4R3UC

Crystal structure of 2-hydroxyisobutyryl-coa mutase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
QTPIRVLLAKVGLDGHDRGVKVVARALRDAGMDVIYSGLHRTPEEVVNTAIQEDVDVLGVSLLSGVQLTVFPKIFKLLDERGAGDLIVIAGGVMPDEDAAAIRKLGVREVLLQDTPPQAIIDSIRSLVAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the stereospecificity of bacterial B12-dependent 2-hydroxyisobutyryl-CoA mutase.
pubmed doi rcsb
source organism Aquincola tertiaricarbonis
molecule tags Isomerase
molecule keywords 2-hydroxyisobutyryl-CoA mutase large subunit
total genus 43
structure length 131
sequence length 131
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 4r3uC00
3REQB 1REQA 1CCWA 4HEHA 1E1CA 1XRSB 2XIJA 5C8DA 3KOXA 2REQA 2YXBA 3BULA 3EZXA 3KOWA 4HH0A 4JGIA 3IVAA 7REQB 3WHPA 3KP1A 4REQA 3IV9A 1REQB 6REQA 3BICA 2REQB 1K98A 1BE1A 7REQA 4REQB 6REQB 2I2XB 4R3UC 1B1AA 1Y80A 5REQA 3REQA 1FMFA 1ID8A 1CB7A 3KOZA 4HH1A 4HH3C 4Q37A 1BMTA 1I9CA 1E1CB 5REQB 1K7YA 3KOYA 2XIQA
chains in the Genus database with same CATH superfamily
1OXSC 2WPNA 4L8GA 4TTQA 3BG5A 2IHBA 2FVXA 2GPTA 2QMHA 2XSZA 1SQ6A 3CUWA 2YZ7A 3PUXA 4XLZA 3K6JA 5AI6A 5K0TA 4PICA 1M1UA 2OCAA 4B85A 3HXPA 2LWIA 2HLDD 3EXEB 4L75A 1EP2B 4I36A 4GYYA 4XWOA 2V3WA 2X9NA 3ESZA 4AKSA 1VPLA 5L7WA 3MCZA 2WUVA 4ENWA 3OT1A 2OD9A 1RI1A 2H51A 4PR0A 4R8SA 2GF0A 2XXJA 4RFSB 1WZNA 3O1LA 1QZXA 3F2VA 1FPMA 2HJSA 2PT7A 4GBJA 4OJQA 3W3AH 4DMCA 1BVUA 4D56A 1OOEA 1UJ6A 4JI7B 1KY4A 3KV1A 5G0UA 4NNPA 5MGBA 4TLDA 3OQ1A 3PQCA 3VFDA 1GUBA 1RZ3A 4XVRA 2FE4A 2X8BA 4RF2A 1D1QA 4LYHA 1WJGA 1A9PA 4Y9TA 3K9CA 4E32A 3KB1A 1XRMA 1BU5A 2QT1A 2RG1A 4PGAA 3ZHXA 1T1EA 5KWSA 5KYWA 2DXIA 4ZOLF 3L05A 3TNYA 2AN9A 2E21A 2LGJA 3N2YA 4G0NA 2ZU6A 3E3MA 5KSPA 4KXNA 4F5WA 2YY5A 1JHQA 4BC0A 3ZZNA 3RHFA 3V80A 1LQTA 1U1CA 2O3TA 3AL3A 1OYYA 3TSYA 4LOHA 1PU2A 4NXMB 1YC5A 5F98A 4P22A 1DRVA 4QUGA 2PH1A 1WG8A 4UMVA 4ZAFA 3HWSA 4MYSA 3I9NA 1GTMA 3GYGA 4L72A 1H3FA 2B4KA 3I04M 4HJXA 1OGYA 4F4HA 1P4SA 4MVJF 5LJLA 1KI6A 4NWIA 4F06A 2YWEA 3I30X 3OA0A 2YV3A 3FDZB 1J56A 2I1VB 4LE2A 2R7AA 4D80A 5T41A 2FMUA 8LDHA 1M8JA 2O1EA 4G4SP 5FI0B 2PKRA 5ES3A 5FJJA 3UK1A 3QG1A 4O0MA 3ZHCA 3ZXYA 3KUDA 4PIVA 1RJFA 1USKA 1L9KA 3GNLA 1U0BB 1V45E 1MGOA 3CVYA 3AF1A 2OYCA 4TN1A 2PG3A 1VPWA 4ASUA 1TL7C 2Q0XA 2J1LA 2EJBA 4LXQA 5FNZA 3TUIC 1EUCB 2OHFA 5LB4A 1NVFA 3GLFE 1N5JA 3KKEA 3PBKA 3WSWA 4PX5A 2FUCA 2IYEA 3WWDA 4KGZA 2Z98A 3GR6A 3M33A 1CUGA 3CVXA 4L0DA 2Q6KA 2C0CA 1PEYA 1QX3A 2AZTA 3K94A 3RJZA 3WGTA 5DHTA 2VRWA 1ETUA 4K46A 3SC6A 5E9WA 5GV8A 4FEYA 3OMWA 1N78A 1C29B 2NVOA 2R7KA 4P80A 2QRVA 1WLYA 4I6JA 5JY1A 3TS1A 1G4HA 2XB8A 2Y76A 3OPYI 3P26A 3WYDA 1CQJB 4EB6B 3CNLA 3CUTA 5LOVB 2AT1A 5IMBA 1OGJA 4Y1EA 1YDHA 1Z34A 4MV5A 4DJ5X 1NBMD 4B7ZA 1G5RA 3ETLA 2E87A 3ICEA 2FP4A 2ATEA 4DLUA 1OX4B 4RMGA 3WX0A 1GTL1 5C7LO 2AG6A 2IL1A 2OG1A 3B3AA 4CIBA 2VTBB 3LQFA 4JYAB 2ADMA 2QPOA 2QXTA 1FBTA 1X1CA 3ZHTA 4KN9S 4UU0A 1RWBA 3AB3A 1DRJA 1E58A 4CIWA 2GNPA 2ZI4A 3QLVA 4G4SO 4TWZA 2PMWB 3CT6A 3HJHA 4FNOA 1LEHA 2FCRA 1IEWA 3LF2A 3N8NA 3R9KA 1RXYA 4DNFA 4ETWA 2Q4DA 5K9ZA 2UVDA 5M7EA 1QHNA 2I67A 2YASA 4O4LB 4UDYX 3GIWA 5LBUA 3IIKA 4OQDA 4AJ2A 3A1CA 2VTKA 2VF5X 1PJZA 1ITZA 5ELXA 1X19A 3B7PA 1HT2E 4OL0A 2QLNA 4RIGA 4UQLA 5I4BA 4W5OA 2R9VA 4KHPB 2QVBA 3GRYA 3H83A 4R68A 1V0JA 2EIXA 2GTIA 2HIHA 2PMDA 3MUNA 1SBHA 4GM1A 4W4TA 1GTZA 3H18A 3H2KA 1II8A 1E6CA 3UAVA 1TVEA 3FE2A 2OCXA 4C88A 1HOXA 1PHRA 2WAYA 1K5HA 2BISA 5J4KA 4KMRA 2H0QA 4XARA 5KNBD 3DFMA 2GHIA 3EGEA 2N1BA 4PRLA 3UB2A 1WM1A 3ILVA 1SIBE 1M67A 2HTEA 2WMDA 4RDIA 1BRTA 1THTA 2OGZA 2CLOB 4OPMA 4E5DA 2F64A 3KXLA 2JJYA 1I7DA 1YS9A 2GLTA 5KYYB 4LOJA 2HMVA 4TKVA 1WD7A 5CHYA 3KPVA 5HM6A 5JDCC 3OCXA 2JIOA 3LWDA 4IHJA 3UHOA 4E6PA 3LK6A 1BFUA 1Q83A 5LPNA 1EK6A 1YRBA 2A33A 1SM4A 5CIQA 2FPPB 4I6EA 4RSHA 4EARA 3TQTA 1NF3A 3W79A 2AE2A 4XD2A 2XA2A 4FI3F 1NJ2A 1ADYA 1Z6TA 2MIIA 3SHWA 2X9VA 2PBLA 1OYWA 2IS4A 5KYWB 4B3TB 3QV1A 3K9BA 4QYIB 5ADWA 2AQKA 2JW5A 1NG1A 4U2GA 2NAFA 1HG0A 2VYCA 3S6JA 4A10A 2EV9A 3PC8A 1XD8A 3HSYA 2ZRCA 4TVSA 4QHTA 1E9EA 1IY2A 2Z2KA 1ARZA 1C0KA 2P9ZA 3EWAA 4GU5A 4WACA 5CB4B 1DFGA 5D84A 4WD3A 2FP3A 3MUEA 4NOKA 4X9XA 1T4GA 3GLVA 3VTFA 5TMEA 3VO1A 1XTRA 2PLFA 1H5UA 3ZBQA 1LS1A 4KN5A 1DUIA 1DAGA 1FDOA 4RULA 1KMHA 1NUUA 3QELB 2ZSUA 3L2OB 3H2GA 4FVTA 3RJTA 3TAUA 1ZIDA 2P62A 4PY2A 2UYYA 1A8HA 2ZSAA 4ENQA 1SQ0A 2VT3A 4IVRA 3C6ZA 1KAGA 3FF1A 1CCWA 2BCEA 3NHPA 5DLQC 5FLEX 4F45A 1ZM3A 1J0EA 5F9MA 4YCBA 1X92A 2FPXA 3R9XB 1IY0A 1E62A 4BLUA 4K2AA 1MVLA 2ZDHA 4HBZA 4G63A 3WKEA 2PWBA 1KOFA 3WMFA 3WXMA 5KO2A 4K03A 5F4ZA 5C5IA 1PQYA 3NT4A 4YQFA 1U8ZA 2I4OA 3IQIX 3KT8A 4BO3A 4RBNA 2I2BA 2OKGA 4Q19A 4X97A 1ZCJA 4AB1A 3AXTA 3GCXA 4PTLA 3T5AA 1RAFA 1HT1E 4FDTA 3AHHA 3I6BA 4NL4H 3LBNA 4XQCA 3URMA 1CY7A 1EQUA 1FSFA 1DIBA 5AOBA 1DCFA 4MQMA 1E1RA 1KZYC 1YI0A 2I8LA 3EDCA 3HBMA 5JI3E 4DV4B 2TRSB 1YR9A 4M60A 2FDXA 1IXSB 1OFHA 2JI7A 1T5SA 2INGX 1ML3A 1QWSA 2GAAA 2CFOA 1O96B 4NMLA 3U3MA 1JVNA 3ZE9A 4AXXA 1DMSA 2CK3D 2QENA 1QHSA 4FR5A 3MQ2A 3UHFA 1CR2A 4RVDA 1AB6A 5KQLA 3TMAA 2M9MA 5K3AA 2XBLA 2ZM5A 1P73A 1NQWA 3ZE8A 4D6YA 2QX9A 4ZTBA 3LPNA 4U63A 1P7VA 1SKYE 1Z68A 3E3OA 3GEIA 4EKGA 3LV8A 4XYLA 3P4YA 3M6FA 2BRUA 1KI4A 2YN0A 4BKMA 5F12A 1PR5A 1M5TA 4PNPA 2GF9A 3KQKA 2ZIAA 2GN9A 1IUOA 2DPMA 5KB3A 3AGQA 2PSHA 4WNYA 3ZCRA 2B6HA 3RRZA 1RD4A 1CT9A 2O2ZA 3I76A 2JAXA 4F5EA 1YB2A 4L4XA 3Q8KA 2I6QA 2OQRA 1R50A 1LC0A 4UBOA 4TWIA 1PD0A 2FETA 2QDXA 2WSSA 1XZDA 5CEEA 4G1UC 3SE0A 1I3CA 1A8QA 1LFAA 3FUCA 3ZEIA 3MD9A 2ZYHA 2Z5LA 4E4YA 1JU3A 3VGPA 3ADOA 5JD5A 1QZUA 2I8CA 2EVWX 2P41A 5BV0A 1M0SA 4MW4A 2M32A 1P77A 3DP9A 2FA9A 1DT5A 4JC5A 3K92A 1CUBA 3TD9A 4QU9A 1BMDA 5IUJC 4E14A 3D0QA 3OF5A 3OHMA 4C7MA 5EKXA 1DC8A 2HO4A 4KR0A 4CMKA 5IPFA 2UXBB 1E8MA 1PSWA 4YAFA 5EQTA 5DM60 5JYCA 3GGGA 3B13B 4HK4A 1Y7TA 1YJ5A 3OZGA 1YDWA 4K9RA 4X3CA 5KHOC 1QG0A 1HFEL 1TNDA 3Q15C 1H05A 4GPD1 2VYFA 4RTPA 3W77A 1E1DA 4J1QA 5JZVA 3SK0A 3TLCA 3LWBA 4PNEA 4BKRA 1ZOLA 3WYFA 4OLAA 2RBKA 3CZ9A 1YNOA 2OD2A 2HQBA 4O25A 3RU7A 3DBRB 3NBMA 5EWMB 3ZY4A 4CFYA 4UTZA 1GPDG 1JKJB 1QRUA 3PICA 3ZHBA 2F7SA 2PKXA 1W0JD 1B1AA 2QQ0A 2AJLI 5HQ3B 1LPBB 3LT1A 3I2HA 2R5NA 2ODAA 2Q29A 2OC4A 4D92A 4PGFA 1IFXA 1NRXA 3LXRA 3CNHA 4RKEA 3ZOZA 4F5DA 3TG8A 3LY7A 1C9MA 1EU1A 3HB4X 5ED0A 3WLIA 1CUZA 1EYZA 2H4HA 3FWNA 4TMTA 1JIUA 1ORVA 1RBQA 2FN7A 3Q7PA 5BSTA 3W7VA 4EA8A 1XC7A 5ULLA 1NT2A 2PKEA 2Z83A 2D5AA 1MG5A 4A0QA 1A72A 4N1AA 1Q1ZA 2ZRIA 1CRZA 1CUSA 1E69A 3HUFA 1XRQA 3OEYA 1TMKA 2GO1A 2HAEA 4IEIA 2CBXA 1BOOA 5EERA 4RMIA 1AGPA 1C0PA 3L4BA 2HPZA 7ADHA 1H2WA 2X3UA 3NOQA 3P9RA 2QN6A 3BEOA 3LMKA 4D81A 5JAIA 1AC5A 2GF2A 2KYRA 3L07A 1NVVQ 5HFAA 5L3RA 5CFMA 2JG3A 4LISA 3KQUA 5BW6B 2EFHB 2ZIFA 4M99A 5GGXA 3ZEAA 1OW3B 2G25A 2GI4A 4Z8XA 2NU6B 2FPPA 4TQUS 4WKPA 4NZZA 4NE9A 2HQSA 4Q9KA 5KTSA 3GPBA 2R44A 3P0IA 1QU3A 2PHZA 1NVWQ 2OPHA 2F8TA 1W73A 3RVJA 4RXMA 3AVOA 1RHRA 3PHIA 3KAPA 5DOZA 1DAKA 4Y6RA 2C4MA 4YCAA 4R8VA 3AIMA 5K99A 3QI7A 3VGJA 2ZDGA 3N76A 3PK0A 3VTAA 2HPAA 2DQSA 4XUGB 4HUQB 3VMMA 4LTDA 3N28A 3U7JA 3HU1A 2OWDA 4F5ZA 1OY1A 5JS8A 4ER3A 4MLCA 1KJWA 4EQ6A 1UH5A 4LXYA 2AXPA 4GZ6A 1R8QA 1UK8A 2OE2A 4KTVE 4KXVA 1P5ZB 2BFFA 2ZIXA 1Y9EA 4RO0A 5EHGA 5K2OA 2ISCA 1XLTA 3NDJA 3UMCA 2H1CA 4IZ6A 3WBFA 1CEEA 2GESA 4R3WA 3H6HA 4Y6LA 4U2FA 2B25A 1OSNA 1VYHA 2IPXA 2V45A 4FPXA 1WABA 4LMRA 1N6LA 3Q2KA 3QTLA 3S4YA 1DBIA 4UTVA 4I81A 3W2FA 3EZFA 5F3RA 2AFHB 4UZSA 1QKJA 5AR1A 4CKEB 5CLLA 4DQVA 1LRKA 3AU9A 4CJXA 3FR8A 2VP6A 3W4JA 4F9GA 2XKJE 5I51A 1KAQA 1AQUA 2ZWVA 3BB3A 3M81A 1N1DA 2CLFB 4WA7A 3T3PB 4UE3S 4CCWA 2AD5A 2QTZA 4BTEA 2CMKA 7GPBA 4BMZA 1LBHA 3S28A 1I0ZA 5AKIA 2I78A 5CDFE 2YVQA 3SEFA 3L0CA 1I3MA 3V7FA 2ZK7A 3W8NA 4G25A 5BR1A 3PNSA 2A0WA 1TAUA 3AI7A 3MA0A 4FDUA 4YRLA 2JJ2A 2W83A 5IJ0A 1DHRA 3ZDXB 1P1JA 1XVTA 1NYRA 3DBIA 4H7EA 4DQLA 2NQTA 5JEDA 1PX2A 2NTEA 4Q9IA 1Q7EA 1ZGBA 2CFTA 2R7NA 2X0NA 2ZKLA 3RRXA 4BRWA 4D02A 2XPCA 4GI3A 1FYEA 3GG9A 2FPMA 4RTJA 4FB5A 1RRMA 3K32A 1A0OA 1BXRB 3ZH2A 5KNBA 3EGOA 5CTJA 3AMVA 2LV8A 1CULC 1G21A 2YJZA 5LLDA 2II6A 5TMPA 4PINA 2DM6A 4JUFA 3VU8A 4MVJD 1CUFA 3B9QA 3PEEA 1YIDA 4U9UA 4RADA 1WZUA 1A97A 2WV9A 4WLFA 3HBLA 3K0BA 2XF8A 1A27A 5F78A 4TTAA 4DCJA 5KVSA 3GCWA 4ZT2A 2ONYA 1GYPA 3GUYA 4B75A 1O58A 2GD1O 4OHUA 4QUHA 2Y4OA 4K9KA 2CXHA 3V33A 4BN5A 2G0AA 2WTXA 2X40A 3CNOA 2OO3A 1FFWA 4HDRB 5TPZD 3S8MA 4HTFA 5HUHA 1U2GA 3JQFA 4NZYA 4OYHA 5AIAA 3WMXA 3EVTA 4PQFA 4RD2A 4DQXA 4EJ2A 1RYMA 3MILA 2YQ4A 3GLTA 2H92A 1LJLA 4FLEA 2H00A 2CXTA 2Q8QA 2CXPA 2I3AA 2R87A 5KQGA 2QRGA 3ZD7A 4C0KA 4G0MA 2YWRA 2ZULA 2YS7A 5EZYF 3X1ZA 4U7TB 3IQFA 3PNOA 5BV7A 1KBQA 3DPUA 4JEHA 4TT8A 1SZPA 6ADHA 4LF4B 2G9ZA 1WS6A 3IR5A 2YZNA 3CW8X 3MSCA 3PHCA 5BWOA 4M9RA 5BW8A 1MC8A 4EITA 4BLVA 5ALJA 3PPXA 2PQ6A 3KT3A 4C0QC 4INPA 5AK0A 2CSUA 1YZFA 1CDEA 4XLTA 3N2NA 1HT3A 3MWEB 1E1MA 4H0CA 3B5EA 2AQ8A 1IK6A 2E49A 4WN3A 5SYMA 4FM9A 4N48A 1FTYA 4L2IA 4FHFA 1U1EA 3E1SA 2H8KA 3HYNA 3GWZA 4GECA 4PWYA 4JXXA 1D5CA 1L7BA 2RAPA 1RWQA 4KQGA 3OZTA 1V96A 4NECA 3IMCA 3RUDA 1APBA 4Q21A 3R8XA 1U2TA 2VF2A 2XTJA 5FTJA 2RJOA 2VUHB 2XIQA 3IB3A 4B9AA 3D3KA 3BWVA 1CZKA 1DADA 4NYIQ 1V7QA 4XI9A 4WKBA 2OXIA 4EVQA 3J80A 3VKWA 13PKA 3PXXA 4NBTA 1B6RA 1W96A 3SPXA 1CJTC 5L51A 3UMSA 1MQAA 3E0XA 3P0HA 1W9HA 2D3TA 2PD3A 1V11B 3WXBA 5A06A 3M0EA 4FFDA 5JS7A 2GEDA 3TOXA 2QBYB 2Y1OA 3D7NA 2WYHA 1PZFA 1J4AA 4Y98A 3GLFB 2G36A 3RV3A 1ZN7A 3RG8A 1V3VA 1QCZA 3FW1A 2O9JA 1L3BA 1OGIA 4HS9A 4KLRA 3VC2A 3WGLA 1QH1A 4IMIB 4NZNA 1E1QD 3BOSA 3KZVA 4RZ3A 5TPWB 4DV6B 4DDWA 2GJSA 4QPNA 3L06A 3PNKA 1KK2A 2OFWA 3F1KA 2X8WA 4O4HF 3LOQA 4LGCA 4Q4HA 3VDMA 2Q4OA 4WHMA 2FEXA 3F1LA 2QUAA 3E7PA 4R8LA 5B1IA 1YR3A 3HGQA 3EEFA 2GFIA 3VYWA 2ZZKA 3AEUA 1ZI6A 1CFZA 2C9BA 3KP1A 1R5OA 3LE8A 4JNCA 2XD9A 3KKLA 3QJYA 4KKVA 3EB9A 3BMCB 3OZUA 1JXQA 5KKNB 4PPQA 4ESVA 1K0FA 2NYRA 4Q4JB 1L7RA 4MA5A 2QX4A 1YS7A 2JZOA 1XMXA 1JXOA 1KSFX 3PXBA 1HMPA 5KQRA 2PA3A 5A2GA 1P17A 1P7YA 4I6GA 1BCRA 2PLAA 5GINE 4KYVA 4R83A 3JU3A 3OY2A 1GUDA 2EIHA 5ELMA 5KOJA 4PAOA 2ETXA 4QBKA 3BGDA 1CY2A 2COEA 1P9WA 1MC4A 2JGAA 3CU5A 4MOWA 5B2FA 3GF4A 3NHSA 3QUCA 2JL1A 5E7MA 2B83A 1OIVA 1MJGA 1TYDE 4NYJR 1YWGO 1PJ3A 3TN7A 3VDXA 3I2IA 2WWIA 1GRVA 4DREA 2EFDB 4X1YB 1KJZA 4L50A 6Q21A 4LK2A 3KFXA 3G2OA 4XQGA 3A6EA 1LSUA 1MX3A 1HYQA 1TEXA 5SY9A 3G8DA 4OQXA 3OLYA 4P7KA 4UEWA 3ET4A 1M1YE 4OMDA 3VKGA 5LR6A 2ATXA 1AKEA 2H1IA 4KXQA 3TEJA 3RNOA 1WW8A 4XVQA 1A5ZA 2PYDA 5G40A 4YDQA 4LY9A 1WSBA 4R4JA 5IM4F 2XXAA 4GKJB 4PC6A 2RHGB 2VDWA 2X0RA 2LP4Y 1T6YA 2ZSIA 4RIEA 5FBQB 3BAFA 3PU6A 2HCRA 5FFMA 3UMRA 4XTCS 4DJAA 4F84A 1SXQA 2EFGA 1L4KA 1ZC3A 3AXSA 2GCOA 5CBPB 3SR4A 3FOFC 1J0DA 1NQUA 1C3XA 2VSYA 1ZNZA 1ZWLA 3TLMA 2AOXA 1DAPA 2C9OA 2CYBA 4IHAA 1CWUA 1NW7A 4NJEA 3J81A 1GR0A 4F0JA 4NEHB 1U04A 3EDMA 4WNAA 3IE1A 2X5OA 2C42A 5AXDA 2DB3A 4XPIA 4FEEA 4Z9XA 1U0FA 3A4NA 2XAAA 5J59A 2GZ2A 2FW1A 1FJXA 4MVCA 5ICEA 5C1BA 1G18A 1QUFA 3L8FA 3AF4A 5JNRA 1KY3A 2J3HA 2NO0A 1FDVA 3CF0A 3CRMA 3EXIA 4K40A 2QN7A 1Q22A 3C7DB 4JJ7A 4REMA 4FK8A 3K8ZA 4KQWA 3RVSA 2QRQA 1F0NA 4G9BA 3JALB 1IN5A 2WKSA 4C6SA 1V9LA 2BY4A 1DL5A 2FUG1 2RGBA 3PRYA 2O8DA 1RYFA 4HKTA 5F73A 1XZPA 2CD7A 2OXEA 3ILHA 1J8VA 2BLLA 2P6MA 2P7HA 1J97A 3OH8A 4LXIA 1L5LA 4RGYA 3R7FA 3FMVA 5FAKA 1Z22A 1WKBA 3NFRA 1KTVA 1YCFA 3ZDRA 5BVHA 2BI4A 4QECA 3TR6A 4PSKA 3LUAA 5ADHA 4IFIA 2O1SA 2RHBA 1R27A 3ZNNA 1XNRB 4V0LA 5DHUA 4IDAA 5J2TF 3V6MA 2V0CA 1C1XA 1VB3A 3ITNA 4WZAE 4I0WB 1QQAA 5HNKA 2YX1A 1NKSA 1C9KA 1OBHA 2VDJA 4TGLA 5AHXA 1PIWA 4NESA 4XB2A 4GR5A 4H0NA 4LJSA 1COWA 1E92A 3H42B 4FEAA 1QYIA 3L49A 3FUXA 4L76A 4U6QA 5T4EA 3TH5A 4G89A 1WBBA 4RQAA 3SKVA 4HMQA 4RKRA 3WP0A 5HZKA 2CDNA 4OY3A 4KIUA 3L6EA 2OOSA 1WSDA 3GBPA 3IKLA 2D2XA 2FWAA 4DDUA 3M82A 2WYOA 1F20A 3JQ7B 5IH7A 5BWLA 4RTNA 3FDXA 2GDJA 2I55A 4PX3A 1VG0B 2HKIA 4QRHA 4D4LA 2QRVB 1XJQA 3ZXSA 1QVZA 4Z1OA 4RNDB 2EW1A 3FNQA 1STOA 2GH1A 4POOA 5ECDA 4EYSA 1GWNA 2Q9UA 4LFBB 2EL9A 4BV8A 1W9MA 1PT8A 2XUGA 2I2DA 3VKVA 4CKYA 4CMJA 3F6CA 1WMDA 2XOKA 1RMYA 4ZEOA 4II2A 1X15A 4JENA 5FPQA 1KC3A 3G88A 1IMJA 3DDWA 3FTFA 2DF8A 2O7RA 5FOSA 1C1HA 1G9TA 1RTKA 2M6SA 3A9RA 4OCZA 4QGAA 3QEJA 4P3KA 4NOJA 5LU9A 3THYA 3DEAA 2CJWB 4MW7A 4QWWA 4B4KA 4FONA 4JI4B 3DH0A 1JR3D 1R5NA 1OIWA 1PR9A 3E7DA 1XT6A 3G9XA 3GZNA 4GKVA 4UD6A 5B37A 5FUQA 5ILOA 2B8JA 3GDGA 5KDDA 2E1PA 1UXKA 5HP4A 4ZANA 4POAA 2PNJA 5L95A 4NCAA 4PZUA 4B8ZA 1DS6A 1W4AA 3E2IA 4XD7A 3CQ9A 3OOWA 2AWOA 2BM1A 5JCOA 1T2DA 5LP6C 1XZJA 3E3AA 3K72B 2G76A 4XKJA 1DX4A 1PJ2A 2EBWA 4KNVA 3GX1A 2YINC 2OV6A 1P3JA 2JRCA 1XCLA 2PS3A 3SZLA 3VR6A 5K03A 1M5RA 3W2IA 3QNWA 4KX3A 5B6JA 2A58A 1UKVY 4GI7A 5AI4A 2JGJA 4UMFA 2JHGA 4MQLA 3WHIA 2FFJA 2GN1A 5F5LA 3CN9A 4EYGA 2VHUA 3DNPA 3DZFA 1KDTA 1UK6A 3O38A 3KSDO 4M89A 1EZZA 4I3FA 1EP9A 2FP4B 4M36A 4YV0A 2Y1LA 4UAGA 7REQA 4KE6A 3T5TA 4HAXA 3NBQA 3UT5B 2VZEA 4B71A 2FPIB 1DKPA 1VYUA 3PQ8A 3TRFA 1Z29A 2YJ4A 2X4DA 2YMMA 4OHOA 3V55A 4DA7A 3WB9A 1MW9X 1HDXA 4EL5A 1KPGA 2HA3A 4G5SA 1VA4A 1LRLA 4BVKA 1G0OA 4MRPA 2QRZA 3GGSA 4KAJA 2XYQA 5EQFA 3T9DA 3NDIA 1TJNA 3KTDA 3PQ7A 4G24A 4OBBA 3JXEA 1I6WA 4N0PA 1ZIOA 5IXJA 1JLKA 2QUZA 2WOJA 3W78A 1AURA 1WXDA 1T4DA 3L0DA 4MP8A 2JAHA 3IH5A 2NVUA 3K8OE 4R1QA 1ZN2A 5I7OA 2ZCVA 4ACAA 2ZI7A 1C4OA 3IIJA 1UDWA 4OM7A 1SZCA 5DP1A 2H06A 4QM7A 3SJBA 4IJ5A 2C4NA 4G0PA 4OF4A 2HHHB 2E89A 1NJFA 1P33A 4HQKA 4AL4A 1CY1A 3ELYA 1OXXK 4TTPA 1UK7A 1ZP6A 3B2EA 1JQEA 3H1TA 3IJRA 3KSUA 4KC0A 3EC2A 5B57C 3UMMA 1AUQA 3FN4A 1O97D 1RWVA 1RQXA 1GZ4A 1H2AS 1KFCB 1YKFA 2I5PO 3CMMA 4PHHA 5KHAA 2OCPA 4IIXA 1ZMOA 1BMFD 2C7GA 2WSLA 3CA8A 1ECBA 4E5PA 5JQGB 5LQCA 1PDVA 1ISSA 2R1ZA 3CZ5A 3K9NA 5TF0A 2QTAA 1UODA 2HXGA 4YLGA 3H0KA 3R24A 3RKUA 1QJ4A 4AY6A 4E08A 1C4KA 3AZQA 4I55A 3WISA 4QYSA 1L7QA 2C9MA 3S2YA 5CBPA 1VLQA 4HDKA 1DP4A 1B0AA 3TNFA 1YI1A 1X7XB 1E5TA 5EOVA 2A4MA 4XJXA 4N6OA 3I2GA 3OU7A 1P2FA 2RGGA 2Q7OE 4DA8A 2VPTA 4BE4A 2L42A 4E03A 2QTHA 4O2AA 1VHDA 2YIDA 3TLJA 2R6FA 4JDPA 4KG7A 1Z35A 1Z56C 3LS2A 1ZYUA 2QLTA 3QMWA 1MQSA 4U3JB 4Y0AA 4AKTA 4E2YA 4P4GA 5GADl 2FB9A 3ZBPA 1LK0A 2QNIA 4FKZA 2R86A 4LC9A 3KETA 1BE6A 1CJCA 4EG7A 5B3LA 1I0IA 3JQGB 3GQBB 3AESB 4PG7A 5CT9A 1G2PA 1EVKA 2K7FA 2ON6A 3EVFA 2RD2A 2G5CA 1BYIA 1Y1SA 3MTDA 1QH8B 4HYEA 3O21A 3JX9A 3GDOA 3H2ZA 2X7HA 4GXTA 5CM2Z 3RD5A 1NULA 4FP9A 2VF4X 5DMHA 421PA 2I6XA 3FYSA 4LMBA 2B4AA 3S2FA 4BJ6A 1A7AA 1KJ8A 2OBNA 1YE8A 3HU5A 1KDYA 1RKXA 4YRJA 1Q2UA 2EP7A 4MX8A 4RA9B 4S1WA 1BVRA 4MGZR 5MGNA 2WU1A 4PO3X 3VRHA 2JEOA 2W58A 1O8CA 3DPIA 4I5GA 5TQ0A 4C7JA 5EFZA 3ZV5A 4WAUA 2R84A 4QG3A 4MW6A 2CMGA 1QFSA 4FGSA 3O73A 3OSZA 4TX1A 5LJIA 1UMCA 4LXXA 2VBCA 2ZI5A 4Y2SA 1YL7A 4QDZA 3ESCA 1P81A 4RMJA 1GNPA 1NBME 4HX9A 1NQXA 2D2VA 3WYEA 4MDFA 4PHCA 5C81A 5FNVB 1A9OA 4EY6A 1S8FA 2RH9B 5IS2A 3N0WA 1RM4A 1WEHA 2X41A 3HCAA 2WRZA 1DBRA 1RJWA 1F06A 1OZHA 3AUFA 4IVNA 4LSZA 5BUQA 2BELA 4PFJA 1L4HA 5FT9A 4X93A 3W2HA 4F86A 1OH8A 2CCGA 2JLSA 2PRSA 2Y9PB 4JA0A 3KR1A 3KSZO 3L6BA 3QFHA 3BJRA 4N8DA 2ZT7A 3ROXA 2QLFA 4EOGA 4PLCA 4HWPA 4UUNA 4GMGA 3K70B 4I4LA 4ZAGA 4B3SB 2DP4E 3GJZA 1B23P 5GJWC 4D4JA 1MJ5A 3V4VB 4YLYA 1XZQA 4G4IA 1VE5A 4S12A 1SQ5A 3UJDA 4PLYA 4Z7JA 3JWJA 1H6BA 3OIDA 4C30A 3SDBA 5DRTA 5EKDA 1L4FA 1VC2A 4QQRA 4N8EA 1MF7A 2H2IA 3S2GA 1Q0QA 3QUSA 5KTTA 3H2YA 2I2FA 3R3XA 3BXFA 5HK8A 2JNWA 4JBLA 4C4OA 2V4ZA 2QD4A 1F1JA 1TCCA 1V5WA 2VHEA 4YHHB 1MB0A 1CERA 2OP1A 1I2DA 2QX8A 3THOA 4UUQA 1NJ6A 1SVIA 1TJ3A 2MJLA 1DAMA 2XB6A 1CJBA 3QBEA 4E07A 1XPUA 1E6UA 4JGIA 3K9QO 5DHPA 1DC6A 3RVMA 3UCXA 2XTNA 1JV2B 1AV7A 2WMYA 4DLYA 4JP3A 1CIPA 4UVEA 4ZO4A 5TY0A 4B2LA 1JDZA 3S2EA 4KQMA 5HZGA 4ZO7A 1D07A 3WB1A 4UUBA 3UJNA 1FSGA 2I03A 4OGWA 2H3HA 4UVDA 3LW7A 4XXHA 4DV7B 1KMQA 1KY2A 2R6ZA 1B16A 1LUAA 3BD6A 4BO1A 4JVSB 3EWNA 5DYNA 4Z3OA 1PR3A 2Q5EA 1UBFA 3HWRA 4LZJA 2VPIA 3K0HA 4BZQA 5B12A 4KQ9A 4J9UE 1I80A 1DEXA 3FNIA 2P9QA 3B1YA 4HGZA 3KB8A 4OU5A 5D3MB 4B33A 4GOJA 1IWBB 2VH5R 4ER7A 4H7DA 1NMQA 4XLLA 4KYTA 3D6VA 2PSFA 3O8OA 3HJRA 3OFND 1IOWA 3S55A 1X7XA 4INAA 1SCAA 5B3JC 1JG7A 4W9RA 3WTCA 1NZJA 4C4AA 3O8RA 1SO8A 4LDJA 3PEVA 5AKEA 3LY5A 2F3PA 2IS6A 2IPMA 3R6LA 4O4HA 4U3JA 1P9LA 2P9HA 1U5AA 1RBMA 3B6ZA 4C43A 1UFRA 1G7TA 1QQTA 3TRDA 4IDHA 2NPFA 3DOCA 4WZAA 4UTRA 5B36A 3CX3A 5CD9A 2RGAA 1ANKA 1CF9A 3HKEA 4DYDA 3VU9B 4URUR 1NVBA 1ZH4A 3LGXA 5IXSA 3BZBA 3SX2A 2RI0A 3DNFA 2B5VA 3FVQA 3GJ4A 1YFZA 5JQGA 2HBRA 1XPOA 1VSBA 1US8A 4LYEA 2I91A 1Z18A 3N8DA 3O1IC 5JS2A 4PLVA 2JAUA 3HO6A 2J0UA 3HV2A 1L7MA 1QLHA 3QVMA 3K6SB 3E7FA 5KOIA 1WBDA 1JIJA 1FBNA 2CN1A 3CZ4A 3FRJA 1MV8A 3SCZA 4YP0A 4RK7A 5LIPA 4WKGA 1NBWB 1AF4A 1IWOA 3LK7A 3Q3VA 5TQ0B 2PRJA 1N7GA 5JNWA 3FGNA 4F4UA 4XWWA 1KEUA 3GA5A 2LDXA 2XH8A 4B6SA 3CYFA 2R4UA 1Y82A 4BCDA 2CC2A 4JWTA 1FP4B 1YR2A 1XQWA 1GUYA 1CPYA 1PZGA 4QTTB 4WSOA 4A0GA 3OZFA 6AT1A 5HGXA 1HWYA 3SKYA 1CRQA 3ZLTA 2D7JA 1QVVA 1G41A 4OHFA 4JJFA 3VJLA 1Y1LA 2QTRA 5CFLA 1CHNA 4F3KA 1TRKA 1PEAA 2B2CA 2NLOA 2YICA 3ROFA 3W3AD 4CMEC 4KGVA 2P2SA 1DZ3A 2P78A 2COKA 2C59A 1XTVA 2VH1A 1EFHA 4QC2A 4V38A 3K5PA 5ALSA 3TGLA 1KKMA 1RJGA 1SHJA 2I6SA 3R7DA 4JASB 2C2BA 2H29A 1GV1A 1KPHA 2ID8A 2P4EA 4O3FA 2HO5A 3D8RA 3IP8A 2V74B 4NF2A 4ZO8A 1K2WA 2YOGA 2H17A 2JIDA 3OLZA 4L3OA 4FFSA 1AS0A 1NFRA 3WHKA 4DLVA 4QDKA 2Q45A 3RVBA 3BIWA 3L04A 1OX4A 3B6IA 3UMJA 3O9MA 1N8TA 3GLSA 4QOGA 4LYYA 3BD9A 2OM6A 1H9CA 2HI0A 3V6LA 2EKLA 2B9EA 3GC6A 3GFRA 4OHCA 3CNNA 1Y3DE 2BC9A 3H97A 1WVMA 4QSMA 4XIYA 4F56A 1X1TA 2OO5A 2PA0A 1E1KA 2ORYA 3A04A 3PWSA 1DFIA 1ZLYA 4LOIA 4MPDA 3BN3A 4MR8B 4AZWA 4D97A 2CMFA 3N59A 1JHDA 2XNSA 3T5BA 3WZMA 2FG5A 1HDEA 4MR7A 4WN9B 2XLCA 3ZGZA 2NUPB 1N5OX 1FW8A 4P7FA 2VIIA 4KGDA 1Q6ZA 2QM7A 5ITZA 1Z2DA 1X74A 1O95C 4YMGA 1O3YA 1BEUB 1YQEA 1ONNA 1C9JA 1RM5A 4G8DA 4HATA 4XDGA 2ZQZA 4ZPJA 4HR7A 1IOVA 1ABFA 1JQ3A 2ORIA 2H9AA 3FH0A 4FTWA 1FQOA 2GYUA 4LV8B 2BZGA 1FOEB 2R1TA 1AQ6A 1SVLA 4PCVA 4B31A 2ISQA 3VAZA 2EATA 1PG5A 1Q0HA 1TTPB 2ZSFA 5FOWA 3TKLA 1C0IA 2HSWA 5IAOA 5IKXA 4MRAA 3LU1A 1X1SA 3OZIA 4JWKA 1KK0A 4HL6A 4ALJA 4UNPA 3B9PA 4DG9A 1XU4A 4DR4B 3RC1A 5I6DA 1NYQA 3LIIA 1A9ZA 3WMWA 1RP7A 3ORFA 2XA9A 5ALGA 4Q7JB 1DRKA 3UOWA 1TQ2A 3D6HA 5BQFA 3VA7A 1OYVA 3GOHA 4G85A 4XGQA 3I4FA 2CGEA 1Y5LA 4L8LA 2HCTA 2ZE7A 3GNTA 3MZ0A 4AU1A 2L82A 3LTNC 1N2BA 1F6BA 3HHPA 1K5PA 4IHJB 1Y3IA 2C97A 1YCHA 3QBTA 1CZRA 4HXGA 5IC6A 2X2EA 3TWOA 4W5HA 1R9NA 3U7HB 1E20A 2CV1A 2FMTA 4D9GA 1KEKA 3A6ZA 1WUYA 4KFSA 3QU2A 5CIWA 1NZDA 1THMA 4H6WA 2YW9A 2UAGA 3F46A 1XL0A 1FS5A 3F5MA 1OI4A 3BTVA 2ZBFA 1ADJA 4D41A 1U0GA 4NARA 4DMRA 3KLOA 1MAUA 1UT6A 2GPNA 1EGAA 2WU3A 3NTLA 4DCUA 1ISJA 1M6YA 2DERA 1CQIB 2L17A 1CS0B 2H0AA 1T8UA 3I0MA 2Y99A 1PUJA 3DONA 3L18A 1A4UA 3UXYA 3EZ9A 2OHVA 3DF9A 1L7EA 3RG2A 2COUA 1NI5A 5C3UA 1O0CA 3OLXA 2CUZA 3HM2A 1G6OA 5LNK1 4M76B 2VC2B 4TMWA 5AVJA 1ONPA 1TKAA 3DDNA 2A1IA 4P5EA 4KH0A 3LY9A 2DFPA 4FUQA 3U37A 5HHTA 4BLRA 5DNWA 3VSEA 4CM3A 1W7AA 1PGJA 2R3SA 1JLLB 1ZCZA 4DR6B 5JSUA 4IOJA 1Z37A 1B43A 1TYBE 3NNDA 1Q1AA 3R76A 4AJLA 1ZMTA 2Z1MA 2Z2ZA 1GL3A 3CSDA 5ALDA 3B6JA 4CG1A 2X42A 5EXPA 1XG5A 1Z82A 2DULA 4JR1A 5LU8A 2WM3A 3O3MB 2DVMA 4EEZA 1DBPA 2AMYA 2V6IA 1LPNA 2ZUCA 2NZ8A 5A7HA 4YPOA 4PBSA 3TDMA 1NJSA 4ER6A 1RYBA 1P7WA 5JAOA 2QRUA 4IUYA 4B73A 1MOZA 4KLCA 4RWEA 3QFFA 4ZVVA 4HDQB 3NWBA 3O4JA 2YWHA 3NETA 3P9QA 3QLUC 2O48X 1Q20A 3CLRC 4MZDA 1UJMA 4O1HA 3RW9A 1MP0A 3LQ1A 4OOFA 4BIMA 3L8ZA 4IXWA 2LVBA 5HMMA 5C9ZA 1SNYA 4CM9D 1FMLA 1IHOA 1UK9A 4EGCB 5BSKA 3WAJA 4B0PA 3IJ5A 4I46A 4CEHB 2O8FB 1LPOA 1KYYA 3B9BA 1JQAA 5BXQC 2W2KB 3ETDA 3ASYA 2NV0A 5JATA 1CF4A 1TTTA 1CJSA 1EJ0A 3K4QA 5FXMA 4E09A 1KWKA 2BDTA 4KQ6A 2V6MA 1PT9A 3KCNA 4GX2A 3KOZA 4RNCA 4A4DA 1AZLA 3NRCA 1F9AA 1XFDA 5DGHA 3CEAA 4EKEA 1NRJB 3T1QA 1I4LD 4Y2RA 5EJ4A 3DNMA 3FXAA 4L5CA 4KQXA 4GNRA 2JDID 1ODKA 1KAHA 1P8AA 2UZ3A 1POWA 1TKBA 2XF2A 1Q17A 2D5BA 1V3QE 3PS9A 3FYUA 5SZIA 2WK1A 4BEWA 2EU8A 1TPZA 2DU8A 3F47A 1YZYA 4CV2A 2AI1A 2CVHA 3W6NA 5A9RA 5GIPE 3VR2D 3FFBA 1DV2A 3FCXA 4EKDA 4PFQA 4ZZ3A 1JW9B 1RS0A 5C80A 4B5LA 1E2EA 4GPEA 4ZQEA 1KYQA 3QJ5A 2NT3A 4KCGA 3COWA 4O1IA 4UQPA 4JLBA 1ZWKA 4ZZ0A 3KVOA 4AY2A 1JFFA 1ZVQA 4PYOA 4QWMA 3G5MA 4Q9JA 4KB5A 4BASA 5EQJB 3BA1A 4Q0MA 2GBLA 2PBFA 3N7TA 4IOKA 3TPZA 3KPUA 1ADCA 1KK1A 1DTEA 1RJEA 3PPIA 1XZIA 5DIFA 5HRCA 4DPMA 5KNBH 4M86A 4J8PA 5A62A 2XIJA 5CVDA 4ND7A 4CMHA 3C14C 3UPTA 3C7CB 2XT9A 3PUKA 1OXTA 3IL2A 1R9GA 4AN0A 5HS6A 2UYHA 3QUQA 1XWWA 1KFJB 4G0VA 1J2JA 1GZVA 5JZ9A 1CBUA 5I7SA 2HA2A 2C9CA 4RD3A 3VH4A 4U7DA 1JE1A 5EJ6A 1E9VA 1C0EA 3DE5X 1Y98A 4F1KA 4Q7MB 3PQ5A 1NMZA 2CNWA 3AHIA 2QE7A 3B5JA 1DWOA 1MA3A 1UM8A 2OHGA 3GELA 4PVCA 4U2DA 4UCFA 4ZVNA 2V6FA 4UUPA 2WOOA 2IV2X 2PUFA 1I4WA 3P9NA 1KE1A 1EKXA 4Y8VA 1E1QA 2PN1A 1GUFA 1TFUA 2Y1WA 1DUSA 3LZ6A 2Y4NA 2XADA 2A9PA 1ZITA 2GETA 4U7PB 1EA5A 1J23A 1EFRD 1P6UA 1EBBA 4JB2A 1VB5A 1L3IA 2DG2A 4EH1A 3C6BA 1V9CA 4FI3C 3GRKA 1JVBA 5JADA 1RQGA 3NTQA 4ITVA 2C2ZA 2FGKA 4B32A 4BVBA 4Z7OB 1FFHA 4GLFA 4RM3A 1SHLA 3H4VA 4ZT3A 5FHQA 4UPEA 3T12A 1U1IA 2HJHA 3P9YA 2PMFA 1T6BY 2WU8A 1XLVA 3ZQUA 4JXZA 1ST3A 1RC8A 1JIIA 3NHZA 1Q44A 3WIVA 1ADFA 1J8FA 2MSEB 4IQ8A 4U7JA 4YGYA 5DTJA 3F5SA 4RD0A 2C8JA 4CM4A 5LN1A 2GYYA 3OOHA 3RHZA 5L45A 2IBTA 3ETHA 1DHTA 1A9XB 1Y0BA 1VCNA 3O4VA 1I2AA 1D04A 4QUEA 5AXCA 4CIDA 4G84A 2V7PA 1E2GA 1F2VA 4NBWA 3TJMA 1XRRA 4RQBA 4H7FA 3RVRA 1UC5B 1G66A 3G2JA 4JEMA 2YZ2A 4F2PA 1QPZA 4GSLA 3A1TA 4NDNE 1U7PA 4FYVA 4J7XA 3UJ9A 3VO2A 3ZLVA 1GKIA 4BFUA 3UC9A 3W7BA 4R8RA 5EIBD 3IJEB 3WGKA 2UXDB 2AEFA 4AS1A 1ZNYA 1T8YA 3VPFA 2CL6X 2X6QA 3FWPA 3CPJB 5TQ2A 5FTLA 1UFKA 3G2IA 1PN3A 1T3LA 2JS7A 4ZCLA 3RIYA 3LP8A 4C6HA 1F0KA 2Q99A 1XN1A 4NONA 1X1DA 3RC9A 5CVVA 3NMUF 3EQ2A 4CGZA 2VPWA 2XA1A 3FTQA 1WA5A 2VBIA 4GGPA 3X1XA 1R18A 2H2DA 4CDNA 4DSUA 3RSCA 1GZ5A 1DLJA 2P75A 3KQOA 1Z5OA 4MVWA 3TZHA 1AE1A 2JGMA 2LIPA 3AKEA 3R20A 3WKBA 2XYRA 4DJEC 4HQ0A 4PSUA 1Q92A 3GJTA 4IW3B 5ALQA 3LLCA 3OI7A 3KFVA 1PLLA 3T54A 2BH9A 1C9EA 2QM3A 4Z8YA 1CLUA 5JMTA 4OQFA 1SXGA 4A73A 2ZRBA 4L9RA 4WLUA 2EFCB 2ZWOA 3PQFA 3FPFA 1Z8HA 1ZI8A 2FRDA 1Z4KA 3FCEA 3OCCA 4JGBA 3AHEA 3OPYA 2IBSA 1U7ZA 2WAOA 4FD2A 1Y3BE 3T4EA 3U7EB 1QVRA 3GEHA 4NNOA 1GSAA 1NR1A 2WYUA 2QSYA 2JRLA 2DMRA 3GLHE 2LUOA 3QKIA 3EYWA 1VMAA 4JDUA 4TS1A 3V8MA 4ZTUB 1XCMA 3L1VA 3L7JA 3MAGA 4E4TA 1QNFA 5JH7F 5HSGA 4FFMA 2C9ZA 3KDAA 4UCQA 3S1LA 2O2EA 3EA0A 2WHXA 4YUWA 1NW3A 2J3LA 2XOKD 3U1TA 4FXOA 4H77A 5I8PA 3FUWA 4W9NA 3UOAB 3C43A 5BW5A 5C18A 4G9GA 5C53B 2D06A 3I53A 4WLOA 3WY9A 3OTOB 3AHCA 2ISSD 1BTOA 1ZEMA 3T7EA 1RQNA 3PL5A 4IMPA 2XQVA 3B3GA 3HA3A 4UFNA 5AW7A 1HPLA 2XOXA 3JZIA 1VSQA 2HRCA 3DOIA 2QLBA 5DYWA 1T4BA 3WLMA 4DW8A 2Y1CA 2BLNA 3NEYA 4ND5A 3F7NA 2JVJA 4MI6A 2AMVA 5IT5A 4JXKA 2VHWA 3DFZA 3MJRA 3RCBA 3LUFA 1JEJA 2B4RO 1H2BA 2W8BB 4R16A 5CM8B 5C5DA 5NULA 4B76A 5CLJA 1RHMA 3WK4A 5GZ3A 2R6AA 3JASA 5FWDA 4ER0A 4AYXA 5HILA 1BHO1 3LWZA 2HNAA 5BY2A 4WKCA 2CSXA 1JAZA 2PX8A 4M1MA 3OIUA 2R2AA 3QWFA 5DM2A 2VRCD 4JFAA 2QP9X 2QHXA 3AUUA 3ITKA 3TIGA 1HZZC 2FHSA 3EF1A 3TI9A 2Q4BA 1Z2NX 4X6YA 4BNGA 1HKUA 1M8PA 2FSVC 4MUBA 2ZATA 4IFTA 4RPCA 2PEZA 5GOZA 2ZIVB 2MTBA 3PVSA 4AULA 5L4NA 1VQ1A 3AUJB 4J1NA 4M37A 2WZDA 4I1UA 4W1QA 3GCDA 3NHLA 5AI0A 1GGHA 1SBZA 2VNJA 4F2DA 2YWJA 1N8KA 1WHTA 1IM5A 4EK9A 2A1UB 2XWPA 1YJAA 1MLDA 3H9QA 4LY3A 3X0DA 4E5NA 2OL4A 2ZXFA 3RSOA 4EZEA 1KMMA 2JIZD 2AW3A 5EJFA 2EX4A 4EX7A 5B2ZA 1FNCA 3MF4A 5G41A 3LAWA 3TQIA 1Y34E 4CM8B 4LEIA 3OLQA 4GI5A 3KT6A 1E7MA 1JJ7A 2PGNA 3QE2A 1Z25A 1JXMA 3S8YA 5ES4B 2AWNA 1DO8A 1ACMA 4M6WA 1G3QA 2RAUA 2YR0A 4JJ4A 3TQHA 1XNGA 3TTWA 2G1KA 3AR6A 3MINB 5THKA 4C89A 3C7TA 4A2QA 3EVAA 3VHLB 1U9JA 4F60A 2D2FA 5JD6A 2ZCJA 5EKSA 1KY5A 1XZBA 3BZUA 3GT4A 3SC3A 3IQWA 3T15A 3HXQA 2BR3A 3OUZA 1E1RD 4PZYA 4M1EA 3UBTA 1CYEA 1DKNA 1Q0PA 2FPKA 2OCLA 3OKCA 1HURA 5FPSA 1FDWA 2O50A 1DDGA 1PWHA 5J4VA 5BOVA 4KZPA 5T5QA 3A27A 4QJ4A 4B43A 4BNVA 1ZM9A 5KX5A 1YHYA 3U1VA 3ZI7A 5KNCA 3AVVA 3M9LA 3DHNA 3WK5A 2HRQA 4PPYA 2PR7A 1N7IA 1J70A 2W4MA 3OIGA 5GY7A 4YCNA 3OQVA 1PS0A 4IZOA 4KPUA 4TS4A 3W04A 5JCJD 1G8HA 3D81A 3I32A 3WB2A 3FX2A 5L4SA 1XHLA 1ISGA 1CUHA 2D1SA 3JQ9C 4MJLA 3RUPA 3G2QA 3X3HA 5B64A 5BXYA 3USZA 5JANA 4R8KA 1Z4IA 3M83A 4B87A 3M6XA 4P0PB 4H18A 3WG9A 2QG6A 3D2BA 3WLHA 4EVIA 5KYKA 3DWIA 2ZRPA 3IUMA 4RDHA 2V7VA 3MELA 1UM9B 1HI9A 4J6FA 2NM0A 2MYNA 1T8WA 1YR8A 1Z07A 3NAMA 3MLEA 2DWUA 3SICE 3KO8A 3T1VA 4YMUA 3T1YB 1ISRA 1U28C 2IYTA 2WT8A 2HGSA 2PU5A 1PFQA 1PCXA 3AR9A 4FXPA 2OHIA 4IX9A 1UJCA 4TYQA 2AG0A 3QQ5A 2OV4A 1DBVO 1M72A 4MGYR 3PKIA 3RSLA 1EVLA 2QD2A 2QUHA 3S40A 5AD1A 3COJA 1W48A 3GOQA 2Y1FA 2R68A 4KMOA 4E2WA 4RW0A 1G8GA 4ZHQB 2Z6UA 1EGHA 1I5EA 4ZAVA 4D5GA 3K15A 1Z8DA 3L1KA 1UXOA 5E1MA 5GM2A 1FDRA 1VJTA 1KEEB 4IHJF 4OYLA 1FNBA 1BN6A 1T36B 2DR3A 4YJHB 3SBDA 1FF9A 5AUNB 4HWOA 1Y8QB 1U02A 3CLTC 2ZYTX 2A5GA 2YJTD 5MFZA 1RPZA 3KK0A 5GTDA 4TTTS 2Q5JA 3GQVA 4V0SA 2ZYRA 1BVHA 4AC9A 5CPBA 2KSQA 2GM5A 2V55B 4MS3A 5J3JA 3QIVA 3I8XA 3TD6A 3DVAB 2NAPA 2UDPA 4MPRA 3VR3A 3IUEA 4BQOA 1YRWA 4N0EA 5EKUA 3VV3A 2QD3A 5HKKA 2CXUA 3STUA 3T5PA 1GSOA 4JD5A 3WKDA 1S7GA 1E8NA 1JSRA 4MW9A 1XEXB 5CXQA 1W5BA 4LSWA 1EBUA 2QAGC 9ABPA 3HN7A 3HRKA 1LCIA 1O95D 4LX8A 3SG0A 2QG9A 1B8VA 4HEA1 2XDYA 1YCGA 4GWLA 1U5CA 4QUAA 3RLIA 5E4YA 2ZTVA 3OM1A 4QDJA 3VMFA 2QG4A 3ORRA 3W5BA 5F35A 3UWKA 1JNXX 2BTQA 2I3ZA 3BDIA 3LL7A 4PZLA 4DANA 2FXVA 5INTA 5EVJA 2GBLC 4BJ3A 4H7HA 2HIGA 3QPDA 4ZOCA 3EW9A 3RO7A 5F21A 4CTNA 3CG0A 3P2MA 4NU5A 2O2DA 1P44A 3UWPA 2A0KA 5DYYA 3HJGA 3EEQA 3EK2A 1T4CA 4FOPA 2E4VA 4OXYA 3D54D 1WQ4A 3UUGA 4CU5A 4G41A 3U6KA 4B4UA 4YJ2F 2BCGY 5EJEA 3IX7A 3EIOA 2J30A 3JQ8A 4I9HA 4JB3A 5EN4A 1MZVA 5JAQA 3CKMA 2OAEA 1XROA 2AGVA 1GSHA 2VF7A 2G6BA 3NZEA 4FEGA 3CJQA 1T9CA 3CXUA 4PAWA 1I5RA 4TKLA 4KDEA 4P4SA 2BFBB 2VUUA 4PX9A 5CVEA 4EO7A 4C07A 2P3SA 2RMKA 2ZXUA 2VPPA 3F5DA 1CJVC 3X1WA 2CEAA 3DOJA 4FKMA 5BR4A 3RUCA 4BQEA 2YV2A 2W2NA 4ATNA 3ZDDA 4NDAA 1ISHA 5CCXA 4LDRA 2PT6A 3G7UA 3QG5A 1XYGA 3M5DA 1DJOA 4LDAA 5CD1A 5ILQA 5TQVA 4GM4A 1ZL0A 5DYTA 2BFDB 5JRZA 2HUNA 1T2VA 1XZLA 2G6TA 2EX0A 1CVIA 1U8UA 4Z9FA 1ICEA 3CN7A 3P27A 4MV4A 3SHFA 2GGSA 4DLWA 4BLTA 2ZAYA 3N75A 2B20A 2ZYDA 1R7RA 3F9IA 2CHEA 3GRAA 3R1IA 4OLFA 2OQVA 3HKEB 3VAYA 4DCSA 1PBNA 2QJTA 1GPKA 2VEOA 2JGDB 4ROTA 1BDBA 2WD7B 5JHHB 4RHFA 3JRXA 5AOAA 4E15A 1Y9JA 1RM0A 3PE4A 1GZ7A 4AKEA 4QD3A 1NAIA 4M7OA 2XMRA 3DE6X 1EBFA 4DMMA 1W30A 1X9IA 4CR7A 1VBMA 4L9WA 5G4KA 4FLFA 4B6OA 1JEQA 3UA3A 2TMGA 1V39A 3U9LA 2PYIA 3FPHA 3VPDA 1XA4A 2J3KA 2HLNA 4XRRA 1J9EA 2R8OA 3ESAA 4RELA 1H2YA 4XYBA 1GG9A 2YMLA 2V1XA 4KWTA 4KXYA 2RHMA 3BK2A 1XDWA 4M7PA 1KYIA 5BUCA 3WTBA 4HH1A 3TZ6A 2O2XA 4EELA 3CKKA 1OFIA 2P0YA 3OPYB 4W5RA 4AJ4A 4TYYA 3VR6D 3DBLB 5JO0A 4YV2A 5JISA 3T7RA 2PAFA 3ZV7A 1NATA 3E15A 5FUYA 1JHYA 2E37A 4FIZA 5BRAA 5FWNA 4NJEB 2BEUB 4P0TA 3EZXA 4DQDA 2VOEA 3E9NA 1VGQA 3PIIA 3SIXA 4AKGA 1ODSA 5JPDA 1TRHA 2BF7A 2DWCA 1JZTA 1GCOA 1TUGA 2G0NA 2IYPA 1LDMA 5EIOA 5GVRA 2XMDA 1U2DA 1WTCA 2A35A 4G5RA 3SQOA 1H8EA 5B4TA 4BQIA 3R6GA 4ID3A 4R1TA 3BS4A 4JLOA 2YXNA 2Z5VA 2BF4A 2CLCX 4HDMB 4X54A 2D1TA 1PP4A 3OC0A 4QUIA 3U48A 4QJIA 3VPCA 4C7KA 1VHTA 3PQDA 4GZLA 1M6EX 4FHZA 1C7EA 4P32A 4HQOA 1XD2B 2QY6A 4P0QB 4KREA 2GS9A 2C4UA 3NTXA 3QA3E 1K7SN 4H1WA 2JLZA 1K3TA 3MFQA 2NSHA 4I50F 1J21A 3RBZA 4BP8A 2H2AA 3WA6A 3NC1C 1NY6A 1AM4D 2OENG 1GTG1 2VP3A 3SBOA 3HZHA 4YRMA 4YT2A 1U98A 2A86A 5E1DA 2IQIA 2N9UA 3C74A 3KX2A 1OWLA 1Z0AA 1RABA 4IJ6A 4M87A 3QYAA 5DPMA 4BAGA 5GOTA 5EIBC 3JQ9A 5CGZA 4BKOA 1JHVA 1N2HA 2B21A 3BKWA 3M7IA 3SQXA 3PUIA 1P0QA 3DHYA 2XOEA 2YHSA 5SYAA 1TO6A 3HUUA 1VL6A 2HLPA 2J0EA 4FZRA 3BXOA 5FWXA 4U5XA 3V48A 3L92A 4EG3A 3IPRA 4FB4A 1UBNA 5B1YA 2IIQA 3PQ6A 2VQ3A 3UXEA 2ZTLA 4B4OA 1B3RA 1I1OA 3Q0IA 4YRPA 2PRKA 1VPVA 3OX1A 1OXMA 4AURA 2WKPA 1G7CA 1CNFA 1T13A 3WGMA 3B3JA 5KTNA 1A8IA 4ZJZA 2Z5GA 1LWOA 1MORA 4M49A 3UVEA 1P1KA 3VI4B 1DT3A 4IJMA 5HDBB 4C7XA 5IVDA 3OQNA 1XQYA 1VG1A 1W4LA 4CM9A 3Q6MA 3U4QB 3WK7A 1VRVA 1UANA 2V7WA 2LDBA 4MUEA 3O26A 5A4IS 1PZEA 1IC6A 1H9AA 2Y0CA 1H22A 1A3CA 2ORED 2IGBA 2ST1A 2OD7A 1J09A 1SVMA 4UU8A 3AF5A 3WLRA 3FI9A 3ZK7A 4ADSG 3N0VA 2EBFX 5LXTB 1S8OA 1KK3A 2QPLA 4ISBA 2PT9A 1YU9A 1N0IA 1DGQA 4B8YA 3EOZA 3E6AA 2XTZA 5AVKA 3QX9A 4JUCA 1IZ7A 2YN4A 1LNSA 1N9GA 1SXJE 1VCHA 3ISTA 3KJIA 3P5BA 1NP7A 1WEKA 1YZ3A 4UEJA 4CMEA 5K0EA 1ODCA 1QR2A 4C76A 5LZ9A 5KDLA 1UDRA 3R3SA 2QVYX 8MHTA 2EZTA 2Z04A 1V1MB 2G4VA 3OY7A 3DMTA 3TSOA 4C7BA 2F8MA 4RJ2A 3ZNPA 5FQOA 3LVBA 5JC8A 3LCJA 3OJXA 5T64A 4U7WA 2GO7A 2NUBA 2Q5LA 4ALKA 3L79A 3JZFA 3LNCA 3GEMA 2PBRA 5FV7A 1DUVG 2IYRA 1EFUA 4XH9B 4XM2A 1A5TA 4KO3S 2H1OA 4E3WA 3VUFA 3KQSA 4MVJG 5IANA 3F7OA 1TECE 3O2SB 4JP2A 1R6VA 5JCJA 3IOEA 4PYIA 4EFDA 1X3SA 3I4CA 1GTVA 3H16A 4F4IA 4MLDA 3EQ7A 2OM2A 5AKGA 1O6GA 2V8BA 1F8YA 5M34A 4KEAA 5A6SB 3RS9A 2ZTMA 5HUQA 1TO2E 1M6HA 2F1HA 1IPEA 1IBRA 1BHSA 3EZGA 4IKOA 2I3BA 4YGXB 5EA2A 2PSEA 5B1HA 1VYVA 3ZW9A 4EPTA 1YU6A 1IJEA 3PR3A 1EK5A 4FX5A 1XMSA 3I04A 1BQ3A 3I45A 1KEEA 2IZ5A 4TLMB 1I14A 4FJ0A 1GOTA 1ZG3A 1ESDA 1GAWA 1MRZA 2BJVA 3ENQA 3KD2A 4KSYA 2Q6VA 1CE8A 1YA8A 4W63A 4EW2A 2NSDA 4IGAA 2G80A 4KBFA 1Y9AA 3KYBA 4MVXA 3LCCA 4PANA 1JIVA 5FPPA 3TD2A 1C9NA 1DTSA 1P6XA 4HXEB 2WZCA 4HDMA 4BMDA 1VJGA 2QMEA 5HDQA 1XCGB 1UADA 5ESRA 1NDHA 2WF9A 3BCRA 2JAPA 3DDOA 1RXSA 2PY6A 3MWJA 2R6CA 4RV9A 5E2BA 2C03A 3ZDFA 3G23A 3UJPA 3HCPA 1IQUA 2K2QB 2VJOA 4WOCA 4YREA 1WB6A 2D1QA 1Q1EA 5BQOA 4DWVA 4S1NA 3D59A 5CRIA 4DA0A 4NSNA 2FRDC 3B53X 1T3ZA 3FSGA 3QU7A 3ZGNA 5ARBA 4QTXA 1CW2B 1J06A 3GNSA 2HMWA 1KYWA 2O3QA 1JSCA 2WWFA 3ENKA 3F7TA 3DT6A 2PVSA 4CMIB 3QF7A 2NYAA 3PCTA 1TLTA 4LK3A 4OQQA 2A0UA 2YYAA 3QHQA 2BMEA 1L8XA 1D7AA 1DQSA 1JDBC 3FZYA 4CTKA 5BN3A 4R1MA 2WG2A 5D51S 2Y0EA 5C1OA 1Z75A 5AJYA 4H3HB 3QEBZ 4GOOD 5L7YA 2XDWA 3C7AA 1OWNA 1J0AA 1ZI9A 3FPLA 3GZTB 5TEWA 4CUKA 4OSEA 5A5DA 2GA8A 4FYJA 2QS9A 2ZJAA 4FFLA 4WQMA 3KBBA 4FT4A 5CFQA 3YASA 2EGUA 2PPVA 5FBZA 2BHRA 2HRBA 4Q3BA 1YV9A 4K9QA 4FMBB 1O9BA 2BSAA 1MRNA 2CNDA 3OQOA 3K0SA 2VT6A 4CM4B 4D74A 3DA8A 1H2FA 4IM7A 1QZ3A 4OI0A 1X7WA 3PJEA 3UJ6A 4B17A 1C4WA 5D2CA 5KS2A 5FA5A 4OQ4A 4U7HA 4YR7A 1PNOA 1NBAA 1UOOA 3B3QA 4YK7A 5HWSA 5K5EA 4HG2A 4CQLB 2P2DA 1L7PA 1YQQA 3D3WA 3OF3A 1C8VB 4ZAWA 1Y3AA 1HNZB 2DFLA 1C7FA 4PWZA 1E3MA 5F5NA 2JH8A 2D13A 4ZAZA 4EI7A 2FMIA 3W8FA 3I3OA 5C4MA 3NKVA 4H7KA 2EGGA 4YV1A 2PFGA 3F96A 5T3UA 5ALXA 1WL8A 5REQB 3RVPA 3Q5DA 1HNWB 3I3SR 1AF7A 3R7AA 2EKBA 3PRHA 3C98A 5KOJB 1E4YA 2BM0A 1RYYA 1VSTA 1HTTA 1Z73A 2A9FA 2P30A 3C85A 3HYLA 1UKBA 4B5KA 5JNLA 5AFSA 1Z6QA 1IZ8A 4CHGA 1GKKA 4CKBA 4QA9A 1N9KA 1QE0A 5ADUS 3CO5A 3TCKA 1CIJA 1C3EA 2WFMA 4FWBA 3OOJA 4D8YA 4K9NA 4DSZA 5DEIA 1ZK2A 5CG1A 1CEYA 1NE7A 2IE8A 1NASA 4JUDX 2RK3A 4CR8A 4H08A 2ZXEA 1CJUC 2F90A 2J0UB 2VTEA 4XGNA 5E9QA 1UZUA 1GRQA 1N0HA 2RGUA 3ZYZA 4EFNA 4F8JA 2E6UX 3U44A 1CQXA 2OZPA 4MP3A 2F55A 2EKZA 4CKCA 4H6XA 4ARVA 4X62B 1PK8A 1QIMA 4RH0A 5FOQA 2EJVA 1YTLA 2IGTA 3GZJA 3KYDB 5FAXA 1A8SA 3CB2A 1LQUA 4LYDA 1TUBB 2ZEJA 4F6RA 3RRNA 4KBYA 3QFCA 2I6FA 2IOQA 3GJ6A 2FDRA 3VX4A 4NR0A 3MJ4A 3FMIA 3R3ZA 1V4VA 1M54A 3SAJA 4WWHA 3TZKA 1RE0A 3M3DA 2BFOA 4RETA 3STYA 2P3QA 2IZ7A 1RNLA 2PCJA 4PYKA 4RIIA 1X0XA 3CV3A 4OHXA 2ZUBA 3SLGA 9MHTA 3HNRA 5G53C 5ITVA 4W8GA 4UTPA 2QGFA 4KIWA 2VSQA 2XD4A 3PENA 3N2ZB 4EY7A 2XCTB 2Q0HA 2LRHA 3FRIA 2PIAA 1N5KA 2O2YA 4J0KA 4WK6A 4XPIB 3MWDA 4L8WB 4RX1A 4M0CA 5I5GA 4BEJA 4E5SA 3AF3A 3L6DA 2IYOA 3CR3C 3FUVA 3GP5A 2R4TA 3MMPA 3N6RA 1YZLA 3RFCA 3NDRA 4NOLA 4QBHA 3KEMA 5JECA 3EGXB 1TQ4A 3PGKA 4EF5A 1VKZA 2DYKA 1IZ9A 1U2PA 2H16A 2X0DA 1LLDA 5LBTA 4PRKA 4F11A 1Y1KE 2AFRA 1FEZA 4D45A 4B9EA 1TA0A 2IXAA 3AKYA 3H2BA 1L8OA 3HO8A 3SX4A 1AMOA 3WL7A 1PI3A 1BQEA 1P4RA 2WG0A 3AFGA 3CC8A 1DBWA 4WBSA 2OV8A 3VH2A 1E4EB 1WULS 5IKOA 3NAQA 4DUYB 3P0RA 1U2ZA 1IRIA 1GNLA 4IFEA 1BFKA 5EIEA 3K6KA 2HEGA 3RC7A 3QF4B 1KMCA 4UARA 1SUWA 4FS3A 3W7AA 4IJWA 5DNVA 4QPCA 1KAOA 5CNIA 1RBZA 3MB5A 1IN4A 1DTWA 1ZA1A 1KI3A 1PDOA 2B1QA 2Z6QA 2LBPA 4NABA 2Y66A 3N6VA 4G1EB 5K6RA 4Q6WA 5EJMA 2P6RA 2VHQA 5U1PA 3R3HA 4L4YA 4MYRA 4EY5A 1OJLA 2JLCA 2R8ZA 1UEXC 3LBFA 3M4YA 3SYLA 2E7ZA 2ODTX 5K4AA 2WTAA 1T1JA 4L8YA 1UKZA 2NGRA 3P9PA 1PLJA 3NAGA 2P8JA 4LTMA 3MERA 1W4ZA 3F6PA 1FDUA 4ZV7A 4F6CA 4X00A 2AOVA 2D4HA 3M3PA 2ZWMA 1OV4A 1UKAA 1U6IA 1T1IA 2PX6A 3R2JA 4Q00A 1TEVA 3KEOA 1ZD4A 4WZBB 3OCZA 2CLEB 4II7A 1BJKA 3O3CA 4OHKA 1YFJA 4Y18A 5IUKC 2WI8A 4C4ZA 1L8LA 1VA5A 2QD5A 4RSGA 1W94A 3AUAA 2FWMX 3IURA 4MV1A 4O2BA 3KPJA 1JKMA 4LPSA 3MG9A 1LPAB 3IOBA 1FUIA 2VJPA 4RAOA 3UQYS 2JIPA 5DO9A 5HR5A 1G0NA 2QR5A 3M6IA 1PO7A 3I09A 3E5RA 3E9EA 4CU2A 3PC7A 4FIDA 4JJ6A 4J0IA 4BN0A 3WGQA 3O93A 1K7XB 1R64A 4D6PA 3T1TA 1XLUA 5BN1A 5I9BA 5DCUA 3OEEA 1JR3E 3GHYA 1W88B 5KWJA 4LJLA 4O5OA 5KTYA 5DM4A 3NLLA 2BHTA 5G1PA 1JA0A 1Q0RA 2P0AA 2VJKA 4KXFB 4WCDA 2PUCA 3ZDCA 2OHJA 5ERXA 1M0TA 2RE8A 2KWIA 3O0DA 3OZAA 4GP7A 3D3NA 5JQGF 3AKZA 2AFIE 1QF7A 1I3OA 1T8RA 3A3PA 1XRSB 3TYXA 5LP6A 4EO9A 4PZZA 4OHVA 4YAGA 2FEMA 3QI2A 1XMOB 2O57A 2BFCA 3VR2A 1IY8A 3OQIA 4P2BA 1S6YA 4TZKA 1WZCA 4K2HA 2RHRA 1ZBQA 3OVMA 4CHTA 1WHTB 2QNRA 1EJBA 1CZUA 2PCLA 2DKFA 1AA9A 3W0LB 1G8MA 2AFHA 3FMPB 1DKUA 5D8DA 4ND6A 2PSDA 2EP8A 3SE7A 3AFOA 4L78A 4A8JB 5ARDA 1OT5A 2OK8A 3VDQA 3MJEA 4JLNA 2AW5A 4WFQA 2G83A 1CEXA 1MB4A 1ATIA 1E1CB 1R37A 1R0YA 2PBZA 1QBKC 4UBIA 2YY7A 2PJUA 3IQEA 4KOEC 1FXWA 4C04A 5MFPA 2H4WA 1BWRA 3EDQA 4FFVA 5J2TA 4PG8A 4ZU6X 3QSGA 4HO1X 3MCVA 1P61B 4MJXA 5G0WA 3VR6H 3VZSA 4KXLA 4GX1A 4TMVA 3I58A 3LX5A 1F2UB 4BN4A 4ZOLA 4BO8A 4LJ7A 4BP1A 3MRVA 4JSYA 4UE6A 3WGVA 4JQOA 4CDRA 2B8NA 1ZAYA 5D1HA 2DHRA 1ZFNA 4H35A 4CDGA 1X42A 1Q7TA 2AEJA 5LA6F 4DS3A 4MH0R 3TW4A 2Z2JA 1DMRA 2DUJA 3QIAA 2RGEA 1PT5A 3ZVKA 3KOMA 4F21A 4UBJA 1MB2A 4ZOEA 4Z4HA 3DMFA 3IQZA 4ALLA 1XKLA 5I9IA 1R4ZA 2D5LA 4NE7A 4EABA 4TV9A 4O6VA 2FLKA 2FPWA 3OEED 4TZ6A 5DBHX 1FFGA 2K87A 3D8NA 4QYMA 5AW8A 5KJCA 2ATCA 3NHRA 1AN9A 2QRMA 4JIMA 4Q9LA 1NBIA 4Z4GA 1LBEA 2QU8A 3ANMA 2XWJI 3BWBA 4FLMA 3PEYA 4EYQA 4QGSA 3KNZA 4UPDA 2B0CA 5ECWA 2IH2A 4AKHA 3C3CA 1H66A 2XWQA 4UHKA 4NJMB 4O59O 1JLSA 1BH6A 1GZHB 3IKJA 3KYDA 1HQYE 3ZE0B 1RKBA 4F2GA 4FWTA 2PV7A 3K2EA 4DBZA 3BXZA 1EGVB 3DCJA 3E8XA 1NHWA 1U31A 1VECA 5CJ2A 1USWA 3ZWQA 1EVJA 3ECSA 3ORQA 3F3YA 4KUHA 4QX6A 4RZSA 4E5UA 2A6PA 1UPXA 4KVZA 1L5ZA 2HJGA 3I5UA 1SWVA 1D6MA 3NALA 2G8LA 5SY6A 1S2LA 1TM4E 4HRVA 1W34A 1DEOA 4UUAA 1KMNA 4BUZA 4ESOA 3RADC 3GA0A 4KACA 1OPXA 2BUBA 2GXUA 2XDAA 1U65A 4N4AA 1WW2A 2C1EA 1OVMA 3P8ZA 3QWHA 4AN4A 4URZR 5JASA 3OKPA 5ENDA 2GJ8A 3LDGA 3P2KA 5HF8A 1WSAA 4KPYA 1VE3A 3L41A 3Q1KA 4ZQBA 4FGKA 3RF6A 5D3ZA 3R6DA 2AQIA 2ACWA 1VJRA 3C16C 1CDZA 5K3CA 4AO6A 1UL1X 3LHFA 2VAVA 1KAMA 1N2CE 3L82B 4FU0A 5EWJA 5A71A 1T36A 4YJHA 5KUTA 5TVGA 2QAIA 3MJDA 3OX3A 1FTGA 5CNKA 4YP7A 3BA6A 4JVMA 3INTA 4AJIA 3AF6A 5FLXA 1P29A 1HEUA 3R77A 5ER9A 4WESA 2OFXA 3BFXA 1A9XA 4DBVO 5LP1A 3DL7A 1OZAA 1R16A 3BYZA 4WL0A 2BTOA 1OXUA 2FPUA 4L3VA 3ZGVA 1YBFA 1ZJJA 2QMYA 1A5BB 2XZDA 2ZJ6A 1JEOA 3IP3A 4KWHA 4DUGA 2WYVA 2QN9A 3BFVA 1LNZA 2I7XA 1XX6A 1GNQA 4PS0A 4Y6SA 5EY5B 4CF6A 3GLGE 2ZUEA 4JQCA 3R0ZA 4DA9A 4ROSA 1A9YA 5EFOA 4L9SA 5H80A 3A36A 2JFGA 3FKSA 5TMDA 1S3GA 4BGIA 3JR3A 3HJNA 1N9GB 2JD0A 1B00A 4YJ2B 2DSTA 3GK3A 4CQJA 1TCBA 2YHIB 3LQYA 4HZGA 2YHAA 3N1UA 3QE3A 1F2DA 2Y1KA 2JI4A 5BPFA 3U5ZB 1UQUA 4I1RA 3IKMB 4G86A 1OILA 4ENSA 1H1LB 2H5LA 3FHOA 3F6YA 1JT9A 3GUUA 3GROA 1VL5A 4OHRA 5EI5A 5BQ3A 3E22A 3LSYA 3TO5A 4Q4DA 3VDRA 1B93A 4RTKA 3JYLA 3IJPA 3QY9A 1KA9H 1RP1A 4I5EA 4N3GA 1QRDA 4HUJA 1QGAA 3OQHA 2D7CA 2EDAA 4HAVA 4E5MA 1MXFA 5HOEA 5AHKA 5K05A 1ZJWA 1U0RA 5A4KA 1W4RA 5I3ZA 4W5TA 2MMGA 4OO3A 2YC2C 4HLUC 2Y8EA 2XCQA 3U7IA 3VPSA 5JSYA 4A9AA 2MWMA 2PMCA 1JEDA 1UBUS 3HU3A 2P4SA 2VDNB 1FFEA 3KLPX 3WL8A 4ZV9A 2REBA 3RWOA 3K9GA 1YUMA 4ZT5A 3LDFA 5JSKA 4JLUA 4B8WA 1NLUA 1NP3A 1RPAA 4PBRA 5FTKA 4GRAA 5DNDA 1FUKA 1JJVA 1TGVA 3QOYA 1GARA 4AMUA 2PH5A 4B45A 2JGNA 2EHJA 2XNJA 5IT4A 2HRZA 3RB8A 4Z5XA 1NX9A 2IY9A 1P4AA 1YDGA 2OQIA 1DX6A 1MGPA 2PL5A 2C2MA 3H9BA 3K5HA 2ZRNA 5DHQA 1UEIA 5JLAA 621PA 1OQAA 2OPBA 4N8SA 4J2OA 4U9IS 3L8HA 4UE2A 4BV9A 4G1FA 2I65A 3MTAA 1RYDA 4IH4A 4EMTA 1DRWA 4K1XA 3RIEA 3OO1A 2YN2A 3MT8A 5A3JA 2GJ9A 1KO1A 1RQ7A 2GM9A 2Y9MB 1QQ5A 3GEBA 2HIMA 4FHCA 3SVZA 4DHWA 1FS6A 3LSTA 3A1NA 4QFDA 3PX7A 4NMWA 4AFNA 4ZKDA 3T41A 3F74A 1NTOA 3O8DA 4LAFA 1KDZA 1MO5A 3RYTC 2JKYA 4X1IA 3K9HA 2WSYB 4M4SA 5BRNA 5T8KC 3WIEA 3TI7A 2WHYA 2IP1A 1Z83A 2RARA 3D3EA 4G3XA 3JQEA 4P38A 4TYMA 4MMYB 2GCOB 2HA7A 3TZEA 7YASA 1Y4AE 4BLQA 4HN9A 2YWDA 2VHZA 4QDUA 2O5VA 5DCWA 1JR4A 1UBSB 4M1TA 1KTIA 3HS3A 1GL9B 3KYJB 3HP4A 4GEKA 5EEGA 3A6FA 2GRJA 3LW8A 2AX4A 1XE3A 2W2XA 3CY6A 3D02A 5JZMA 1Q84A 3EY9A 3UENA 3UTDA 3NHKA 2X1MA 2NU9A 3FCUB 4MAFA 1DSSG 3LLUA 5AKHA 4A03A 3P4UA 2IHKA 3AFMA 3B60A 4EGQA 2A4KA 1R12A 3DZKA 1KJ9A 5F7JA 5I4CA 2MSNA 3WNCA 1A82A 1S2DA 2LD4A 2Q7XA 3WAKA 4XVHA 3RVQA 3TIXB 2XB9A 1HLDA 2ENUA 4DJJA 1QGYA 2C92A 1BZYA 5EPEA 3M5WA 1CUYA 2JB9A 5KYYA 1U2SA 2HV9A 2Y71A 2H11A 1IB6A 3KTAA 4Q3CA 1YDEA 2ACVA 5ALUA 4QLAA 1ODIA 5SV2A 4AP5A 1O03A 4F7WA 3TGPA 3JAMA 4KR2A 2F1RA 1YQXA 2PWYA 4Y9SA 3UGTA 3AYZB 1WXIA 1SD2A 2AG5A 1BHJA 2OBFA 2CBGA 2QRPA 3C5CA 4PSVA 4Y6QA 1UP4A 3QVLA 4RY8A 1CF2O 2ECPA 4FDLA 4XDYA 5AWFC 2OEPA 1EHIA 2Z57A 4LZAA 2O8BA 2WVGA 3B5IA 3N2KB 4YRBA 4E70A 1W0CA 1WX1A 1XKTA 3ND5A 2G9VA 4R2KA 3REFA 5FWXB 1A04A 3CKLA 1NW4A 1EJ2A 2R66A 2FU5C 3J7AC 4IUBS 4OK5A 3T94A 2H2HA 5IVPA 4U5QA 4UVHA 2FWPA 5LUAA 4HVCA 1W44A 3G59A 3GFPA 1ZOPA 3ND6A 4AYWA 4H7PA 4YMLA 1RQLA 2W37A 1GCIA 1SU7A 2XKKA 1PV4A 2GK4A 3WNVA 5EUQB 1I51A 1KDPA 2EJTA 3FZQA 4IXDA 3R3VA 16PKA 1G55A 1G1AA 1LX6A 2LKCA 2VHYA 2Y0DA 1PFUA 3ODGA 3QKRB 4FQ8A 4HFMA 4WCFA 5CK5A 3UXHA 4JI0B 1GO2A 2H54A 1YS6A 4MB0A 1LZKA 3TL6A 4PN7A 4J7CA 3THYB 1CC1S 5T4FA 1RKVA 1XOIA 3AR4A 1GKYA 4GUDA 1UBGA 2QN8A 3SNKA 3UBMA 4EGAA 2F48A 3R4VA 3UK2A 3JZMA 3EZNA 1GXSA 5FX2A 4UUMA 2C4HA 2QTVB 5CVUA 3ORHA 4B44A 1S5PA 4LECA 3HDGA 3ROMA 2HCJB 2OZEA 1XF9A 4OQPA 1XLTC 1SBNE 4JHXA 4YAIA 1M2OB 2H7VA 2JI6A 1PJBA 1T1SA 2NUPA 2PH3A 2HM7A 1Q0ZA 1TCAA 1E9BA 2PRYA 1REQA 4IGFA 4XIIA 5SY4A 1CDDA 4I9FA 3ONWA 4L1KA 4HDOB 4TSKA 3ESQA 3SY8A 2E5FA 1Z36A 4N54A 3U49A 2I1WA 3DDZX 3M4JA 2IF0A 1U9IA 3E70C 5EG5A 2Q1WA 2P6PA 4CN9A 5FTMA 1FU4A 1QIKA 1YQTA 2C77A 3IODA 1JSXA 1NLFA 4ZC8A 1K6MA 1G4UR 3D7MA 4TL8A 1DJQA 2GHRA 2J5QA 2YVLA 3K0CC 2XMQA 2QN3A 3B48A 3HL0A 3I5AA 3CKYA 3KALA 1TU3A 1ISFA 2FZVA 1O0SA 3EXIB 3IAXA 3S99A 3H5NA 1LA2A 1N6PA 1VBNA 2P9BA 1F0YA 2C83A 2WVHA 3DC2A 2V7QA 1BKSB 4Z0TA 1OLXB 4EHIA 4V2IA 5FL3A 1X9GA 3QE9Y 1RWPA 1T25A 1FJHA 3BRQA 3HHEA 3N53A 4A27A 3DTVA 3H9CA 1DIHA 3JARB 3QUAA 1CZLA 1N5LA 1ACLA 5IN5A 5KWEA 1N2GA 1T6ZA 3KXPA 4ZRDA 4O5AA 4YRAA 3H2IA 1ENOA 3ZHQA 3UB3A 2Z4SA 3DDHA 4LFCB 4G0YA 1U7UA 4AROA 3AJDA 4H3KB 1W6RA 3H2HA 1Y9DA 3O8CA 3CRNA 2FUEA 2H4FA 1Q7RA 3RTGA 4MI1A 3HVJA 1LQ2A 1WDKA 4EJFA 1QF6A 2E5LB 3ZWYA 2QMQA 1OE0A 2O4CA 3RS0A 2R97A 4L4SA 2B35A 2LR0A 1FFXA 1VIAA 2D1FA 4CCYA 1S8AA 1A96A 3ZWNA 4BWFB 3NBKA 1KQFA 3QXHA 1JSLA 2D5CA 3HB5X 4MUKA 4QYXA 4F9FA 1V8OA 4NK5A 5B5SA 3ZY2A 3RT9A 4B6JA 3VAAA 1XTBA 4NI5A 4BMOB 4AICA 2PVPA 2X4GA 1SBTA 1M1YA 3HH8A 5AXAA 4ZO6A 1JDPA 4HGRA 3SZMA 1KI6B 9GPBA 2YNMC 4RHUA 3TQQA 2PJZA 3S1SA 3B85A 2HK9A 1KRXA 2HZ7A 3E82A 4J16C 3IDZA 4J16A 4F2HA 5I3CA 1K89A 3HYTA 4P4SB 1FNSA 2NXEA 2QK4A 3AILA 3FD8A 4R2IA 4TSRA 2RGNC 4A2CA 3ZX4A 3JYPA 2EEPA 4Q3NA 1JLLA 1HFJA 1OCEA 1CHDA 2HU2A 1ELOA 3ZHUA 2Q3BA 3AY0A 4GIBA 2G04A 2FH5B 2QN1A 3EVDA 3JTMA 3REGA 1MHTA 2GK6A 5AW6A 4FMCF 3TLKA 3P71T 1AG9A 3V8RA 4YMWA 4PRZA 3G0OA 3GMIA 3PXDA 1Z0ZA 1P2SA 4Y1RA 2CDAA 1VJ0A 1M75A 2HADA 4LQCA 1U4NA 5DISB 5DULA 4A26A 2ZRDA 4RTOA 4L08A 2M1XA 1L5MA 1JTVA 3CS3A 3A4YA 1E61A 1CQIA 1SKQA 1U3CA 2WLSA 3BH6A 3DMNA 1E3JA 2IOFK 2JGEA 3ZW7A 3MYRA 4RHYA 2ESRA 3QFTA 1D2HA 1N2ZA 1Y3FE 3JYNA 4ZD6A 3GAFA 1Q7CA 4OB6A 4EP1A 1ZHFA 2IF2A 2Q7DA 3RBAA 2ZRAA 1K06A 3EXFA 4RLFA 4GEGA 5KX5B 5HJEA 1T1GA 1XCJA 4JXJA 4M8NE 2AR0A 1Z2PX 2B99A 3EXHA 3HB7A 4I4TB 3BT7A 3RSFA 4JKOA 4QU8A 5ICSA 3NKLA 3QM1A 4EA9A 4Q1AA 3SXPA 1DQRA 1DINA 4GXNA 1E0AA 1QYCA 3ZTWA 3GBVA 1H4VB 3FWHA 1SJ9A 1DU4A 3R5KA 1KC1A 4TM7A 3O94A 4ARZB 2EF0A 5LQRA 4ZMRA 4DFDA 5TVKA 3GGOA 2BEJA 2J9FA 1Z26A 2J48A 2PGXA 3G1WA 3I5MA 3OC6A 4G5QA 2JCVA 4XQEA 5A3VA 2PQ2A 1ZJZA 1BGWA 2GEJA 2HX1A 3URKA 5JS6A 4NCNA 2I80A 4IHQA 3MINA 1UM9A 2IZ0A 1BYUA 1N25A 3KR0A 4GKAA 4GOND 3INNA 5FA6A 3M9XA 3TCXB 3UA4A 5A5VA 1QQBA 1ZZEA 1LZLA 4NBLA 2FFQA 4HUTA 5J2UF 1D8TA 3VDNB 2WTNA 1OF1A 1EFPB 1ONSA 2WWWA 3GPDG 4XD7D 2C1ZA 1P1RA 3RJMA 4OOEA 1RAEA 1R0RE 3JS5A 4OQEA 4XASA 4ZTZB 1QVWA 5K0ZA 4URVR 1D0SA 1U3DA 1W2GA 2OAQ1 4Z9AA 5EXDA 3P0EA 5ICMA 4G01B 3OZWA 2FMKA 1PE0A 2XYVA 4I2VA 5L6MB 1NI4A 1NN3A 4EUHA 5BV2P 3U4MA 3EZ2A 4PS1A 5EZQA 1USVA 2AOUA 3V9PA 4AECA 1WCYA 1AK9A 4CMAA 3TAXA 4OFZA 3OPMA 4KR6A 4S1VA 5EJ8A 3BIFA 1X9HA 3O7WA 4DWWA 5C1PA 3K70D 4IX1A 2PZGA 2FSVA 1EK1A 2J67A 1QK5A 2XLBA 5FLYA 3ZLBA 2DPHA 4RFSA 1JDTA 1QLWA 5ECGC 1J00A 1VE1A 3SX0A 4BPRA 4TKUA 5ALEA 2RK4A 4MUFA 3WZLA 3T35A 3NWOA 2G07A 3VKUA 4YC7A 1GTSA 1D2EA