4R4IA

Structure of rpa70n in complex with 5-(4-((6-(5-carboxyfuran-2-yl)-1-thioxo-3,4-dihydroisoquinolin-2(1h)-yl)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4iA00
1CKNA 2XTIA 3KOJA 4JCVE 2UXBQ 5AJ3Q 1WCMG 1VS0A 4C2MH 1VQIA 4LF4Q 4R4QA 4JV5L 5JJIA 3M3YH 1XNQQ 3BJUA 1LUZA 2JEBI 4APVA 2QEXA 4LFCQ 4NPSA 2OWOA 4QQBX 4DV5L 4NB3A 3CC7A 3K80C 4LFBL 4WJ3M 4LF8Q 1E3PA 5K36G 4DV0Q 2IHEA 1XJVA 1Q12A 4A3MG 1NY4A 5LMNL 4FDBA 1VQJA 3K81C 4IFDJ 1QUQA 4QIWE 4DUZQ 1KHIA 3KYHC 2MQHA 3RN5A 1VQKA 1OTCA 1L0WA 3CCJA 5LMUQ 3EBEA 1HR0Q 3E9IA 4JOIC 4TVAB 5LMNW 4QGUA 3NENA 1KIXA 2HT1A 4B3ML 4YY3L 1Y1VH 1K9MC 1VQPA 2BH2A 4JBJA 4JI1L 4DK6C 1VQFA 3GTJH 1PFSA 3F8TA 1WOCA 4O2DA 1EWIA 5C44H 3J7ZC 4DNIA 3GTKH 4DUYQ 2I5HA 5AJ3L 1SRUA 4DV3Q 4LF7Q 2E2JH 1EYGA 1HNXQ 4IPCA 2UXCQ 2C35B 2UXDQ 1LM0A 3TS2A 1YVCA 4IJHA 2VUMH 2JQOA 4DV7Q 3AEVA 2RF4A 1HNWQ 4LFCL 1TWCH 2JE6I 3CF5A 4HJ8A 2UUCQ 3HOVH 1FL0A 4A76A 1OXUA 1SR3A 4TQUS 5M3FG 4LF6L 1A0IA 5IWAQ 3A0JA 1Y1VG 4DV0L 4DV4L 4JI0Q 4A3LH 2ATWA 1U5KA 2N78A 4GNXA 1K8AC 3BZCA 2F4VL 1TXYA 2GVBA 4C3HH 4DPGA 3CCLA 4P72A 5C44G 1EQQA 2E8GA 1L1OC 1VQ9A 1IL2A 3UE1A 3STBC 4DUZL 3ULPA 2NVYH 2QGQA 1YJNA 3TQYA 1Q8KA 2VUMG 1FVIA 4DR1L 1C0AA 2Q2HA 3HKZE 4DV2Q 2D0PA 4IPDA 2H5XA 3DLLA 1N9WA 3HOVG 2VY3A 3ZJYC 5BR8L 4JI6Q 3I4NH 1QUQB 4A3LG 1GD7A 4L5QA 4C3IH 4LUZA 3M85A 1IBKL 1IBML 1HR0W 4AQYQ 4DUYL 5IP9H 4X66Q 4A75A 2UXDL 1HNXL 2Q2UA 2IX0A 2KCMA 4B3SQ 1YHBA 4DV7L 3H0GH 3G6EA 2ZM6Q 1VQGA 4K0KQ 1G6PA 2YTXA 2PQAB 3L7ZC 1HNWL 4C3JH 2UUCL 4QL5A 2Q2TA 3PUXA 4DR5L 2UUBQ 1Z47A 2E2HH 1Q1EA 4JI8Q 1YJWA 1IZ6A 4R4CA 3FHWA 4OWWB 1XNRQ 2E2IH 2MO1A 5FLMH 2RCNA 4YHHL 1X9NA 4JI0L 3S2HH 3CPWA 1NBWA 3MXNB 2NVXH 2UUAQ 3FP9A 3I4NG 5IYDH 1B8AA 1VQ6A 5H1SE 4KLKA 3RNUA 3DM3A 1R9TH 4A3GH 1I3QH 1I50H 5IP9G 5IYCH 2XGTA 3CMEA 2JA8H 2ES2A 3GTLH 2IX1A 3F2BA 4IFDI 1EOVA 3CP0A 3NEMA 4LW1A 3HOXH 5GQOA 1VQLA 5M5YH 1MIUA 4DR2Q 3CC4A 3GTPH 1J5EL 4X62L 4GNXB 4BY7H 5GAGC 4DV1Q 4LF5L 3S1MH 1LTLA 2DUDA 3STBD 5IE8A 2YTYA 1D7QA 2N3SA 4JI6L 5FLMG 1VQCA 4A3IH 1QVCA 3I56A 1PH2A 2A1AA 1KQSA 3RLNA 1PH1A 3T1YQ 2UU9Q 2R7FA 3M9BA 5IYDG 2K14A 2NN6I 3I4OA 4X66L 5C0XJ 4B3TL 5GAHC 4OWXB 3CD6A 1H95A 4RG1A 1S72A 1TWFH 4B3SL 4A3GG 4P74A 1BVSA 4K0KL 2K5VA 5IYCG 4IOCA 2JA8G 1X56A 1X3EA 4R4TA 3HOXG 1KD1C 1M1KC 4JI8L 2K50A 1XNRL 2IHFA 1I94L 3S15H 4BY7G 1I5FA 1CUKA 4DV6Q 2Y0SG 1B7YB 1QVGA 2WAQG 4DK3C 5C4XH 2NZHA 1N8RC 1ASYA 1NMGA 1N33Q 3H3VH 3W1GA 2VQFQ 1IBLQ 1KL9A 4R4IA 1OXVA 2ZJRA 4DR4L 4PZ6A 1E1TA 3CCVA 3J7A5 4GOPA 4EQ5A 4A3FH 2ID0A 1XTDA 4JI2Q 1AH9A 1C7YA 2JJQA 1MKHA 3RZDH 5HY6A 4JI5Q 3T1HQ 3L0OA 5IYBH 4A3KH 3GTQH 3UE0A 2OQ0A 1CKMA 1NMFA 1PH4A 3S1NH 3RN2A 2OTJA 3RZOH 3RLOA 1E7ZA 4DAYB 1YJ9A 4AH6A 4BY1H 1IXRA 1VQ8A 1VQNA 4PZ7A 2PQAA 3UDXA 1VQBA 5C4XG 4GS3A 1PA6A 2K52A 3A74A 4R4OA 4P75A 2ASBA 1HZAA 1HZCA 3KJOA 3S1RH 1XMOL 4DR6Q 4PMWA 3SGIA 4A3FG 1PVOA 3J81c 2YV5A 2OCEA 3TEHB 5FJ8H 5C0XG 5M5WH 4OO1G 4XTCS 1BBUA 1JJ2A 2UXBL 4X65Q 2Z0SA 4WJ4A 4RMFA 5IYBG 4Y52H 4A3KG 4A3EH 4LF4L 1VQDA 4HIDA 1I6HH 4J15A 1XNQL 5J3BA 1PHJA 4DV6L 4YWKA 1ASZA 4KHPQ 4B3RQ 1TWAH 3CCMA 4BY1G 3KLWA 1N33L 5GAEC 2ZTEA 2VZAA 1YNXA 2I5LX 3KF8B 5IP7H 4LF8L 3OTOQ 1GKHA 2JA7H 3CAMA 1WJJA 4JBMA 4BA1I 5JJLA 1VCIA 1GVPA 2D62A 4POFA 4R1JA 1N32Q 3TREA 5C3EH 2RHSB 2CCZA 3PF5A 3EN2A 4GN5A 5FJ8G 1Q86C 3PO2H 4LFAQ 4OWTB 2IY5B 1SE8A 2YYZA 5JEAJ 1YIJA 4NXNQ 2WP8J 3A5UA 3G71A 3CCQA 4HJ7A 4A3EG 5LMUL 1UE1A 1HR0L 3I4MH 4Y7NH 1K83H 4GOPB 3KDFB 2JA9A 4OX9Q 4L5RC 4A93H 1WI5A 2F3IA 2LSSA 1W2BA 2JA7G 1WYDA 5IP7G 3S16H 2PI2E 4HIKA 1JJGA 3AFPA 1VQMA 3S2DH 1KAWA 3ULJA 1PH8A 1SROA 3PO3H 3HFZB 1IYJB 5FLXc 3PIPA 4LF7L 4OO1I 4DV3L 1VQ5A 2UXCL 4X64Q 3U50C 3CQZH 1Q81C 2E5LQ 3TS0A 4KHZA 5C3EG 2ZTDA 4BBRH 2FXQA 1OXSC 1K3RA 1VQAA 2MFIA 5E7NA 3LGJA 1HNZQ 3PO2G 1DGSA 1RL2A 4KHPL 4NXMQ 3GTMH 2R6GA 1XMQQ 3I4MG 4HJ9A 2A8VA 3J80i 5IWAL 4JYAQ 3HOWH 3K0XA 2I0QA 4GKJQ 4A93G 2I5MX 4BXXH 4LF9Q 2PI2A 1BKBA 2CWAA 3CXCA 1EIFA 1L1OA 4UPAA 2VW9A 2K5NA 5DLQE 3CCRA 2WFWA 2V1CC 2YTVA 4P71A 3PO3G 1NTGA 3JAMi 1N32L 3HOUH 2N8NA 4GKKQ 4QY7A 4HIOA 4A3DH 2JK8A 3M7NA 4BBRG 2R7ZH 3H0GG 4MZ9A 3BZKA 1QZGA 4O0AA 1VQ7A 3G48A 1X54A 4DV2L 3ERSX 3KF6B 1HJPA 3UDFA 5JEAG 4POGA 3B6YA 2F52A 2JA6H 4JV5Q 2AMCB 1TWHH 3HOWG 3U58A 2Q2IA 3Q8DA 5IT9c 2NVQH 2BH8A 3S14H 4A3BH 4BXXG 1XPRA 4MNOA 1S40A 3H15A 3K7AH 2B63H 1YITA 2EXDA 2KHJA 1UE7A 3PV0A 4GLXA 4AQYL 1J6QA 3CW2C 3HOZH 5ELNA 1HNZL 1UE6A 3HOUG 4JI3Q 1UWVA 3PUWA 2CKZB 4PZ8A 2D0OA 2ZM6L 4JI4Q 4A3CH 2WB1G 1X55A 2R7ZG 4AYBG 1YBYA 2UUBL 1V9PA 2Z6KA 1JMCA 4A3JH 1CSQA 4IOAA 3J81j 3G4SA 2GN5A 2GVAA 4AYBE 4LF9L 2JA6G 2IT1A 2UUAL 1Q7YC 2VNUD 4A3IG 4A3BG 2JA5H 3ICEA 4B3MQ 2B63G 2OTLA 2QA4A 1A8VA 4UY8C 1YHQA 2Y0SE 4JI1Q 3RR5A 3PUYA 2WAQE 2AWNA 3AFQA 3KDFA 3HOZG 4YWLA 1GM5A 1PH7A 1KRSA 2OQKA 3GTGH 3UDGA 4A3CG 3I55A 4A4IA 1N36Q 4DR2L 2KHIA 1JJCB 1X3GA 3PSIA 2MO0A 3W5OA 2EQSA 4DV1L 1L1OB 2DGYA 3HOYH 1YZ6A 4BA2I 1OXTA 4DKAC 4A3JG 1PV4A 1G291 4JG2A 1JT8A 2BA0A 3CC2A 2NVTH 4LF6Q 2RHQB 3S24A 3T1YL 4GLAC 1D8LA 2UU9L 1PH5A 3GD7A 1HZ9A 1LYLA 1YHAA 2JA5G 5JJKA 1EUJA 3J81i 4ME3A 1HH2P 1VQEA 4DAMA 4UP8A 5M3MH 4DV4Q 1Y1WH 1EIYB 2VS1A 4JI3L 3NBHB 4JI4L 2HHHQ 2F4VQ 1VQ4A 3S1QH 2R93H 3M4OH 1XPUA 4P73A 1FJGQ 4GNXC 1E22A 4IO9A 1PYSB 1X65A 1L2FA 3PGZA 1V43A 1SMXA 2AHOB 1B70B 2ZJPA 1A62A 2KBNA 1Y14B 2LXKA 1K0RA 3HOYG 2B29A 2VQEQ 1SLJA 4DR1Q 3HKSA 2KCTA 4OONA 5M3FH 4L5SA 1FGUA 2VQFL 1IBLL 1YI2A 1W3SA 3KF6A 4PG3A 4JI7Q 1G51A 2PNHA 3F2DA 1Q82C 1RIPA 5BR8Q 4JBKA 1UEBA 1S3OA 2NZOA 4JI2L 3NELA 2VL6A 5M3MG 1Y1WG 1CKOA 3CPFA 3JC66 3RLFA 3PIOA 4JI5L 3T1HL 1HZBA 1WFQA 1CSPA 1IBKQ 1IBMQ 4H02A 2R93G 4KI0A 1K8GA 3TRZA 1N34Q 1O7IA 2KENA 3A5ZB 2HQLA 4JOIA 1PH6A 2K75A 1TWGH 4MTNA 1PH9A 3AYHB 3PUZA 3CCEA 3OW2A 3U4VA 4HJ5A 4DR5Q 4GLVB 4DR3Q 3FKIH 5GADC 5GROA 1X6OA 3W1BA 3VDYA 3S17H 3H3VI 1CKNB 4YHHQ 1YEZA 1PYBA 1UE5A 2A19A 3PF4A 1XPOA 3I2ZA 4DR6L 2K5HA 3D31A 4IPHA 1SFOH 1QZHA 2HHHL 4X6AH 5C0XI 1FJGL 4X65L 2ALYB 1KRTA 1QVFA 3HKZG 1VQHA 2K4KA 4IJLA 4L5TA 2ZJQA 3WWVA 5C4JH 2HIVA 2JEAI 2VQEL 4IFDG 3ER0A 3D0FA 3M4PA 3CMAA 4LNQA 4B3RL 3PUVA 3EIVA 1E1OA 2N49A 3U4ZA 2AKWB 1JE5A 4IPGA 4GN4B 4X62Q 3F2CA 3OTOL 2R7DA 1J5EQ 3E9HA 3FKIG 4JI7L 4LF5Q 4BBSH 1BBWA 1EFWA 3CCSA 1PH3A 2R92H 3GDEA 3KJPA 3CCUA 1VQOA 1AE3A 2B3GA 3OYYA 2AWOA 4YCUA 3K8AA 4DR7Q 1U0LA 3AQQA 2BA1A 3L2PA 4ALPA 1GO3E 2NN6G 1P16A 5M5XH 4B3TQ 4LFAL 4EX5A 2L15A 4NXNL 4HIMA 1OXXK 1N34L 4YCWA 3I7FA 1Q1BA 3IRBA 2EIFA 2YU9H 2CQOA 1Z9FA 3E0EA 1SN8A 1V1QA 3ULLA 4DR3L 1JB7A 4OX9L 2CFMA 3GO5A 3M4QA 1I94Q 1NJIC 5EAYA 4JC0A 4BBSG 2Z6KC 1KC8C 4DV5Q 3J80c 2R92G 3UDIA 5HGQA 1M90C 2PMZE 4LFBQ 3F1ZA 2LXJA 1T9HA 4XIGS 4X64L 4DR4Q 2E5LL 3PCOB 1P8LA 4UP7A 4AIMA 3MEFA 3JAMc 5LMNQ 3KFUA 4A3DG 1WCMH 1NE3A 4OXPA 4GOPC 4NXML 1MJCA 4YWMA 1XMQL 4JYAL 4GN3B 2ZTCA 4LUOA 2WB1E 4GKJL 1A63A 4LUVA 4LWCA 1KXLA 1C9OA 1X3FA 4YCVA 1E24A 3BU2A 1N36L 1EQRA 1AE2A 4DR7L 2HIXA 4UP9A 4YY3Q 2CWPA 4JBWA 3GTOH 5ELOA 1Q46A 5IY0A 4A3MH 1MJEA 4GKKL 4QJFA 3K7UC 1XMOQ 2MNAA 1K73C 4HJAA
chains in the Genus database with same CATH superfamily
1LTAD 1RF2D 3EQLC 1QJOA 2PNRC 2RBMA 3M3YH 2F0EA 2L1BA 4NB3A 1TS5A 4WORA 2WKDA 1LTGD 3HG9A 1Y8NB 5E4XA 1NY4A 1VQJA 1W6JA 1KHIA 2A6HC 4X3TA 2DJGC 3FKIB 5LMUQ 5DM63 3JAME 5IGGA 4JOIC 4TVAB 3NENA 1KIXA 2HCIA 4B3ML 4YY3L 5FLXL 2BH2A 2DNCA 1MI2A 4JI1L 3CQZB 2XSCA 1K3BC 4DNIA 4DXFA 2UXCQ 1VMCA 4X3SA 2C35B 2OT2A 4RHSA 3AEVA 1SYBA 3J7AF 5AFWA 2UUCQ 4BBSB 3HOVH 2MHVA 4F87A 1LABA 2K7VA 2RDFA 1VMPA 1U5KA 2N78A 2B2UA 3LWUA 3MTSA 5HGTA 2GVBA 5COYA 3DMUA 4C3HH 4WRDA 5C44G 1Y8OB 2R7ZB 1VQ9A 3UE1A 2DJFC 3A55A 4FXGC 1F77A 1IYUA 3TQYA 1TVXA 1DOMA 5KNBA 3TP5A 3DLLA 4R9WA 4RFBA 1KNEA 3S14B 1GOZA 2BE5D 4XT3B 4DXGA 2KHSA 3BVGA 1QUQB 2AQ2B 4A3LG 4L5QA 3VA7A 3NQIA 2KCMA 4B3SQ 1YHBA 1QB5D 1VQGA 1FNUA 2UUCL 3BYYB 2Q2TA 4DR5L 1Z47A 2KECA 2F4IA 2RA4A 4CJ2C 2XVSA 2K05A 1IW7D 2E2IH 3QR8A 5FLMH 2RCNA 4YHHL 1U4RA 1NBWA 2UUAQ 3LWEA 3I4NG 3P1HA 3Q22A 3DM3A 1R9TH 1DD2A 1SEBD 4PV1C 5FK9C 1WTRA 2ES2A 2B2VC 1LT5D 1EOVA 3HOXH 4C3JG 4XT1B 3P75A 1J5EL 4X62L 2XRQD 4UAIA 4DV1Q 2MUYA 4LF5L 1LTLA 1H9SB 2DUDA 5IE8A 2YTYA 1D7QA 2N3SA 4A3IH 3QOJA 3C46A 1PH2A 3SK6A 5IOCA 3W3AA 1PH1A 3G6JB 1WD0A 3GTPH 1H95A 1XX8A 3CD6A 2QILA 5C3XA 3Q23A 3D4WA 4B3SL 1S5BD 1MD2D 5JPMC 1X3EA 2D5DA 1KD1C 5M3FB 1I94L 4BY7G 1I5FA 1I4PA 2Y0SG 2R61A 3H3VH 1CHQD 4R4IA 2MNAA 1E1TA 4F7XA 2PZWA 2EVBA 3FPPA 4ZK9B 1L0YB 1XTCD 5IYBH 3UE0A 4BWGB 5EBDA 1CHPD 1S4ZA 1IXRA 3I90A 1VQNA 1STHA 5KEEA 4R4OA 1WTVA 1SNQA 4P75A 4C3HB 1HZAA 1EY7A 3S1RH 3SGIA 3J81c 2EDGA 5C0XG 1JJ2A 3CRKC 4LF4L 4A3EH 1VQDA 3OSOA 2V4DA 3BZDB 2RKSA 3P7JA 3V96A 1SYCA 1QOHA 2I5LX 4Z9CB 2LMCB 3OPOA 1STGA 1J9OA 3EJIA 4POFA 1ESFA 5C3EH 3PO2H 1G2SA 1UNSA 4ME5A 2F03A 4OWTB 2IY5B 1YIJA 3A5UA 3T4AC 3ERQA 3DXJC 3OW7A 1HR0L 1FYCA 1K83H 2K01A 1BUVT 3R2IA 4CJ0B 4K8IA 2LFNA 4L5RC 1XWEA 1WI5A 2JA7G 4HIKA 3FPUB 2NWGA 1SROA 2F3WA 1L0XB 3IFDA 1WTOA 3HFZB 3NTKA 1G6ZA 4LF7L 4OO1I 4DV3L 1CA5A 1O78A 4KHZA 4DFAA 2ZTDA 4BBRH 2FXQA 3TS0A 1K3RA 3HOXB 4QQBX 1DGSA 2L5TA 3EROA 1CQVA 2ZXRA 1BBXC 3NPPA 2D2CC 2PPBC 2R6GA 1CA6A 3I4MG 4JYAQ 5IWAL 2EJFC 3PQIA 2F0PA 2CWAA 3CXCA 4HJ5A 1N36Q 3GTPB 2K5NA 2K28A 3NQTA 3K5NA 2V1CC 3CCRA 1TS3A 3PO3G 2QDLA 4K14A 1IYVA 3G7LA 3M7NA 3BZKA 1QZGA 4I7AA 3A8KE 3ERSX 2J7ZA 4N9PA 5JEAG 4POGA 1E0BA 3PIO3 4ZKBB 2JA6H 4L8JA 2Q2IA 4KK7A 2BH8A 3BVMA 4MNOA 3H15A 5TSSA 1YITA 3CKIB 2EXDA 4GLXA 1UE7A 5D3IB 3OMCA 3HOZH 1XYIA 3HOUG 1RD9D 3PUWA 5A35A 2WB1G 4XDXA 1SMYC 1X55A 4AYBG 1NUCA 3KK7A 1CSQA 4RH6A 3J81j 1DCZA 1LTID 3G4SA 2GVAA 1U4LA 5D65A 1Q7YC 2ZXPA 1WTXA 2JA5H 3S1RB 1A8VA 2EYLA 3T53B 5C4ZA 2Y0SE 1KDAA 3RR5A 5C44B 4UY8C 4YWLA 2PZUA 1PH7A 2OQKA 4A3EB 4A3CG 3I55A 1KLGD 2KHIA 1JJCB 2SOBA 3OMGA 3PSIA 1L1OB 2DGYA 3HOYH 1STYA 1YZ6A 1OXTA 4BA2I 4CKBA 3CC2A 4FXDA 1ENAA 3T1YL 4GLAC 1D8LA 1E2ZA 2UU9L 1HZ9A 4DAMA 4UP8A 5IIFA 5M3MH 5C3EB 3PO2B 3NWSA 2F4VQ 1VQ4A 2NVYB 1KDCA 2R93H 3M4OH 1FJGQ 2X6GA 4IO9A 1PYSB 3J7AV 1L2FA 1SMXA 3K6OA 2AHOB 1K83B 4F8MA 1YNND 2ZJPA 1AZPA 1K0RA 2VQEQ 1LT3D 1TKWB 2AQ3B 1UUPA 2VQFL 3I4NB 1YI2A 1HRJA 4JI7Q 4PQXA 1RIPA 3NELA 3CHBD 2L12A 3JC66 1ET6A 4JI5L 3T1HL 1IBKQ 3H0GB 5IGCA 2K75A 1TWGH 5C4HA 1ML0D 3U4VA 2AUKA 4GLVB 3VDYA 3S17H 5GROA 3S2HB 1YEZA 2A19A 1UE5A 2EYOA 4JPBW 3JAML 1SYGA 2K5HA 3D31A 4IUQA 1QZHA 5JOBA 1FJGL 2SNSA 5JPNC 1Q8IA 1VQHA 2K4KA 1PRTB 2ZJQA 2JEAI 3T13A 1STBA 2VQEL 1AN8A 1HUNA 4XQNA 1F9SA 3S1MB 2JA6B 4LNQA 2Y0SB 4KTAA 3EIVA 1D5ZC 1K8MA 2AKWB 4IPGA 3FKIG 4JI7L 3NE5B 1EFWA 2B3GA 1PTOF 2AWOA 4YCUA 2HDLA 2M2LA 1LT6D 2NN6G 4FXKC 5M5XH 4LFAL 3FMCA 1HXYD 1MSGA 3I7FA 2EIFA 1HUMA 3NHHA 1MBYA 1V1QA 3ULLA 3DWAA 5ELBA 1EY4A 4OX9L 3M4QA 2SNMA 1RCVD 4KHVA 4O42A 4BBSG 4DV5Q 3D8GA 4KMUC 4IUUA 2LXJA 1T9HA 2E5LL 4DAPA 4AIMA 4UP7A 1Q3LA 3T51B 2BDOA 1WCMH 3HOYB 2F0LA 4NXML 4YWMA 1XMQL 3A7AB 1LACA 2E2DC 1HPCA 2WB1E 4LWCA 4B08A 5BN3A 1X3FA 1EQRA 4ZCKA 2DY8A 5M3MB 5K36H 1GUGA 3UI2A 2CH4W 2G9HD 3GTOH 4GKKL 2R93B 3M4OB 4QJFA 3K7UC 3KBXA 1XMOQ 4K2LA 4HJAA 2NB0A 1H9JA 5AJ3Q 1CZWA 2F0JA 4C2MH 2K5WA 4JV5L 5JJIA 3IFTA 1XNQQ 4LFCQ 2JEBI 4APVA 1I4HA 4DV5L 4K6DA 1Y8PB 1E3PA 4H7BA 2IHEA 1Q12A 4HCEA 3HKZB 4A3MG 2P5ZX 2EJGC 2KUMA 3J80E 5E4WC 2BE5C 4QIWE 3TP8A 4DUZQ 3H3VC 1GUSA 3I4MB 3KYHC 3RN5A 1OTCA 4QUCA 1EY8A 1H9RA 4CJ1B 1PMRA 1D5MC 1EY6A 1Y1VH 1K9MC 1VQPA 4R8NA 1O7YA 4JBJA 2RSOA 1VQFA 3TSSA 2L11A 1PFSA 3X3MA 1SAPA 1FNWA 1I4GA 4IQZA 4NMZA 5AJ3L 3MXNA 2E2JH 1EYGA 1HNXQ 2EZVA 2KJXA 1A2TA 1YVCA 3NK9A 2VUMH 2F0GA 4DV7Q 2RF4A 2EYMA 1A2UA 4LFCL 2L55A 3A7LA 1IKLA 3K57A 4LF6L 1OXUA 1SR3A 4TQUS 5M3FG 2F0MA 2B2TA 1B1ZA 1HQMC 2IJ0A 4JI0Q 2QCPX 2ATWA 5M5XB 2F0HA 1UEAB 3BZCA 2WV6D 2CHBD 4A3DB 2WB1B 3Q6SA 1EQQA 1L1OC 1IL2A 4DUZL 1AP0A 1YJNA 1JOKA 1FVIA 1NNXA 4RKLA 4DR1L 1PLFA 4DV2Q 2D0PA 1C8CA 5D14A 2H5XA 1SE3A 3HOVG 2VY3A 3MHBA 2OF1A 2ICEC 3ZJYC 4JW0A 1GD7A 1I4RA 3M85A 4LUZA 1IBML 4AQYQ 4C3HG 4A75A 1HNXL 1WCMB 1I4XA 3HGBA 4DV7L 1JE4A 2PQAB 2KVMA 3RMHA 3VR6A 3J81E 4JI8Q 1XNRQ 4OWWB 3FHWA 1KABA 2IW3A 1X9NA 4JI0L 2LS01 3GTOB 4RA8A 5IYDH 4OGQC 3MA2B 3TZDA 3RNUA 2HCCA 4A3GH 3GTGB 1I3QH 2PCFB 1SJHD 2JA8H 3OIQA 4FF3A 3TDQA 3MEHA 5GQOA 1MIUA 3DWQA 5EJWA 1EL0A 5FLMG 1KDBA 1QVCA 2WACA 3RLNA 4HEDA 1XXGA 1RTNA 2N55A 2R7FA 3M9BA 2X6LA 2K14A 1PRTC 2F0VA 3I4OA 3QWNA 1BQQT 4B3TL 4RG1A 1HHVA 1S72A 4EVOA 1B9NA 3KF8A 1ZYRD 4P74A 4X3KA 2K5VA 4IOCA 1X56A 1LTRD 3HOXG 1M1KC 4JI8L 1XNRL 1MSHA 3BG3A 1Y1VB 4DV6Q 1B7YB 5KYLA 2WAQG 4DK3C 5C4XH 3A56A 1N8RC 1NMGA 4P2CB 1PFBA 1KL9A 2Z1CA 5EPLA 2ZJRA 2CVRA 4TKOB 4GOPA 4A3FH 1IKMA 2ID0A 4JI2Q 2E2JB 3QJYA 1MKHA 3D4RA 2VUMB 3GTQH 4A3KH 2OQ0A 1NMFA 1PH4A 1B53A 3RZOH 4DAYB 2Q8IB 1RDPD 2PQAA 3UDXA 1PA6A 3D4DA 2K52A 2XWJB 4DU9A 2BCOA 1QG7A 4ZUIA 3DWPA 3KJOA 2B2TC 2YV5A 3TEHB 2E75C 1BBUA 3T56B 4X65Q 4RMFA 3RD4A 5IYBG 4GZYC 3W2DA 4HIDA 2FHTA 1SNPA 5J3BA 1DOLA 4DV6L 5KRUA 4KHPQ 4LMQD 4B3RQ 1TWAH 3CCMA 5IP7H 1YNJD 2JSOA 4DF7A 1SNCA 2D62A 1N32Q 5CV6A 3EN2A 1SE8A 4NXNQ 4ZUJA 2WP8J 3CCQA 4A3EG 1PZID 2J0TD 5LMUL 2C9OA 3MVVA 1PDQA 1BXTA 2RQXA 4HTHA 5K5PA 2RSNA 3VR3A 4KN7C 1WYDA 1Y69U 3FDTA 5CV4A 3AFPA 2L4NA 4A3GB 3SK8A 3PIPA 1M8AA 1V8QA 2UXCL 2JA8B 2EY6A 1O7ZA 3U50C 4KV6A 5C3EG 3PO2G 1OXSC 1VQAA 5ELCA 1RL2A 1QWYA 3E0JA 4KKSA 4KHPL 1QE6A 2A8VA 3HOWH 4MHEA 2I5MX 4K5VA 2PI2A 4LF9Q 3TP7A 4QF4A 3V2TA 4DAYA 1Q86C 4A3MB 4N8FA 5C5MA 1N32L 3NUCA 1KAAA 1PTOB 1QNUA 4BBRG 4B9XA 3H0GG 1A3VA 1G8ZD 3G48A 3KF6B 3M3YB 3NBHA 5I6YA 3BDLA 3B6YA 2G9DA 3N52A 1FD7D 1B9MA 2F52A 3WOFA 2AMCB 1TWHH 3ND9A 5KIXA 3DUZA 3MFYA 4EQOA 5IT9c 1F2ZA 1GHJA 2B63H 2KHJA 1HA6A 4A3FB 2EPBA 4H44C 3TZUA 5ELNA 5CORA 4JI3Q 1EY5A 2CKZB 1AFPA 1STEA 1YBYA 2KOLA 1JMCA 4A3JH 4IOAA 4ID6A 2Z4HA 4LF9L 5CBEE 2JA6G 3D3RA 2UUAL 2VNUD 4FO2A 4C56C 2QA4A 2OTLA 4JVZA 1YHQA 2WAQE 2AWNA 3AFQA 3HOZG 2WKCA 1KRSA 3UDGA 2WINB 4IN3A 4G7HC 1RHPA 4RGNA 3W5OA 1CT1D 5L37A 4DV1L 3HOVB 4DKAC 1PV4A 1BDOA 1G291 3GV3A 1PXUA 2NVTH 4TRDA 5CBAE 1MHWC 3GD7A 2EYFA 2JA5G 5JJKA 1EUJA 3KLSA 1VQEA 4DV4Q 1EIYB 4FF2A 4UDUC 4S3SA 4JI3L 1EQTA 3A8JE 1HA5A 1ICFB 1S5CD 2AQ1B 1CQFA 1E22A 2B2UC 1X65A 2HQEA 1B70B 4RCOA 1A62A 1WTWA 2KBNA 3HOYG 2KCTA 4L5SA 3E6ZX 3SHLA 1X32A 4K2KA 3KF6A 2DY7A 3KLRA 2PNHA 1Q82C 3EFXD 5BR8Q 1UEBA 1S3OA 2NZOA 4HSVA 5FO8B 5M3MG 1CKOA 1QNKA 4N8X1 4CDEC 3PIOA 2MPMA 1WFQA 1CSPA 4H02A 2R93G 2FINB 1K8GA 3TRZA 1SDFA 2K04A 3U9SA 4KJOA 1SNOA 2RDHA 5IODA 5DNFA 3HOWB 3AYHB 3PUZA 2E2IB 1JOOA 3OW2A 3J80L 3L3OC 4DR3Q 5GADC 4M1UB 1GUWA 1DXMA 4C1NK 5C6AA 1R9TB 3PF4A 1XPOA 4N9TA 1SFOH 3DEPA 3E5SA 1NSNS 2B8FA 1KRTA 3HKZG 4IJLA 1EWHA 4IUTA 5C4JH 3ER0A 1ESRA 3J7YW 2WAQB 2FMMA 3U4ZA 4A3IB 3F2CA 4RKBA 5IGFA 2B63B 1BBWA 2NTSA 3GQBA 2R92H 3GDEA 3CCUA 1VQOA 2KCCA 1VF7A 2K6AA 4RGMA 4HIMA 4YCWA 2EYHA 4X3UA 1K28A 1Q1BA 1Z7TA 2J4XA 4A3JB 2YU9H 2LKVA 3NP8A 1SN8A 4DR3L 5CV5A 1K0SA 2K5DA 4FVMA 1SYEA 1NJIC 3QIAA 4J8QA 4KD4A 4U68A 4I7ZC 3MFGA 3UDIA 2PMZE 4DR4Q 2NTTA 1NAPA 2A73B 2CQAA 1P8LA 2I07B 5M9OA 3OIPA 3MEFA 3JAMc 3KFUA 4A3DG 2BOSA 2A6ED 4JYAL 2JYOA 5NUCA 2NVTB 4EQNA 4LUVA 4K5WA 3DHQA 4YCVA 1MGSA 1E24A 2TMPA 5EPKA 1N36L 1AE2A 4E6IA 4UP9A 3J81L 1C48A 2DNEA 4IALA 5I9OA 4DN4M 4CBVA 1Q46A 5IY0A 1MJEA 3F2UA 1D2BA 2FMCA 2XTIA 3MC0B 4HN7A 2UXBQ 4H0LC 1WCMG 1VS0A 2NYZD 1VQIA 4XYOA 3BJUA 1LUZA 2A69D 1TS4A 5KNDA 1PTOC 1EFID 4LF8Q 5K36G 2FJ2A 4FDBA 4O1NA 3K81C 2JP1A 3KUPA 2MQHA 1VQKA 2IPKD 3EBEA 2I46A 4B9WA 1A3TA 2D9UA 2M00A 3HS0C 1STNA 4DK6C 1WOCA 1RTOA 1PFNA 1EWIA 4KKTA 4O2DA 4BBRB 5LL6X 5CYUA 3GTKH 2I5HA 1SRUA 3D6CA 2UXDQ 1JORA 1PYWD 4IPCA 1LM0A 3TS2A 4IJHA 2PMZB 1HNWQ 1TWCH 4HJ8A 4A76A 2B2YA 2R92B 3A0JA 1Y1VG 4GNXA 1K8AC 2F4VL 4MTKA 1TXYA 4HMIA 4DPGA 2RVLA 4P72A 2E8GA 4H13C 3MWYW 2EY1A 2QGQA 4ZRZA 3Q0AA 1D1KA 1Q8KA 2VUMG 4JK1C 1C0AA 2Q2HA 3HKZE 1J8IA 3C2PA 4FF1A 3OWEB 3URYA 4ODGA 3HOZB 5G3LF 4C3IH 5JJZA 1IBKL 4NDXA 1X3PA 5I4DA 4KN4C 5IP9H 1NR4A 2UXDL 1TQOA 2CW0D 2MP1A 3VR5A 4R8IA 2ZM6Q 3K5MA 2YTXA 1HNWL 5JEAH 1NR2A 2UUBQ 1U4PA 2E2HH 1YJWA 1FR3A 2Z9HA 4CKCA 2JA5B 3MXNB 1SE4A 3FP9A 1B3QA 1B8AA 1VQ6A 4KLKA 1G91A 3MZ5A 3GP7A 5IYCH 3ZYYX 3TBIB 4CDFC 5FOBB 3F2BA 3AMUA 4IFDI 5M5YH 3VYSA 5IGBA 4DR2Q 1LT4D 3CC4A 1E2WA 5LHY1 3STBD 3I3CA 2Z6BA 3I56A 2A1AA 1EYDA 3NSWA 1EQVA 5IYDG 5C0XJ 5GAHC 3QOLA 3IL8A 4NKLA 1TWFH 1JCKB 2Q8RE 2F3VA 1WTQA 4A3GG 2JA8G 5J1ZA 4R4TA 3MAQA 3VYUA 1YNJC 2K50A 3H6MA 2IHFA 5ELDA 1BF4A 3S15H 4ZLTF 1PZKD 2BDNA 2QW7A 1QVGA 1LLRD 4L6TB 3W1GA 1IBLQ 1OXVA 1EOTA 4PZ6A 4IURA 1CTMA 2ZT9C 3J7A5 4EQ5A 3VR2A 1G2TA 1XTDA 3LX0A 1EU3A 4OO1H 2JJQA 3RZDH 3L0OA 1TWGB 1TY0A 1CKMA 3S1NH 3A54A 1WTPA 3RN2A 1EYAA 1H9KA 1E7ZA 1B3AA 4C1NI 1S5DD 3S17B 4Q0FA 4OELB 3VYRA 4BY1H 2XN9C 1VQ8A 4PZ7A 4V0BA 1EZ6A 5C4XG 4GS3A 4J1MA 1SNMA 3EVQA 2K5QA 2ASBA 1EEFD 1HZCA 1XMOL 4DR6Q 4PMWA 3ITPA 4A3FG 1PVOA 5IT9E 2KCNA 5FJ8H 5M5WH 4XTCS 1IW7C 3I8ZA 4ZQ3A 4A3KG 1I6HH 1SE2A 3Q24A 4J15A 1XNQL 4YWKA 1TY2A 1ASZA 4QB4A 5GAEC 2VZAA 2XRSD 3KF8B 3OTOQ 1Q90A 1DONA 1WJJA 5EKLA 4G7ZC 4U673 1S5FD 3E3XA 5CC4A 1GVPA 4R1JA 1S5ED 3FRPB 3TREA 5ISRA 2RHSB 2CCZA 5KYIA 3PF5A 5G3LD 1KTKA 2YYZA 3M7GA 1IL8A 2SDFA 5JEAJ 4HJ7A 2EOTA 2E2HB 4LAAA 1JB3A 2K32A 4GOPB 2JA9A 4A93H 2K33A 3U9OA 2F3IA 5IP7G 2PI2E 1VQMA 1KAWA 3SEBA 1GJXA 5FLXc 2DN8A 4X64Q 3CQZH 1Q81C 3BS1A 3N6RA 2MFIA 4OEMB 5E7NA 5M5YB 4RCNA 2H1EA 1A3UA 3BYTB 1LTSD 1STAA 3GTMH 1O80A 1JC7A 2I0QA 4GKJQ 4BXXH 1EIFA 2VW9A 4UPAA 3D6WA 5DEHA 2WFWA 4P71A 2YTVA 4ULLA 1TWFB 3JAMi 1EWCA 2XIWA 4QY7A 4HIOA 2MGSA 1TR5A 2JK8A 1BOSA 4RWSC 5T1GA 4C2MB 2R7ZH 1VQ7A 1CZGA 4O0AA 1X54A 4DV2L 4RHRA 5CGKA 1HJPA 4YIJA 3UDFA 2IWHA 1WVLA 1V1OA 3HOWG 3U58A 5EQ0A 4ILWA 1BCPF 2NVQH 3S14H 4A3BH 3GV6A 1S40A 3I73A 1CFMA 3PV0A 5EKIA 4AQYL 1J6QA 4WJWA 3RZDB 2M9VA 2B8GA 1EY0A 4JI4Q 4PZ8A 3S1NB 1HFNA 3K59A 3LNNA 2Z6KA 2H4OA 3SXHA 3C1EA 2L9HA 4J6HA 2R3ZA 4KKUA 4A3IG 1Z6HA 4G57A 3ICEA 4B3MQ 1V1PA 2B63G 2B2VA 4JI1Q 3PUYA 1CM9A 1F2MA 4L63B 5M5WB 1GM5A 1B2TA 1I6HB 4A4IA 5CR3A 1EY9A 1X3GA 2F0FA 4RAUC 4A3JG 4JG2A 1TIID 1JT8A 4XQJA 1ICWA 1FNVA 2NUCA 5A2QE 2RHQB 1PH5A 1YHAA 5FKAC 1Y1WH 3NBHB 4JI4L 2AUJD 1QCBD 2HD3A 2KQ3A 3BDCA 1AW7A 1V43A 3H94A 1Y14B 2B29A 4A93B 3X3NA 1SLJA 3HKSA 4OONA 3I91A 5M3FH 1FGUA 4DK0A 4PG3A 3F2DA 4JI2L 1D6EC 1EU4A 3CPFA 3RLFA 1B50A 1HZBA 1ET9A 4KI0A 1O7IA 1PH6A 3A5ZB 2HQLA 4IFDH 3GTMB 2KEEA 4CGYB 5J39A 4MTNA 4HCSA 1U4MA 1ILQA 1TT2A 4ABNA 4DR5Q 3OHXC 1F2YA 1CKNB 1GUNA 3TP6A 4YHHQ 1JICA 2A6EC 5I9PA 1X3QA 1I3QB 4IPHA 4X6AH 2Q8TA 1PRTF 5C0XI 3S9WA 4X65L 1HCZA 2ALYB 4L5TA 3A8IE 3WWVA 2HIVA 5I2XA 4F88A 1WD1A 2A5HA 3D0FA 3CMAA 4B3RL 3PUVA 4Q5VA 1J5EQ 1JE5A 3CU7A 4GN4B 4X62Q 2NVQB 5EBCA 4A3BB 4LF5Q 2K1BA 3CCSA 1PH3A 1ONLA 3KJPA 2Z4IA 3OYYA 4PNYA 4DR7Q 2O4XA 2BA1A 3KLSX 3L2PA 1BCPD 4ALPA 1ZEQX 1E2VA 4OIJA 4EX5A 4NP5A 4NXNL 2A69C 4FP5D 5F2DA 3EA6A 2O5JC 2CQOA 1JB7A 1R4QB 3E0EA 2CFMA 3OOCA 3GO5A 1I94Q 5C4XB 3QG1A 5EAYA 4JC0A 1LV9A 2Z6KC 1KC8C 3J80c 1A15A 3K0YA 2R92G 1M90C 3NWTA 4LFBQ 3F1ZA 1YNNC 3PCOB 4CKEA 3GTQB 4A3KB 1C4QA 1K8OA 5LMNQ 3RZOB 1NE3A 4IZ8A 2SEBD 4GOPC 1KLUD 4FNFA 5FO7B 2ZTCA 4BS9A 1KXLA 1C9OA 5DAUA 3BU2A 5HURA 1RKNA 3C1FA 1DYQA 4DR7L 2HIXA 1Y1WB 3I4LA 2CWPA 1IHZA 3QB3A 1K73C 3TMEA 1CKNA 3K5LA 3KOJA 2F0KA 1SNDA 4JCVE 5BN5A 1TS2A 4LF4Q 2KA7A 1R4PB 1TWAB 4R4QA 1RJTA 3PIP3 2QEXA 2F0NA 4NPSA 2OWOA 4M8AA 3CC7A 3IKJA 3K80C 4LFBL 4WJ3M 1JOQA 4DV0Q 1XJVA 3K5OA 2TSSA 5LL6S 5LMNL 3R8BA 2E76C 2PQEA 4IFDJ 1QUQA 2ICIA 5KGUA 1L0WA 3CCJA 1HR0Q 3E9IA 5LMNW 2ENBA 4QGUA 2HT1A 1JWMD 5KNCA 4OL7A 2CW0C 5T1IA 2WIIB 3SK5A 3GTJH 2EXZA 3F8TA 5C44H 3J7ZC 4DUYQ 4LF7Q 4DV3Q 2A68D 4ZAIA 2JQOA 1PRTD 4PMCA 2LY7A 3CF5A 2JE6I 1FL0A 1A0IA 5IWAQ 3O13A 4DV0L 4DV4L 4A3LH 2F0IA 2O5IC 1H9SA 1I4QA 3CCLA 1F9QA 1SBBB 3STBC 3I72A 3KBGA 2NVYH 3NTHA 4UHVA 3ULPA 1SYFA 3DEOA 5IT9L 1TWHB 4IPDA 2C5CA 1NCVA 1N9WA 3I70A 1KNAA 3R93A 3HEJA 5BR8L 4JI6Q 2A6HD 2F0TA 3I4NH 1HR0W 4DUYL 4X66Q 2KEDA 2Q2UA 2IX0A 2O2LD 3H0GH 3G6EA 4K0KQ 1G6PA 3L7ZC 3MXUA 4G4KA 4C3JH 1GUOA 4QL5A 3PUXA 1Q1EA 3SDZA 1IZ6A 4R4CA 1DZ1A 2QEJC 2MO1A 3S2HH 3CPWA 2NZ1D 2NVXH 2OXPA 1BO0A 4C3IG 5H1SE 2CH4A 1I50H 5IP9G 2XGTA 2VXWA 5CV9A 3CMEA 3ND8A 2F0DA 3GTLH 4KD3A 2IX1A 3CP0A 3NEMA 5ELFA 4LW1A 1VQLA 3NBIA 2F0UA 4GNXB 4TSSA 4BY7H 5GAGC 1ILPA 1PZJD 3S1MH 4JI6L 1VQCA 2B39A 1KQSA 3T1YQ 1EIGA 1BCPB 4HAEA 2UU9Q 2NN6I 4X66L 2NBFA 4OWXB 1H9MA 2N88A 4XXEA 3OWFA 1BVSA 4K0KL 5IYCG 2EY2A 1SYDA 1VDZA 1UAPA 2ZXOA 5FLXE 4KY5A 1T5XD 1TU2B 2F0QA 2F0OA 1CUKA 1QILA 2JXMB 1GXDC 5JAVA 1ASYA 2NZHA 1N33Q 3FEWX 4OIKA 3GTJB 2VQFQ 5EPJA 3SVMA 4DR4L 3MXGA 3CCVA 4OHJA 3VR4A 4DA2A 4DNTB 3DM1A 1AH9A 1C7YA 5C0XH 5HY6A 1HQRD 4KY7A 4JI5Q 3T1HQ 3VYTA 2MJ8A 3QO2A 2OTJA 3RLOA 1YJ9A 1D5XC 4AH6A 1PFMA 1SXTA 4EGVA 3H91A 1CK1A 1DOKA 2PYKA 1VQBA 3AU7A 3A74A 1SFOB 1A6XA 1SJED 4LJZC 5C3WA 3PMFA 1EEID 2QDBA 4QCLA 4I65A 2OCEA 3BDOA 3MXPA 5E3FA 4OO1G 5C4JB 2UXBL 4Y52H 4WJ4A 2Z0SA 1DM0B 2VB3X 4IUNA 5BN4A 4QUFA 1PHJA 2B2WA 4BY1G 3KLWA 1N33L 2ZTEA 1YNXA 2JA7H 4LF8L 1GKHA 3HZXA 3CAMA 4CDCC 4JBMA 4KJNA 3R3OA 4BA1I 5JJLA 1VCIA 4DNRB 5A2QL 3IAYA 2HDMA 4GN5A 5FJ8G 2YU9B 4LFAQ 3WDNA 4C3JB 3AB9A 3G71A 1UE1A 3SK4A 3I4MH 2PO4A 4Y7NH 1LTTD 3KDFB 5IGDA 4OX9Q 2LSSA 1W2BA 2NVXB 1ZYRC 5D3DA 3S16H 5EGTA 1JJGA 3S2DH 3ULJA 1PH8A 3PO3H 1I50B 1IYJB 1VQ5A 2F0WA 2EYJA 3GTLB 2E5LQ 1HNZQ 5IGEA 3LGJA 2JN4A 2XNAC 4BY7B 4NXMQ 1XMQQ 4HJ9A 3J80i 3K0XA 4A93G 1F2LA 1O7LA 1LTBD 1BKBA 1L1OA 5DLQE 5JVH3 1ZXTA 3L9AX 1NTGA 3T16A 3HOUH 2N8NA 1EZ8A 4GKKQ 4DAVA 4A3DH 2OEOA 2PZTA 4MZ9A 3V05A 3HRZC 2IX3A 4JV5Q 3BVZA 1VF5C 4K6LA 4HMJA 3Q8DA 4BXXG 4MIUA 1XPRA 1AZQA 3K7AH 1U9RA 1OO9B 1B4OA 3CW2C 3ONAB 1F9RA 1HNZL 1UE6A 1UWVA 2ZM6L 4A3CH 2D0OA 1FGBD 5CV7A 2R7ZG 2UUBL 1V9PA 1W6KA 2GN5A 4AYBE 1I6VC 2IT1A 1M4VA 2X69A 4A3BG 4XYQA 1GHKA 3HP3A 1GUTA 3KDFA 3GTKB 2EJMA 3GTGH 1II3A 4DR2L 3VA5A 1TWCB 2MO0A 2QF7A 4FF4A 1EIHA 2EQSA 5DM73 2JA7B 1D1IA 2BA0A 3C3LA 4LF6Q 3S24A 2B2WC 2GA4B 1LYLA 1WTHA 2EY5A 4V190 3H09A 4ME3A 1HH2P 3J81i 2B2YC 1T5EA 4CDDC 2VS1A 4IUVA 2HHHQ 1LO5D 3S1QH 1ZKOA 2RCFA 1XPUA 4P73A 4GNXC 5ELEA 5CV8A 3PGZA 4Y7NB 3WOEA 4PMBA 4K5XA 2LXKA 5E1FA 5I2YA 1F9PA 1HFGA 2F1MA 4DR1Q 1BCPC 3S16B 1SMYD 1IBLL 3S2DB 3PO3B 1W3SA 4FYDA 4C3IB 1G51A 4JBKA 1BNZA 2VL6A 1Y1WG 1ENFA 4CHTB 2PW5A 2Z8LA 1JQYD 1IBMQ 1DJRD 2K03A 5I6WA 2F0SA 1N34Q 4JOIA 2KENA 2L0CA 4G7OC 3SE0A 1ENCA 1V1PB 1PH9A 3CCEA 1EYCA 2IL8A 3FKIH 1X6OA 3W1BA 4DGZA 3H3VI 1PYBA 2EE1A 3HOUB 4DR6L 3I2ZA 1JR0D 4DK1A 2HHHL 2NN6H 3NTIA 1B44D 2XWBB 4AYBB 3NXWA 1PTOD 1QVFA 4HR7B 4NW2A 3SR1A 2VB2X 4ZYSA 4IFDG 2FFKB 4MN3A 3M4PA 5JVG3 2QKIC 5C5LA 1E1OA 5FO9B 1BR9A 2N49A 5J22A 3OTOL 1CI3M 2R7DA 3E9HA 4BBSH 1JWUD 3K7AB 3M4YA 4LK1C 5CMDA 3CRLC 1AE3A 5EKKA 3K8AA 4ZKCB 1AEXA 4KY6A 1U0LA 3AQQA 1GO3E 1P16A 4B3TQ 2L15A 1N34L 1OXXK 4EQPA 3IRBA 3S15B 3P20A 1Z9FA 2G5DA 4K8JA 2A74C 4QMGA 1SSOA 2RDGA 4QIWB 5HGQA 4XIGS 4X64L 1HTPA 1HTLD 2HUGA 4HSPA 2PW7A 4OXPA 1MJCA 1JWSD 4RGOS 4BY1B 4GN3B 3FVQA 4LUOA 4GKJL 1A63A 2E74C 4XQQA 3R2TA 4IUPA 2A68C 4YY3Q 3TN2A 4RGTA 4JBWA 3K58A 4WFN3 5ELOA 4A3MH 3S1QB 1RODA 2EYPA 3RUZA 1PTOH
chains in the Genus database with same CATH topology
1CKNA 2XTIA 3KOJA 4JCVE 2UXBQ 5AJ3Q 1WCMG 1VS0A 4C2MH 1VQIA 4LF4Q 4R4QA 4JV5L 5JJIA 3M3YH 1XNQQ 3BJUA 1LUZA 2JEBI 4APVA 2QEXA 4LFCQ 4NPSA 2OWOA 4QQBX 4DV5L 4NB3A 3CC7A 3K80C 4LFBL 4WJ3M 4LF8Q 1E3PA 5K36G 4DV0Q 2IHEA 1XJVA 1Q12A 4A3MG 1NY4A 5LMNL 4FDBA 1VQJA 3K81C 4IFDJ 1QUQA 4QIWE 4DUZQ 1KHIA 3KYHC 2MQHA 3RN5A 1VQKA 1OTCA 1L0WA 3CCJA 5LMUQ 3EBEA 1HR0Q 3E9IA 4JOIC 4TVAB 5LMNW 4QGUA 3NENA 1KIXA 2HT1A 4B3ML 4YY3L 1Y1VH 1K9MC 1VQPA 2BH2A 4JBJA 4JI1L 4DK6C 1VQFA 3GTJH 1PFSA 3F8TA 1WOCA 4O2DA 1EWIA 5C44H 3J7ZC 4DNIA 3GTKH 4DUYQ 2I5HA 5AJ3L 1SRUA 4DV3Q 4LF7Q 2E2JH 1EYGA 1HNXQ 4IPCA 2UXCQ 2C35B 2UXDQ 1LM0A 3TS2A 1YVCA 4IJHA 2VUMH 2JQOA 4DV7Q 3AEVA 2RF4A 1HNWQ 4LFCL 1TWCH 2JE6I 3CF5A 4HJ8A 2UUCQ 3HOVH 1FL0A 4A76A 1OXUA 1SR3A 4TQUS 5M3FG 4LF6L 1A0IA 5IWAQ 3A0JA 1Y1VG 4DV0L 4DV4L 4JI0Q 4A3LH 2ATWA 1U5KA 2N78A 4GNXA 1K8AC 3BZCA 2F4VL 1TXYA 2GVBA 4C3HH 4DPGA 3CCLA 4P72A 5C44G 1EQQA 2E8GA 1L1OC 1VQ9A 1IL2A 3UE1A 3STBC 4DUZL 3ULPA 2NVYH 2QGQA 1YJNA 3TQYA 1Q8KA 2VUMG 1FVIA 4DR1L 1C0AA 2Q2HA 3HKZE 4DV2Q 2D0PA 4IPDA 2H5XA 3DLLA 1N9WA 3HOVG 2VY3A 3ZJYC 5BR8L 4JI6Q 3I4NH 1QUQB 4A3LG 1GD7A 4L5QA 4C3IH 4LUZA 3M85A 1IBKL 1IBML 1HR0W 4AQYQ 4DUYL 5IP9H 4X66Q 4A75A 2UXDL 1HNXL 2Q2UA 2IX0A 2KCMA 4B3SQ 1YHBA 4DV7L 3H0GH 3G6EA 2ZM6Q 1VQGA 4K0KQ 1G6PA 2YTXA 2PQAB 3L7ZC 1HNWL 4C3JH 2UUCL 4QL5A 2Q2TA 3PUXA 4DR5L 2UUBQ 1Z47A 2E2HH 1Q1EA 4JI8Q 1YJWA 1IZ6A 4R4CA 3FHWA 4OWWB 1XNRQ 2E2IH 2MO1A 5FLMH 2RCNA 4YHHL 1X9NA 4JI0L 3S2HH 3CPWA 1NBWA 3MXNB 2NVXH 2UUAQ 3FP9A 3I4NG 5IYDH 1B8AA 1VQ6A 5H1SE 4KLKA 3RNUA 3DM3A 1R9TH 4A3GH 1I3QH 1I50H 5IP9G 5IYCH 2XGTA 3CMEA 2JA8H 2ES2A 3GTLH 2IX1A 3F2BA 4IFDI 1EOVA 3CP0A 3NEMA 4LW1A 3HOXH 5GQOA 1VQLA 5M5YH 1MIUA 4DR2Q 3CC4A 3GTPH 1J5EL 4X62L 4GNXB 4BY7H 5GAGC 4DV1Q 4LF5L 3S1MH 1LTLA 2DUDA 3STBD 5IE8A 2YTYA 1D7QA 2N3SA 4JI6L 5FLMG 1VQCA 4A3IH 1QVCA 3I56A 1PH2A 2A1AA 1KQSA 3RLNA 1PH1A 3T1YQ 2UU9Q 2R7FA 3M9BA 5IYDG 2K14A 2NN6I 3I4OA 4X66L 5C0XJ 4B3TL 5GAHC 4OWXB 3CD6A 1H95A 4RG1A 1S72A 1TWFH 4B3SL 4A3GG 4P74A 1BVSA 4K0KL 2K5VA 5IYCG 4IOCA 2JA8G 1X56A 1X3EA 4R4TA 3HOXG 1KD1C 1M1KC 4JI8L 2K50A 1XNRL 2IHFA 1I94L 3S15H 4BY7G 1I5FA 1CUKA 4DV6Q 2Y0SG 1B7YB 1QVGA 2WAQG 4DK3C 5C4XH 2NZHA 1N8RC 1ASYA 1NMGA 1N33Q 3H3VH 3W1GA 2VQFQ 1IBLQ 1KL9A 4R4IA 1OXVA 2ZJRA 4DR4L 4PZ6A 1E1TA 3CCVA 3J7A5 4GOPA 4EQ5A 4A3FH 2ID0A 1XTDA 4JI2Q 1AH9A 1C7YA 2JJQA 1MKHA 3RZDH 5HY6A 4JI5Q 3T1HQ 3L0OA 5IYBH 4A3KH 3GTQH 3UE0A 2OQ0A 1CKMA 1NMFA 1PH4A 3S1NH 3RN2A 2OTJA 3RZOH 3RLOA 1E7ZA 4DAYB 1YJ9A 4AH6A 4BY1H 1IXRA 1VQ8A 1VQNA 4PZ7A 2PQAA 3UDXA 1VQBA 5C4XG 4GS3A 1PA6A 2K52A 3A74A 4R4OA 4P75A 2ASBA 1HZAA 1HZCA 3KJOA 3S1RH 1XMOL 4DR6Q 4PMWA 3SGIA 4A3FG 1PVOA 3J81c 2YV5A 2OCEA 3TEHB 5FJ8H 5C0XG 5M5WH 4OO1G 4XTCS 1BBUA 1JJ2A 2UXBL 4X65Q 2Z0SA 4WJ4A 4RMFA 5IYBG 4Y52H 4A3KG 4A3EH 4LF4L 1VQDA 4HIDA 1I6HH 4J15A 1XNQL 5J3BA 1PHJA 4DV6L 4YWKA 1ASZA 4KHPQ 4B3RQ 1TWAH 3CCMA 4BY1G 3KLWA 1N33L 5GAEC 2ZTEA 2VZAA 1YNXA 2I5LX 3KF8B 5IP7H 4LF8L 3OTOQ 1GKHA 2JA7H 3CAMA 1WJJA 4JBMA 4BA1I 5JJLA 1VCIA 1GVPA 2D62A 4POFA 4R1JA 1N32Q 3TREA 5C3EH 2RHSB 2CCZA 3PF5A 3EN2A 4GN5A 5FJ8G 1Q86C 3PO2H 4LFAQ 4OWTB 2IY5B 1SE8A 2YYZA 5JEAJ 1YIJA 4NXNQ 2WP8J 3A5UA 3G71A 3CCQA 4HJ7A 4A3EG 5LMUL 1UE1A 1HR0L 3I4MH 4Y7NH 1K83H 4GOPB 3KDFB 2JA9A 4OX9Q 4L5RC 4A93H 1WI5A 2F3IA 2LSSA 1W2BA 2JA7G 1WYDA 5IP7G 3S16H 2PI2E 4HIKA 1JJGA 3AFPA 1VQMA 3S2DH 1KAWA 3ULJA 1PH8A 1SROA 3PO3H 3HFZB 1IYJB 5FLXc 3PIPA 4LF7L 4OO1I 4DV3L 1VQ5A 2UXCL 4X64Q 3U50C 3CQZH 1Q81C 2E5LQ 3TS0A 4KHZA 5C3EG 2ZTDA 4BBRH 2FXQA 1OXSC 1K3RA 1VQAA 2MFIA 5E7NA 3LGJA 1HNZQ 3PO2G 1DGSA 1RL2A 4KHPL 4NXMQ 3GTMH 2R6GA 1XMQQ 3I4MG 4HJ9A 2A8VA 3J80i 5IWAL 4JYAQ 3HOWH 3K0XA 2I0QA 4GKJQ 4A93G 2I5MX 4BXXH 4LF9Q 2PI2A 1BKBA 2CWAA 3CXCA 1EIFA 1L1OA 4UPAA 2VW9A 2K5NA 5DLQE 3CCRA 2WFWA 2V1CC 2YTVA 4P71A 3PO3G 1NTGA 3JAMi 1N32L 3HOUH 2N8NA 4GKKQ 4QY7A 4HIOA 4A3DH 2JK8A 3M7NA 4BBRG 2R7ZH 3H0GG 4MZ9A 3BZKA 1QZGA 4O0AA 1VQ7A 3G48A 1X54A 4DV2L 3ERSX 3KF6B 1HJPA 3UDFA 5JEAG 4POGA 3B6YA 2F52A 2JA6H 4JV5Q 2AMCB 1TWHH 3HOWG 3U58A 2Q2IA 3Q8DA 5IT9c 2NVQH 2BH8A 3S14H 4A3BH 4BXXG 1XPRA 4MNOA 1S40A 3H15A 3K7AH 2B63H 1YITA 2EXDA 2KHJA 1UE7A 3PV0A 4GLXA 4AQYL 1J6QA 3CW2C 3HOZH 5ELNA 1HNZL 1UE6A 3HOUG 4JI3Q 1UWVA 3PUWA 2CKZB 4PZ8A 2D0OA 2ZM6L 4JI4Q 4A3CH 2WB1G 1X55A 2R7ZG 4AYBG 1YBYA 2UUBL 1V9PA 2Z6KA 1JMCA 4A3JH 1CSQA 4IOAA 3J81j 3G4SA 2GN5A 2GVAA 4AYBE 4LF9L 2JA6G 2IT1A 2UUAL 1Q7YC 2VNUD 4A3IG 4A3BG 2JA5H 3ICEA 4B3MQ 2B63G 2OTLA 2QA4A 1A8VA 4UY8C 1YHQA 2Y0SE 4JI1Q 3RR5A 3PUYA 2WAQE 2AWNA 3AFQA 3KDFA 3HOZG 4YWLA 1GM5A 1PH7A 1KRSA 2OQKA 3GTGH 3UDGA 4A3CG 3I55A 4A4IA 1N36Q 4DR2L 2KHIA 1JJCB 1X3GA 3PSIA 2MO0A 3W5OA 2EQSA 4DV1L 1L1OB 2DGYA 3HOYH 1YZ6A 4BA2I 1OXTA 4DKAC 4A3JG 1PV4A 1G291 4JG2A 1JT8A 2BA0A 3CC2A 2NVTH 4LF6Q 2RHQB 3S24A 3T1YL 4GLAC 1D8LA 2UU9L 1PH5A 3GD7A 1HZ9A 1LYLA 1YHAA 2JA5G 5JJKA 1EUJA 3J81i 4ME3A 1HH2P 1VQEA 4DAMA 4UP8A 5M3MH 4DV4Q 1Y1WH 1EIYB 2VS1A 4JI3L 3NBHB 4JI4L 2HHHQ 2F4VQ 1VQ4A 3S1QH 2R93H 3M4OH 1XPUA 4P73A 1FJGQ 4GNXC 1E22A 4IO9A 1PYSB 1X65A 1L2FA 3PGZA 1V43A 1SMXA 2AHOB 1B70B 2ZJPA 1A62A 2KBNA 1Y14B 2LXKA 1K0RA 3HOYG 2B29A 2VQEQ 1SLJA 4DR1Q 3HKSA 2KCTA 4OONA 5M3FH 4L5SA 1FGUA 2VQFL 1IBLL 1YI2A 1W3SA 3KF6A 4PG3A 4JI7Q 1G51A 2PNHA 3F2DA 1Q82C 1RIPA 5BR8Q 4JBKA 1UEBA 1S3OA 2NZOA 4JI2L 3NELA 2VL6A 5M3MG 1Y1WG 1CKOA 3CPFA 3JC66 3RLFA 3PIOA 4JI5L 3T1HL 1HZBA 1WFQA 1CSPA 1IBKQ 1IBMQ 4H02A 2R93G 4KI0A 1K8GA 3TRZA 1N34Q 1O7IA 2KENA 3A5ZB 2HQLA 4JOIA 1PH6A 2K75A 1TWGH 4MTNA 1PH9A 3AYHB 3PUZA 3CCEA 3OW2A 3U4VA 4HJ5A 4DR5Q 4GLVB 4DR3Q 3FKIH 5GADC 5GROA 1X6OA 3W1BA 3VDYA 3S17H 3H3VI 1CKNB 4YHHQ 1YEZA 1PYBA 1UE5A 2A19A 3PF4A 1XPOA 3I2ZA 4DR6L 2K5HA 3D31A 4IPHA 1SFOH 1QZHA 2HHHL 4X6AH 5C0XI 1FJGL 4X65L 2ALYB 1KRTA 1QVFA 3HKZG 1VQHA 2K4KA 4IJLA 4L5TA 2ZJQA 3WWVA 5C4JH 2HIVA 2JEAI 2VQEL 4IFDG 3ER0A 3D0FA 3M4PA 3CMAA 4LNQA 4B3RL 3PUVA 3EIVA 1E1OA 2N49A 3U4ZA 2AKWB 1JE5A 4IPGA 4GN4B 4X62Q 3F2CA 3OTOL 2R7DA 1J5EQ 3E9HA 3FKIG 4JI7L 4LF5Q 4BBSH 1BBWA 1EFWA 3CCSA 1PH3A 2R92H 3GDEA 3KJPA 3CCUA 1VQOA 1AE3A 2B3GA 3OYYA 2AWOA 4YCUA 3K8AA 4DR7Q 1U0LA 3AQQA 2BA1A 3L2PA 4ALPA 1GO3E 2NN6G 1P16A 5M5XH 4B3TQ 4LFAL 4EX5A 2L15A 4NXNL 4HIMA 1OXXK 1N34L 4YCWA 3I7FA 1Q1BA 3IRBA 2EIFA 2YU9H 2CQOA 1Z9FA 3E0EA 1SN8A 1V1QA 3ULLA 4DR3L 1JB7A 4OX9L 2CFMA 3GO5A 3M4QA 1I94Q 1NJIC 5EAYA 4JC0A 4BBSG 2Z6KC 1KC8C 4DV5Q 3J80c 2R92G 3UDIA 5HGQA 1M90C 2PMZE 4LFBQ 3F1ZA 2LXJA 1T9HA 4XIGS 4X64L 4DR4Q 2E5LL 3PCOB 1P8LA 4UP7A 4AIMA 3MEFA 3JAMc 5LMNQ 3KFUA 4A3DG 1WCMH 1NE3A 4OXPA 4GOPC 4NXML 1MJCA 4YWMA 1XMQL 4JYAL 4GN3B 2ZTCA 4LUOA 2WB1E 4GKJL 1A63A 4LUVA 4LWCA 1KXLA 1C9OA 1X3FA 4YCVA 1E24A 3BU2A 1N36L 1EQRA 1AE2A 4DR7L 2HIXA 4UP9A 4YY3Q 2CWPA 4JBWA 3GTOH 5ELOA 1Q46A 5IY0A 4A3MH 1MJEA 4GKKL 4QJFA 3K7UC 1XMOQ 2MNAA 1K73C 4HJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKN A;  2XTI A;  3KOJ A;  4JCV E;  2UXB Q;  5AJ3 Q;  1WCM G;  1VS0 A;  4C2M H;  1VQI A;  4LF4 Q;  4R4Q A;  4JV5 L;  5JJI A;  3M3Y H;  1XNQ Q;  3BJU A;  1LUZ A;  2JEB I;  4APV A;  2QEX A;  4LFC Q;  4NPS A;  2OWO A;  4QQB X;  4DV5 L;  4NB3 A;  3CC7 A;  3K80 C;  4LFB L;  4WJ3 M;  4LF8 Q;  1E3P A;  5K36 G;  4DV0 Q;  2IHE A;  1XJV A;  1Q12 A;  4A3M G;  1NY4 A;  5LMN L;  4FDB A;  1VQJ A;  3K81 C;  4IFD J;  1QUQ A;  4QIW E;  4DUZ Q;  1KHI A;  3KYH C;  2MQH A;  3RN5 A;  1VQK A;  1OTC A;  1L0W A;  3CCJ A;  5LMU Q;  3EBE A;  1HR0 Q;  3E9I A;  4JOI C;  4TVA B;  5LMN W;  4QGU A;  3NEN A;  1KIX A;  2HT1 A;  4B3M L;  4YY3 L;  1Y1V H;  1K9M C;  1VQP A;  2BH2 A;  4JBJ A;  4JI1 L;  4DK6 C;  1VQF A;  3GTJ H;  1PFS A;  3F8T A;  1WOC A;  4O2D A;  1EWI A;  5C44 H;  3J7Z C;  4DNI A;  3GTK H;  4DUY Q;  2I5H A;  5AJ3 L;  1SRU A;  4DV3 Q;  4LF7 Q;  2E2J H;  1EYG A;  1HNX Q;  4IPC A;  2UXC Q;  2C35 B;  2UXD Q;  1LM0 A;  3TS2 A;  1YVC A;  4IJH A;  2VUM H;  2JQO A;  4DV7 Q;  3AEV A;  2RF4 A;  1HNW Q;  4LFC L;  1TWC H;  2JE6 I;  3CF5 A;  4HJ8 A;  2UUC Q;  3HOV H;  1FL0 A;  4A76 A;  1OXU A;  1SR3 A;  4TQU S;  5M3F G;  4LF6 L;  1A0I A;  5IWA Q;  3A0J A;  1Y1V G;  4DV0 L;  4DV4 L;  4JI0 Q;  4A3L H;  2ATW A;  1U5K A;  2N78 A;  4GNX A;  1K8A C;  3BZC A;  2F4V L;  1TXY A;  2GVB A;  4C3H H;  4DPG A;  3CCL A;  4P72 A;  5C44 G;  1EQQ A;  2E8G A;  1L1O C;  1VQ9 A;  1IL2 A;  3UE1 A;  3STB C;  4DUZ L;  3ULP A;  2NVY H;  2QGQ A;  1YJN A;  3TQY A;  1Q8K A;  2VUM G;  1FVI A;  4DR1 L;  1C0A A;  2Q2H A;  3HKZ E;  4DV2 Q;  2D0P A;  4IPD A;  2H5X A;  3DLL A;  1N9W A;  3HOV G;  2VY3 A;  3ZJY C;  5BR8 L;  4JI6 Q;  3I4N H;  1QUQ B;  4A3L G;  1GD7 A;  4L5Q A;  4C3I H;  4LUZ A;  3M85 A;  1IBK L;  1IBM L;  1HR0 W;  4AQY Q;  4DUY L;  5IP9 H;  4X66 Q;  4A75 A;  2UXD L;  1HNX L;  2Q2U A;  2IX0 A;  2KCM A;  4B3S Q;  1YHB A;  4DV7 L;  3H0G H;  3G6E A;  2ZM6 Q;  1VQG A;  4K0K Q;  1G6P A;  2YTX A;  2PQA B;  3L7Z C;  1HNW L;  4C3J H;  2UUC L;  4QL5 A;  2Q2T A;  3PUX A;  4DR5 L;  2UUB Q;  1Z47 A;  2E2H H;  1Q1E A;  4JI8 Q;  1YJW A;  1IZ6 A;  4R4C A;  3FHW A;  4OWW B;  1XNR Q;  2E2I H;  2MO1 A;  5FLM H;  2RCN A;  4YHH L;  1X9N A;  4JI0 L;  3S2H H;  3CPW A;  1NBW A;  3MXN B;  2NVX H;  2UUA Q;  3FP9 A;  3I4N G;  5IYD H;  1B8A A;  1VQ6 A;  5H1S E;  4KLK A;  3RNU A;  3DM3 A;  1R9T H;  4A3G H;  1I3Q H;  1I50 H;  5IP9 G;  5IYC H;  2XGT A;  3CME A;  2JA8 H;  2ES2 A;  3GTL H;  2IX1 A;  3F2B A;  4IFD I;  1EOV A;  3CP0 A;  3NEM A;  4LW1 A;  3HOX H;  5GQO A;  1VQL A;  5M5Y H;  1MIU A;  4DR2 Q;  3CC4 A;  3GTP H;  1J5E L;  4X62 L;  4GNX B;  4BY7 H;  5GAG C;  4DV1 Q;  4LF5 L;  3S1M H;  1LTL A;  2DUD A;  3STB D;  5IE8 A;  2YTY A;  1D7Q A;  2N3S A;  4JI6 L;  5FLM G;  1VQC A;  4A3I H;  1QVC A;  3I56 A;  1PH2 A;  2A1A A;  1KQS A;  3RLN A;  1PH1 A;  3T1Y Q;  2UU9 Q;  2R7F A;  3M9B A;  5IYD G;  2K14 A;  2NN6 I;  3I4O A;  4X66 L;  5C0X J;  4B3T L;  5GAH C;  4OWX B;  3CD6 A;  1H95 A;  4RG1 A;  1S72 A;  1TWF H;  4B3S L;  4A3G G;  4P74 A;  1BVS A;  4K0K L;  2K5V A;  5IYC G;  4IOC A;  2JA8 G;  1X56 A;  1X3E A;  4R4T A;  3HOX G;  1KD1 C;  1M1K C;  4JI8 L;  2K50 A;  1XNR L;  2IHF A;  1I94 L;  3S15 H;  4BY7 G;  1I5F A;  1CUK A;  4DV6 Q;  2Y0S G;  1B7Y B;  1QVG A;  2WAQ G;  4DK3 C;  5C4X H;  2NZH A;  1N8R C;  1ASY A;  1NMG A;  1N33 Q;  3H3V H;  3W1G A;  2VQF Q;  1IBL Q;  1KL9 A;  4R4I A;  1OXV A;  2ZJR A;  4DR4 L;  4PZ6 A;  1E1T A;  3CCV A;  3J7A 5;  4GOP A;  4EQ5 A;  4A3F H;  2ID0 A;  1XTD A;  4JI2 Q;  1AH9 A;  1C7Y A;  2JJQ A;  1MKH A;  3RZD H;  5HY6 A;  4JI5 Q;  3T1H Q;  3L0O A;  5IYB H;  4A3K H;  3GTQ H;  3UE0 A;  2OQ0 A;  1CKM A;  1NMF A;  1PH4 A;  3S1N H;  3RN2 A;  2OTJ A;  3RZO H;  3RLO A;  1E7Z A;  4DAY B;  1YJ9 A;  4AH6 A;  4BY1 H;  1IXR A;  1VQ8 A;  1VQN A;  4PZ7 A;  2PQA A;  3UDX A;  1VQB A;  5C4X G;  4GS3 A;  1PA6 A;  2K52 A;  3A74 A;  4R4O A;  4P75 A;  2ASB A;  1HZA A;  1HZC A;  3KJO A;  3S1R H;  1XMO L;  4DR6 Q;  4PMW A;  3SGI A;  4A3F G;  1PVO A;  3J81 c;  2YV5 A;  2OCE A;  3TEH B;  5FJ8 H;  5C0X G;  5M5W H;  4OO1 G;  4XTC S;  1BBU A;  1JJ2 A;  2UXB L;  4X65 Q;  2Z0S A;  4WJ4 A;  4RMF A;  5IYB G;  4Y52 H;  4A3K G;  4A3E H;  4LF4 L;  1VQD A;  4HID A;  1I6H H;  4J15 A;  1XNQ L;  5J3B A;  1PHJ A;  4DV6 L;  4YWK A;  1ASZ A;  4KHP Q;  4B3R Q;  1TWA H;  3CCM A;  4BY1 G;  3KLW A;  1N33 L;  5GAE C;  2ZTE A;  2VZA A;  1YNX A;  2I5L X;  3KF8 B;  5IP7 H;  4LF8 L;  3OTO Q;  1GKH A;  2JA7 H;  3CAM A;  1WJJ A;  4JBM A;  4BA1 I;  5JJL A;  1VCI A;  1GVP A;  2D62 A;  4POF A;  4R1J A;  1N32 Q;  3TRE A;  5C3E H;  2RHS B;  2CCZ A;  3PF5 A;  3EN2 A;  4GN5 A;  5FJ8 G;  1Q86 C;  3PO2 H;  4LFA Q;  4OWT B;  2IY5 B;  1SE8 A;  2YYZ A;  5JEA J;  1YIJ A;  4NXN Q;  2WP8 J;  3A5U A;  3G71 A;  3CCQ A;  4HJ7 A;  4A3E G;  5LMU L;  1UE1 A;  1HR0 L;  3I4M H;  4Y7N H;  1K83 H;  4GOP B;  3KDF B;  2JA9 A;  4OX9 Q;  4L5R C;  4A93 H;  1WI5 A;  2F3I A;  2LSS A;  1W2B A;  2JA7 G;  1WYD A;  5IP7 G;  3S16 H;  2PI2 E;  4HIK A;  1JJG A;  3AFP A;  1VQM A;  3S2D H;  1KAW A;  3ULJ A;  1PH8 A;  1SRO A;  3PO3 H;  3HFZ B;  1IYJ B;  5FLX c;  3PIP A;  4LF7 L;  4OO1 I;  4DV3 L;  1VQ5 A;  2UXC L;  4X64 Q;  3U50 C;  3CQZ H;  1Q81 C;  2E5L Q;  3TS0 A;  4KHZ A;  5C3E G;  2ZTD A;  4BBR H;  2FXQ A;  1OXS C;  1K3R A;  1VQA A;  2MFI A;  5E7N A;  3LGJ A;  1HNZ Q;  3PO2 G;  1DGS A;  1RL2 A;  4KHP L;  4NXM Q;  3GTM H;  2R6G A;  1XMQ Q;  3I4M G;  4HJ9 A;  2A8V A;  3J80 i;  5IWA L;  4JYA Q;  3HOW H;  3K0X A;  2I0Q A;  4GKJ Q;  4A93 G;  2I5M X;  4BXX H;  4LF9 Q;  2PI2 A;  1BKB A;  2CWA A;  3CXC A;  1EIF A;  1L1O A;  4UPA A;  2VW9 A;  2K5N A;  5DLQ E;  3CCR A;  2WFW A;  2V1C C;  2YTV A;  4P71 A;  3PO3 G;  1NTG A;  3JAM i;  1N32 L;  3HOU H;  2N8N A;  4GKK Q;  4QY7 A;  4HIO A;  4A3D H;  2JK8 A;  3M7N A;  4BBR G;  2R7Z H;  3H0G G;  4MZ9 A;  3BZK A;  1QZG A;  4O0A A;  1VQ7 A;  3G48 A;  1X54 A;  4DV2 L;  3ERS X;  3KF6 B;  1HJP A;  3UDF A;  5JEA G;  4POG A;  3B6Y A;  2F52 A;  2JA6 H;  4JV5 Q;  2AMC B;  1TWH H;  3HOW G;  3U58 A;  2Q2I A;  3Q8D A;  5IT9 c;  2NVQ H;  2BH8 A;  3S14 H;  4A3B H;  4BXX G;  1XPR A;  4MNO A;  1S40 A;  3H15 A;  3K7A H;  2B63 H;  1YIT A;  2EXD A;  2KHJ A;  1UE7 A;  3PV0 A;  4GLX A;  4AQY L;  1J6Q A;  3CW2 C;  3HOZ H;  5ELN A;  1HNZ L;  1UE6 A;  3HOU G;  4JI3 Q;  1UWV A;  3PUW A;  2CKZ B;  4PZ8 A;  2D0O A;  2ZM6 L;  4JI4 Q;  4A3C H;  2WB1 G;  1X55 A;  2R7Z G;  4AYB G;  1YBY A;  2UUB L;  1V9P A;  2Z6K A;  1JMC A;  4A3J H;  1CSQ A;  4IOA A;  3J81 j;  3G4S A;  2GN5 A;  2GVA A;  4AYB E;  4LF9 L;  2JA6 G;  2IT1 A;  2UUA L;  1Q7Y C;  2VNU D;  4A3I G;  4A3B G;  2JA5 H;  3ICE A;  4B3M Q;  2B63 G;  2OTL A;  2QA4 A;  1A8V A;  4UY8 C;  1YHQ A;  2Y0S E;  4JI1 Q;  3RR5 A;  3PUY A;  2WAQ E;  2AWN A;  3AFQ A;  3KDF A;  3HOZ G;  4YWL A;  1GM5 A;  1PH7 A;  1KRS A;  2OQK A;  3GTG H;  3UDG A;  4A3C G;  3I55 A;  4A4I A;  1N36 Q;  4DR2 L;  2KHI A;  1JJC B;  1X3G A;  3PSI A;  2MO0 A;  3W5O A;  2EQS A;  4DV1 L;  1L1O B;  2DGY A;  3HOY H;  1YZ6 A;  4BA2 I;  1OXT A;  4DKA C;  4A3J G;  1PV4 A;  1G29 1;  4JG2 A;  1JT8 A;  2BA0 A;  3CC2 A;  2NVT H;  4LF6 Q;  2RHQ B;  3S24 A;  3T1Y L;  4GLA C;  1D8L A;  2UU9 L;  1PH5 A;  3GD7 A;  1HZ9 A;  1LYL A;  1YHA A;  2JA5 G;  5JJK A;  1EUJ A;  3J81 i;  4ME3 A;  1HH2 P;  1VQE A;  4DAM A;  4UP8 A;  5M3M H;  4DV4 Q;  1Y1W H;  1EIY B;  2VS1 A;  4JI3 L;  3NBH B;  4JI4 L;  2HHH Q;  2F4V Q;  1VQ4 A;  3S1Q H;  2R93 H;  3M4O H;  1XPU A;  4P73 A;  1FJG Q;  4GNX C;  1E22 A;  4IO9 A;  1PYS B;  1X65 A;  1L2F A;  3PGZ A;  1V43 A;  1SMX A;  2AHO B;  1B70 B;  2ZJP A;  1A62 A;  2KBN A;  1Y14 B;  2LXK A;  1K0R A;  3HOY G;  2B29 A;  2VQE Q;  1SLJ A;  4DR1 Q;  3HKS A;  2KCT A;  4OON A;  5M3F H;  4L5S A;  1FGU A;  2VQF L;  1IBL L;  1YI2 A;  1W3S A;  3KF6 A;  4PG3 A;  4JI7 Q;  1G51 A;  2PNH A;  3F2D A;  1Q82 C;  1RIP A;  5BR8 Q;  4JBK A;  1UEB A;  1S3O A;  2NZO A;  4JI2 L;  3NEL A;  2VL6 A;  5M3M G;  1Y1W G;  1CKO A;  3CPF A;  3JC6 6;  3RLF A;  3PIO A;  4JI5 L;  3T1H L;  1HZB A;  1WFQ A;  1CSP A;  1IBK Q;  1IBM Q;  4H02 A;  2R93 G;  4KI0 A;  1K8G A;  3TRZ A;  1N34 Q;  1O7I A;  2KEN A;  3A5Z B;  2HQL A;  4JOI A;  1PH6 A;  2K75 A;  1TWG H;  4MTN A;  1PH9 A;  3AYH B;  3PUZ A;  3CCE A;  3OW2 A;  3U4V A;  4HJ5 A;  4DR5 Q;  4GLV B;  4DR3 Q;  3FKI H;  5GAD C;  5GRO A;  1X6O A;  3W1B A;  3VDY A;  3S17 H;  3H3V I;  1CKN B;  4YHH Q;  1YEZ A;  1PYB A;  1UE5 A;  2A19 A;  3PF4 A;  1XPO A;  3I2Z A;  4DR6 L;  2K5H A;  3D31 A;  4IPH A;  1SFO H;  1QZH A;  2HHH L;  4X6A H;  5C0X I;  1FJG L;  4X65 L;  2ALY B;  1KRT A;  1QVF A;  3HKZ G;  1VQH A;  2K4K A;  4IJL A;  4L5T A;  2ZJQ A;  3WWV A;  5C4J H;  2HIV A;  2JEA I;  2VQE L;  4IFD G;  3ER0 A;  3D0F A;  3M4P A;  3CMA A;  4LNQ A;  4B3R L;  3PUV A;  3EIV A;  1E1O A;  2N49 A;  3U4Z A;  2AKW B;  1JE5 A;  4IPG A;  4GN4 B;  4X62 Q;  3F2C A;  3OTO L;  2R7D A;  1J5E Q;  3E9H A;  3FKI G;  4JI7 L;  4LF5 Q;  4BBS H;  1BBW A;  1EFW A;  3CCS A;  1PH3 A;  2R92 H;  3GDE A;  3KJP A;  3CCU A;  1VQO A;  1AE3 A;  2B3G A;  3OYY A;  2AWO A;  4YCU A;  3K8A A;  4DR7 Q;  1U0L A;  3AQQ A;  2BA1 A;  3L2P A;  4ALP A;  1GO3 E;  2NN6 G;  1P16 A;  5M5X H;  4B3T Q;  4LFA L;  4EX5 A;  2L15 A;  4NXN L;  4HIM A;  1OXX K;  1N34 L;  4YCW A;  3I7F A;  1Q1B A;  3IRB A;  2EIF A;  2YU9 H;  2CQO A;  1Z9F A;  3E0E A;  1SN8 A;  1V1Q A;  3ULL A;  4DR3 L;  1JB7 A;  4OX9 L;  2CFM A;  3GO5 A;  3M4Q A;  1I94 Q;  1NJI C;  5EAY A;  4JC0 A;  4BBS G;  2Z6K C;  1KC8 C;  4DV5 Q;  3J80 c;  2R92 G;  3UDI A;  5HGQ A;  1M90 C;  2PMZ E;  4LFB Q;  3F1Z A;  2LXJ A;  1T9H A;  4XIG S;  4X64 L;  4DR4 Q;  2E5L L;  3PCO B;  1P8L A;  4UP7 A;  4AIM A;  3MEF A;  3JAM c;  5LMN Q;  3KFU A;  4A3D G;  1WCM H;  1NE3 A;  4OXP A;  4GOP C;  4NXM L;  1MJC A;  4YWM A;  1XMQ L;  4JYA L;  4GN3 B;  2ZTC A;  4LUO A;  2WB1 E;  4GKJ L;  1A63 A;  4LUV A;  4LWC A;  1KXL A;  1C9O A;  1X3F A;  4YCV A;  1E24 A;  3BU2 A;  1N36 L;  1EQR A;  1AE2 A;  4DR7 L;  2HIX A;  4UP9 A;  4YY3 Q;  2CWP A;  4JBW A;  3GTO H;  5ELO A;  1Q46 A;  5IY0 A;  4A3M H;  1MJE A;  4GKK L;  4QJF A;  3K7U C;  1XMO Q;  2MNA A;  1K73 C;  4HJA A; 
#chains in the Genus database with same CATH topology
 1LTA D;  1RF2 D;  3EQL C;  1QJO A;  2PNR C;  2RBM A;  3M3Y H;  2F0E A;  2L1B A;  4NB3 A;  1TS5 A;  4WOR A;  2WKD A;  1LTG D;  3HG9 A;  1Y8N B;  5E4X A;  1NY4 A;  1VQJ A;  1W6J A;  1KHI A;  2A6H C;  4X3T A;  2DJG C;  3FKI B;  5LMU Q;  5DM6 3;  3JAM E;  5IGG A;  4JOI C;  4TVA B;  3NEN A;  1KIX A;  2HCI A;  4B3M L;  4YY3 L;  5FLX L;  2BH2 A;  2DNC A;  1MI2 A;  4JI1 L;  3CQZ B;  2XSC A;  1K3B C;  4DNI A;  4DXF A;  2UXC Q;  1VMC A;  4X3S A;  2C35 B;  2OT2 A;  4RHS A;  3AEV A;  1SYB A;  3J7A F;  5AFW A;  2UUC Q;  4BBS B;  3HOV H;  2MHV A;  4F87 A;  1LAB A;  2K7V A;  2RDF A;  1VMP A;  1U5K A;  2N78 A;  2B2U A;  3LWU A;  3MTS A;  5HGT A;  2GVB A;  5COY A;  3DMU A;  4C3H H;  4WRD A;  5C44 G;  1Y8O B;  2R7Z B;  1VQ9 A;  3UE1 A;  2DJF C;  3A55 A;  4FXG C;  1F77 A;  1IYU A;  3TQY A;  1TVX A;  1DOM A;  5KNB A;  3TP5 A;  3DLL A;  4R9W A;  4RFB A;  1KNE A;  3S14 B;  1GOZ A;  2BE5 D;  4XT3 B;  4DXG A;  2KHS A;  3BVG A;  1QUQ B;  2AQ2 B;  4A3L G;  4L5Q A;  3VA7 A;  3NQI A;  2KCM A;  4B3S Q;  1YHB A;  1QB5 D;  1VQG A;  1FNU A;  2UUC L;  3BYY B;  2Q2T A;  4DR5 L;  1Z47 A;  2KEC A;  2F4I A;  2RA4 A;  4CJ2 C;  2XVS A;  2K05 A;  1IW7 D;  2E2I H;  3QR8 A;  5FLM H;  2RCN A;  4YHH L;  1U4R A;  1NBW A;  2UUA Q;  3LWE A;  3I4N G;  3P1H A;  3Q22 A;  3DM3 A;  1R9T H;  1DD2 A;  1SEB D;  4PV1 C;  5FK9 C;  1WTR A;  2ES2 A;  2B2V C;  1LT5 D;  1EOV A;  3HOX H;  4C3J G;  4XT1 B;  3P75 A;  1J5E L;  4X62 L;  2XRQ D;  4UAI A;  4DV1 Q;  2MUY A;  4LF5 L;  1LTL A;  1H9S B;  2DUD A;  5IE8 A;  2YTY A;  1D7Q A;  2N3S A;  4A3I H;  3QOJ A;  3C46 A;  1PH2 A;  3SK6 A;  5IOC A;  3W3A A;  1PH1 A;  3G6J B;  1WD0 A;  3GTP H;  1H95 A;  1XX8 A;  3CD6 A;  2QIL A;  5C3X A;  3Q23 A;  3D4W A;  4B3S L;  1S5B D;  1MD2 D;  5JPM C;  1X3E A;  2D5D A;  1KD1 C;  5M3F B;  1I94 L;  4BY7 G;  1I5F A;  1I4P A;  2Y0S G;  2R61 A;  3H3V H;  1CHQ D;  4R4I A;  2MNA A;  1E1T A;  4F7X A;  2PZW A;  2EVB A;  3FPP A;  4ZK9 B;  1L0Y B;  1XTC D;  5IYB H;  3UE0 A;  4BWG B;  5EBD A;  1CHP D;  1S4Z A;  1IXR A;  3I90 A;  1VQN A;  1STH A;  5KEE A;  4R4O A;  1WTV A;  1SNQ A;  4P75 A;  4C3H B;  1HZA A;  1EY7 A;  3S1R H;  3SGI A;  3J81 c;  2EDG A;  5C0X G;  1JJ2 A;  3CRK C;  4LF4 L;  4A3E H;  1VQD A;  3OSO A;  2V4D A;  3BZD B;  2RKS A;  3P7J A;  3V96 A;  1SYC A;  1QOH A;  2I5L X;  4Z9C B;  2LMC B;  3OPO A;  1STG A;  1J9O A;  3EJI A;  4POF A;  1ESF A;  5C3E H;  3PO2 H;  1G2S A;  1UNS A;  4ME5 A;  2F03 A;  4OWT B;  2IY5 B;  1YIJ A;  3A5U A;  3T4A C;  3ERQ A;  3DXJ C;  3OW7 A;  1HR0 L;  1FYC A;  1K83 H;  2K01 A;  1BUV T;  3R2I A;  4CJ0 B;  4K8I A;  2LFN A;  4L5R C;  1XWE A;  1WI5 A;  2JA7 G;  4HIK A;  3FPU B;  2NWG A;  1SRO A;  2F3W A;  1L0X B;  3IFD A;  1WTO A;  3HFZ B;  3NTK A;  1G6Z A;  4LF7 L;  4OO1 I;  4DV3 L;  1CA5 A;  1O78 A;  4KHZ A;  4DFA A;  2ZTD A;  4BBR H;  2FXQ A;  3TS0 A;  1K3R A;  3HOX B;  4QQB X;  1DGS A;  2L5T A;  3ERO A;  1CQV A;  2ZXR A;  1BBX C;  3NPP A;  2D2C C;  2PPB C;  2R6G A;  1CA6 A;  3I4M G;  4JYA Q;  5IWA L;  2EJF C;  3PQI A;  2F0P A;  2CWA A;  3CXC A;  4HJ5 A;  1N36 Q;  3GTP B;  2K5N A;  2K28 A;  3NQT A;  3K5N A;  2V1C C;  3CCR A;  1TS3 A;  3PO3 G;  2QDL A;  4K14 A;  1IYV A;  3G7L A;  3M7N A;  3BZK A;  1QZG A;  4I7A A;  3A8K E;  3ERS X;  2J7Z A;  4N9P A;  5JEA G;  4POG A;  1E0B A;  3PIO 3;  4ZKB B;  2JA6 H;  4L8J A;  2Q2I A;  4KK7 A;  2BH8 A;  3BVM A;  4MNO A;  3H15 A;  5TSS A;  1YIT A;  3CKI B;  2EXD A;  4GLX A;  1UE7 A;  5D3I B;  3OMC A;  3HOZ H;  1XYI A;  3HOU G;  1RD9 D;  3PUW A;  5A35 A;  2WB1 G;  4XDX A;  1SMY C;  1X55 A;  4AYB G;  1NUC A;  3KK7 A;  1CSQ A;  4RH6 A;  3J81 j;  1DCZ A;  1LTI D;  3G4S A;  2GVA A;  1U4L A;  5D65 A;  1Q7Y C;  2ZXP A;  1WTX A;  2JA5 H;  3S1R B;  1A8V A;  2EYL A;  3T53 B;  5C4Z A;  2Y0S E;  1KDA A;  3RR5 A;  5C44 B;  4UY8 C;  4YWL A;  2PZU A;  1PH7 A;  2OQK A;  4A3E B;  4A3C G;  3I55 A;  1KLG D;  2KHI A;  1JJC B;  2SOB A;  3OMG A;  3PSI A;  1L1O B;  2DGY A;  3HOY H;  1STY A;  1YZ6 A;  1OXT A;  4BA2 I;  4CKB A;  3CC2 A;  4FXD A;  1ENA A;  3T1Y L;  4GLA C;  1D8L A;  1E2Z A;  2UU9 L;  1HZ9 A;  4DAM A;  4UP8 A;  5IIF A;  5M3M H;  5C3E B;  3PO2 B;  3NWS A;  2F4V Q;  1VQ4 A;  2NVY B;  1KDC A;  2R93 H;  3M4O H;  1FJG Q;  2X6G A;  4IO9 A;  1PYS B;  3J7A V;  1L2F A;  1SMX A;  3K6O A;  2AHO B;  1K83 B;  4F8M A;  1YNN D;  2ZJP A;  1AZP A;  1K0R A;  2VQE Q;  1LT3 D;  1TKW B;  2AQ3 B;  1UUP A;  2VQF L;  3I4N B;  1YI2 A;  1HRJ A;  4JI7 Q;  4PQX A;  1RIP A;  3NEL A;  3CHB D;  2L12 A;  3JC6 6;  1ET6 A;  4JI5 L;  3T1H L;  1IBK Q;  3H0G B;  5IGC A;  2K75 A;  1TWG H;  5C4H A;  1ML0 D;  3U4V A;  2AUK A;  4GLV B;  3VDY A;  3S17 H;  5GRO A;  3S2H B;  1YEZ A;  2A19 A;  1UE5 A;  2EYO A;  4JPB W;  3JAM L;  1SYG A;  2K5H A;  3D31 A;  4IUQ A;  1QZH A;  5JOB A;  1FJG L;  2SNS A;  5JPN C;  1Q8I A;  1VQH A;  2K4K A;  1PRT B;  2ZJQ A;  2JEA I;  3T13 A;  1STB A;  2VQE L;  1AN8 A;  1HUN A;  4XQN A;  1F9S A;  3S1M B;  2JA6 B;  4LNQ A;  2Y0S B;  4KTA A;  3EIV A;  1D5Z C;  1K8M A;  2AKW B;  4IPG A;  3FKI G;  4JI7 L;  3NE5 B;  1EFW A;  2B3G A;  1PTO F;  2AWO A;  4YCU A;  2HDL A;  2M2L A;  1LT6 D;  2NN6 G;  4FXK C;  5M5X H;  4LFA L;  3FMC A;  1HXY D;  1MSG A;  3I7F A;  2EIF A;  1HUM A;  3NHH A;  1MBY A;  1V1Q A;  3ULL A;  3DWA A;  5ELB A;  1EY4 A;  4OX9 L;  3M4Q A;  2SNM A;  1RCV D;  4KHV A;  4O42 A;  4BBS G;  4DV5 Q;  3D8G A;  4KMU C;  4IUU A;  2LXJ A;  1T9H A;  2E5L L;  4DAP A;  4AIM A;  4UP7 A;  1Q3L A;  3T51 B;  2BDO A;  1WCM H;  3HOY B;  2F0L A;  4NXM L;  4YWM A;  1XMQ L;  3A7A B;  1LAC A;  2E2D C;  1HPC A;  2WB1 E;  4LWC A;  4B08 A;  5BN3 A;  1X3F A;  1EQR A;  4ZCK A;  2DY8 A;  5M3M B;  5K36 H;  1GUG A;  3UI2 A;  2CH4 W;  2G9H D;  3GTO H;  4GKK L;  2R93 B;  3M4O B;  4QJF A;  3K7U C;  3KBX A;  1XMO Q;  4K2L A;  4HJA A;  2NB0 A;  1H9J A;  5AJ3 Q;  1CZW A;  2F0J A;  4C2M H;  2K5W A;  4JV5 L;  5JJI A;  3IFT A;  1XNQ Q;  4LFC Q;  2JEB I;  4APV A;  1I4H A;  4DV5 L;  4K6D A;  1Y8P B;  1E3P A;  4H7B A;  2IHE A;  1Q12 A;  4HCE A;  3HKZ B;  4A3M G;  2P5Z X;  2EJG C;  2KUM A;  3J80 E;  5E4W C;  2BE5 C;  4QIW E;  3TP8 A;  4DUZ Q;  3H3V C;  1GUS A;  3I4M B;  3KYH C;  3RN5 A;  1OTC A;  4QUC A;  1EY8 A;  1H9R A;  4CJ1 B;  1PMR A;  1D5M C;  1EY6 A;  1Y1V H;  1K9M C;  1VQP A;  4R8N A;  1O7Y A;  4JBJ A;  2RSO A;  1VQF A;  3TSS A;  2L11 A;  1PFS A;  3X3M A;  1SAP A;  1FNW A;  1I4G A;  4IQZ A;  4NMZ A;  5AJ3 L;  3MXN A;  2E2J H;  1EYG A;  1HNX Q;  2EZV A;  2KJX A;  1A2T A;  1YVC A;  3NK9 A;  2VUM H;  2F0G A;  4DV7 Q;  2RF4 A;  2EYM A;  1A2U A;  4LFC L;  2L55 A;  3A7L A;  1IKL A;  3K57 A;  4LF6 L;  1OXU A;  1SR3 A;  4TQU S;  5M3F G;  2F0M A;  2B2T A;  1B1Z A;  1HQM C;  2IJ0 A;  4JI0 Q;  2QCP X;  2ATW A;  5M5X B;  2F0H A;  1UEA B;  3BZC A;  2WV6 D;  2CHB D;  4A3D B;  2WB1 B;  3Q6S A;  1EQQ A;  1L1O C;  1IL2 A;  4DUZ L;  1AP0 A;  1YJN A;  1JOK A;  1FVI A;  1NNX A;  4RKL A;  4DR1 L;  1PLF A;  4DV2 Q;  2D0P A;  1C8C A;  5D14 A;  2H5X A;  1SE3 A;  3HOV G;  2VY3 A;  3MHB A;  2OF1 A;  2ICE C;  3ZJY C;  4JW0 A;  1GD7 A;  1I4R A;  3M85 A;  4LUZ A;  1IBM L;  4AQY Q;  4C3H G;  4A75 A;  1HNX L;  1WCM B;  1I4X A;  3HGB A;  4DV7 L;  1JE4 A;  2PQA B;  2KVM A;  3RMH A;  3VR6 A;  3J81 E;  4JI8 Q;  1XNR Q;  4OWW B;  3FHW A;  1KAB A;  2IW3 A;  1X9N A;  4JI0 L;  2LS0 1;  3GTO B;  4RA8 A;  5IYD H;  4OGQ C;  3MA2 B;  3TZD A;  3RNU A;  2HCC A;  4A3G H;  3GTG B;  1I3Q H;  2PCF B;  1SJH D;  2JA8 H;  3OIQ A;  4FF3 A;  3TDQ A;  3MEH A;  5GQO A;  1MIU A;  3DWQ A;  5EJW A;  1EL0 A;  5FLM G;  1KDB A;  1QVC A;  2WAC A;  3RLN A;  4HED A;  1XXG A;  1RTN A;  2N55 A;  2R7F A;  3M9B A;  2X6L A;  2K14 A;  1PRT C;  2F0V A;  3I4O A;  3QWN A;  1BQQ T;  4B3T L;  4RG1 A;  1HHV A;  1S72 A;  4EVO A;  1B9N A;  3KF8 A;  1ZYR D;  4P74 A;  4X3K A;  2K5V A;  4IOC A;  1X56 A;  1LTR D;  3HOX G;  1M1K C;  4JI8 L;  1XNR L;  1MSH A;  3BG3 A;  1Y1V B;  4DV6 Q;  1B7Y B;  5KYL A;  2WAQ G;  4DK3 C;  5C4X H;  3A56 A;  1N8R C;  1NMG A;  4P2C B;  1PFB A;  1KL9 A;  2Z1C A;  5EPL A;  2ZJR A;  2CVR A;  4TKO B;  4GOP A;  4A3F H;  1IKM A;  2ID0 A;  4JI2 Q;  2E2J B;  3QJY A;  1MKH A;  3D4R A;  2VUM B;  3GTQ H;  4A3K H;  2OQ0 A;  1NMF A;  1PH4 A;  1B53 A;  3RZO H;  4DAY B;  2Q8I B;  1RDP D;  2PQA A;  3UDX A;  1PA6 A;  3D4D A;  2K52 A;  2XWJ B;  4DU9 A;  2BCO A;  1QG7 A;  4ZUI A;  3DWP A;  3KJO A;  2B2T C;  2YV5 A;  3TEH B;  2E75 C;  1BBU A;  3T56 B;  4X65 Q;  4RMF A;  3RD4 A;  5IYB G;  4GZY C;  3W2D A;  4HID A;  2FHT A;  1SNP A;  5J3B A;  1DOL A;  4DV6 L;  5KRU A;  4KHP Q;  4LMQ D;  4B3R Q;  1TWA H;  3CCM A;  5IP7 H;  1YNJ D;  2JSO A;  4DF7 A;  1SNC A;  2D62 A;  1N32 Q;  5CV6 A;  3EN2 A;  1SE8 A;  4NXN Q;  4ZUJ A;  2WP8 J;  3CCQ A;  4A3E G;  1PZI D;  2J0T D;  5LMU L;  2C9O A;  3MVV A;  1PDQ A;  1BXT A;  2RQX A;  4HTH A;  5K5P A;  2RSN A;  3VR3 A;  4KN7 C;  1WYD A;  1Y69 U;  3FDT A;  5CV4 A;  3AFP A;  2L4N A;  4A3G B;  3SK8 A;  3PIP A;  1M8A A;  1V8Q A;  2UXC L;  2JA8 B;  2EY6 A;  1O7Z A;  3U50 C;  4KV6 A;  5C3E G;  3PO2 G;  1OXS C;  1VQA A;  5ELC A;  1RL2 A;  1QWY A;  3E0J A;  4KKS A;  4KHP L;  1QE6 A;  2A8V A;  3HOW H;  4MHE A;  2I5M X;  4K5V A;  2PI2 A;  4LF9 Q;  3TP7 A;  4QF4 A;  3V2T A;  4DAY A;  1Q86 C;  4A3M B;  4N8F A;  5C5M A;  1N32 L;  3NUC A;  1KAA A;  1PTO B;  1QNU A;  4BBR G;  4B9X A;  3H0G G;  1A3V A;  1G8Z D;  3G48 A;  3KF6 B;  3M3Y B;  3NBH A;  5I6Y A;  3BDL A;  3B6Y A;  2G9D A;  3N52 A;  1FD7 D;  1B9M A;  2F52 A;  3WOF A;  2AMC B;  1TWH H;  3ND9 A;  5KIX A;  3DUZ A;  3MFY A;  4EQO A;  5IT9 c;  1F2Z A;  1GHJ A;  2B63 H;  2KHJ A;  1HA6 A;  4A3F B;  2EPB A;  4H44 C;  3TZU A;  5ELN A;  5COR A;  4JI3 Q;  1EY5 A;  2CKZ B;  1AFP A;  1STE A;  1YBY A;  2KOL A;  1JMC A;  4A3J H;  4IOA A;  4ID6 A;  2Z4H A;  4LF9 L;  5CBE E;  2JA6 G;  3D3R A;  2UUA L;  2VNU D;  4FO2 A;  4C56 C;  2QA4 A;  2OTL A;  4JVZ A;  1YHQ A;  2WAQ E;  2AWN A;  3AFQ A;  3HOZ G;  2WKC A;  1KRS A;  3UDG A;  2WIN B;  4IN3 A;  4G7H C;  1RHP A;  4RGN A;  3W5O A;  1CT1 D;  5L37 A;  4DV1 L;  3HOV B;  4DKA C;  1PV4 A;  1BDO A;  1G29 1;  3GV3 A;  1PXU A;  2NVT H;  4TRD A;  5CBA E;  1MHW C;  3GD7 A;  2EYF A;  2JA5 G;  5JJK A;  1EUJ A;  3KLS A;  1VQE A;  4DV4 Q;  1EIY B;  4FF2 A;  4UDU C;  4S3S A;  4JI3 L;  1EQT A;  3A8J E;  1HA5 A;  1ICF B;  1S5C D;  2AQ1 B;  1CQF A;  1E22 A;  2B2U C;  1X65 A;  2HQE A;  1B70 B;  4RCO A;  1A62 A;  1WTW A;  2KBN A;  3HOY G;  2KCT A;  4L5S A;  3E6Z X;  3SHL A;  1X32 A;  4K2K A;  3KF6 A;  2DY7 A;  3KLR A;  2PNH A;  1Q82 C;  3EFX D;  5BR8 Q;  1UEB A;  1S3O A;  2NZO A;  4HSV A;  5FO8 B;  5M3M G;  1CKO A;  1QNK A;  4N8X 1;  4CDE C;  3PIO A;  2MPM A;  1WFQ A;  1CSP A;  4H02 A;  2R93 G;  2FIN B;  1K8G A;  3TRZ A;  1SDF A;  2K04 A;  3U9S A;  4KJO A;  1SNO A;  2RDH A;  5IOD A;  5DNF A;  3HOW B;  3AYH B;  3PUZ A;  2E2I B;  1JOO A;  3OW2 A;  3J80 L;  3L3O C;  4DR3 Q;  5GAD C;  4M1U B;  1GUW A;  1DXM A;  4C1N K;  5C6A A;  1R9T B;  3PF4 A;  1XPO A;  4N9T A;  1SFO H;  3DEP A;  3E5S A;  1NSN S;  2B8F A;  1KRT A;  3HKZ G;  4IJL A;  1EWH A;  4IUT A;  5C4J H;  3ER0 A;  1ESR A;  3J7Y W;  2WAQ B;  2FMM A;  3U4Z A;  4A3I B;  3F2C A;  4RKB A;  5IGF A;  2B63 B;  1BBW A;  2NTS A;  3GQB A;  2R92 H;  3GDE A;  3CCU A;  1VQO A;  2KCC A;  1VF7 A;  2K6A A;  4RGM A;  4HIM A;  4YCW A;  2EYH A;  4X3U A;  1K28 A;  1Q1B A;  1Z7T A;  2J4X A;  4A3J B;  2YU9 H;  2LKV A;  3NP8 A;  1SN8 A;  4DR3 L;  5CV5 A;  1K0S A;  2K5D A;  4FVM A;  1SYE A;  1NJI C;  3QIA A;  4J8Q A;  4KD4 A;  4U68 A;  4I7Z C;  3MFG A;  3UDI A;  2PMZ E;  4DR4 Q;  2NTT A;  1NAP A;  2A73 B;  2CQA A;  1P8L A;  2I07 B;  5M9O A;  3OIP A;  3MEF A;  3JAM c;  3KFU A;  4A3D G;  2BOS A;  2A6E D;  4JYA L;  2JYO A;  5NUC A;  2NVT B;  4EQN A;  4LUV A;  4K5W A;  3DHQ A;  4YCV A;  1MGS A;  1E24 A;  2TMP A;  5EPK A;  1N36 L;  1AE2 A;  4E6I A;  4UP9 A;  3J81 L;  1C48 A;  2DNE A;  4IAL A;  5I9O A;  4DN4 M;  4CBV A;  1Q46 A;  5IY0 A;  1MJE A;  3F2U A;  1D2B A;  2FMC A;  2XTI A;  3MC0 B;  4HN7 A;  2UXB Q;  4H0L C;  1WCM G;  1VS0 A;  2NYZ D;  1VQI A;  4XYO A;  3BJU A;  1LUZ A;  2A69 D;  1TS4 A;  5KND A;  1PTO C;  1EFI D;  4LF8 Q;  5K36 G;  2FJ2 A;  4FDB A;  4O1N A;  3K81 C;  2JP1 A;  3KUP A;  2MQH A;  1VQK A;  2IPK D;  3EBE A;  2I46 A;  4B9W A;  1A3T A;  2D9U A;  2M00 A;  3HS0 C;  1STN A;  4DK6 C;  1WOC A;  1RTO A;  1PFN A;  1EWI A;  4KKT A;  4O2D A;  4BBR B;  5LL6 X;  5CYU A;  3GTK H;  2I5H A;  1SRU A;  3D6C A;  2UXD Q;  1JOR A;  1PYW D;  4IPC A;  1LM0 A;  3TS2 A;  4IJH A;  2PMZ B;  1HNW Q;  1TWC H;  4HJ8 A;  4A76 A;  2B2Y A;  2R92 B;  3A0J A;  1Y1V G;  4GNX A;  1K8A C;  2F4V L;  4MTK A;  1TXY A;  4HMI A;  4DPG A;  2RVL A;  4P72 A;  2E8G A;  4H13 C;  3MWY W;  2EY1 A;  2QGQ A;  4ZRZ A;  3Q0A A;  1D1K A;  1Q8K A;  2VUM G;  4JK1 C;  1C0A A;  2Q2H A;  3HKZ E;  1J8I A;  3C2P A;  4FF1 A;  3OWE B;  3URY A;  4ODG A;  3HOZ B;  5G3L F;  4C3I H;  5JJZ A;  1IBK L;  4NDX A;  1X3P A;  5I4D A;  4KN4 C;  5IP9 H;  1NR4 A;  2UXD L;  1TQO A;  2CW0 D;  2MP1 A;  3VR5 A;  4R8I A;  2ZM6 Q;  3K5M A;  2YTX A;  1HNW L;  5JEA H;  1NR2 A;  2UUB Q;  1U4P A;  2E2H H;  1YJW A;  1FR3 A;  2Z9H A;  4CKC A;  2JA5 B;  3MXN B;  1SE4 A;  3FP9 A;  1B3Q A;  1B8A A;  1VQ6 A;  4KLK A;  1G91 A;  3MZ5 A;  3GP7 A;  5IYC H;  3ZYY X;  3TBI B;  4CDF C;  5FOB B;  3F2B A;  3AMU A;  4IFD I;  5M5Y H;  3VYS A;  5IGB A;  4DR2 Q;  1LT4 D;  3CC4 A;  1E2W A;  5LHY 1;  3STB D;  3I3C A;  2Z6B A;  3I56 A;  2A1A A;  1EYD A;  3NSW A;  1EQV A;  5IYD G;  5C0X J;  5GAH C;  3QOL A;  3IL8 A;  4NKL A;  1TWF H;  1JCK B;  2Q8R E;  2F3V A;  1WTQ A;  4A3G G;  2JA8 G;  5J1Z A;  4R4T A;  3MAQ A;  3VYU A;  1YNJ C;  2K50 A;  3H6M A;  2IHF A;  5ELD A;  1BF4 A;  3S15 H;  4ZLT F;  1PZK D;  2BDN A;  2QW7 A;  1QVG A;  1LLR D;  4L6T B;  3W1G A;  1IBL Q;  1OXV A;  1EOT A;  4PZ6 A;  4IUR A;  1CTM A;  2ZT9 C;  3J7A 5;  4EQ5 A;  3VR2 A;  1G2T A;  1XTD A;  3LX0 A;  1EU3 A;  4OO1 H;  2JJQ A;  3RZD H;  3L0O A;  1TWG B;  1TY0 A;  1CKM A;  3S1N H;  3A54 A;  1WTP A;  3RN2 A;  1EYA A;  1H9K A;  1E7Z A;  1B3A A;  4C1N I;  1S5D D;  3S17 B;  4Q0F A;  4OEL B;  3VYR A;  4BY1 H;  2XN9 C;  1VQ8 A;  4PZ7 A;  4V0B A;  1EZ6 A;  5C4X G;  4GS3 A;  4J1M A;  1SNM A;  3EVQ A;  2K5Q A;  2ASB A;  1EEF D;  1HZC A;  1XMO L;  4DR6 Q;  4PMW A;  3ITP A;  4A3F G;  1PVO A;  5IT9 E;  2KCN A;  5FJ8 H;  5M5W H;  4XTC S;  1IW7 C;  3I8Z A;  4ZQ3 A;  4A3K G;  1I6H H;  1SE2 A;  3Q24 A;  4J15 A;  1XNQ L;  4YWK A;  1TY2 A;  1ASZ A;  4QB4 A;  5GAE C;  2VZA A;  2XRS D;  3KF8 B;  3OTO Q;  1Q90 A;  1DON A;  1WJJ A;  5EKL A;  4G7Z C;  4U67 3;  1S5F D;  3E3X A;  5CC4 A;  1GVP A;  4R1J A;  1S5E D;  3FRP B;  3TRE A;  5ISR A;  2RHS B;  2CCZ A;  5KYI A;  3PF5 A;  5G3L D;  1KTK A;  2YYZ A;  3M7G A;  1IL8 A;  2SDF A;  5JEA J;  4HJ7 A;  2EOT A;  2E2H B;  4LAA A;  1JB3 A;  2K32 A;  4GOP B;  2JA9 A;  4A93 H;  2K33 A;  3U9O A;  2F3I A;  5IP7 G;  2PI2 E;  1VQM A;  1KAW A;  3SEB A;  1GJX A;  5FLX c;  2DN8 A;  4X64 Q;  3CQZ H;  1Q81 C;  3BS1 A;  3N6R A;  2MFI A;  4OEM B;  5E7N A;  5M5Y B;  4RCN A;  2H1E A;  1A3U A;  3BYT B;  1LTS D;  1STA A;  3GTM H;  1O80 A;  1JC7 A;  2I0Q A;  4GKJ Q;  4BXX H;  1EIF A;  2VW9 A;  4UPA A;  3D6W A;  5DEH A;  2WFW A;  4P71 A;  2YTV A;  4ULL A;  1TWF B;  3JAM i;  1EWC A;  2XIW A;  4QY7 A;  4HIO A;  2MGS A;  1TR5 A;  2JK8 A;  1BOS A;  4RWS C;  5T1G A;  4C2M B;  2R7Z H;  1VQ7 A;  1CZG A;  4O0A A;  1X54 A;  4DV2 L;  4RHR A;  5CGK A;  1HJP A;  4YIJ A;  3UDF A;  2IWH A;  1WVL A;  1V1O A;  3HOW G;  3U58 A;  5EQ0 A;  4ILW A;  1BCP F;  2NVQ H;  3S14 H;  4A3B H;  3GV6 A;  1S40 A;  3I73 A;  1CFM A;  3PV0 A;  5EKI A;  4AQY L;  1J6Q A;  4WJW A;  3RZD B;  2M9V A;  2B8G A;  1EY0 A;  4JI4 Q;  4PZ8 A;  3S1N B;  1HFN A;  3K59 A;  3LNN A;  2Z6K A;  2H4O A;  3SXH A;  3C1E A;  2L9H A;  4J6H A;  2R3Z A;  4KKU A;  4A3I G;  1Z6H A;  4G57 A;  3ICE A;  4B3M Q;  1V1P A;  2B63 G;  2B2V A;  4JI1 Q;  3PUY A;  1CM9 A;  1F2M A;  4L63 B;  5M5W B;  1GM5 A;  1B2T A;  1I6H B;  4A4I A;  5CR3 A;  1EY9 A;  1X3G A;  2F0F A;  4RAU C;  4A3J G;  4JG2 A;  1TII D;  1JT8 A;  4XQJ A;  1ICW A;  1FNV A;  2NUC A;  5A2Q E;  2RHQ B;  1PH5 A;  1YHA A;  5FKA C;  1Y1W H;  3NBH B;  4JI4 L;  2AUJ D;  1QCB D;  2HD3 A;  2KQ3 A;  3BDC A;  1AW7 A;  1V43 A;  3H94 A;  1Y14 B;  2B29 A;  4A93 B;  3X3N A;  1SLJ A;  3HKS A;  4OON A;  3I91 A;  5M3F H;  1FGU A;  4DK0 A;  4PG3 A;  3F2D A;  4JI2 L;  1D6E C;  1EU4 A;  3CPF A;  3RLF A;  1B50 A;  1HZB A;  1ET9 A;  4KI0 A;  1O7I A;  1PH6 A;  3A5Z B;  2HQL A;  4IFD H;  3GTM B;  2KEE A;  4CGY B;  5J39 A;  4MTN A;  4HCS A;  1U4M A;  1ILQ A;  1TT2 A;  4ABN A;  4DR5 Q;  3OHX C;  1F2Y A;  1CKN B;  1GUN A;  3TP6 A;  4YHH Q;  1JIC A;  2A6E C;  5I9P A;  1X3Q A;  1I3Q B;  4IPH A;  4X6A H;  2Q8T A;  1PRT F;  5C0X I;  3S9W A;  4X65 L;  1HCZ A;  2ALY B;  4L5T A;  3A8I E;  3WWV A;  2HIV A;  5I2X A;  4F88 A;  1WD1 A;  2A5H A;  3D0F A;  3CMA A;  4B3R L;  3PUV A;  4Q5V A;  1J5E Q;  1JE5 A;  3CU7 A;  4GN4 B;  4X62 Q;  2NVQ B;  5EBC A;  4A3B B;  4LF5 Q;  2K1B A;  3CCS A;  1PH3 A;  1ONL A;  3KJP A;  2Z4I A;  3OYY A;  4PNY A;  4DR7 Q;  2O4X A;  2BA1 A;  3KLS X;  3L2P A;  1BCP D;  4ALP A;  1ZEQ X;  1E2V A;  4OIJ A;  4EX5 A;  4NP5 A;  4NXN L;  2A69 C;  4FP5 D;  5F2D A;  3EA6 A;  2O5J C;  2CQO A;  1JB7 A;  1R4Q B;  3E0E A;  2CFM A;  3OOC A;  3GO5 A;  1I94 Q;  5C4X B;  3QG1 A;  5EAY A;  4JC0 A;  1LV9 A;  2Z6K C;  1KC8 C;  3J80 c;  1A15 A;  3K0Y A;  2R92 G;  1M90 C;  3NWT A;  4LFB Q;  3F1Z A;  1YNN C;  3PCO B;  4CKE A;  3GTQ B;  4A3K B;  1C4Q A;  1K8O A;  5LMN Q;  3RZO B;  1NE3 A;  4IZ8 A;  2SEB D;  4GOP C;  1KLU D;  4FNF A;  5FO7 B;  2ZTC A;  4BS9 A;  1KXL A;  1C9O A;  5DAU A;  3BU2 A;  5HUR A;  1RKN A;  3C1F A;  1DYQ A;  4DR7 L;  2HIX A;  1Y1W B;  3I4L A;  2CWP A;  1IHZ A;  3QB3 A;  1K73 C;  3TME A;  1CKN A;  3K5L A;  3KOJ A;  2F0K A;  1SND A;  4JCV E;  5BN5 A;  1TS2 A;  4LF4 Q;  2KA7 A;  1R4P B;  1TWA B;  4R4Q A;  1RJT A;  3PIP 3;  2QEX A;  2F0N A;  4NPS A;  2OWO A;  4M8A A;  3CC7 A;  3IKJ A;  3K80 C;  4LFB L;  4WJ3 M;  1JOQ A;  4DV0 Q;  1XJV A;  3K5O A;  2TSS A;  5LL6 S;  5LMN L;  3R8B A;  2E76 C;  2PQE A;  4IFD J;  1QUQ A;  2ICI A;  5KGU A;  1L0W A;  3CCJ A;  1HR0 Q;  3E9I A;  5LMN W;  2ENB A;  4QGU A;  2HT1 A;  1JWM D;  5KNC A;  4OL7 A;  2CW0 C;  5T1I A;  2WII B;  3SK5 A;  3GTJ H;  2EXZ A;  3F8T A;  5C44 H;  3J7Z C;  4DUY Q;  4LF7 Q;  4DV3 Q;  2A68 D;  4ZAI A;  2JQO A;  1PRT D;  4PMC A;  2LY7 A;  3CF5 A;  2JE6 I;  1FL0 A;  1A0I A;  5IWA Q;  3O13 A;  4DV0 L;  4DV4 L;  4A3L H;  2F0I A;  2O5I C;  1H9S A;  1I4Q A;  3CCL A;  1F9Q A;  1SBB B;  3STB C;  3I72 A;  3KBG A;  2NVY H;  3NTH A;  4UHV A;  3ULP A;  1SYF A;  3DEO A;  5IT9 L;  1TWH B;  4IPD A;  2C5C A;  1NCV A;  1N9W A;  3I70 A;  1KNA A;  3R93 A;  3HEJ A;  5BR8 L;  4JI6 Q;  2A6H D;  2F0T A;  3I4N H;  1HR0 W;  4DUY L;  4X66 Q;  2KED A;  2Q2U A;  2IX0 A;  2O2L D;  3H0G H;  3G6E A;  4K0K Q;  1G6P A;  3L7Z C;  3MXU A;  4G4K A;  4C3J H;  1GUO A;  4QL5 A;  3PUX A;  1Q1E A;  3SDZ A;  1IZ6 A;  4R4C A;  1DZ1 A;  2QEJ C;  2MO1 A;  3S2H H;  3CPW A;  2NZ1 D;  2NVX H;  2OXP A;  1BO0 A;  4C3I G;  5H1S E;  2CH4 A;  1I50 H;  5IP9 G;  2XGT A;  2VXW A;  5CV9 A;  3CME A;  3ND8 A;  2F0D A;  3GTL H;  4KD3 A;  2IX1 A;  3CP0 A;  3NEM A;  5ELF A;  4LW1 A;  1VQL A;  3NBI A;  2F0U A;  4GNX B;  4TSS A;  4BY7 H;  5GAG C;  1ILP A;  1PZJ D;  3S1M H;  4JI6 L;  1VQC A;  2B39 A;  1KQS A;  3T1Y Q;  1EIG A;  1BCP B;  4HAE A;  2UU9 Q;  2NN6 I;  4X66 L;  2NBF A;  4OWX B;  1H9M A;  2N88 A;  4XXE A;  3OWF A;  1BVS A;  4K0K L;  5IYC G;  2EY2 A;  1SYD A;  1VDZ A;  1UAP A;  2ZXO A;  5FLX E;  4KY5 A;  1T5X D;  1TU2 B;  2F0Q A;  2F0O A;  1CUK A;  1QIL A;  2JXM B;  1GXD C;  5JAV A;  1ASY A;  2NZH A;  1N33 Q;  3FEW X;  4OIK A;  3GTJ B;  2VQF Q;  5EPJ A;  3SVM A;  4DR4 L;  3MXG A;  3CCV A;  4OHJ A;  3VR4 A;  4DA2 A;  4DNT B;  3DM1 A;  1AH9 A;  1C7Y A;  5C0X H;  5HY6 A;  1HQR D;  4KY7 A;  4JI5 Q;  3T1H Q;  3VYT A;  2MJ8 A;  3QO2 A;  2OTJ A;  3RLO A;  1YJ9 A;  1D5X C;  4AH6 A;  1PFM A;  1SXT A;  4EGV A;  3H91 A;  1CK1 A;  1DOK A;  2PYK A;  1VQB A;  3AU7 A;  3A74 A;  1SFO B;  1A6X A;  1SJE D;  4LJZ C;  5C3W A;  3PMF A;  1EEI D;  2QDB A;  4QCL A;  4I65 A;  2OCE A;  3BDO A;  3MXP A;  5E3F A;  4OO1 G;  5C4J B;  2UXB L;  4Y52 H;  4WJ4 A;  2Z0S A;  1DM0 B;  2VB3 X;  4IUN A;  5BN4 A;  4QUF A;  1PHJ A;  2B2W A;  4BY1 G;  3KLW A;  1N33 L;  2ZTE A;  1YNX A;  2JA7 H;  4LF8 L;  1GKH A;  3HZX A;  3CAM A;  4CDC C;  4JBM A;  4KJN A;  3R3O A;  4BA1 I;  5JJL A;  1VCI A;  4DNR B;  5A2Q L;  3IAY A;  2HDM A;  4GN5 A;  5FJ8 G;  2YU9 B;  4LFA Q;  3WDN A;  4C3J B;  3AB9 A;  3G71 A;  1UE1 A;  3SK4 A;  3I4M H;  2PO4 A;  4Y7N H;  1LTT D;  3KDF B;  5IGD A;  4OX9 Q;  2LSS A;  1W2B A;  2NVX B;  1ZYR C;  5D3D A;  3S16 H;  5EGT A;  1JJG A;  3S2D H;  3ULJ A;  1PH8 A;  3PO3 H;  1I50 B;  1IYJ B;  1VQ5 A;  2F0W A;  2EYJ A;  3GTL B;  2E5L Q;  1HNZ Q;  5IGE A;  3LGJ A;  2JN4 A;  2XNA C;  4BY7 B;  4NXM Q;  1XMQ Q;  4HJ9 A;  3J80 i;  3K0X A;  4A93 G;  1F2L A;  1O7L A;  1LTB D;  1BKB A;  1L1O A;  5DLQ E;  5JVH 3;  1ZXT A;  3L9A X;  1NTG A;  3T16 A;  3HOU H;  2N8N A;  1EZ8 A;  4GKK Q;  4DAV A;  4A3D H;  2OEO A;  2PZT A;  4MZ9 A;  3V05 A;  3HRZ C;  2IX3 A;  4JV5 Q;  3BVZ A;  1VF5 C;  4K6L A;  4HMJ A;  3Q8D A;  4BXX G;  4MIU A;  1XPR A;  1AZQ A;  3K7A H;  1U9R A;  1OO9 B;  1B4O A;  3CW2 C;  3ONA B;  1F9R A;  1HNZ L;  1UE6 A;  1UWV A;  2ZM6 L;  4A3C H;  2D0O A;  1FGB D;  5CV7 A;  2R7Z G;  2UUB L;  1V9P A;  1W6K A;  2GN5 A;  4AYB E;  1I6V C;  2IT1 A;  1M4V A;  2X69 A;  4A3B G;  4XYQ A;  1GHK A;  3HP3 A;  1GUT A;  3KDF A;  3GTK B;  2EJM A;  3GTG H;  1II3 A;  4DR2 L;  3VA5 A;  1TWC B;  2MO0 A;  2QF7 A;  4FF4 A;  1EIH A;  2EQS A;  5DM7 3;  2JA7 B;  1D1I A;  2BA0 A;  3C3L A;  4LF6 Q;  3S24 A;  2B2W C;  2GA4 B;  1LYL A;  1WTH A;  2EY5 A;  4V19 0;  3H09 A;  4ME3 A;  1HH2 P;  3J81 i;  2B2Y C;  1T5E A;  4CDD C;  2VS1 A;  4IUV A;  2HHH Q;  1LO5 D;  3S1Q H;  1ZKO A;  2RCF A;  1XPU A;  4P73 A;  4GNX C;  5ELE A;  5CV8 A;  3PGZ A;  4Y7N B;  3WOE A;  4PMB A;  4K5X A;  2LXK A;  5E1F A;  5I2Y A;  1F9P A;  1HFG A;  2F1M A;  4DR1 Q;  1BCP C;  3S16 B;  1SMY D;  1IBL L;  3S2D B;  3PO3 B;  1W3S A;  4FYD A;  4C3I B;  1G51 A;  4JBK A;  1BNZ A;  2VL6 A;  1Y1W G;  1ENF A;  4CHT B;  2PW5 A;  2Z8L A;  1JQY D;  1IBM Q;  1DJR D;  2K03 A;  5I6W A;  2F0S A;  1N34 Q;  4JOI A;  2KEN A;  2L0C A;  4G7O C;  3SE0 A;  1ENC A;  1V1P B;  1PH9 A;  3CCE A;  1EYC A;  2IL8 A;  3FKI H;  1X6O A;  3W1B A;  4DGZ A;  3H3V I;  1PYB A;  2EE1 A;  3HOU B;  4DR6 L;  3I2Z A;  1JR0 D;  4DK1 A;  2HHH L;  2NN6 H;  3NTI A;  1B44 D;  2XWB B;  4AYB B;  3NXW A;  1PTO D;  1QVF A;  4HR7 B;  4NW2 A;  3SR1 A;  2VB2 X;  4ZYS A;  4IFD G;  2FFK B;  4MN3 A;  3M4P A;  5JVG 3;  2QKI C;  5C5L A;  1E1O A;  5FO9 B;  1BR9 A;  2N49 A;  5J22 A;  3OTO L;  1CI3 M;  2R7D A;  3E9H A;  4BBS H;  1JWU D;  3K7A B;  3M4Y A;  4LK1 C;  5CMD A;  3CRL C;  1AE3 A;  5EKK A;  3K8A A;  4ZKC B;  1AEX A;  4KY6 A;  1U0L A;  3AQQ A;  1GO3 E;  1P16 A;  4B3T Q;  2L15 A;  1N34 L;  1OXX K;  4EQP A;  3IRB A;  3S15 B;  3P20 A;  1Z9F A;  2G5D A;  4K8J A;  2A74 C;  4QMG A;  1SSO A;  2RDG A;  4QIW B;  5HGQ A;  4XIG S;  4X64 L;  1HTP A;  1HTL D;  2HUG A;  4HSP A;  2PW7 A;  4OXP A;  1MJC A;  1JWS D;  4RGO S;  4BY1 B;  4GN3 B;  3FVQ A;  4LUO A;  4GKJ L;  1A63 A;  2E74 C;  4XQQ A;  3R2T A;  4IUP A;  2A68 C;  4YY3 Q;  3TN2 A;  4RGT A;  4JBW A;  3K58 A;  4WFN 3;  5ELO A;  4A3M H;  3S1Q B;  1ROD A;  2EYP A;  3RUZ A;  1PTO H; 
#chains in the Genus database with same CATH homology
 1CKN A;  2XTI A;  3KOJ A;  4JCV E;  2UXB Q;  5AJ3 Q;  1WCM G;  1VS0 A;  4C2M H;  1VQI A;  4LF4 Q;  4R4Q A;  4JV5 L;  5JJI A;  3M3Y H;  1XNQ Q;  3BJU A;  1LUZ A;  2JEB I;  4APV A;  2QEX A;  4LFC Q;  4NPS A;  2OWO A;  4QQB X;  4DV5 L;  4NB3 A;  3CC7 A;  3K80 C;  4LFB L;  4WJ3 M;  4LF8 Q;  1E3P A;  5K36 G;  4DV0 Q;  2IHE A;  1XJV A;  1Q12 A;  4A3M G;  1NY4 A;  5LMN L;  4FDB A;  1VQJ A;  3K81 C;  4IFD J;  1QUQ A;  4QIW E;  4DUZ Q;  1KHI A;  3KYH C;  2MQH A;  3RN5 A;  1VQK A;  1OTC A;  1L0W A;  3CCJ A;  5LMU Q;  3EBE A;  1HR0 Q;  3E9I A;  4JOI C;  4TVA B;  5LMN W;  4QGU A;  3NEN A;  1KIX A;  2HT1 A;  4B3M L;  4YY3 L;  1Y1V H;  1K9M C;  1VQP A;  2BH2 A;  4JBJ A;  4JI1 L;  4DK6 C;  1VQF A;  3GTJ H;  1PFS A;  3F8T A;  1WOC A;  4O2D A;  1EWI A;  5C44 H;  3J7Z C;  4DNI A;  3GTK H;  4DUY Q;  2I5H A;  5AJ3 L;  1SRU A;  4DV3 Q;  4LF7 Q;  2E2J H;  1EYG A;  1HNX Q;  4IPC A;  2UXC Q;  2C35 B;  2UXD Q;  1LM0 A;  3TS2 A;  1YVC A;  4IJH A;  2VUM H;  2JQO A;  4DV7 Q;  3AEV A;  2RF4 A;  1HNW Q;  4LFC L;  1TWC H;  2JE6 I;  3CF5 A;  4HJ8 A;  2UUC Q;  3HOV H;  1FL0 A;  4A76 A;  1OXU A;  1SR3 A;  4TQU S;  5M3F G;  4LF6 L;  1A0I A;  5IWA Q;  3A0J A;  1Y1V G;  4DV0 L;  4DV4 L;  4JI0 Q;  4A3L H;  2ATW A;  1U5K A;  2N78 A;  4GNX A;  1K8A C;  3BZC A;  2F4V L;  1TXY A;  2GVB A;  4C3H H;  4DPG A;  3CCL A;  4P72 A;  5C44 G;  1EQQ A;  2E8G A;  1L1O C;  1VQ9 A;  1IL2 A;  3UE1 A;  3STB C;  4DUZ L;  3ULP A;  2NVY H;  2QGQ A;  1YJN A;  3TQY A;  1Q8K A;  2VUM G;  1FVI A;  4DR1 L;  1C0A A;  2Q2H A;  3HKZ E;  4DV2 Q;  2D0P A;  4IPD A;  2H5X A;  3DLL A;  1N9W A;  3HOV G;  2VY3 A;  3ZJY C;  5BR8 L;  4JI6 Q;  3I4N H;  1QUQ B;  4A3L G;  1GD7 A;  4L5Q A;  4C3I H;  4LUZ A;  3M85 A;  1IBK L;  1IBM L;  1HR0 W;  4AQY Q;  4DUY L;  5IP9 H;  4X66 Q;  4A75 A;  2UXD L;  1HNX L;  2Q2U A;  2IX0 A;  2KCM A;  4B3S Q;  1YHB A;  4DV7 L;  3H0G H;  3G6E A;  2ZM6 Q;  1VQG A;  4K0K Q;  1G6P A;  2YTX A;  2PQA B;  3L7Z C;  1HNW L;  4C3J H;  2UUC L;  4QL5 A;  2Q2T A;  3PUX A;  4DR5 L;  2UUB Q;  1Z47 A;  2E2H H;  1Q1E A;  4JI8 Q;  1YJW A;  1IZ6 A;  4R4C A;  3FHW A;  4OWW B;  1XNR Q;  2E2I H;  2MO1 A;  5FLM H;  2RCN A;  4YHH L;  1X9N A;  4JI0 L;  3S2H H;  3CPW A;  1NBW A;  3MXN B;  2NVX H;  2UUA Q;  3FP9 A;  3I4N G;  5IYD H;  1B8A A;  1VQ6 A;  5H1S E;  4KLK A;  3RNU A;  3DM3 A;  1R9T H;  4A3G H;  1I3Q H;  1I50 H;  5IP9 G;  5IYC H;  2XGT A;  3CME A;  2JA8 H;  2ES2 A;  3GTL H;  2IX1 A;  3F2B A;  4IFD I;  1EOV A;  3CP0 A;  3NEM A;  4LW1 A;  3HOX H;  5GQO A;  1VQL A;  5M5Y H;  1MIU A;  4DR2 Q;  3CC4 A;  3GTP H;  1J5E L;  4X62 L;  4GNX B;  4BY7 H;  5GAG C;  4DV1 Q;  4LF5 L;  3S1M H;  1LTL A;  2DUD A;  3STB D;  5IE8 A;  2YTY A;  1D7Q A;  2N3S A;  4JI6 L;  5FLM G;  1VQC A;  4A3I H;  1QVC A;  3I56 A;  1PH2 A;  2A1A A;  1KQS A;  3RLN A;  1PH1 A;  3T1Y Q;  2UU9 Q;  2R7F A;  3M9B A;  5IYD G;  2K14 A;  2NN6 I;  3I4O A;  4X66 L;  5C0X J;  4B3T L;  5GAH C;  4OWX B;  3CD6 A;  1H95 A;  4RG1 A;  1S72 A;  1TWF H;  4B3S L;  4A3G G;  4P74 A;  1BVS A;  4K0K L;  2K5V A;  5IYC G;  4IOC A;  2JA8 G;  1X56 A;  1X3E A;  4R4T A;  3HOX G;  1KD1 C;  1M1K C;  4JI8 L;  2K50 A;  1XNR L;  2IHF A;  1I94 L;  3S15 H;  4BY7 G;  1I5F A;  1CUK A;  4DV6 Q;  2Y0S G;  1B7Y B;  1QVG A;  2WAQ G;  4DK3 C;  5C4X H;  2NZH A;  1N8R C;  1ASY A;  1NMG A;  1N33 Q;  3H3V H;  3W1G A;  2VQF Q;  1IBL Q;  1KL9 A;  4R4I A;  1OXV A;  2ZJR A;  4DR4 L;  4PZ6 A;  1E1T A;  3CCV A;  3J7A 5;  4GOP A;  4EQ5 A;  4A3F H;  2ID0 A;  1XTD A;  4JI2 Q;  1AH9 A;  1C7Y A;  2JJQ A;  1MKH A;  3RZD H;  5HY6 A;  4JI5 Q;  3T1H Q;  3L0O A;  5IYB H;  4A3K H;  3GTQ H;  3UE0 A;  2OQ0 A;  1CKM A;  1NMF A;  1PH4 A;  3S1N H;  3RN2 A;  2OTJ A;  3RZO H;  3RLO A;  1E7Z A;  4DAY B;  1YJ9 A;  4AH6 A;  4BY1 H;  1IXR A;  1VQ8 A;  1VQN A;  4PZ7 A;  2PQA A;  3UDX A;  1VQB A;  5C4X G;  4GS3 A;  1PA6 A;  2K52 A;  3A74 A;  4R4O A;  4P75 A;  2ASB A;  1HZA A;  1HZC A;  3KJO A;  3S1R H;  1XMO L;  4DR6 Q;  4PMW A;  3SGI A;  4A3F G;  1PVO A;  3J81 c;  2YV5 A;  2OCE A;  3TEH B;  5FJ8 H;  5C0X G;  5M5W H;  4OO1 G;  4XTC S;  1BBU A;  1JJ2 A;  2UXB L;  4X65 Q;  2Z0S A;  4WJ4 A;  4RMF A;  5IYB G;  4Y52 H;  4A3K G;  4A3E H;  4LF4 L;  1VQD A;  4HID A;  1I6H H;  4J15 A;  1XNQ L;  5J3B A;  1PHJ A;  4DV6 L;  4YWK A;  1ASZ A;  4KHP Q;  4B3R Q;  1TWA H;  3CCM A;  4BY1 G;  3KLW A;  1N33 L;  5GAE C;  2ZTE A;  2VZA A;  1YNX A;  2I5L X;  3KF8 B;  5IP7 H;  4LF8 L;  3OTO Q;  1GKH A;  2JA7 H;  3CAM A;  1WJJ A;  4JBM A;  4BA1 I;  5JJL A;  1VCI A;  1GVP A;  2D62 A;  4POF A;  4R1J A;  1N32 Q;  3TRE A;  5C3E H;  2RHS B;  2CCZ A;  3PF5 A;  3EN2 A;  4GN5 A;  5FJ8 G;  1Q86 C;  3PO2 H;  4LFA Q;  4OWT B;  2IY5 B;  1SE8 A;  2YYZ A;  5JEA J;  1YIJ A;  4NXN Q;  2WP8 J;  3A5U A;  3G71 A;  3CCQ A;  4HJ7 A;  4A3E G;  5LMU L;  1UE1 A;  1HR0 L;  3I4M H;  4Y7N H;  1K83 H;  4GOP B;  3KDF B;  2JA9 A;  4OX9 Q;  4L5R C;  4A93 H;  1WI5 A;  2F3I A;  2LSS A;  1W2B A;  2JA7 G;  1WYD A;  5IP7 G;  3S16 H;  2PI2 E;  4HIK A;  1JJG A;  3AFP A;  1VQM A;  3S2D H;  1KAW A;  3ULJ A;  1PH8 A;  1SRO A;  3PO3 H;  3HFZ B;  1IYJ B;  5FLX c;  3PIP A;  4LF7 L;  4OO1 I;  4DV3 L;  1VQ5 A;  2UXC L;  4X64 Q;  3U50 C;  3CQZ H;  1Q81 C;  2E5L Q;  3TS0 A;  4KHZ A;  5C3E G;  2ZTD A;  4BBR H;  2FXQ A;  1OXS C;  1K3R A;  1VQA A;  2MFI A;  5E7N A;  3LGJ A;  1HNZ Q;  3PO2 G;  1DGS A;  1RL2 A;  4KHP L;  4NXM Q;  3GTM H;  2R6G A;  1XMQ Q;  3I4M G;  4HJ9 A;  2A8V A;  3J80 i;  5IWA L;  4JYA Q;  3HOW H;  3K0X A;  2I0Q A;  4GKJ Q;  4A93 G;  2I5M X;  4BXX H;  4LF9 Q;  2PI2 A;  1BKB A;  2CWA A;  3CXC A;  1EIF A;  1L1O A;  4UPA A;  2VW9 A;  2K5N A;  5DLQ E;  3CCR A;  2WFW A;  2V1C C;  2YTV A;  4P71 A;  3PO3 G;  1NTG A;  3JAM i;  1N32 L;  3HOU H;  2N8N A;  4GKK Q;  4QY7 A;  4HIO A;  4A3D H;  2JK8 A;  3M7N A;  4BBR G;  2R7Z H;  3H0G G;  4MZ9 A;  3BZK A;  1QZG A;  4O0A A;  1VQ7 A;  3G48 A;  1X54 A;  4DV2 L;  3ERS X;  3KF6 B;  1HJP A;  3UDF A;  5JEA G;  4POG A;  3B6Y A;  2F52 A;  2JA6 H;  4JV5 Q;  2AMC B;  1TWH H;  3HOW G;  3U58 A;  2Q2I A;  3Q8D A;  5IT9 c;  2NVQ H;  2BH8 A;  3S14 H;  4A3B H;  4BXX G;  1XPR A;  4MNO A;  1S40 A;  3H15 A;  3K7A H;  2B63 H;  1YIT A;  2EXD A;  2KHJ A;  1UE7 A;  3PV0 A;  4GLX A;  4AQY L;  1J6Q A;  3CW2 C;  3HOZ H;  5ELN A;  1HNZ L;  1UE6 A;  3HOU G;  4JI3 Q;  1UWV A;  3PUW A;  2CKZ B;  4PZ8 A;  2D0O A;  2ZM6 L;  4JI4 Q;  4A3C H;  2WB1 G;  1X55 A;  2R7Z G;  4AYB G;  1YBY A;  2UUB L;  1V9P A;  2Z6K A;  1JMC A;  4A3J H;  1CSQ A;  4IOA A;  3J81 j;  3G4S A;  2GN5 A;  2GVA A;  4AYB E;  4LF9 L;  2JA6 G;  2IT1 A;  2UUA L;  1Q7Y C;  2VNU D;  4A3I G;  4A3B G;  2JA5 H;  3ICE A;  4B3M Q;  2B63 G;  2OTL A;  2QA4 A;  1A8V A;  4UY8 C;  1YHQ A;  2Y0S E;  4JI1 Q;  3RR5 A;  3PUY A;  2WAQ E;  2AWN A;  3AFQ A;  3KDF A;  3HOZ G;  4YWL A;  1GM5 A;  1PH7 A;  1KRS A;  2OQK A;  3GTG H;  3UDG A;  4A3C G;  3I55 A;  4A4I A;  1N36 Q;  4DR2 L;  2KHI A;  1JJC B;  1X3G A;  3PSI A;  2MO0 A;  3W5O A;  2EQS A;  4DV1 L;  1L1O B;  2DGY A;  3HOY H;  1YZ6 A;  4BA2 I;  1OXT A;  4DKA C;  4A3J G;  1PV4 A;  1G29 1;  4JG2 A;  1JT8 A;  2BA0 A;  3CC2 A;  2NVT H;  4LF6 Q;  2RHQ B;  3S24 A;  3T1Y L;  4GLA C;  1D8L A;  2UU9 L;  1PH5 A;  3GD7 A;  1HZ9 A;  1LYL A;  1YHA A;  2JA5 G;  5JJK A;  1EUJ A;  3J81 i;  4ME3 A;  1HH2 P;  1VQE A;  4DAM A;  4UP8 A;  5M3M H;  4DV4 Q;  1Y1W H;  1EIY B;  2VS1 A;  4JI3 L;  3NBH B;  4JI4 L;  2HHH Q;  2F4V Q;  1VQ4 A;  3S1Q H;  2R93 H;  3M4O H;  1XPU A;  4P73 A;  1FJG Q;  4GNX C;  1E22 A;  4IO9 A;  1PYS B;  1X65 A;  1L2F A;  3PGZ A;  1V43 A;  1SMX A;  2AHO B;  1B70 B;  2ZJP A;  1A62 A;  2KBN A;  1Y14 B;  2LXK A;  1K0R A;  3HOY G;  2B29 A;  2VQE Q;  1SLJ A;  4DR1 Q;  3HKS A;  2KCT A;  4OON A;  5M3F H;  4L5S A;  1FGU A;  2VQF L;  1IBL L;  1YI2 A;  1W3S A;  3KF6 A;  4PG3 A;  4JI7 Q;  1G51 A;  2PNH A;  3F2D A;  1Q82 C;  1RIP A;  5BR8 Q;  4JBK A;  1UEB A;  1S3O A;  2NZO A;  4JI2 L;  3NEL A;  2VL6 A;  5M3M G;  1Y1W G;  1CKO A;  3CPF A;  3JC6 6;  3RLF A;  3PIO A;  4JI5 L;  3T1H L;  1HZB A;  1WFQ A;  1CSP A;  1IBK Q;  1IBM Q;  4H02 A;  2R93 G;  4KI0 A;  1K8G A;  3TRZ A;  1N34 Q;  1O7I A;  2KEN A;  3A5Z B;  2HQL A;  4JOI A;  1PH6 A;  2K75 A;  1TWG H;  4MTN A;  1PH9 A;  3AYH B;  3PUZ A;  3CCE A;  3OW2 A;  3U4V A;  4HJ5 A;  4DR5 Q;  4GLV B;  4DR3 Q;  3FKI H;  5GAD C;  5GRO A;  1X6O A;  3W1B A;  3VDY A;  3S17 H;  3H3V I;  1CKN B;  4YHH Q;  1YEZ A;  1PYB A;  1UE5 A;  2A19 A;  3PF4 A;  1XPO A;  3I2Z A;  4DR6 L;  2K5H A;  3D31 A;  4IPH A;  1SFO H;  1QZH A;  2HHH L;  4X6A H;  5C0X I;  1FJG L;  4X65 L;  2ALY B;  1KRT A;  1QVF A;  3HKZ G;  1VQH A;  2K4K A;  4IJL A;  4L5T A;  2ZJQ A;  3WWV A;  5C4J H;  2HIV A;  2JEA I;  2VQE L;  4IFD G;  3ER0 A;  3D0F A;  3M4P A;  3CMA A;  4LNQ A;  4B3R L;  3PUV A;  3EIV A;  1E1O A;  2N49 A;  3U4Z A;  2AKW B;  1JE5 A;  4IPG A;  4GN4 B;  4X62 Q;  3F2C A;  3OTO L;  2R7D A;  1J5E Q;  3E9H A;  3FKI G;  4JI7 L;  4LF5 Q;  4BBS H;  1BBW A;  1EFW A;  3CCS A;  1PH3 A;  2R92 H;  3GDE A;  3KJP A;  3CCU A;  1VQO A;  1AE3 A;  2B3G A;  3OYY A;  2AWO A;  4YCU A;  3K8A A;  4DR7 Q;  1U0L A;  3AQQ A;  2BA1 A;  3L2P A;  4ALP A;  1GO3 E;  2NN6 G;  1P16 A;  5M5X H;  4B3T Q;  4LFA L;  4EX5 A;  2L15 A;  4NXN L;  4HIM A;  1OXX K;  1N34 L;  4YCW A;  3I7F A;  1Q1B A;  3IRB A;  2EIF A;  2YU9 H;  2CQO A;  1Z9F A;  3E0E A;  1SN8 A;  1V1Q A;  3ULL A;  4DR3 L;  1JB7 A;  4OX9 L;  2CFM A;  3GO5 A;  3M4Q A;  1I94 Q;  1NJI C;  5EAY A;  4JC0 A;  4BBS G;  2Z6K C;  1KC8 C;  4DV5 Q;  3J80 c;  2R92 G;  3UDI A;  5HGQ A;  1M90 C;  2PMZ E;  4LFB Q;  3F1Z A;  2LXJ A;  1T9H A;  4XIG S;  4X64 L;  4DR4 Q;  2E5L L;  3PCO B;  1P8L A;  4UP7 A;  4AIM A;  3MEF A;  3JAM c;  5LMN Q;  3KFU A;  4A3D G;  1WCM H;  1NE3 A;  4OXP A;  4GOP C;  4NXM L;  1MJC A;  4YWM A;  1XMQ L;  4JYA L;  4GN3 B;  2ZTC A;  4LUO A;  2WB1 E;  4GKJ L;  1A63 A;  4LUV A;  4LWC A;  1KXL A;  1C9O A;  1X3F A;  4YCV A;  1E24 A;  3BU2 A;  1N36 L;  1EQR A;  1AE2 A;  4DR7 L;  2HIX A;  4UP9 A;  4YY3 Q;  2CWP A;  4JBW A;  3GTO H;  5ELO A;  1Q46 A;  5IY0 A;  4A3M H;  1MJE A;  4GKK L;  4QJF A;  3K7U C;  1XMO Q;  2MNA A;  1K73 C;  4HJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...