A 3GX9A 5D09A 4GNJA 4L4LA 3LX9A 3C52A 3W1LA 3W88A 4FO4A 4ADUA 5FEPA 4MYXA 2WKJA 4GWEA 3MWAA 4O53A 2IQTA 1F6KA 3LCGA 2FTPA 3M6YA 3ZWSA 2VEKA 5U4NA 4DO5A 5LZLA 4E2BA 3MMTA 1IXOA 2RDWA 1D3GA 3RK8A 5G4EA 3T78A 1Q3NA 1DORA 4K8HA 3NA8A 4WUIA 2I9EA 1X6UA 1OFAA 3UZJA 3HF3A 3ABOA 5K9XA 2HMCA 4AWTA 1FWRA 3DFQA 2H3BA 3LRLA 1YDVA 1HL2A 3MI3A 3W2NA 1PS9A 1FQ0A 3UWWA 4IJBA 4K38A 1X7FA 2E09A 3QC3A 5BMXA 1PCKA 3B03A 3HPXA 3UWQA 3FKKA 3G1AA 4UFHA 2RKXA 2X1UA 2ZYFA 5D02A 1SR9A 3HPSA 5AC6A 5AHNA 1FWSA 4Y96A 4ZQRA 1TV7A 1F5ZA 1KFBA 4EOUA 1VYPX 1S5VA 1UCWA 2PC4A 3EWBX 3TSBA 2CU0A 1D3HA 4JYEA 3PULA 4ONVA 3LHYA 4LVBA 5CZJA 5HQEA 3DAQA 4K36A 3WJSA 4MY8A 4M5PA 1TV5A 1FXPA 2YXGA 3L0KA 3C3NA 2J88A 1QPQA 3S5ZA 2ZCGA 1TJRA 3WJZA 4HNVA 3L0GA 4JS3A 4O4VA 5E0KA 1BWKA 3R13A 4UTTA 5KMYA 5HR6A 3Q37A 2QCCA 3GKFA 4GFSA 3T40A 1TPWA 1UB3A 3BGJA 4JTHA 5IM51 3M5YA 4DO4A 1Q6LA 4O52A 2CLKA 3S5OA 4JYDA 4MZYA 5EPDA 1IXNA 2AAMA 5CZSA 3S0CA 4XBSA 2X30A 5LKYA 1JVNA 4KKXA 2QCLA 3ZFHA 4FIRA 1O60A 1GZGA 1T0OA 3OG3A 2E5CA 3A21A 4ZL1A 4ICNA 4M7TA 3O15A 3KAOA 2YFOA 4X22A 1ICQA 2P10A 4LVGA 5H91A 5D03A 2ZFAA 3W1PA 1SW7A 2J9YA 2C16A 4WY0B 3QF0A 4GUJA 5G5IA 1BWLA 1SO3A 3O63A 3PAJA 1YTKA 2ZZ2A 4P2VA 3G0XA 3NOEA 2DZUA 1XXXA 3DI0A 1TREA 2PURA 4HT3A 3PG9A 4U28A 4BI7A 4PCFA 5AHIA 1R2RA 1B57A 2B4GA 3KHJA 2QUUA 1JRBA 1G67A 3DKJA 4JXCA 5D33A 3LBMA 2FB3A 1W5QA 3T44A 3I7RA 3JS3A 3UY7A 3P82A 1KW1A 1H50A 4BWLA 3FIGA 4MIMA 3M16A 1KM6A 2G97A 1LP6A 4UMBA 1IIHA 1X8FA 5G2WA 1H1YA 1XI3A 2PRHA 3W23A 5DXYA 3GVGA 3P80A 4HIBA 4Z0JA 4FXRA 3ZWTA 3NQ8A 1IIGA 3SY5A 3WJYA 5I3JA 3AJXA 3TFCA 3BLIA 1EP1A 3W1XA 4LUJA 3EXSA 2NX3A 1KM4A 1PE1A 1VYRA 1OVDA 2CLMA 4K37A 1N8FA 4AF0B 1ZHAA 3W1MA 1ML1A 1N55A 1A50A 3W74A 3NM1A 1AL8A 2FJKA 3ABRA 3LDVA 1J2WA 4JDYA 4Z1CA 1G4TA 5C54A 2GVGA 4LVAA 3QH2A 4Q33A 1SO6A 2YW4A 3BO9A 3NPVA 4WJEA 3G1DA 5LGXA 2OMAA 3OA3A 4YWIA 3BK0A 1QPOA 3FJLA 3NQ6A 3NVTA 3W84A 1QDSA 4TMCA 2Y7DA 3CEPA 4FF7A 2TYSA 1W56A 3UXAA 2Z2UA 1TO3A 3PVFA 1FBAA 2NXGA 3F4WA 3L66A 1GWJA 1ZCOA 3NL5A 3N14A 3CIXA 3DU0A 3SGUA 4DF1A 1S3HA 2HS6A 1OG0A 4NQ1A 1P1XA 1R2SA 3LXAA 5K7JA 3PF3A 1ALDA 3EX4A 1W5NA 2V82A 5F2GA 3S5NA 1EPXA 4G1KA 4GXMA 1TQXA 3LTPA 4N6EA 4Y8FA 3W7QA 3C56A 4QISA 5F1UA 1TSIA 4BF9A 1F76A 4DF2A 3W73A 4A2SA 1K8XA 2CW6A 3S1WA 3QQ0A 1ICPA 4IUOA 3PS7A 1OX4A 5D04C 1JUEA 3P81A 3DFOA 4GUIA 3HBLA 1C29A 3P8JA 1OYCA 3W2JA 1DBTA 1KBIA 3BW4A 3GR7A 4UFLA 1MEHA 5F2LA 3TXZA 1ZFJA 1FXQA 3LHWA 3TW6A 3PG8A 4O16A 2J27A 1QOQA 5LNWA 2QDGA 1LRNA 4R34A 4XTIA 1LROA 1C9DA 2DZSA 4O54A 2Y7EA 3DBPA 1SQ7A 1O5KA 1R47A 4NU7A 5BMWA 5DELA 3W7IA 1EX5A 1Q6RA 4AAJA 4UR7A 2BZNA 2NUYA 2JK2A 5BNKA 2DU2A 3I65A 1SW3A 2VFGA 4NX0A 5D2WA 3IIZA 1E51A 3MUXA 4UXDA 5L9FA 1TTJA 2WO5A 4JTUA 2H6RA 2H8ZA 1OFRA 2I1OA 5DY2A 5C55A 1TPVA 3IGUA 3LRMA 5AOUA 2QCEA 1EA0A 1LOLA 1CW2A 1VR6A 2B0MA 4NJIA 3TA6A 3NZRA 3L9CA 3R5EA 4AHQA 2Q3OA 4IXXA 8TIMA 1S5TA 2NWSA 2VEIA 1OX6A 4ZMGA 1T96A 3O05A 4MZ8A 5E1QA 1W3IA 3LHZA 3C2EA 1XDLA 3UPWA 3P8IA 2Q8LA 3TC7A 2E1DA 4EF9A 3LCLA 4EVZA 3VCRA 4OE7A 1L2UA 3EKLA 3GDKA 3BLEA 3CHVA 5FF3A 3NL3A 5F4XA 4BR1A 2EGZA 3C2RA 3YPIA 2ZRYA 4JTJA 4W9TA 1Q6OA 3NGJA 4MKNA 4UTUA 4MJZA 4O0KA 1H51A 4Z1AA 5D38A 1JCLA 4POCA 4GBUA 3KRZA 4GE8A 2A85A 1P0NA 3HGOA 3B0PA 4UTIA 2V5BA 1YXCA 4AMAA 2C3ZA 3T7VA 1OABA 3MW7A 3P7YA 5AYZA 3I6RA 1G69A 5G2IA 4HSNA 1VHNA 3GXPA 5ABTA 3GB6A 2PRLA 1QO2A 2TMDA 4ZZ9A 2VXNA 2P0OA 5HJLA 4IOTA 4NZFA 4JR5A 2JBMA 3TAOA 1MXSA 1TTIA 2RDTA 5K3VA 4CCCA 5AYXA 1D9EA 5TIMA 3MYOA 4WZHA 4PEKA 1H7RA 4FNSA 1B4KA 1SSGA 4I7WA 1UASA 2I14A 3KRUA 3W7JA 1KM3A 1TTPA 4O57A 1T8XA 1K02A 4PTNA 1L6WA 4DBEA 1I2QA 2WPBA 3O8AA 5CPNA 5FEWA 1YXYA 4M6PA 1XL9A 3MHFA 2DP3A 3QEZA 3M0ZA 1JCXA 1KM0A 2YSWA 3DKLA 4O11A 1ZENA 2C18A 3PBUA 2YR1A 1OFQA 3W1AA 4JN6A 1YPIA 4Z1DA 1MEWA 1G4EA 5FEXA 3G3DA 1V7YA 5DCBA 3SW6A 4I7VA 3L5MA 3TNOA 1GJPA 1OK6A 1G7UA 2C0AA 2DZVA 4ZQOA 2GOUA 2WOQA 1ME7A 4IGHA 2WNNA 4LU0A 5KZDA 3E12A 3PR2A 4OBTA 4LVDA 4WX2A 2Y63A 4NJHA 3W2MA 4HKPA 4DELA 3C4UA 4YLWA 1DL3A 4QITA 3GAKA 5KZMA 3S8HA 2A4AA 1JRCA 3A22A 3QQ1A 4MVAA 4O15A 4UFKA 1THFD 3B05A 2GJLA 5G1YA 1K03A 5EL1A 4QIUA 3NQVA 3NZ1A 3QJAA 4JIPA 5DN1A 3CLMA 4UFIA 1RQHA 2JKPA 2BWGA 3HB9A 2GQAA 1N7KA 2UV8G 1LM1A 3CWOX 3PC0A 3GYEA 3M44A 3SGZA 5J5DA 4LC8A 3NPXA 3HG2A 1GYNA 1WA3A 3STCA 4UUIA 4ALDA 2A5HA 4JNMA 4UTJA 4LS2A 3WFAA 1L9WA 2YPIA 4LV4A 1TRIA 1JQXA 3W76A 3P84A 5KZEA 1JCJA 1HTIA 3NO5A 4RXFA 6TIMA 2VFHA 4GUGA 3OVPA 3SZ8A 2KZHA 2Y89A 4MPQA 2FLIA 1L6YA 4O1AA 5I3FA 2ZTKA 4GUHA 4FNTA 1GEQA 4EWND 4JTIA 1YADA 1OJXA 5AFDA 3EX2A 3NQDA 3SSJA 5LHFA 1FWNA 1WAUA 3L68A 2X1RA 1SZGA 2HTMA 3A23A 1XBZA 2Y85A 1VGAA 4Z08A 4LRTA 3VE7A 1QPRA 1W1ZA 3TXVA 5HUPA 5I3IA 3M43A 1UUMA 3D0CA 3QW4B 3C8FA 2ABAA 3L65A 1H63A 1SPQA 5FF2A 3U6WA 3L5LA 2FB2A 4GC4A 2DORA 2V2CA 3M5XA 3F4NA 4LWWA 1I2PA 1EWEA 5DCEA 3DGRA 2E5DA 3H53A 3QFEA 3CT7A 1FCVA 3STGA 3HGRA 1U5JA 3QRHA 2NLIA 3CPRA 2QCDA 3NL2A 4NJJA 4O4WA 3B8DA 3OVRA 1NFBA 4L4MA 5HMSA 4XKYA 3P74A 4NJKA 3DFPA 1Z42A 4MUZA 1H1ZA 3DI1A 4GJ1A 3M5ZA 4O1CA 4O50A 2Y62A 4LOCA 4X3ZA 1FUYA 4C1KA 1EUNA 4M19A 2F7FA 1FCBA 3FEMA 4LS1A 2X16A 3HQ1A 2R14A 3BARA 4DO6A 2OT0A 1W37A 3EWXA 2PRMA 1VS1A 3TR2A 4CQ9A 1KFJA 1OYBA 3LHTA 4HNNA 2O7SA 4ZVJA 3NDOA 2GQ8A 4NZJA 3PUOA 4UCGA 4ADTA 2QCHA 5G1TA 2XN2A 1DJQA 1QWGA 2EF9A 1F73A 2ZDRA 4JTLA 1SFLA 3DHFA 3PUDA 1LBMA 3G24A 3NQAA 1QO5A 2C15A 1OFOA 3VKJA 1LDCA 3UWVA 2C1HA 2P1FA 1H7XA 1VC4A 6ALDA 3B4UA 4KWWA 3KVKA 4RJEA 4IMEA 1TIMA 1TPFA 3H54A 3W7PA 2ABBA 1AK5A 1QAPA 3G3MA 1KLYA 3PBYA 5U7SA 1JUBA 4OU1A 2HSAA 2E5BA 3EEGA 2DZPA 3W1RA 1QCWA 2R91A 4K39A 1WOBA 3C2FA 3I7SA 5TBOA 2V0TA 1GTEA 2YYTA 3W7KA 3TSMA 3RFAA 2G95A 4NNBA 1CI1A 4PL2A 3T55A 5H2ZA 2V9DA 4KFNA 2H8XA 1RD5A 1XBXA 2YCEA 4WXYA 2A6NA 1ZJIA 1GVOA 1G6CA 2WQPA 3EX6A 3GNNA 3R12A 2WSRA 3MP5A 7TIMA 3S9YA 3GXTA 4YMZA 4UR8A 2ZA3A 1NAL1 1S5WA 1GOXA 5KSWA 2B7OA 3PSWA 1TPEA 3PUEA 1M7OA 5I3KA 1KA9F 4LUIA 3NQMA 4UTKA 3G1FA 1ZNNA 2CLIA 1ME8A 2WV8A 2BSLA 3P60A 3PWAA 4AHPA 1YTEA 2QEZA 3M41A 5LSMA 3NM3A 3W3OA 4N6FA 2JGYA 1TRDA 1TTQA 3BW2A 3PY2A 5HULA 2ZRUA 4XQ6A 3EB2A 1OFBA 3TSDA 2CZEA 1W3TA 3GZ3A 3TE9A 2ZZ7A 1SO4A 1WQ5A 3EWYA 4FNRA 3E96A 1KFCA 2QCMA 1MZHA 3W7NA 4LVFA 2E6AA 1TPH1 3WJWA 1P4CA 2J9ZA 3HIJA 1LLWA 3WK3A 2R8WA 3MYPA 4XBKA 1QPNA 3ANYA 2QCFA 2W6RA 1NSJA 3M7WA 5K4ZA 2G5WA 4O1BA 1ZALA 2NUWA 2FIQA 1EP3A 1H7OA 2NWRA 2ISSA 2W0UA 2VELA 4CQAA 3FYOA 3ABSA 5CPMA 3O07A 3NXFA 3C61A 4MYAA 1TV8A 3FJ6A 4RR4A 4AH7A 1Q6QA 3EWZA 4R7JA 1NF7A 1QMLA 2CZFA 4I9AA 3W85A 1F05A 5D37A 2V5LA 3GDLA 4JTKA 1DVJA 3RU6A 1I8JA 4S2CA 3VE9A 1WOAA 2FPVA 3TUUA 1PHWA 1HO4A 3DFSA 4QM1A 4J9JA 3NPUA 4RCXA 3ELFA 1BKSA 1XKYA 2ZZ4A 4OV4A 1FY6A 1KFEA 2ZRVA 3L0NA 4NX5A 4JTGA 2V30A 3VI2A 2A7NA 4NNAA 1G7VA 1X1OA 1ZAHA 1VPXA 2ZQ0A 4K6AA 1VCGA 3HOJA 4JIQA 3NNTA 3GK0A 3TQ0A 2ATSA 1KTCA 1P0KA 4S1FA 2C14A 4O12A 4ZQNA 1I2RA 1H7PA 1GTHA 3ABQA 1PL9A 3W22A 3NQCA 3EX3A 3G18A 2QAPA 5AB3A 1RVGA 2B7NA 2DJXA 3GXNA 3B0VC 4RXGA 2OX1A 2RHGA 2Y7GA 1VZWA 2X2GA 1PVNA 3N3MA 5DXXA 2ZA2A 2Q8ZA 4DEFA 5G4WA 3QM3A 4EIVA 4LW7A 3S5YA 1YPFA 3G0SA 1SW0A 3KFTA 4C1LA 3GDRA 3LB0A 4DPQA 4JY8A 4DBDA 4TIMA 1TPC1 2XFWA 4OHQA 3TW7A 2BLEA 1SZFA 4M6VA 4LS0A 3NQEA 2J6XA 3NQGA 2CZDA 3DHDA 4LNYA 3IRDA 3U2OA 4FNPA 5D05A 2OZ0A 1DQXA 2QJGA 3QPYA 2FDSA 1PIIA 1K7FA 1RPXA 3UNDA 3N34A 3LCXA 1XBYA 3W7HA 2RFGA 2C19A 3LBCA 3QYQA 2OT1A 4H6KA 1DV7A 4NT0A 4XWUA 3GDTA 2NUXA 2VFEA 3W7OA 3W75A 2CLLA 1C8VA 4TR9A 2ALDA 3W7CA 5F2MA 4QJ1A 4ZQCA 4MLRA 4RX0A 3NYZA 4Y9AA 3O16A 3W70A 3R2GA 4E38A 4JTFA 1K7EA 3PBWA 4FX8A 2Z0IA 3TJXA 1OX4B 1TPB1 4LRSA 3STFA 4AWSA 3CIWA 4WQ6A 3MP4A 1ZY9A 2YGYA 2ZRZA 1Z44A 3W87A 2A1YA 1R30A 4LV9A 4UC5A 4JTTA 2DZXA 3BW3A 5I3GA 1A5BA 4AB4A 4XUGA 2Z1BA 5F1VA 1OHLA 3O06A 3LCWA 2ZZ6A 3LGEA 1LTDA 1OK4A 1OFEA 5D2TA 1W31A 1LBFA 5FF0A 4OT7A 2QJHA 3DH7A 5CPOA 3LI1A 5D2YA 3S1VA 4N4PA 4PC8A 2VFIA 3HGJA 3W2LA 3SI9A 3IVTA 1NVMA 2QCGA 5C2XA 3B06A 3EXTA 1XUUA 2CLEA 4LY8A 1B3OA 5CZ0A 3BPWA 1AW2A 2BX7A 5HWJA 4NXKA 3S1UA 3ZR4A 2PE4A 3HG5A 4QSHA 5I3HA 1HO1A 5K2ZA 5CKSA 1FWTA 3W1QA 1LORA 1KLZA 2YZRA 2B7QA 1GQNA 3CQ0A 4BI5A 4H4IA 1QNVA 3LCFA 3STEA 5CGQA 1XDMA 4R53A 4JTSA 3K30A 1KBJA 1ZAJA 1H61A 3LXBA 3RNDA 4TO8A 2CLOA 3OHIA 1QR7A 1MSSA 4S2BA 3TU9A 1ONRA 5F4WA 3OVQA 5HR7A 3T4CA 1FDJA 1HFBA 4HHPA 2TSYA 5D2VA 3V1PA 3FKRA 3SFKA 3P67A 3UD6A 3TIMA 3N73A 2YYUA 2VENA 1GYLA 2GVLA 3WK1A 1U83A 2QUVA 4ML9A 4MY9A 1W8SA 1OFDA 4JY9A 5J5RA 2ZZ3A 3RLVA 3HO8A 1GVFA 2OCZA 4P61A 2DZTA 1KV8A 2EPHA 1WX0A 2ISVA 4JX5A 3C6CA 5GVJA 4O17A 4RLIA 4EF8A 1G4SA 2G96A 2VOMA 4TX9A 2ISWA 1WDWA 1OFPA 4UTWC 1DHPA 3FLUA 3LTSA 1SZEA 3JRKA 3F1QA 4ADSA 1SSDA 2VFFA 4A3UA 3Q2DA 2FPTA 1XCFA 1ZAIA 4ORMA 3HG3A 2CLFA 1LRQA 4DQWA 3HPZA 1JCYA 1RR2A 1HG3A 3G1XA 5FF4A 4CCDA 4WOZA 1RQBA 4WY0F 1DKWA 5AN7A 4UTMA 2WJZA 3NEVA 2GVJA 3IIVA 5HWMA 4JD4A 4FIQA 4IQLA 1NF0A 1KTNA 5BW6A 1TB3A 3TH6A 1GVRA 3FOKA 4NUWA 2A7PA 1P5BA 5G2HA 1UJPA 1J5TA 1AW1A 2ZRXA 2QJIA 2QUTA 1OF6A 4OQVA 1FCUA 3M9YA 1A5SA 1VJIA 1MO0A 4IMCA 3GAYA 4KFOA 1ADOA 3PBVA 3OEXA 1M7PA 4IMDA 5DY3A 3GKAA 3KVLA 4MJMA 4PODA 3ZS4A 1Q45A 5L6UA 3P5YA 4FEZA 2V2DA 1RV8A 3W7EA 3C2OA 1EWDA 2AGKA 4ORIA 1FCQA 4GUFA 5FF7A 3MI2A 5K4XA 4Q32A 1GG0A 1SU5A 3VFLA 4JX4A 1TMHA 1Z41A 1O4UA 4N9EA 2H90A 3W83A 3L2IA 2FFCA 2ZRWA 4WY0A 4N9BA 2BTMA 4UTLA 3USBA 1GT8A 3EKZA 3WJXA 4IX0A 1AMKA 5LHEA 4HNUA 3B04A 4FX6M 3HG4A 5BOOA 1H7NA 4Y90A 2EKCA 3O6YX 3MO7A 2ZA1A 2NX9A 3FS2A 4K7VA 4IMGA 1WXJA
chains in the Genus database with same CATH superfamily
2WMJA 1W3NA 1SFSA 1L6FA 4DB7A 3MSGA 4WGXA 3SECA 3N19B 4L7ZA 1H5YA 1JYNA 3W86A 2NV2A 3JZUA 3PSVA 3W7RA 4EPKA 4G1NA 1TG7A 3URBA 4Z2GA 4LBUA 2J7EA 2ISDA 1XIIA 4DXXA 2ZTJA 5A8NA 4IPIA 3EXRA 2VKZG 4D8ZA 3WL1A 2G3JA 1EGVA 3SB0A 1F3TA 1V8EA 1QW7A 1FHDA 3DUGA 4ZXOA 3KCJA 4K1WA 2REQB 2O7QA 1TX0A 1DQUA 4E4UA 4W5UA 2V38A 3TN4A 3T6CA 4CLMA 1QTWA 2VYOA 3WNLA 1VFTA 1TZ7A 3TCEA 4QG6A 2BFGA 4WLCA 2XSAA 3BQ5A 3PB2A 2XG9A 3EWUA 4FP1A 5FA5A 1BFNA 2RDUA 4AEOA 2J13A 4Z1BA 3BG5A 4GK8A 2QAFA 3LM7A 3MZ2A 4J4KA 3KXQA 3RX4A 4E5TA 4NJGA 1POKA 5HA7A 3W1TA 4D2JA 3GNPA 4H2HA 4F0HA 4WHBA 3B0UX 1JCMP 4H1ZA 1ODUA 1W5PA 3LLFA 1UBPC 5FACA 1VLIA 1ESWA 2I57A 3AIBA 3WSUA 1S2CA 5KZ6A 3IJQA 1TWDA 3S9IA 1F74A 1V5XA 3DFTA 4OWGA 4ZO9A 1BG4A 3U3HA 2DSWA 3IIOA 2UY2A 4KBXA 1YRRA 3W2KA 2OEKA 1TPUA 4H9YA 1BYDA 1W1PA 1P0DA 2A2IA 2GGGA 3I3EA 5KINA 4PTMA 3BQ6A 2CC0A 3LBOA 3N04A 2O9PA 1FDYA 5C7HA 2BBFA 1S46A 2Q02A 1EIBA 2YJQA 5A5WA 2XN1A 2GL5A 3UJEA 4FNUA 1QI0A 2YKKA 2FMNA 3SIZA 3JW7A 1TFVA 3LOTA 4MFDA 2Z6JA 3N18A 1IF2A 5TQLA 1H41A 1RA0A 2QR6A 3UZXA 5A8MA 4GX9A 1QNSA 3LGGA 3DXIA 1IEXA 3CWNA 2YFNA 2HBVA 1Y65A 4I9TA 2DJLA 4CCZA 3EOEA 1Q6DA 3N13A 2Z7GA 3GNDA 1A5CA 4TXEA 3UZZA 4J35A 1ZP3A 2VD9A 4MHBA 3D5HA 4O19A 2Y1HA 3EWWA 1EEXA 1UKPA 4UTTC 2VFDA 3TROA 3VX1A 1UD5A 4LBRA 4GNKB 3WLMA 3IJDA 3G6LA 5HXMA 1EP2A 3RIKA 1AJZA 3QMTA 4QHRA 1EHNA 1W54A 2YZ5A 3BJTA 2EJ1A 3NWRA 4IH3A 4ICCX 1UR3M 1VFMA 4M24A 2WK2A 3TMLA 2VC5A 2J4GA 5AYIA 4DUXA 4HN4A 1I0BA 4LF2A 4A29A 1TVPA 3WEOA 3NQ2A 1REQB 1UZ1A 4X9SA 3EWCA 4HYRA 1EEPA 4GQBA 5T26A 2ZXQA 2P3EA 4PFHA 2L5HA 3RILA 3BL3A 1XIDA 3GUGA 1RAKA 2ZICA 5CGTA 3TQKA 2NZLA 3UWEA 4YCOA 2R94A 3C0QA 3ID7A 5AHFA 1RH9A 4E2DA 1V0MA 2WMFA 3GU2A 2O0TA 4UTWA 1EB3A 3GY1A 2OLSA 5KITA 1KKOA 1GOOA 3QZ6A 4AUBA 3RX3A 3JR2A 3RUBL 1O5XA 4R3UA 1K70A 4GYPC 8A3HA 1A53A 1IQ8A 3IAPA 3VUPA 3UG3A 4XD6A 1FH9A 2CZ5A 3IIPA 2EHHA 4L4PA 1W2VA 1KQYA 3N4AA 4C6JA 2NXHA 1UUOA 3BXWA 2VD8A 2O92A 3V5OA 3W7GA 1WV2A 3R8RA 3L21A 4X61A 1K8ZA 3LS9A 2GUYA 4JFSA 2OJPA 1U1UA 3QPZA 3ISIX 4KFPA 3CM4A 2VOTA 2DIKA 1ME9A 4K8EA 1BEUA 5A8GA 5E0CA 1BQCA 3QR1A 4GQ0A 4DPPA 2A7RA 2E6FA 3OP2A 4O1EA 4AZIA 1VBUA 2PDCA 3UVAA 2H3DA 2BGSA 3NTYA 3FAXA 4IFKA 3LENA 2J62A 3AWNA 2EEXA 3M6DA 4ROQA 2INFA 1V6WA 1MRQA 1PHQA 4JEQA 1W9VA 2UBPC 4CNOA 1TV2A 4M56A 4W87A 2OB3A 3WDIA 1B9BA 4MNKA 2VL4A 4N2YA 4Z0SA 3OGVA 4D6DA 2A6LA 2OZTA 5G1MA 4AXNA 1YLVA 2BXVA 3N25A 1JR1A 4LUTB 2V81A 2WZEA 1FFQA 3TQVA 3G1SA 1MW2A 2Q01A 4KEMA 4XSLA 2YW3A 1UD4A 2NV1A 4Y6GA 2NXIA 1U30A 1PX4A 1W17A 1DJGA 2V3GA 5EMJA 1XM3A 2YDSA 4I9JA 2YB1A 2BHYA 2J6VA 3M46A 4FX7A 5C9RA 3R89A 2XZ9A 3SUUA 4GFIA 1O66A 2CFFA 4GJJA 5I2UA 4MOZA 1NEYA 5D2XA 2O4MA 1VYSX 4MWAC 3WDJA 4ZQMA 2OWCA 4US6A 4WSKA 4HHLA 4KW2A 3EX1A 3VINA 4GXWA 3N2CA 1XH2A 2VC6A 1R46A 2ZXBA 3M0MA 3W28A 1A5AA 1VEMA 1X1NA 1TWIA 3T0BA 4Q4OA 1S2VA 1FHLA 3H22A 4JOMA 1YTDA 3OBKA 2PLCA 1QHZA 4UTHA 4KGLA 3OTRA 3CMJA 4Z2KA 3WQ6A 2WVVB 2XIMA 4R33A 1XX1A 1JYWA 1R3RA 3GW0A 1MEIA 1T99A 5JBEA 2CPUA 4AXKA 3P6LA 2WPGA 3EMQA 4UIOA 1AW5A 3BICA 4UMAA 3WLHA 4EACA 1LWJA 5I77A 3RRXA 1WXYA 1V77A 2QIIA 1T6MA 1EXBA 1QNRA 1ZB5A 3LX9A 1O1HA 3C52A 3BJSA 3H7VA 1MUMA 3GVRA 4MYXA 4V1XA 2WKJA 2D2HA 6ENLA 4O53A 2IQTA 5BOEA 3OG2A 4P8WA 2GGIA 3ZWSA 5U4NA 4GVGA 1E9IA 4E2BA 2V5DA 4PTVA 3T78A 2TAAA 1CB7B 5C8BB 1DORA 4UB9A 5I00A 2OKOA 7TAAA 1LQ2A 2PP1A 1RBOB 5K9XA 1RY0A 2H3BA 4D72A 1YNYA 2CCRA 2WBKA 3CAWA 1HKIA 3QC3A 4YU1A 4UFHA 2X1UA 3T0AA 5AC6A 1F5ZA 4KERA 1VYPX 4L65A 1DYSA 1P6CA 1ZBVA 5C7VA 2AQVA 3B9EA 4LJ3A 2CU0A 1I6NA 1D3HA 4JYEA 4S23A 3T8QA 3WJSA 4M5PA 2BY1A 4Z42C 1WZAA 2YXGA 3TTEA 1H3GA 4WJXA 4DM1A 4XO6A 2ZCGA 3S5ZA 3WQVA 3WJZA 3QXBA 5C2CA 2J74A 3R13A 4UTTA 5KMYA 1AH3A 1Y8BA 3EZ4A 3T2OA 1B3WA 1N8IA 1EBHA 1D8WA 1WKYA 3AMLA 2SFPA 4A3HA 1WUEA 1QK2A 1P0EA 3IARA 1XYMA 4YPJA 4DNHA 1QBBA 2XVPA 1SMAA 3EPNA 2X30A 5LKYA 4KKXA 2QCLA 5BOFA 4V1YA 3CZEA 3OG3A 3BCDA 2E5CA 3ZOAA 4ZL1A 3WL0A 1Q6EA 5ECUA 3E5BA 4X22A 1ICQA 1W9UA 2V69A 3KTXA 2P10A 4IMAA 1Q5MA 3SEPA 1OCBA 3O63A 1YTKA 4JIEA 3WBYA 2PDLA 3NOEA 3PPCA 3U9IA 4PSPA 3VX0A 1ONXA 3HZ3A 1R2RA 1TWWA 3WDPP 3TYZA 3TYBA 3ES8A 2PTYA 1W5QA 3RPTA 3UY7A 3P82A 4YVVA 3MSYA 1I1WA 3M16A 2G97A 1O5QA 3PPGA 4QQUA 3GVGA 1FHUA 1JGMA 4HIBA 3ZWTA 4ZXLA 4PZVA 1IIGA 4MUPA 3TFCA 3WDHA 2WLZA 4HHMA 1PE1A 3VIOA 1OVDA 2CLMA 1DJXA 4K37A 1N8FA 1JDEA 1ZHAA 1V93A 1A50A 1O5RA 6XIMA 3ABRA 1XPGA 3LDVA 1G4TA 4LUSA 4FALA 3BAWA 2GVEA 4WJEA 5LGXA 3TJ4A 3OA3A 3RCNA 3GU1A 4F0RA 3W84A 3NVTA 2OTDA 1UD6A 2TYSA 1US0A 4FF7A 5FIPA 4MB3A 4XVDA 1ENUA 3FX4A 4LCQA 5GJPA 3ZLHA 1GWJA 1BYAA 2JALA 3CIXA 3LYEA 5H8UA 4DF1A 2HS6A 3DDMA 1OG0A 4ZFMA 1R2SA 1PO9A 4X0VA 4DJFD 3QHOA 4U3AA 3LTPA 4N6EA 4PRRA 5CAHA 3C56A 3MMUA 3S4TA 1K8XA 4C5ZA 1OX4A 3BLOA 4B3ZA 2DW6A 1C29A 2AKZA 1OYCA 4CVWA 3BW4A 3GR7A 4FI4A 5F2LA 3TXZA 3LHWA 3PG8A 2J66A 4XTIA 2DZSA 1SQ7A 1O5KA 1R47A 3E0FA 1KRMA 5BMWA 3A4AA 5BU6A 1UQZA 3CHDA 3DECA 3CYVA 4ZFCA 3WH6A 4GVFA 4UR7A 2BZNA 4RPPA 3H4WA 3RCYA 5BNKA 2DU2A 3I65A 3MUXA 4UXDA 2CLPA 2VRKA 1GGOA 2H8ZA 2QF8A 1XH0A 1TPVA 2ICSA 4ECLA 1VEOA 4LB4A 1OCQA 2WW5A 1CENA 4X0NA 4UZUA 3MDUA 1FP8A 4NJIA 1U5VA 1UYQA 4C6LA 3ZSSA 1W1YA 2RGLA 3R5EA 2Q3OA 8TIMA 4NKCA 4R7WA 4GMEA 1R85A 1T96A 1PUDA 3SFWA 4BCEA 1S1PA 3TC7A 1CGTA 4Q7BA 1LQAA 1VEPA 2GDVA 3LCLA 4CNSA 5LXEA 1RD6A 3VCRA 1L2UA 3EKLA 1X96A 1CWYA 2DH3A 5M5DA 4Z2IA 1CECA 4FLQA 1EZ2A 2CBUA 3TN5A 4HZMA 3NL3A 5F4XA 3FYYA 1MW0A 5D9PA 1MW3A 4GH1A 2HNHA 3N29A 3A9BA 1H51A 4QBXA 4ROPA 5D38A 4Z1AA 4HU8A 4GBUA 1P0NA 3HGOA 3TYAA 4AEFA 1YXCA 2C3ZA 2W3ZA 3FEQA 4IJRA 2X0SA 3L23A 1XHGA 3N2OA 2DFAA 3UT0A 4Q8NA 4ZENA 4RNFA 3TAOA 4URIA 2V5CA 4ACYA 1XD0A 1SJAA 4PEKA 1H7RA 2VCAA 1B4KA 3T9PA 4P7LA 3KRUA 5HMFA 3W7JA 2ONEA 5IFTA 1TTPA 3KS6A 1T8XA 1J6OA 1XICA 1K02A 3OYZA 5FD0A 3MUY1 3NUKA 1WE5A 4TX8A 4LXFA 3ZVHA 4BEQA 4H8VA 4PMJA 3BURA 4U2ZA 2YL5A 3BH4A 1C7TA 4O11A 1ZENA 4FXJA 3W1AA 4UOJA 5FEXA 5JH2A 4AQLA 3G3DA 1V7YA 3ZT5A 3SW6A 4I7VA 3PFMA 1GJPA 2XM1A 1YHTA 3K8MA 4ZQOA 2WZIA 3VD4A 4IP5A 3E12A 1GQLA 4OBTA 4E4FA 2OVLA 2ZXDA 1HGWA 3W2MA 1XSIA 5REQA 4HKPA 3MMWA 2YA1A 4DELA 5KZMA 2A4AA 4O15A 1JAKA 4S38A 5HJXA 3UJ2A 2OSXA 1XLAA 3RHGA 2CXGA 4HBKA 3NQVA 3NZ1A 3QJAA 4WKHA 4JIPA 4PTDA 3QTGA 1RQHA 4PB5A 4PGLA 2GQAA 1N7KA 1LM1A 3KW3A 3T81A 3CWOX 3SY8A 3SGZA 4LAOA 3HG2A 4AU0A 2PSNA 3STCA 4PMXA 4UUIA 2VVSA 3MUCA 4MJ4A 3ZQ9A 1QNQA 5T91A 1BXCA 3APTA 5I23A 2YLLA 1E5NA 1JQXA 2NSXA 4IFKB 3IJ6A 1QW8A 2IKHA 4H8NA 3G77A 2P50A 2J7DA 4B5XA 2FLIA 4IIEA 1CNVA 4ZTYA 4YVPA 4PBFA 1TUFA 3VO0A 4WKFA 4RE2A 4EWND 4HZ6A 1OJXA 4V2XA 5AFDA 3EX2A 4QCFA 3SSJA 3UG5A 3ITLA 5FOOA 4E2OA 2Y85A 4P7QA 4MADA 1W1ZA 3AU6A 4DUWA 3MVIA 1OGBA 3M43A 4BZYA 3CHFA 3D0CA 3QV7A 3C8FA 3U6WA 2FB2A 4GC4A 2JEPA 2DORA 3KZSA 5D8WA 3DN5A 3AXXA 2FTWA 2E5DA 2EPLX 3STGA 3GBEA 4A3YA 2NLIA 1UWAA 4E6MA 5AC4A 4O4WA 1J18A 3CASA 3OVRA 5DRCA 2XIOA 2YLAA 1NOFA 3LPOA 1K1DA 1KBLA 4NJKA 1MWOA 4MUZA 4YHGA 1XYFA 1HF6A 4CVUA 4O50A 1WKFA 2Y62A 2V67A 5HANA 1FUYA 2QXWA 2AL2A 3E2QA 3FEMA 4IIFA 4OBRA 3T42A 4GGHA 2XH2A 3HQ1A 4JFVA 1ONEA 1JNDA 3RM9A 4CQBA 3GXFA 4D6CA 2OT0A 5A1AA 1W37A 3EWXA 5H1WA 2GOKA 2PRMA 1VS1A 1KFJA 2PLJA 3ABZA 3NDOA 2GQ8A 4NZJA 3GVVA 2FZDA 2RGMA 4UCGA 3WUGA 1E9YB 2VC9A 4H9UA 2QCHA 3N11A 4TVUA 2XN2A 1DJQA 1F73A 5HBFA 4GXPA 3CBWA 3GC5A 3VOGA 4J3SA 3NQAA 3L7RA 1KGWA 1ZL1A 3UWVA 3KE0A 3OQ8A 1VC4A 4RV3A 2WVSA 4RJEA 3W01A 1J12A 4DXKA 3MA8A 4V28A 1AK5A 1QAPA 3HV8A 5A8PA 3QGKC 1UWQA 2E0PA 3W1RA 4HPGA 2QV5A 5LIUX 1QCWA 2R91A 3REQA 3I7SA 3TSMA 4Q8TA 1CI1A 5E5CA 4PL2A 5H2ZA 2VCBA 4KFNA 1RD5A 1XBXA 1O1ZA 2A6NA 3M0KA 1ZJIA 3R58A 4EAMA 2OXNA 3PAOA 3MP5A 3S9YA 2POTA 3GXTA 2ZA3A 1NAL1 3BSMA 2B7OA 5HK4A 1D3CA 3VOCA 4NILA 4H7CA 2VM8A 4JQ2A 5I3KA 1KA9F 4LUIA 3H2CA 3NQMA 2VJXA 2Y5SA 3BAYA 4DJEC 3B8VA 2BSLA 4GX8A 2QEZA 3FK4A 2IQDA 2C0HA 3NM3A 3PFRA 4N6FA 1KR1A 2JGYA 4I5RA 1RXOB 1TRDA 1XS2A 2VUNA 5HULA 4KH2A 4P7OA 1OFBA 1V0NA 4NI3A 3TSDA 2J7HA 3TE9A 2ZZ7A 4HOWA 3PNUA 4FNRA 2WSPA 4LVFA 2J9ZA 2XH0A 1NWRA 3QTPA 2W6RA 3S2NA 1GKPA 3CMGA 4CU8A 3SUSA 9CGTA 2ZUTA 3ABSA 3GU9A 1TCMA 3NXFA 4YTQA 3RLGA 2XFFA 4MYAA 3NCOA 1PZ3A 3VGDA 1E0XA 4R7JA 8XIMA 1QMLA 3GTHA 1F05A 5DT5A 3F4CA 3GDLA 2VZUA 3DERA 4QR6A 2EPKX 4B5UA 3DFSA 3BV7A 2EPMX 3AISA 3NPUA 4AMCA 1P6BA 3ELFA 1BKSA 1SJCA 3ALGA 2WMGA 3WBEA 2R6OA 4NX5A 3L0NA 4DZAA 2V30A 3MUZ1 1VENA 1GW9A 3EDFA 1NY1A 4KIEA 3HOJA 3P93A 4JIQA 2Y5EA 1KTCA 1P0KA 3CK5A 4IIGA 1MUCA 1OQFA 3ABQA 1WB0A 3W22A 4ZE5A 2X1IA 5AB3A 2R1PA 1FWJC 1RVGA 3HPFA 5XINA 3MDWA 2Y7GA 2X2GA 3N3MA 2Q8ZA 4DEFA 5G4WA 1JZ2A 1AQMA 1H09A 2WAGA 1XIGA 3E2VA 2OQLA 1KNWA 3S5YA 1WKEA 2WM1A 4JTDA 4LAKA 3HURA 3TA9A 3FV9A 1WDRA 3G0SA 1SW0A 4KQNA 1JF6A 4C1LA 4ACZA 4DBDA 1VRXA 3MB9A 3EGJA 4Y7EA 4J1OA 4LUSB 3KLKA 2CESA 2GFTA 2CZDA 4HN8A 3IRDA 1NQKA 4OVXA 3ICJA 4XZMX 2OZ0A 3K1DA 3QPYA 3NO1A 3VC5A 2FDSA 4XAFA 1PIIA 1RCXB 1K7FA 3LCXA 1XBYA 4IGNA 3UCCA 1SM9A 2X0HA 4UOQA 2PWVA 5AYBA 4H6KA 4NT0A 4XWUA 1A3WA 3GDTA 2NUXA 1UD2A 4YTUA 3R8HA 1HKVA 4TR9A 1EJWC 3ITYA 4QJ1A 1Q7QA 4MLRA 4RX0A 2YA0A 1J01A 2ZKMX 3DFYA 3SCVA 4JTFA 1K7EA 3PBWA 2Z0IA 3TJXA 1OX4B 3RM8A 1LL4A 1UWRA 1ISYA 3R11A 3STFA 4WQ6A 3MCNA 4LYPA 1U22A 1J2BA 4B4HA 3PZ9A 2H9AA 1Z44A 1HKJA 4B5TA 3GC4A 3W87A 4AX6A 1R30A 5C9UA 1JXKA 3BW3A 1V03A 1B31A 2DH2A 3WUBA 4AB4A 4UQ9A 3FVDA 3ITCA 3CB3A 2Z1BA 1Z6KA 4ASTA 3RLHA 3LCWA 4KWUA 1LTDA 1OFEA 1W31A 3U0HA 5ABHA 5IXEA 2PBOA 2VWSA 3IRSA 4PC8A 3MKKA 4AD2A 1M65A 4C1NA 3OBAA 4XUYA 2RUSA 3AYTA 5CZ0A 1B3OA 2OZ8A 1J0JA 5HWJA 2BX7A 4JCLA 3KOYA 3S1UA 4O0QA 4L1WA 1W1A1 1FWGC 3ZR4A 3CL8A 5K2ZA 3M7SA 3W1QA 4I9MA 1LORA 2XH7A 2ZVIA 5JU6A 4RZBA 4L5ZA 4H4IA 3KZPA 2O55A 5E09A 3RO6A 5CGQA 4JTSA 3GIQA 2E25A 3LXBA 2PDGA 1DWAM 2CLOA 3IK2A 3OHIA 3VDAA 2ZE0A 5F4WA 1E4MM 4A8NA 4RNJA 4MM1A 3UD6A 2Z29A 3N73A 1V3LA 3WCZA 1FWIC 1OG6A 2GVLA 4JCMA 4RDYA 1IT0A 4N7QA 4OBSA 2HVMA 3KLLA 3HO8A 2MUCA 1GVFA 2HCVA 1ZJBA 2CKRA 1J10A 1RK5A 1KV8A 2EPHA 1WX0A 3PN8A 1BF6A 2PZNA 4RLIA 1G4SA 4TX9A 1ZS2A 3LTSA 3DYPA 2F6UA 1SZEA 2GGEA 4HOZA 3F1QA 4HTYA 2PB1A 2XVNA 3Q2DA 2FPTA 2DQXA 3NZGA 4H9ZA 1CGWA 2E4TA 1JCYA 1QXLA 4S3BA 5CPQA 4WOZA 3ZVHB 1RQBA 1DKWA 2WJZA 3NEVA 2GVJA 3IIVA 4DJEA 1NQ6A 3HN3A 1XIHA 4NSBA 4QLKA 1KTNA 1UHVA 2X7WA 1TB3A 3WDQA 1P0BA 5I06A 1CXIA 2FHFA 3EDJA 5M03A 3H2MA 1OF6A 4OQVA 1FCUA 1A5SA 4HCDA 1AZ1A 1MO0A 1WP6A 4ZSTA 1YDYA 1M7PA 4IMDA 2O9RA 2X2YA 3KVLA 3ZS4A 3CUJA 3DFHA 4PODA 5REQB 3S2MA 5HNNA 1RV8A 1ITQA 5CEWA 4DVOA 3WH7A 3C2OA 1I75A 2AGKA 5FF7A 3MI2A 4F4RA 5DMYA 1GVIA 1XPYA 1EDTA 3W83A 1XYCA 4UCFA 4W5ZA 4AY8A 1XJBA 1ADDA 2PDIA 2BTMA 4UTLA 1MUWA 4NASA 1GT8A 4IX0A 4FX6M 1NOUA 2FH8A 2FHBA 4V27A 3QQWA 4Y90A 4QTGA 3MO7A 2ZA1A 1IEWA 2NX9A 4I5XA 1OD8A 1JPMA 3LERA 2FMOA 4XVEA 3MJYA 4QDMA 3M5VA 4UMCA 3LV6A 2NQLA 1FWCC 3DYOA 4LYRA 2A0NA 3CQHA 2E6YA 2DZBA 5E93A 4MY1A 4KEVA 4DJFC 1OT1A 4B92A 4U3CA 3GG7A 1J11A 1G1YA 1F4HA 2E3ZA 3Q94A 4AF0A 1MQPA 2WC3A 4A21A 2WC7A 1PTAA 2NQHA 4HPHA 4US5D 1FA2A 4OFCA 4QEEA 3TMQA 3GE7A 2IQ0A 1RZMA 1XCXA 4A6GA 3PNZA 3I7QA 1OC6A 2BOEX 2AL2B 2DSKA 5LA1A 3DENA 3H2OA 3NSXA 2PDBA 3BAJA 4E8GA 3SRKA 2I5IA 3EPOA 1JFHA 3VDGA 3H7RA 4GQGA 1W0MA 3SURA 4RDWA 4JL1A 3BE7A 2Y7FA 3DHPA 1KTBA 2WSQA 3BG3A 1E15A 2QZRA 3MBFA 4P8UA 3TFXA 3UWYA 3MBDA 3OBEA 3Q4DA 1UWSA 3BOLA 3KS5A 1GZJA 1AG1O 5C5YA 2WSYA 1QW9A 5DLCA 3MCMA 4TX6A 3IV3A 4A4AA 3JZEA 1ZZMA 5CBBA 1HGYA 2ZX8A 1GVQA 3PM6A 4GJIA 2D1ZA 3M0IA 1E5JA 1TYGA 3UG4A 1XW8A 4B4FA 1D7FA 4GRSA 3S42A 4O28A 2V8ZA 1UIPA 1JUKA 2W66A 1CIUA 2YB4A 3KL0A 3EEZA 3E0VA 3OLGA 1M68A 3KWSA 4A22A 3LI0A 4FHAA 4AZ7A 2ODOA 4NXSA 3REQB 3VDCA 2VZOA 1E70M 4IGMA 4U5KA 3CB8A 1YDOA 4CNPA 3LHUA 2NV9A 3WY1A 5BXPA 4HJFA 1XUZA 4M7SA 4LC6A 1WCGA 5HNUA 2PDXA 5F2IA 4ZR8A 4F2UA 1K3UA 4JEJA 2F84A 2B81A 2P8CA 4JTEA 2ZZ1A 5GNYA 3KVMA 1T5AA 3QFWA 3OHMB 2E9MA 4B3KA 2WYSA 4DF0A 3S9ZA 4OOUA 4IPJA 4RK8A 3KVJA 2WHMA 4JX6A 5JIPA 1OZQA 3CT2A 5A2BA 2C1GA 3IJ8A 4UNKA 3W1NA 5FESA 3AWOA 4JN7A 2HZGA 3O1NA 3MV01 4TU1A 4Y8EA 3HMJG 3IVUA 4BA0A 5HATA 1ITCA 3EOOA 1EJ7L 4S3GA 1ICSA 4WK9A 3N6JA 1KB3A 1F3EA 3NAVA 5CSSA 3JUGA 1KR0A 4DBWA 1K7XA 3SCTA 3MI6A 1IYXA 2QMJA 4XZ9A 1XLMA 3NR0A 4HD5A 3OLIA 3P14A 3W7LA 3L67A 3SADA 1UBSA 2JKAA 2WMIA 5CSRA 2OSYA 1VP5A 3MHUA 3GR8A 1DTUA 2PU0A 3GHUA 2HK0A 1XWYA 1BTCA 4Q4KA 1IZCA 4O8AA 1YE4A 5DF0A 3DFNA 3RF9A 3W7MA 5HNRA 1DOSA 3LPPA 3UYCA 4HA0A 2HDJA 2NVDA 5AHMA 1KFKA 3BCJA 4IF2A 2C6QA 1UC5A 2VHLA 3B9AA 4C7FA 5FJIA 5HWNA 1XRFA 1U2YA 3HQPA 5TAOA 4LQ1A 1DP0A 1FKWA 1SUXA 3GHRA 1VRDA 1F3WA 3UJRA 2Q3RA 2INEA 4HPXA 4QNEA 1A0CA 4LGXA 4HMEA 3KUMA 1GKRA 3SJ3A 3G1VA 4LT9A 3QMRA 3S6OA 2DIJA 3KHDA 1AUSL 4GYFA 4ML4A 2GZXA 3U7BA 3C0SA 1LRTA 3KRBA 3QZEA 1B3XA 1BGAA 2WVTA 4R27A 5HINA 1I4NA 1JDDA 1E6QM 2QQ6A 1AL7A 4JIHA 2BVDA 1FH7A 2RH9A 4ACZB 3BDKA 2Y70A 1BWVA 2VCCA 2ZBTA 2J24A 4UFJA 1NDYA 2I9UA 3UZ5A 2D0HA 3E6EA 3AS3A 1A4LA 3GR4A 4O0ZA 1OYAA 4Z2HA 1QOPA 3MHGA 3BV4A 3W4RA 3CTLA 4M8UA 3TWBA 4D9PA 1XC4A 3NSNA 2Y8VA 2F8QA 1JPDX 1GW1A 4L1GA 1H49A 1QFEA 4O1DA 3CEUA 3LMZA 3CUGA 2E9LA 3L4UA 1GOWA 4AFYA 2ADAA 3A9IA 1I2OA 1TJ2A 2F6KA 2X40A 4R9OA 1BXBA 1BQGA 4ZB2A 3N2MA 2ZUMA 3KOWA 4W4QA 4P5UA 3KRSA 4ZOEA 4N9DA 2DQWA 1FDZA 2QGYA 1VH7A 2CWNA 2EQDA 1CYGA 2H9AB 4GZ7A 3TJLA 4ZEPA 4GI9A 4AZGA 4IWWA 4MDPA 4XTDA 3TW9A 1G5AA 3TLQA 5BCAA 2VVNA 2GQ9A 3V36A 3AZSA 1I1XA 1LCOA 4K7YA 2IKJA 2PDJA 4NG3A 3H55A 3G8RA 3GHSA 4XX6A 3IGSA 3IGXA 3NQBA 4I7UA 3B8TA 3N9SA 3E49A 2PMQA 2V2HA 2B31A 3M0YA 1PKNA 4EWJA 1IEQA 4QQ3A 3E02A 3C0JA 1FWAC 4C1NB 3ATZA 2QKFA 3TJIA 1E0WA 3NQ7A 4TQTA 1E73M 2C13A 4HNCA 2Z6IA 3TAKA 4QX4A 4E0CA 5D32A 3T8LA 3G8EA 1V3MA 2Y6ZA 4CN1A 3R8GA 1OX5A 1LOSA 4PUUA 3VFCA 1EPVA 1MYRA 2PWGA 3KBMA 4W7VA 4D6JA 4PUJA 4PL1A 4C6MA 1LLZA 1VBRA 1VIZA 2AOSA 1BD0A 3ANUA 1VFOA 1UA3A 4OTKA 1B30A 3O6CA 5BXTA 2CLHA 3MCOA 1H7WA 2O9OA 1UD8A 3P62A 4Q4PA 1VHCA 1CX9A 3CHCA 5D09A 5CG0A 5IRPA 4GNJA 4L4LA 3H70A 1MI3A 1NP2A 4TTUA 4H6QA 4ADUA 1GCYA 4CD7A 2BY3A 3RITA 3FW6A 1CTNA 3AI0A 1Q63A 1PPIA 1GUVA 5LZLA 1IXOA 1R87A 3MANA 2OGYA 4PRTA 1GOMA 1XLCA 4U10A 1Q3NA 4E4PA 3GIPA 3NA8A 4ZOAA 1X6UA 3UZJA 9RUBA 1UD3A 4AWTA 4PUWA 3UXLA 1FWRA 2OO0A 3W2NA 4IJBA 3RAOA 1WDQA 2E09A 1UWIA 2PD9A 3HPXA 3UWQA 3OJGA 4ZQRA 3CAVA 1UCWA 4IGSA 5CPTA 1B0IA 4FZIA 1DJZA 2DT2A 1NTHA 3AFBA 3R6IA 3APYA 2J88A 1QPQA 4HNVA 3L0GA 4JS3A 5E0KA 3AYVA 4GIEA 1U33A 4TVCA 1C92A 2QCCA 1RALA 3GKFA 3IACA 2PDUA 1TPWA 4IUGA 3BGJA 4DO4A 3PTDA 1Q6LA 4O52A 2CLKA 2HQAA 3S5OA 5EPDA 1IXNA 4NF7A 4QDWA 5I6SA 3O0KA 1JPKA 3WNOA 3OZYA 3B9NA 2QLYA 3ZFHA 3GXMA 1O60A 1GZGA 4ZOBA 2PEVA 1JI1A 2ZX9A 4ICNA 3H2NA 4M7TA 1EGMA 4I8DA 3ZR6A 2DSVA 1OC7A 2C16A 1VPYA 4ZA0A 4EAYA 5G5IA 2ZZ2A 5J04A 3VMOA 2PF8A 3G0XA 3OOQA 2WZMA 4JNZA 2PURA 4HT3A 4BI7A 2B4GA 3KHJA 3B4YA 3CUIA 1JRBA 3DIPA 4W84A 3I7RA 1UROA 2E67A 1H50A 3RR1A 1WUFA 4BEUA 1KM6A 1BRLA 1IIHA 3AIUA 1HJXA 3GO2A 2PRHA 3LMYA 3W23A 1DXEA 3WDRA 3WQFA 4FXRA 3PANA 3CGTA 1ONWA 3WJYA 3PZNA 3ARYA 3M64A 3W1XA 3EXSA 2V3FA 2NT0A 1VYRA 1AJ0A 1R0MA 1OWQA 4AF0B 3RPDA 2HXTA 3W1MA 3F2BA 3LK6A 2G8ZA 4OUIA 1AL8A 5C54A 2GVGA 4DY1A 4LVAA 1Z89A 3I6EA 3TLLA 3FNDA 1SO6A 1QK0A 3GFXA 3FJLA 4TMCA 1QDSA 3RM4A 3UXAA 1P6WA 2X05A 2G3IA 2XGBA 2NXGA 1UZHA 2NLYA 4FAMA 2CITA 3L2MA 3N14A 3FAWA 3DU0A 1S3HA 1HP4A 3CIVA 1H5VA 5I78A 3PF3A 3SCSA 1CGUA 1W5NA 1UC4A 2JF6A 4G1KA 4CKQA 4GXMA 4WF7A 5F1UA 2RJHA 1LWIA 3W73A 4A2SA 3S1WA 2CKSA 1ICPA 1Q6CA 4GBDA 3GUWA 1H0GA 4C7GA 3UCDA 1WKDA 3P8JA 2FYMA 5E6YA 3BSGA 3W2JA 5LXXA 3EDKA 4UFLA 3PPHA 1FXQA 3TW6A 4O16A 2J27A 5LNWA 2HE8A 3ONCA 1LROA 1EX1A 1C9DA 4O54A 4GNVA 2EO7A 3DBPA 1XLGA 5FCZA 1KCXA 3SRDA 1B1YA 1C8XA 1JDCA 1UW9A 2DPEA 1DWJM 3W7IA 5AZ0A 1KD0A 4J27A 4MAZA 2NUYA 3IK4A 2HJPA 5T9CE 5BXRA 1I60A 4TVDA 1CDGA 1KBKA 4QG9A 2WO5A 4RPQA 2WB5A 4FA3A 4EPBC 2QCEA 5CPSA 1KWGA 2B0MA 2VQUA 3TA6A 3NZRA 2Q09A 1KXHA 1HKKA 3W0KA 3WQEA 2R1LA 1QI2A 2BY0A 4AHQA 3TC3A 1N8WA 4ZBCA 2ESCA 1OD0A 1OX6A 4ZMGA 3PZVA 5D4YA 2QW5A 3LHZA 1XDLA 4KPLA 1OZMA 4L6DA 3P8IA 3GTXA 2E1DA 1J8VA 1GQKA 1K77A 1GOKA 1VFHA 4GQQA 3CPUA 2OSWA 2ASHA 1HJUA 3FJ4A 3KBWA 5A3HA 4BR1A 4J3UA 1HL8A 3C2RA 4B16A 2JIWA 4XO7A 2HK1A 1NWSA 3MV11 2VGGA 4JTJA 2QPXA 3NGJA 4MJZA 5FJJA 2D20A 2A85A 4J3VA 1WZKA 5LA2A 2V5BA 3DESA 1G0CA 3T7VA 3I6RA 1G69A 3UA4A 1JD7A 4HSNA 4CEUC 4Q8WA 2WMIB 3GXPA 5EU9A 5ABTA 2PRLA 2TMDA 2VXNA 5HJLA 1FWEC 3BZJA 4IOTA 4JR5A 2CEQA 2JBMA 1W32A 1MXSA 1X97A 1UWTA 3R10A 4H01A 3U48A 1AQHA 2G3NA 5AYXA 1D9EA 1UP3A 2BOFX 3CPGA 3MYOA 1UIOA 3TONA 1W91A 2I14A 1OT2A 2YL6A 3W81A 3V5CA 3CZGA 3S2CA 3GSMA 2Z1XA 4DBEA 3O8AA 2WPBA 4FK9A 1RBAA 2PWDA 3CQJA 4G2DA 2DP3A 3QEZA 4CNTA 1Z3NA 4ZO8A 4QSFA 4UQEA 3KL3A 4WDTA 2YSWA 3DKLA 3BCFA 2HWGA 3U2ZA 1JGIA 2YR1A 1OFQA 3M0JA 4JN6A 2XIBA 2JFEX 5DCBA 4J3XA 3KBNA 1CXFA 3PBGA 5LA0A 1OK6A 1R38A 5A8OA 4Q6JA 3SUWA 1G7UA 2DZVA 2PBGA 1W9BM 1ME7A 4GZJA 1XV8A 1WDDA 4JNYA 4WX2A 5DT7A 1DIDA 1Q13A 4XZIA 3C2YA 4L9XA 4W7WA 4D6GA 3GVQA 4RL3A 3WMBA 1DL3A 3UA3A 3GAKA 5IDIA 3S8HA 1RJPA 3EOSA 4MVAA 1IR1A 3WELA 1EF2A 5EL1A 2ZUSA 4HMNA 4B5WA 1JZ4A 2JKPA 3HB9A 2UV8G 1JZ6A 4HQVA 3WQWA 2HBXA 1HJQA 1O7AA 3GYEA 5I5RA 3CZ8A 4FF5A 4LC8A 2JIEA 3WQPA 1WA3A 3AUJA 4LS2A 7REQA 1B5TA 3OW1A 2YPIA 2VT0A 1TRIA 3NO5A 3U2EA 1QBAA 1VKFA 4DZIA 2VFHA 1YKWA 3SZ8A 2J77A 2Y89A 3N1AA 4C60A 1DHKA 4EP8C 4MPQA 2ZUUA 2BGQA 4IIDA 1JIBA 5BZAA 1IWAA 2YCKX 4F2BA 1XR2A 3NQDA 5LHFA 1J9YA 4IG2A 2X1RA 1A5UA 3A23A 1F8MA 5A69A 4LRTA 1UUMA 2X41A 3THUA 3K4DA 2ABAA 5A6BA 3WBWA 5AKQA 4PRWA 3RU8X 2WZHA 2V2CA 3RG6A 4LWWA 2VP8A 4EPEC 3TVAA 1ZQ5A 2Z24A 5H8MA 3CT7A 3F5KA 5AZ1A 3N2BA 2POZA 2QCDA 4YIWA 3NL2A 4NJJA 3B8DA 3USZA 4L4MA 4XKYA 3P74A 3APGA 3DI1A 3A13A 3FXYA 1BKHA 1FFRA 4X3ZA 7PTDA 4REQA 4C1KA 4MKVA 4M19A 2D2JA 4X60A 1FCBA 2XINA 4DHGA 1QJWA 4AIEA 4RE3A 1HVXA 3VGBA 4KMQA 3L4YA 3BARA 3QR0A 4HGXA 3T2PA 4MAVA 2PDQA 2R82A 3V35A 3W27A 1V3HA 1W9PA 1J0ZA 3PUOA 4ADTA 3JU2A 1TE6A 1E6XM 4R7OA 4I5UA 1ECQA 1HXJA 2ZDRA 1PTDA 1SFLA 3DHFA 4D6EA 2Z1VA 2G37A 1IEIA 3HFYA 4ZSUA 2C15A 5JMUA 1LDCA 2C1HA 2P1FA 4LEQA 1H7XA 4QAWA 3KVKA 1TPFA 3H54A 3II1A 3W7PA 2XTKA 5GJNA 1EDQA 4IQDA 3U7VA 1F4AA 5U7SA 1JUBA 1OB0A 3C3UA 3EEGA 3N2TA 1C3FA 3QY6A 3U5UA 3KBVA 4K39A 1WOBA 3C2FA 2PP0A 1QASA 2YYTA 3W7KA 3S2LA 2G95A 3KL5A 3T55A 4KEZA 3WLNA 3KP0A 1G6CA 2JQXA 3EX6A 3SDOA 1OC5A 2WSRA 7TIMA 4S39A 4M1BA 4YMZA 2BV9A 5KSWA 1W6TA 1JZ5A 1W1VA 3PSWA 5XIMA 3VKKA 1M7OA 1UR2A 1OCJA 3G1FA 1DIEA 4OECA 5C70A 4AD4A 3O6AA 1Q6GA 1WO2A 1KGXA 3P60A 3QGAC 4AHPA 3ECQA 4DWSA 3M41A 3W3OA 1RPKA 1NU5A 2P3ZA 1TTQA 4I6KA 3Q67A 3PY2A 2ZRUA 1IZKA 4AIBA 4TV6A 1ITXA 1LF1A 1RP9A 1W3TA 3GZ3A 2WBGA 4B15A 3H6OA 4WSJA 3GYCA 4HP5A 1IZJA 2ANUA 3UP8A 3W7NA 4QCEA 3O9NA 4M1RA 4PMNA 4RW3A 3HIJA 1LLWA 1V3JA 1PDYA 3RMEA 2CHRA 3ANYA 3AHTA 2W62A 4MF4A 4YYCA 3M7WA 4XAGA 3UR5A 4K2SA 2UY5A 2WCGA 1ZALA 3TP4A 1EP3A 1EO5A 3R1ZA 2D0FA 2IKIA 3PPFA 2GYIA 2VGBA 1UKQA 3C61A 2HISA 3VZXA 1TV8A 3FJ6A 3VDBA 4AH7A 1RLDA 2CZFA 4I9AA 2YCIX 3W85A 3UGRA 3VC6A 1NP0A 4JTKA 1DIOA 1V7AA 3HFTA 3MQTA 1CXLA 2VO5A 1WOAA 7CGTA 2FPVA 3TUUA 1HO4A 1FWFC 3NSMA 3WQ4A 4PTWA 3H23A 4R88A 1FY6A 2GWNA 3VI2A 1IR2A 2A7NA 4IP4A 4DI9A 3GHTA 2I17A 1X1OA 3ZLFA 1E6SM 2ZQ0A 3VD3A 3GK0A 2ATSA 3A3XA 3SN1A 3CV6A 1LQ0A 6PTDA 4B2DA 1BRLB 4OUEA 3VIHA 1ZBCA 2WCAA 1GQIA 1S2AA 4GO8A 3G18A 1C8QA 2CHOA 2FVMA 2B7NA 4RXGA 2OX1A 1VZWA 3SSZA 2BOGX 4HZ8A 1Y5XA 1X6LA 2WKLA 4EIVA 4LW7A 3IPWA 3QV6A 3V7PA 4S3AA 3KFTA 1QHPA 3LB0A 1XQKA 1Z8AA 4DPQA 4TIMA 1D2KA 3TW7A 1SZFA 2VMFA 3JVAA 3WEMA 4LS0A 1ZCCA 1ZGDA 1R8LA 1I9CB 3NQGA 2WHLA 2GJPA 2V3EA 4LNYA 4UQCA 4L4OA 3G1RA 3KP1A 2Z1KA 5A2AA 4C6FA 3WQCA 5CLWA 3A4XA 3W7HA 3AMDA 3AS0A 4EXQA 2VFEA 2CLLA 3T0TA 2ALDA 4ZQCA 4IZGA 2XVLA 1N82A 3VIJA 4F40A 3W70A 3LA4A 4E38A 5BRPA 4LRSA 3A47A 4C6KA 4C6OA 3ARQA 3OU8A 1BPLB 1E0UA 3MS8A 3W24A 3UF9A 1ZY9A 2OOGA 2ZRZA 3IS4A 4DYKA 5EMYA 2A1YA 4XAPA 3VNIA 3SCNA 4XUGA 4K1GA 2R1KA 2BDQA 1Q66A 3TNBA 1OK4A 4KS0A 1LBFA 2WNWA 2GVYA 1ITUA 2P53A 4OT7A 3K46A 2V6AA 5D2YA 1QI5A 4DX3A 3S1VA 2Y4SA 2VFIA 1EC8A 3W2LA 3IVTA 1NVMA 4PCSA 3ES7A 1R3WA 1KFWA 4UQAA 3CQIA 1LT8A 5C2XA 1EYWA 3FCPA 2CLEA 2ZVRA 3AIEA 2QVHA 4LY8A 4Q4RA 4S3EA 1C91A 2D69A 4NXKA 3WLOA 2AMGA 4FS9A 1XYLA 4JKMA 1HNYA 2PE4A 3GW3A 3GZAA 1FWTA 4AZCA 5ECVA 1KLZA 3MO4A 4KRTA 3VOHA 1OGGA 3WFLA 1IGWA 4BI5A 1JDFA 1TUXA 3LCFA 2E9BA 4R53A 1IWPA 3PJWA 3RNDA 4TO8A 1V51A 1OIMA 1RBLA 2BASA 3ARZA 1ONRA 1DEDA 4DAFA 5HR7A 1FDJA 5D2VA 1XCWA 3BMWA 5CJ5A 2O9TA 4AISA 2YYUA 5HDRA 1GYLA 2V5JA 3OIHA 4ML9A 1DJWA 4MY9A 1OFDA 5J5RA 4G7FA 3A4WA 2OCZA 1EJRC 3PTMA 4P61A 4B90A 3O0FA 1C90A 2DZTA 1XFCA 3NEHA 3AROA 3VNLA 3BMXA 3CS2A 3C6CA 3WQGA 5GVJA 2FFIA 2VOMA 2ISWA 1WDWA 5DMMA 1OFPA 1UKSA 4BQ3A 3WNMA 4ADSA 2PC8A 2VFFA 4A3UA 1PX3A 3ABXA 2CLFA 1LRQA 3LNMA 4FR6A 3CHEA 1AMYA 3LSBA 4WY0F 1EF3A 5AN7A 4UTMA 3VMNA 1XGEA 3WQ8A 4FIQA 4IQLA 5GNZA 2NW0A 2YA2A 3WQ5A 1NF0A 4XV0A 2IMRA 3BOFA 1GVRA 4AYSA 4NUWA 1YQ2A 1UJPA 1AW1A 2ZRXA 2QJIA 3ARSA 3M9YA 4IMCA 3B8IA 4CGTA 3MJMA 1OADA 1UWUA 3VM7A 3M07A 2XWEA 4FEZA 4LEFA 2V3DA 2V2DA 1M01A 2CNCA 4A3RA 1JNEA 1IT7A 1LWHA 1L6GA 4F0SA 1B9ZA 1SU5A 1B54A 4JX4A 3FJNA 4LAZA 1Z41A 5I24A 4XB3A 4N9EA 3VVGA 4KEUA 3SJNA 7REQB 2RAGA 4WY0A 3USBA 3EKZA 1GVEA 3WJXA 2IS7A 1AMKA 2DVXA 4HNUA 5LHEA 5F7UA 2HPMA 3G5EA 5C9WA 5D9NA 2P8BA 2IPFA 4GCXA 3H7UA 3GXIA 4QE5A 2AL1A 3CXOA 4IMGA 1P7TA 3ALFA 1WXJA 2ACRA 3FDKA 1SZNA 2PUZA 4F9DA 3PZQA 4IG2B 2XH4A 3VABA 3C5QA 2FQIA 4GY7A 2E6DA 3DZ1A 2VX6A 3W07A 3L4TA 4IP7A 4XSMA 3PUGA 3KEHA 3WLIA 5BYWA 3S1XA 3VOIA 2D2GA 4W8BA 4OZOA 1LBLA 4WRHA 1VQTA 5AHEA 3WO8A 4LFYA 3N15A 5AC7A 3TK7A 2E77A 4Z17A 1E6ZA 2NVAA 1UZDA 1E40A 2GGJA 2QCDB 4IMFA 1YX1A 3VIMA 4YXGA 1W5OA 3VIPA 1XLIA 3OYXA 2ZADA 2QV4A 3EA2A 1SFTA 4XKYB 1T7LA 1CXEA 5SWUA 3VA8A 5CXPA 4RNHA 4REQB 4N9CA 3T05A 3GNRA 1EJXC 4DBSA 1PV8A 3B8UA 3STPA 4HNTA 4WOQA 1IT8A 1E9LA 1UKOA 1JZ7A 4KCTA 1OEPA 2PWUA 1EJVC 3E1F1 2ACSA 1F7BA 4CQCA 1GQJA 3GFYA 5DANA 5EYWA 1ZTVA 1XFBA 4C7DA 1GVYA 4P7RA 3W1UA 1JULA 4CU7A 5IBXC 3LLDA 1T41A 1E6NA 3W7DA 2WHKA 4U4MA 4J3WA 4NZ1A 3VKBA 3W72A 1CT5A 5HNTA 5CAKA 3WNPA 4ZB5A 1JCNA 3GG8A 2QJNA 3DC0A 3UJFA 3UXKA 4UWMA 3PWIA 1DE5A 5A2CA 4D1JA 4JDBA 3CV7A 5AY7A 4GYPA 2ACQA 4RKAA 4WGHA 2VEMA 3GIYA 2TODA 1J5SA 3A24A 4DLMA 4HU4A 3AOFA 5F4SA 4BK9A 2E8YA 3KDNA 4O8RA 4YL2A 1MVYA 1KKRA 3URQA 3W37A 2OGJA 5CZKA 2UZ9A 4C65A 4DBUA 2PTWA 2A21A 3MSRA 3TDFA 3I4EA 2GSJA 3K8LA 4IISA 4LAUA 5HOSA 4O18A 1XIBA 1XF0A 3EKGA 4ZOCA 4DAIA 4DJDC 1V4YA 3GDMA 3BGGA 4Q6XA 3VNDA 5GNXA 3RRAA 1VF8A 4DWSB 5H6HA 5KTLA 4H6RA 1BTMA 1V02E 2D22A 3P2VA 4LSBA 1KM2A 3ZLGA 2OYLA 2DVUA 3FY1A 4J28A 4W85A 3WK2A 1YDNA 4QP0A 3QHNA 1VFFA 3F5JA 1UH3A 2XHYA 3AO0A 4ZO7A 4FB7A 3CL6A 3OZOA 3I6TA 1LZOA 1RQEA 1D7KA 5FJTA 4N0RA 5EFDA 4PUDA 1KM5A 4KCWA 4ICMA 1W1B1 5CSYA 5EY5A 2CIPA 1G4PA 2QF7A 1TE1A 2NQ9A 3QMSA 4PCPA 3LM3A 4IXHA 1WBHA 4ZQPA 3ITGA 1LG1A 1YMYA 3N6HA 4H2CA 1LOQA 3S5SA 5B80A 4YTRA 2PCQA 1BG9A 1GEHA 3CMFA 2HS8A 2QGHA 4GD0A 4KWVA 2ZC8A 3INPA 3LTYA 3BLFA 3LHVA 2XGIA 1KFLA 4EX4A 4JQ4A 5D9MA 4U2YA 1H62A 3MKVA 2YDAA 4HYWA 3IJIA 1P1MA 4H8UA 4R85A 2BY2A 4FLOA 4MWAA 1XYAA 3QOKA 2AMXA 1BVNP 2CZVA 5EBUA 1K9EA 3LXCA 1UR0A 1PIGA 4PUEA 2EG8A 2VEPA 5K9CA 3DBNA 3M4HA 2J7BA 4CNNA 3SCWA 4MLJA 2FGZA 1XH1A 2F2HA 4FNQA 4HHHA 1AH4A 3SQSA 3AHXA 5EMUA 3PWGA 4C6QA 3S47A 1X7IA 3NQFA 4RZ5A 3I3BA 2QDHA 2VI0A 3UXDA 3LG3A 4MKSA 1IWBA 4QEHA 1TZZA 3TN6A 1KXQA 1BYCA 2QCNA 3QLDA 5LNSA 1W5MA 4NNCA 5A94A 1F6YA 2Y0FA 3UY8A 4CN6A 3RLUA 1F3XA 2NT1A 1SZRA 3L5AA 3P5ZA 4ZCWA 4GHRA 1JJKA 4P8XA 1WBJA 1W9XA 4GC3A 1GKQA 1AQFA 1UA7A 2J8FA 2E7FA 3ARVA 3R0DA 2WNQA 4O13A 3ANVA 1M5WA 2ON3A 1US2A 3UR7A 1MDRA 4CQDA 3W38A 4BHYA 4DRSA 1GPWA 1X8CA 2IPJA 1HVQA 2NX1A 1LUCA 3G1YA 4X2RA 3W9ZA 3W6MA 4BI6A 3FDGA 1SFJA 3SCRA 2GQ3A 1ZPTA 3DHUA 3IUIA 1HUVA 3A5VA 5FSEC 1GNXA 2BHZA 1I0DA 1O68A 1FWWA 1UR1A 2GWGA 1JG9A 2IXVA 1NDVA 2WWCA 1TPDA 2J25A 3AZRA 5EA9A 1A4MA 3QYSA 5EKYA 4O10A 2BVTA 2J47A 3UQNA 2QPUA 3OGSA 3ONBA 4GINA 8XIAA 4AVFA 2OQHA 3C0LA 6A3HA 1Z69A 4H04A 3WUFA 3H21A 1JQVA 1IXPA 1IV8A 5HJYA 3AU2A 1FX6A 3LCHA 4AWUA 4NZ5A 1PIFA 3FXGA 1AJ2A 5DBUA 3A12A 4XD4A 1UR4A 3W2UA 3ZJ7A 7ENLA 1CLVA 2W79A 1TJPA 3DG3A 3GH7A 3IIXA 1F2JA 1VLWA 4PH6A 2PWEA 2QNEA 4JICA 3TX9A 1M03A 3NG3A 3F03K 1UQYA 2QHAA 5IFPA 4Y9MA 2HRWA 2ATMA 3KM8A 1BAGA 1YNPA 4WD0A 2TRSA 2DGAA 3TOYA 2XZ7A 4S3CA 4LANA 1XINA 1EIXA 4Y2WA 3Q58A 3N17A 3P0XA 2WC4A 3I4KA 4BFAA 4DO7A 4UBPC 4AZCB 5CG7A 1ISXA 3WQOA 1VCFA 3NPWA 5HUOA 1MZRA 1W3JA 1XGZA 3VNJA 3G1HA 4A3QA 1GOIA 2EPNA 5IBXA 4CUCA 5EFFA 4OJYA 2JKEA 4M81A 2JGQA 4CQ8A 3QZAA 4H9XA 3GX9A 4F0KA 3OB8A 4OOZA 3UYIA 3W88A 4FO4A 1GPFA 2VZSA 2XIJA 4GWEA 2DUAA 4L6OA 1RUSA 1F6KA 1BXNA 2ZXAA 4HK6A 1LJYA 1S2WA 1CLKA 4DO5A 1GK8A 4JIIX 3K5XA 3MMTA 2RDWA 4RW5A 3VIIA 2PAJA 1D3GA 1XG4A 3RK8A 1PSCA 4LPCA 5EMMA 3AHVA 4A8LA 3FA4A 4K8HA 2C91A 1OFAA 4YHEA 3HF3A 3ABOA 3GNOA 2HMCA 1YDVA 3MI3A 3AS1A 1PS9A 1FQ0A 3FN9A 3UWWA 4K38A 1LLOA 3WMSA 5BMXA 2XVGA 1PCKA 2YBTA 3NZQA 2ZYFA 5D02A 3HPSA 5AHNA 1FWSA 4HNOA 4Y96A 1TV7A 3WENA 4EOUA 3IV8A 5EB8A 1S5VA 2XIIA 1XP3A 5DRIA 1DWGM 1MW1A 2PC4A 3CUXA 2JE8A 4D71A 3EWBX 4MB5A 5TD4A 3LSCA 3PULA 4DJDA 5I3DA 5CZJA 3LHYA 4JTCA 1AD1A 4NAEA 4AC7C 2W91A 3AYRA 1WDPA 3NO3A 1MFVA 1TV5A 1FXPA 3SCUA 4JTQA 2QYGA 3MC5A 4MNJA 3C3NA 1JDAA 1VFLA 1KWKA 4C6NA 3B97A 2PF0A 1BWKA 3CYJA 5HR6A 1M53A 1FHVA 4GFSA 1UB3A 5IM51 1WZMA 3M5YA 3VD5A 3UEQA 4ZODA 4JYDA 3SBFA 3CJPA 3PTQA 3S0CA 4XBSA 3L4VA 1XLFA 1JVNA 2DT3A 1T0OA 1OINA 2INZA 4LAMA 4GYKA 4C6IA 3KAOA 5I02A 2YFOA 3WD2A 3AXKA 4LVGA 4HSHA 1KRAC 5H91A 4B9ZA 4WY0B 4YWSA 3QF0A 3B9OA 4GO9A 4GUJA 2IPGA 1BWLA 1SO3A 3LLXA 3PAJA 1MQQA 4P2VA 4GVHA 3SQLA 3BLPX 2DZUA 3MPGA 1TREA 4S3JA 3PG9A 4U28A 4PCFA 2EJAA 5AHIA 1H4PA 1B57A 3AZTA 1P7TB 4QG8A 1G67A 4JXCA 3LBMA 2FB3A 3JS3A 3VMPA 3WH8A 3FIGA 4GPNA 4UMBA 1X8FA 1R9XA 2PODA 1XI3A 3OPSA 3P80A 4U5IA 4Z0JA 3CLWA 4C91A 3NQ8A 5I3JA 3SY5A 3AJXA 3VOJA 3HPAA 3S6TA 3N4EA 2VR4A 4IPLA 2NX3A 1KM4A 3OQEA 3DC8A 4PMYA 4ZGYA 3H2FA 2X09A 3MKCA 1ML1A 1N55A 4W86A 4ERIA 5LIXX 3W74A 3BUVA 3NM1A 4I90A 4KRUA 1V6VA 3QH2A 2HROA 4Q33A 2YW4A 5CC3A 3BO9A 3NPVA 1RSCA 2OMAA 4YWIA 3BSHA 3BK0A 1FH8A 5E70A 1XLHA 2Y7DA 1TKKA 1W56A 2NQJA 2A3LA 4DYEA 4LCRA 1TO3A 3PVFA 4J7RA 3NL5A 4YTTA 4PMRA 1XG3A 1PKLA 2WSKA 1CB2A 3QY8A 3KBSA 4NQ1A 3LXAA 5ABGA 3DYMA 2EBNA 4FR1A 4AD0A 3EPMA 3S5NA 5F2GA 2BMBA 3PBMA 4Y8FA 3W7QA 1Q7ZA 1JFXA 4QISA 4BF9A 1BVZA 1F76A 4PR4A 4DF2A 4GIRA 3QHMA 2CW6A 3QQ0A 1QUMA 2KAUC 1AA1B 4F2TA 3C86A 5D04C 3UW6A 1JUEA 2VR5A 3DFOA 3HBLA 2DUZA 3T0CA 3LQGA 4CD6A 1MEHA 2PDFA 2Z1SA 1J79A 4LF1A 1XIMA 1LRNA 4R34A 4BQ5A 2F38A 4GQRA 4NU7A 1E55A 3VIFA 4G8TA 4D6HA 4AAJA 4DJED 1CLXA 2JK2A 2VFGA 1SW3A 4NX0A 5D2WA 1A5MC 3IIZA 1E51A 5L9FA 1EC7A 1TTJA 4DYJA 4JTUA 5EMKA 1OFRA 3VYLA 2I1OA 5C55A 4GCAA 3IGUA 3VGGA 3S46A 3LRMA 5AOUA 5A6AA 3SCQA 1HP5A 1CW2A 1VR6A 2X42A