4R4IA

Structure of rpa70n in complex with 5-(4-((6-(5-carboxyfuran-2-yl)-1-thioxo-3,4-dihydroisoquinolin-2(1h)-yl)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4iA00
3PGZA 3PUZA 4UP9A 1X6OA 3S16H 4QQBX 2ZJRA 2WP8J 1PHJA 4KI0A 4AYBG 1AE2A 1XNQL 2GVBA 1YIJA 5C4XH 4DR1L 3OYYA 2Z6KA 3BZKA 2E5LQ 5M3MH 3U58A 2K50A 2E2HH 3M4OH 2IY5B 3CCSA 3I4MH 4IJLA 5FLXc 4MTNA 4GOPB 1VQGA 1L1OB 1C7YA 3I4MG 4KHPL 4DV3Q 4DUYQ 3HOUH 4A4IA 4TVAB 1PVOA 2K14A 3EN2A 3H3VH 1LM0A 5ELOA 3S24A 3HOUG 1G51A 4OWWB 4C3IH 5JEAG 1IYJB 2IX0A 1PH6A 1N9WA 4DNIA 4IPGA 1K0RA 3W5OA 1CSPA 2YTYA 3AQQA 2HQLA 4DV3L 3KJPA 4KLKA 4DUYL 4GOPA 3H15A 1L1OA 4A3DH 1UE6A 5JJKA 4LUZA 2MQHA 1PH1A 4LF9Q 4A3DG 3B6YA 4OXPA 1HNXQ 2NVXH 3G71A 2JEBI 2C35B 2NN6G 2N8NA 1KAWA 1VQ5A 3GTQH 3PUVA 1IBKQ 1Q81C 1NE3A 1TWFH 2CWAA 5ELNA 3RNUA 1PH8A 4OO1G 1E1TA 4DV4L 1BBWA 3G48A 1HNXL 3K80C 1G6PA 2RCNA 4MNOA 5IYDG 2D62A 2F52A 2YYZA 3ZJYC 4DR7Q 4A76A 1YBYA 1FJGL 5LMUL 4DR2Q 1X56A 1UE5A 2HHHL 4A3FH 2JQOA 1I5FA 4X64Q 3CMAA 1WFQA 4A3FG 1UE1A 3U50C 1WYDA 2LXKA 2DGYA 4YHHQ 4LFBQ 2CCZA 3KLWA 2CFMA 3FP9A 5GADC 4A3EH 1BBUA 1FGUA 3PUWA 4L5QA 4DR2L 2WB1E 5M5XH 3PF5A 2KHJA 1S40A 1X3EA 1XJVA 1DGSA 1Y1VH 5M3FG 4X64L 4DR4Q 4BBSH 4RMFA 1I50H 1Y1VG 4YHHL 1NMFA 1QVFA 4LFBL 4WJ3M 1EOVA 4LUVA 1Y1WH 1C9OA 2QGQA 4JG2A 2OQKA 3RLOA 3JAMi 4H02A 3CD6A 1Y1WG 2A1AA 1SFOH 4HJ8A 2OTLA 1KD1C 4DR4L 1WCMG 3ERSX 4JBMA 4QJFA 1J5EQ 2VS1A 1NY4A 1GM5A 1HNZQ 4JOIA 1IBML 4A3CH 3M9BA 4B3RQ 3D0FA 1JJCB 1OXVA 4RG1A 3CAMA 2XGTA 2JK8A 4A3CG 3J80i 3ULJA 4LFCL 5BR8Q 2K5NA 1BVSA 1OXSC 3HKZE 1EWIA 3NELA 5LMNW 1JJ2A 1ASYA 4BBRH 4HIKA 1J5EL 5GQOA 3GDEA 3CCUA 4R1JA 1HNZL 4TQUS 4X66Q 4BY1H 3K0XA 3BZCA 4BBRG 4B3RL 2JA5H 1UWVA 4OWTB 2KBNA 4BY1G 4L5SA 4NXNL 5BR8L 2A19A 1CKNA 3PUYA 2VW9A 3S14H 1EYGA 3W1BA 3CCJA 1KQSA 4OONA 2ATWA 5IY0A 1GD7A 4HJ5A 3H3VI 3KFUA 3TRZA 1VQEA 3K8AA 2YTXA 4X66L 2K75A 4PG3A 4DK6C 4JC0A 1XPOA 3S1NH 4HJ9A 4DAYB 1YITA 4GLAC 1XMOL 1PH7A 2EIFA 4OWXB 4JI8Q 4R4OA 1XPUA 3CC7A 4A3IH 2N49A 3U4VA 2UUCQ 4BA2I 3MXNB 4BA1I 3HOZH 1N8RC 3S17H 4A3IG 4IOAA 2E8GA 4PZ7A 4C2MH 3HOZG 2GVAA 1YHQA 1J6QA 3I2ZA 1S3OA 1K8GA 1H95A 1RL2A 4JI8L 3G4SA 2R93H 3PIOA 2NVYH 2XTIA 2NVTH 1V43A 4DR5Q 1JE5A 4OO1I 1MKHA 3KDFA 1Z9FA 3A5UA 3HOVH 2K4KA 4AQYQ 2ES2A 1VQBA 1P8LA 3NENA 4APVA 1JB7A 3HOVG 3KYHC 3I7FA 3PV0A 4JBJA 2AMCB 4DR5L 4R4IA 2JEAI 1JJGA 1JMCA 1FL0A 1P16A 4NPSA 4KHPQ 4AQYL 2N3SA 4HIMA 2E2IH 1QUQB 3RN2A 1Q1EA 1CKOA 4DR6Q 4DV2Q 1YJ9A 3TEHB 2Q2TA 3PO3H 5IP9G 1SN8A 1EIFA 3PO3G 2UXCQ 1B7YB 4R4CA 3TQYA 3KF6B 2QA4A 4JI5L 4PZ8A 4DR6L 4DV2L 4BXXH 1QUQA 2RHQB 4GN5A 1XPRA 1CUKA 1TXYA 4BXXG 3I4NH 1N32Q 4YWMA 2UXCL 1T9HA 2UUAQ 4EQ5A 3CMEA 3I4NG 1Z47A 4DV4Q 3T1YQ 1EUJA 3L7ZC 4OX9L 3I56A 1XNRQ 4ME3A 2JJQA 2VQFQ 3PO2G 3KF6A 4UPAA 3M3YH 2I0QA 1FJGQ 5LMUQ 1YZ6A 4IFDI 4DUZQ 4HIOA 4GNXB 3OW2A 2HHHQ 1N32L 2R7FA 4B3MQ 5IYDH 2UUAL 3EBEA 4GLXA 3T1YL 2I5HA 3S1QH 5GAEC 2JA7G 2B63H 1XNRL 2MFIA 2AHOB 2JA6H 4JCVE 2VQFL 1NBWA 2PQAB 3I4OA 4YY3L 4JI6Q 2B63G 2BH2A 1MJEA 2JA6G 4DUZL 1CKMA 4J15A 1O7IA 4JI1Q 3KJOA 3A74A 1HZBA 1Q12A 1UEBA 2ZM6Q 4B3ML 2R92G 4LFAL 4X65Q 3GTLH 4GNXA 1N33Q 1KRSA 1Q82C 3RN5A 4YCWA 5C0XJ 3PF4A 3S1MH 2GN5A 2LSSA 4PZ6A 5M3FH 1OXXK 3CW2C 4JI6L 4IPDA 1KHIA 3STBC 4JI1L 3RLNA 4A3GH 3Q8DA 2PQAA 3BJUA 3U4ZA 5C3EH 4EX5A 2ZM6L 3F8TA 2WB1G 4X65L 1VQ8A 4UY8C 2I5MX 4P74A 3J81j 2VQEQ 4HJ7A 3GD7A 1N33L 5C3EG 1IBMQ 4LF8Q 2KHIA 4GKKQ 1IXRA 2PMZE 3M4PA 2YU9H 1XTDA 1WCMH 2VL6A 2VY3A 4GOPC 3H0GH 4DV0L 4LFCQ 2YV5A 1L1OC 1Q86C 2UXDL 2Q2HA 1YJWA 3H0GG 4C3JH 4XIGS 5M5WH 1HZAA 3NEMA 2VQEL 2D0OA 1SROA 4Y7NH 4LF8L 4JV5Q 2VNUD 1KIXA 1KL9A 4GKKL 4A3GG 1CKNB 1SR3A 1VQHA 1VQOA 2V1CC 4A3LG 4BY7G 1QZGA 4C3HH 4DV7Q 1VQMA 4NXNQ 3S15H 1RIPA 1SRUA 2D0PA 1E24A 1YEZA 3HKSA 4R4QA 4L5TA 4JI3Q 3HOWH 4LF6L 1NJIC 3HKZG 3M4QA 1U0LA 1HR0Q 2PNHA 1N34Q 4JV5L 1PA6A 1VS0A 3HOWG 4LF4Q 4MZ9A 2JA9A 1X3FA 5H1SE 1XMOQ 4DV7L 5AJ3L 5K36G 1W2BA 1QVCA 1VQPA 1Q46A 2B29A 3EIVA 4JI3L 2R6GA 4JI2Q 2BA0A 2ASBA 2UXBQ 3S1RH 1HH2P 1X3GA 2FXQA 1N34L 1HR0L 3NBHB 3F2BA 1HNWL 4LUOA 4LF4L 1X9NA 5IYCG 1AH9A 2ID0A 2VUMH 1GO3E 2I5LX 3KDFB 3GTJH 4A75A 2UUBQ 3I55A 4O2DA 4A3KG 3BU2A 4X62Q 2VUMG 4JI2L 1Q1BA 1QZHA 4A3MH 1AE3A 3HOYH 2UXBL 4AIMA 1YVCA 5HGQA 2NN6I 1PH3A 4HJAA 3HOYG 4A3MG 4A93H 3UDXA 4GLVB 1VQKA 3GTPH 4GKJQ 2R7ZH 2UUBL 4A93G 3A5ZB 3TS2A 4X62L 3TREA 2BH8A 2R7ZG 3J7A5 1ASZA 5M5YH 2AWNA 3ULLA 3DM3A 5E7NA 3S2HH 3ICEA 2UXDQ 2AWOA 2B3GA 1Q7YC 1PH9A 4GKJL 1QVGA 1KC8C 1MIUA 3UDFA 1BKBA 2Q2IA 2NZHA 3CCRA 4LNQA 3K7AH 1LUZA 2VZAA 2ZTCA 3J81i 4LF7L 3CC4A 1K8AC 1VQ9A 2OCEA 1N36Q 1KRTA 2CQOA 3AYHB 1VQIA 3WWVA 2K5HA 5JJLA 3L0OA 2ZJQA 1PYSB 4JI5Q 2WAQE 5IP9H 3UE0A 2A8VA 4K0KL 3F2DA 3CPFA 2WAQG 2CWPA 3TS0A 1N36L 3K7UC 4POFA 3S2DH 4FDBA 1VQ4A 1FVIA 3FKIG 4IJHA 4GN4B 3E9HA 4OX9Q 4AYBE 4UP8A 2BA1A 2E2JH 3GTKH 3CCVA 1WOCA 1KXLA 4YWKA 3KOJA 1G291 4UP7A 2DUDA 3CC2A 1VQ6A 4QL5A 2PI2E 2OWOA 1U5KA 3RZOH 1IBLL 5EAYA 1K9MC 3PO2H 1SLJA 1PH5A 5C4XG 4JI7L 1HJPA 4Y52H 1TWHH 5M3MG 2RHSB 5C0XG 1EQQA 4YY3Q 4DV5Q 1L2FA 2ALYB 3E0EA 2JA7H 3RR5A 2MNAA 2E5LL 4LFAQ 4DR3Q 1CSQA 1K83H 1WJJA 4DV1Q 3UDGA 4WJ4A 2AKWB 1X54A 1M1KC 4DV6Q 2OTJA 3GTGH 2QEXA 1LYLA 1OXTA 1NTGA 1SE8A 2JE6I 3GO5A 5C44H 4DV5L 1I3QH 2R92H 1YHBA 3J81c 3PIPA 5C44G 2K52A 1VQLA 4LWCA 4DR3L 3D31A 4DPGA 1I6HH 2Z6KC 2LXJA 4IO9A 4DV1L 5GAHC 4LF5Q 5IYBH 3CCMA 3RZDH 3F1ZA 4DV6L 1E22A 1TWGH 4P71A 4DKAC 3G6EA 2UU9Q 5IYBG 1VQCA 2EXDA 2HIXA 1A0IA 4B3TQ 4DV0Q 4PMWA 4YWLA 4LF9L 1X55A 1L0WA 1PV4A 1C0AA 1VQJA 3FHWA 1VQNA 4O0AA 5JEAJ 1R9TH 1IZ6A 1NMGA 1B8AA 4LF5L 2Q2UA 3CXCA 2HT1A 3GTMH 1K3RA 4X6AH 4P73A 4IPHA 5DLQE 4P72A 2UU9L 3VDYA 1D7QA 1S72A 1IBKL 3PCOB 2NZOA 4DAMA 4B3TL 3DLLA 3STBD 4LW1A 1JT8A 1E7ZA 1EIYB 5FJ8H 2RF4A 3ER0A 4LF6Q 4A3LH 4BY7H 3SGIA 1HZ9A 2N78A 1A63A 1OTCA 4DR7L 5FJ8G 4AH6A 2KCTA 1GKHA 1SMXA 5AJ3Q 3HOXH 1VQFA 2K5VA 1Y14B 4A3EG 3A0JA 5LMNQ 4IPCA 4R4TA 5J3BA 4B3SQ 1D8LA 3HOXG 3HFZB 4POGA 1V9PA 3F2CA 4BBSG 1HNWQ 3AFQA 2JA8H 3CPWA 2WFWA 2ZJPA 4QGUA 5IE8A 1VQ7A 2JA8G 4QIWE 2EQSA 5LMNL 4L5RC 4A3BH 3CCEA 2ZTDA 4B3SL 2IHEA 5IP7H 4QY7A 3RLFA 3L2PA 3MEFA 2IX1A 3PSIA 5IYCH 4GNXC 4A3BG 4JI0Q 5IP7G 4NXMQ 1K73C 1EFWA 1YNXA 5GROA 3JC66 4A3KH 4JBKA 4GS3A 4NB3A 4JI4Q 5IT9c 1XMQQ 4P75A 2YTVA 4IOCA 1PH4A 2NVQH 1A62A 2F4VQ 5C0XI 3K81C 3T1HQ 1HR0W 4JI0L 5IWAQ 4NXML 3UDIA 4IFDG 1A8VA 4GN3B 3E9IA 3W1GA 2JA5G 4JI4L 1XMQL 1OXUA 2Z0SA 3GTOH 2KENA 4DK3C 1YHAA 1EQRA 3PUXA 4HIDA 2F4VL 1VCIA 4A3JH 3T1HL 4LF7Q 3M85A 5IWAL 4ALPA 3CCLA 2MO0A 4JOIC 3M7NA 2MO1A 2Y0SE 1LTLA 2H5XA 3OTOQ 3CCQA 2KCMA 4A3JG 1B70B 2IT1A 3AFPA 1E3PA 4XTCS 3CQZH 2R7DA 1X65A 2Y0SG 1MJCA 1PFSA 1PYBA 4YCUA 1PH2A 3J7ZC 3UE1A 5GAGC 3ULPA 1VQDA 4K0KQ 4IFDJ 2CKZB 2L15A 2OQ0A 4YCVA 3OTOL 1YJNA 5HY6A 3AEVA 1W3SA 1E1OA 3IRBA 4JYAQ 5FLMH 3JAMc 3CP0A 3LGJA 2UUCL 2IHFA 3CF5A 1I94Q 1TWCH 4JBWA 2R93G 5FLMG 1IL2A 1UE7A 1M90C 1VQAA 5C4JH 2ZTEA 3KF8B 5JJIA 1XNQQ 1GVPA 1Q8KA 4DR1Q 2F3IA 3FKIH 1V1QA 2HIVA 4JYAL 1TWAH 2PI2A 4KHZA 1IBLQ 1HZCA 1WI5A 3J80c 1YI2A 4JI7Q 1I94L
chains in the Genus database with same CATH superfamily
1SYEA 3PUZA 5CBEE 2B2TC 5EPLA 5G3LD 4TSSA 2ZJRA 2WP8J 1B9MA 4RH6A 1XNQL 2GVBA 1CM9A 5C4XH 4DR1L 1I6HB 2IY5B 3M4OH 1SJHD 4XXEA 1PFBA 1J8IA 1JCKB 5K5PA 2XWBB 3GTQB 4KHPL 4DV3Q 4TVAB 2BE5D 3EN2A 5FKAC 3H3VH 4OHJA 5JVG3 3R8BA 2CQAA 2O2LD 2EZVA 1CSPA 2HQLA 1PRTF 2ENBA 4C56C 5JJKA 1HPCA 4LUZA 4LF9Q 3B6YA 1I4PA 2JP1A 4KKUA 3G71A 1LTTD 3I8ZA 4K6LA 3RMHA 1VQ5A 3HOXB 2RVLA 3GTQH 3PUVA 2TMPA 4BBSB 5ELNA 3IAYA 1PH8A 1BBWA 1SYDA 2RCNA 4B9WA 2D62A 2PZWA 1JWUD 4DR7Q 3ZJYC 5EPKA 4A76A 1YBYA 3IFTA 3UI2A 4HAEA 1X56A 1STAA 2JQOA 1I5FA 4NKLA 1G2SA 1MBYA 1UE1A 1WYDA 2AQ2B 3KLWA 5GADC 1FGUA 4L5QA 4DR2L 2WB1E 5KYLA 3SR1A 1X3EA 1K8MA 4PNYA 4X64L 5M3FG 4BBSH 1BQQT 1EOVA 1VF7A 2NWGA 3JAMi 4H02A 3CD6A 1Y1WG 1XXGA 1KD1C 4G57A 4QJFA 1J5EQ 4A3JB 2VS1A 1NY4A 4DK1A 4A3CH 4B3RQ 2RDHA 2Y0SB 3CAMA 2XGTA 3CQZB 3ULJA 3OIQA 2K5NA 1KLGD 2OEOA 2E74C 1EWIA 3NELA 5LMNW 4HIKA 3D6CA 3MVVA 4X3SA 2ASBA 4FF1A 3P7JA 1SAPA 1BCPC 4L5SA 1DXMA 4NXNL 1CKNA 1WD0A 1ONLA 1NUCA 3HG9A 3MXPA 3TRZA 3PMFA 4PG3A 1EQVA 3S1NH 2D9UA 3LNNA 4DAYB 4RGTA 3QIAA 1XPUA 3CC7A 3U4VA 3HOZH 3MXGA 1N8RC 3S16B 3K6OA 2E8GA 4LAAA 3R3OA 1K8GA 3OHXC 1H95A 4JI8L 4DAYA 2NVYH 2Z1CA 1V43A 5I9PA 3KLSA 3KDFA 4JVZA 1ZEQX 4IURA 1Z9FA 3A5UA 3K5MA 3HOVG 1JB7A 3KYHC 2J7ZA 1WTWA 2NTTA 1T5EA 1ESRA 3NUCA 1FL0A 4A3DB 5IT9L 4KHPQ 4EQOA 2N3SA 2ICIA 1TVXA 1LLRD 5CBAE 2DJGC 1QUQB 3RN2A 2F1MA 1YJ9A 1D6EC 2Q2TA 3DEPA 5IP9G 1TWFB 5JVH3 5ELFA 1K3BC 2RSOA 3TP7A 3TQYA 3WOFA 2QA4A 4DR6L 1QUQA 3C1FA 1CUKA 4BXXG 1ML0D 1EYDA 2NTSA 2UUAQ 4EQ5A 5HGTA 4ABNA 3I4NG 1Z47A 1EUJA 1VMCA 2R61A 1T5XD 3CRLC 2VQFQ 2N88A 1Y1VB 4GNXB 3V05A 3EBEA 2BOSA 5IGCA 4K8IA 3T1YL 2XNAC 2MFIA 4YY3L 3PQIA 1XX8A 1O7IA 1TY0A 4B3ML 2ZM6Q 2K5WA 2L11A 2RBMA 4LFAL 4GNXA 5CMDA 2XN9C 3PF4A 4FXDA 3S1MH 2MP1A 2XWJB 4IPDA 3STBC 1LT5D 2Z8LA 4X65L 1N33L 2I5MX 1D1IA 2KHIA 2X6GA 4GKKQ 3M4PA 5DM63 2EY2A 3RD4A 3H0GH 4HR7B 1L1OC 3TN2A 3T51B 3AMUA 4XIGS 5M5WH 2VQEL 1SROA 5ELDA 2VNUD 2F03A 1VQHA 2J4XA 1QZGA 4DV7Q 1VQMA 2LKVA 4NXNQ 2D0PA 1E0BA 1GUOA 4R4QA 3HKSA 5C5LA 4L5TA 3HOWH 2A6EC 1TS4A 3HKZG 4C2MB 3GTPB 2A73B 5H1SE 5CORA 5K36G 3K5NA 1W2BA 1A3TA 3EIVA 5BN4A 4JI3L 2R6GA 2UXBQ 1HH2P 3NBHB 3FMCA 3F2BA 2KEEA 1X9NA 5IYCG 2KCCA 2ID0A 2UUBQ 3I55A 1I4QA 3TDQA 4JI2L 1JOQA 4A3MH 5F2DA 1KABA 2Z9HA 4KN7C 5G3LF 3HOYG 2E2IB 3NBHA 3GTPH 1YNJC 2BH8A 1WTQA 4F88A 1SYBA 4GKJL 2CH4W 2WIIB 4RHRA 2NB0A 3VR5A 4LNQA 1MIUA 1BKBA 2N55A 2VZAA 1V1PB 2B2VC 2B39A 1RKNA 3J7YW 2OCEA 2J0TD 4XT1B 3AYHB 4KKSA 2K5HA 3I90A 3L0OA 1HCZA 1D5MC 1IKLA 2WAQE 3MXUA 1SNMA 4NMZA 2EJFC 2A8VA 3CPFA 3NQTA 2V4DA 2CWPA 2NUCA 1V1PA 5ELCA 3TS0A 1K83B 1R4PB 1KDCA 2JA6B 2BDNA 1CA5A 1PDQA 3K5OA 1TS3A 3SHLA 2DUDA 3CC2A 2F0WA 4IUVA 1U5KA 1SLJA 2L5TA 5C4XG 3VYRA 4IZ8A 5EKLA 1O78A 4IUQA 3R2TA 4YY3Q 3JAML 1SNDA 1ICWA 2ZXOA 3CHBD 2AQ1B 5EGTA 4LFAQ 1K83H 1ZYRD 4DV1Q 3UDGA 4WJ4A 2A68D 1DJRD 5FLXE 4KY7A 2OTJA 1OXTA 2JE6I 3FEWX 3GO5A 3J81c 4A3GB 4DR3L 1BCPB 4Y7NB 2XVSA 5EPJA 3DXJC 3RZDH 1EZ8A 2PYKA 2HIXA 1A0IA 5EBDA 1SSOA 1AW7A 2X69A 1VQNA 5JEAJ 3GTMH 1B8AA 2Q2UA 2DJFC 4IALA 4FF4A 4IPHA 1C4QA 1STGA 1PRTD 1JWSD 3VDYA 1S72A 1IBKL 3PCOB 4B3TL 4KV6A 3A55A 1JT8A 1E7ZA 3VA5A 5FJ8H 3ER0A 3S1RB 1NSNS 4A3LH 1FNVA 1HZ9A 2N78A 5EJWA 5KGUA 5A35A 4AH6A 1GKHA 2EYJA 2VUMB 5NUCA 3U9SA 2K05A 2RSNA 4IPCA 5CV7A 2MHVA 4PV1C 3HOXG 4BBSG 4A93B 2A6HD 2EVBA 4DK0A 2PPBC 1SNQA 2EYOA 3IFDA 5LMNL 1LTGD 3CCEA 4A3BH 4QY7A 5M5YB 1CT1D 3L2PA 2IX1A 3PSIA 4OGQC 1AN8A 2F0EA 1YNXA 5GROA 4EGVA 3JC66 1XMQQ 3K7AB 2QKIC 3ZYYX 4IOCA 1PH4A 1A62A 3P1HA 4MTKA 4JI0L 1FD7D 1I4XA 1B3AA 1STBA 2F0UA 3N6RA 3W1GA 4DFAA 3ND8A 4JI4L 3DWQA 1OXUA 4L6TB 3E6ZX 2KENA 3D4RA 3NTHA 2F4VL 2EXZA 1VCIA 3AU7A 3T1HL 4KY5A 3S2DB 4XDXA 4N8FA 4BS9A 4A3JG 2HDMA 4XTCS 4N9TA 1O7LA 2Y0SG 3QJYA 1PFSA 4YCUA 2E2JB 3UE1A 3ULPA 1VQDA 3P75A 5FOBB 2A69D 2L15A 4Z9CB 1E1OA 1QB5D 1ZKOA 5FLMH 1TWHB 2CW0C 3CP0A 2I07B 2R3ZA 1G2TA 2EY5A 1IL2A 3HOUB 4KJOA 1UE7A 5KYIA 1I4GA 3Q0AA 2F3IA 5IGGA 1B3QA 2HIVA 4CKEA 3J80c 1LO5D 1EY9A 1QNKA 3OYYA 3ERQA 3U58A 2K50A 3CCSA 3I4MH 1CA6A 4IJLA 1L1OB 4EQPA 4DUYQ 3HOUH 1H9JA 2K14A 4XQJA 5CGKA 1LM0A 5ELOA 1PLFA 3S24A 5JEAG 3EVQA 1PH6A 2PMZB 4DN4M 4DV3L 3H15A 1L1OA 1PTOD 1UE6A 1PH1A 1Z6HA 2MQHA 4I7AA 4A3DG 2PZTA 4OXPA 3VA7A 1HNXQ 1JICA 2EJMA 2C35B 5CV4A 1H9KA 2N8NA 1KAWA 3H09A 3S9WA 2B8GA 3V96A 1IBKQ 4OO1H 1NE3A 3DWAA 3RNUA 1SMYD 4FVMA 5BN5A 3G48A 3FRPB 3K80C 2JA8B 2YYZA 3QG1A 1EOTA 5I9OA 3NPPA 5LMUL 1PZKD 1CFMA 2SOBA 4A3FH 5DM73 5EQ0A 3TP8A 1RTOA 2LXKA 4IN3A 4K8JA 1VF5C 4YHHQ 3MTSA 3FP9A 5E1FA 4X3UA 2KHJA 2SDFA 4OELB 3QOJA 4DR4Q 3J81E 1Y1VG 2IX3A 4LUVA 3RLOA 5FO8B 3TZDA 4HJ8A 3ERSX 5FK9C 2I46A 1J9OA 3NTKA 2B8FA 3M9BA 5KNDA 3VR2A 4LK1C 5BR8Q 1BVSA 3HKZE 1ASYA 4BBRH 1NR2A 1J5EL 1CQVA 5GQOA 4BY1H 4TQUS 4B3RL 3T13A 3S14H 2NVTB 1EYGA 1AFPA 2ATWA 1SE3A 2K7VA 1VQEA 5C4JB 4DK6C 4JC0A 3TSSA 4HJ9A 4ZUJA 1UEAB 4OWXB 2JXMB 1PH7A 4MHEA 2K28A 2QDBA 4A3IH 1EY0A 2N49A 2L12A 1SBBB 2RA4A 2RCFA 3MXNB 4BA1I 5ELEA 4AYBB 4BA2I 1EY6A 5LHY1 3S17H 4IOAA 3I2ZA 1G8ZD 1RL2A 2KA7A 3G4SA 5J22A 1I4RA 4KY6A 2NVTH 1JE5A 3NP8A 2K4KA 3MXNA 1VQBA 3NENA 2MUYA 1MHWC 3PV0A 2JEAI 1U4RA 3W2DA 1CQFA 4NPSA 2BDOA 3Q24A 4IQZA 1U4LA 1Q90A 4HIMA 1GUWA 3OIPA 1GUNA 1Q1EA 3TEHB 3ONAB 3PO3H 4FYDA 4OIKA 1ET6A 1S4ZA 2UXCQ 1B9NA 4O42A 3S1QB 1EU3A 2AUKA 2EDGA 1EWHA 4OIJA 4JI5L 4PZ8A 3O13A 4XYOA 2RHQB 4GN5A 1XPRA 5KRUA 4H13C 2NN6H 2QW7A 1XNRQ 2JJQA 1D5XC 5FO7B 1STNA 4UPAA 5LMUQ 2DY8A 4G4KA 5C6AA 5C3WA 1RHPA 2UUAL 3NHHA 1F2MA 1IW7C 3LWUA 3S1QH 5GAEC 2B63H 1BF4A 4JCVE 2VQFL 2BH2A 2JA6G 4JI6Q 4QIWB 1CKMA 1Q12A 4B08A 2NYZD 5BN3A 3A7AB 5IOCA 3D6WA 2LSSA 1D5ZC 3CW2C 5A2QE 3BYYB 2MPMA 3Q8DA 5C3EH 2ZM6L 2UXDQ 2F3WA 4P74A 1XYIA 2HD3A 4LF8Q 1IXRA 3G7LA 1XTDA 5FO9B 1STEA 2VY3A 4GOPC 4DV0L 4C3JH 2D0OA 3S1NB 1KL9A 5TSSA 4G7ZC 1CKNB 1SR3A 4A3GG 4A3LG 4GKKL 4C3HH 1RIPA 1SRUA 5LL6S 3HOZB 1E24A 4J1MA 1ET9A 5C3XA 3M4QA 1U0LA 1HR0Q 1N34Q 3SK6A 1VS0A 3SDZA 2CH4A 5DAUA 4MZ9A 4LF4Q 1X3FA 4DV7L 3QB3A 2M2LA 2NVYB 3NTIA 1Q46A 1HA5A 2K6AA 1W6KA 2BA0A 2F4IA 1X3GA 2NZ1D 3A7LA 2F0DA 1AH9A 1MSHA 2QF7A 4EQNA 1A2TA 3KDFB 1BCPD 3OMCA 3BU2A 2VUMG 4OEMB 1D2BA 2UXBL 4DNTB 1YVCA 2K04A 5KIXA 2HQEA 4HJAA 3TP6A 3UDXA 1B50A 2R7ZH 2UUBL 4A93G 3TS2A 5D3DA 5JPMC 2O5JC 2AWNA 3DM3A 5E7NA 3ICEA 2B3GA 1IYVA 1Q7YC 2A74C 2KVMA 4U673 1CK1A 3CCRA 5DEHA 2HUGA 3J81i 1K8AC 3NWSA 1PTOF 1CI3M 2ZJQA 4JI5Q 2IWHA 3UE0A 5L37A 1B4OA 1HTLD 2TSSA 4K0KL 2EYLA 2VXWA 1ENCA 1GUTA 4GN4B 3E9HA 4HSPA 2FINB 1UAPA 2BA1A 3CCVA 1WOCA 2R92B 3FPPA 4YWKA 3R93A 1EQTA 1G291 2E2DC 5C4HA 4WFN3 5E4XA 2EY6A 1IBLL 5C0XH 5EAYA 1Q3LA 4JI7L 3S1MB 4FP5D 4K14A 1S5BD 2K32A 1EQQA 1L2FA 2ALYB 2RKSA 1F77A 1LTRD 3ND9A 1X54A 1M1KC 2QEXA 1GOZA 1NTGA 1SE8A 3BYTB 3H0GB 5C44H 3C3LA 2R92H 2C9OA 1YHBA 2K03A 2KECA 3PIPA 5M5WB 1VQLA 4BY7B 1FNUA 4DPGA 4DV1L 5GAHC 4LF5Q 5IYBH 3CCMA 1TWGH 2CVRA 2EXDA 1DOKA 5FLXL 4DV0Q 1WD1A 1X55A 3HOWB 3FHWA 3A54A 4EVOA 2F0LA 1R9TH 3BG3A 1F9PA 1EU4A 4X6AH 2DN8A 1TR5A 4K5WA 1A3UA 4P72A 1D7QA 3E5SA 3DLLA 3STBD 4LW1A 5J1ZA 2E76C 3HP3A 4BY7H 2Z4HA 1OTCA 4A3KB 4NDXA 4U68A 1SMXA 3H6MA 3MZ5A 3BS1A 2K5VA 1Y14B 2L1BA 4J8QA 3C1EA 4R4TA 4KHVA 5J3BA 1BDOA 4A3MB 2B2YC 3A8IE 3T16A 2O4XA 1V9PA 3R2IA 3F2CA 1UUPA 3GP7A 2WFWA 2ZJPA 4QGUA 3D4WA 1GHKA 2JA8G 2EQSA 3GTOB 3RLFA 1NAPA 4FXKC 1I94L 1TKWB 3X3MA 5IP7G 4NXMQ 1K73C 1EFWA 1DM0B 4R8IA 4A3KH 4R8NA 4JBKA 4NB3A 2EY1A 2G5DA 3D3RA 2FFKB 3K81C 1HR0W 5IWAQ 3UDIA 4IFDG 3OOCA 4GN3B 3E9IA 1XMQL 1NCVA 3H94A 2WAQB 2QCPX 3GTOH 4DK3C 1EQRA 1L0XB 3PUXA 4ALPA 3M7NA 1EYCA 3CCQA 1LTLA 1TWAB 2H5XA 1QE6A 3AFPA 1E3PA 3A8JE 2R7DA 1PFMA 4LMQD 1PYBA 1X3QA 1YNJD 4K0KQ 3DUZA 3SE0A 2ICEC 4YCVA 5HY6A 1W3SA 3IRBA 4CBVA 3JAMc 2UUCL 3LGJA 1TWCH 4JBWA 4DU9A 1II3A 2RQXA 2ZTEA 1QOHA 3KF8B 1CZWA 4ZYSA 1EY5A 1V1QA 1TWAH 4RGNA 4TRDA 1IBLQ 1HZCA 1WI5A 1LT6D 4JI7Q 4UP9A 4KI0A 1JOKA 1AE2A 4AYBG 1YIJA 2Z6KA 3BZKA 3KF8A 2E2HH 5IGEA 5E4WC 3RZDB 2EOTA 4GOPB 4RA8A 2HDLA 4A4IA 4ODGA 2Q8RE 1G51A 3GTMB 1IYJB 4DNIA 5T1GA 3W5OA 1KNEA 3AQQA 4K6DA 4GOPA 3KJPA 4DUYL 1NR4A 1QG7A 1ZYRC 1MGSA 4UAIA 2A68C 2NVXH 3I72A 3KBXA 3BZDB 3J7AV 2NN6G 5M5XB 3V2TA 1AEXA 2SNMA 1Q81C 2FJ2A 1I50B 1E1TA 4HMJA 1HNXL 4MNOA 2F52A 1QNUA 4A3BB 1CHPD 1SYCA 2L4NA 3CMAA 2NBFA 4UDUC 3URYA 1WFQA 1LACA 4LFBQ 2CCZA 1ICFB 1PRTC 2CFMA 3PUWA 5M5XH 3PF5A 4HSVA 5I2XA 1XJVA 1BCPF 1FNWA 4S3SA 4RMFA 1EFID 1I50H 1TY2A 1NMFA 2IPKD 4YHHL 1QVFA 1Y1WH 3QO2A 1C9OA 2F0KA 4KN4C 2A1AA 1SFOH 1WTVA 2OTLA 3HRZC 4DR4L 2FMMA 4IUTA 5CV8A 5CR3A 2A6HC 1HNZQ 1IBML 3J81L 4BWGB 2FMCA 1JJCB 1OXVA 1MI2A 4A3CG 2JK8A 3MEHA 1RCVD 1OXSC 1S5ED 2RDGA 2F0VA 4Q0FA 2F0GA 1H9MA 1DZ1A 3CCUA 3GDEA 4R1JA 1BNZA 4X66Q 3K0XA 3BZCA 1PZJD 2F0OA 3FDTA 2KBNA 3I73A 4DGZA 5BR8L 3PUYA 3D4DA 1MD2D 3W1BA 4OONA 3N52A 3H3VI 1ENAA 1GD7A 2YTXA 2K75A 1F9SA 1O80A 1XPOA 1YITA 4GLAC 1XMOL 2EIFA 5ISRA 4R4OA 2UUCQ 2E75C 2XRQD 1XTCD 3HOZG 2GVAA 3BDCA 1YHQA 3KLSX 4CKBA 1WVLA 3WDNA 1RTNA 5CV5A 3I4MB 1DONA 4L63B 3IKJA 4DR5Q 1KDAA 4I7ZC 1KNAA 1LV9A 1A15A 3HOVH 2A69C 1EEID 1JWMD 4AQYQ 2ES2A 1P8LA 4ZQ3A 4APVA 3VR6A 3M7GA 2KHSA 2K1BA 3I7FA 1M8AA 4R4IA 1P16A 4ZAIA 1HUMA 2VB2X 3DMUA 3SEBA 1LTSD 2OT2A 4CDEC 5CV9A 2L0CA 3BVGA 3DHQA 1CKOA 1GUGA 3M3YB 4DV2Q 1UNSA 1GJXA 1SN8A 1EIFA 1F9QA 4KTAA 4KKTA 1B7YB 2ZXPA 4R4CA 2AQ3B 2XSCA 4BXXH 1EZ6A 1C48A 1HHVA 1S5FD 4DA2A 4A3FB 1TXYA 3I4NH 4KD3A 1N32Q 3I3CA 1QILA 2UXCL 1T9HA 4RCNA 4FO2A 4OX9L 1B53A 3I56A 4ME3A 1QWYA 1AZPA 3M3YH 4OL7A 2IL8A 4DUZQ 2R7FA 4F8MA 3QOLA 2B2YA 5IYDH 2L55A 4GLXA 2K5QA 1XNRL 1NBWA 1WCMB 3LX0A 4ID6A 2WKDA 1SMYC 4J15A 4K2KA 4JI1Q 1UEBA 2R92G 3GTLH 3X3NA 2RDFA 1KRSA 1Q82C 2MGSA 3GV3A 1EEFD 4PZ6A 4JI6L 1KHIA 4BBRB 1K8OA 1X32A 3U4ZA 3SK5A 4EX5A 4WJ3M 3F8TA 4BY1B 1IBMQ 3K5LA 1E2VA 1KTKA 2YU9H 2PMZE 3S14B 1SNOA 3Q23A 1WCMH 2VL6A 3T56B 1Z7TA 2UXDL 2Q2HA 1I6VC 3EA6A 4JPBW 5A2QL 4QUFA 3H0GG 3NEMA 4JV5Q 4LF8L 1BO0A 3U9OA 1VQOA 4BY7G 4K5VA 5DNFA 5KEEA 3DEOA 3S15H 1Y69U 4A3IB 2M9VA 1YEZA 1WTRA 3S17B 4P2CB 3BDOA 4IUUA 4NP5A 1NJIC 4K2LA 5K36H 4MIUA 2JN4A 3HOWG 3KK7A 1XMOQ 1S5CD 5M9OA 4C1NI 1QVCA 2B29A 3NQIA 1YNNC 3NK9A 1BOSA 3C46A 1HR0L 1HNWL 1N34L 3MWYW 4M8AA 4LF4L 2K01A 2I5LX 3G6JB 3GTJH 2VB3X 4A75A 3NXWA 4A3KG 1K28A 1E2WA 2F0TA 4X62Q 1QZHA 3HOYH 1AE3A 4AIMA 1PH3A 1JB3A 4A3MG 1VQKA 4G7HC 1PXUA 3A5ZB 4ZKCB 3PO3B 4XQNA 1ASZA 3J7A5 3VYTA 3S2HH 1GXDC 2LFNA 2AWOA 1EYAA 3MHBA 1QVGA 1WTXA 3UDFA 2Q2IA 1LUZA 2XIWA 3E0JA 1VQ9A 1N36Q 4DXFA 5I2YA 3PO2B 4ME5A 3KLRA 2F0JA 3AB9A 3F2DA 2WAQG 2JA7B 1PRTB 3K7UC 4FDBA 1O7YA 4KJNA 4F87A 2B63B 1FVIA 4ZRZA 4IJHA 4OX9Q 3GTGB 3PIO3 4AYBE 4CHTB 4CGYB 3GTKH 1GUSA 1I3QB 2BE5C 2K5DA 3T53B 4CJ2C 2ZT9C 1DOMA 3M4YA 4B9XA 2PI2E 1V1OA 3RZOH 1L0YB 1B1ZA 3PO2H 1PH5A 1QJOA 4PMCA 4Y52H 3J80E 2RHSB 1RDPD 2WB1B 2G9DA 4DV5Q 5C3EB 3E0EA 2JA7H 3RR5A 2MNAA 2E5LL 1CSQA 1WJJA 3OPOA 5JOBA 2AKWB 3EFXD 4DV6Q 3GTGH 1LYLA 2X6LA 3OW7A 1I3QH 3RUZA 2A5HA 3L9AX 1RD9D 2SNSA 4C3JB 2K52A 4LWCA 1I6HH 2Z6KC 4IO9A 1B2TA 1IW7D 1PMRA 1X3PA 3F1ZA 4C3HB 1E22A 5HURA 1DOLA 2PCFB 4P71A 5AFWA 3G6EA 2UU9Q 4YWLA 1CTMA 1L0WA 4DAPA 1PV4A 1C0AA 1VQJA 2OF1A 4O0AA 4QMGA 4MN3A 4LF5L 3CXCA 2HT1A 2G9HD 3K57A 4P73A 4F7XA 1EWCA 3BDLA 3E3XA 4RKBA 5IGDA 2GA4B 4DAMA 1A6XA 2F0PA 1TT2A 2RF4A 1HFNA 2F0IA 3Q22A 3SGIA 3W3AA 1A63A 2HCIA 4QB4A 5E3FA 5FJ8G 2KCTA 4WORA 1Y8NB 1U9RA 4X3TA 1R4QB 1JOOA 3HOXH 2KCNA 2NVQB 3MAQA 4B3SQ 1D8LA 3HFZB 4POGA 1JE4A 1HNWQ 3C2PA 2PQEA 2F0HA 1VQ7A 2R7ZB 4QIWE 4RWSC 5COYA 4L5RC 2D2CC 2ZTDA 3WOEA 2QDLA 3MEFA 2KQ3A 5EKIA 4A3BG 2PW7A 3VR3A 5IIFA 3D8GA 4GS3A 5IT9c 4N9PA 4IUNA 1F2ZA 4P75A 2YTVA 4H44C 2NVQH 4CKCA 4NXML 3SXHA 1HXYD 2Z0SA 5JAVA 4XT3B 1YHAA 2CHBD 4QUCA 4A3JH 3M85A 5IWAL 4ZLTF 3FKIB 2MO1A 2Y0SE 3OTOQ 4GZYC 2IT1A 1PTOB 3CQZH 1BUVT 1X65A 3J7ZC 2L9HA 4IFDJ 2CKZB 5M3MB 3AEVA 4JYAQ 5LL6X 5I6WA 4RFBA 3CF5A 1I94Q 5EBCA 4R9WA 5FLMG 1SJED 5D14A 3MA2B 1M90C 1VQAA 1XNQQ 2Z6BA 1GVPA 1Q8KA 2H4OA 3FKIH 2IJ0A 4HCEA 4C3IB 4DR1Q 2KJXA 1PTOH 4I65A 1YI2A 2DY7A 3PGZA 5C44B 1STYA 4RAUC 1H9RA 2LS01 1X6OA 3S16H 4QQBX 1PHJA 4PMBA 1JQYD 2E5LQ 5M3MH 2HCCA 3CU7A 1VDZA 3NBIA 5C4ZA 2EYMA 5FLXc 4MTNA 1TWGB 1VQGA 1C7YA 1LT3D 3I4MG 1PZID 1PVOA 1FYCA 5JEAH 3Q6SA 1ILPA 3HOUG 1R9TB 3I70A 4OWWB 4C3IH 1U4PA 2IX0A 1N9WA 2WACA 4IPGA 1K0RA 2YTYA 1SE4A 4A3DH 4KLKA 1IHZA 2Q8TA 1Y8PB 1WTPA 2EPBA 2QILA 1LTAD 4A3EB 2JEBI 4X3KA 5KNCA 1IL8A 2DNCA 1TWFH 2CWAA 1ESFA 4OO1G 4DV4L 1G6PA 3CRKC 1TU2B 4HTHA 5IYDG 4V0BA 1HRJA 3T4AC 1FJGL 2EYPA 4DR2Q 1EY7A 1UE5A 2HHHL 5IGBA 4X64Q 3OSOA 3CKIB 4A3FG 3U50C 2DGYA 4A3EH 1BBUA 2DNEA 4K5XA 1S40A 1STHA 1DGSA 1Y1VH 4HEDA 4ILWA 5KNBA 4C1NK 3MFYA 2JA5B 2EJGC 4LFBL 2PNRC 3K0YA 2B2WC 3TBIB 4KMUC 2IW3A 2QGQA 4JG2A 1W6JA 1DCZA 3MFGA 5CC4A 2OQKA 3K59A 2EYFA 1WCMG 4JBMA 4N8X1 1GM5A 4JOIA 3L3OC 1RJTA 2A6ED 3D0FA 4RG1A 1M4VA 3J80i 2EYHA 4LFCL 3GQBA 4KD4A 1FGBD 1JJ2A 3A8KE 3SK8A 1HUNA 1HNZL 2KEDA 1F9RA 4BBRG 2JA5H 1UWVA 4OWTB 3EROA 4BY1G 2R93B 2A19A 2VW9A 4Q5VA 1VMPA 4NW2A 3CCJA 1KQSA 4TKOB 1TWCB 2M00A 5IY0A 4HJ5A 2D5DA 5I4DA 3KFUA 3K8AA 4X66L 3F2UA 1EIGA 1S5DD 3TZUA 4JI8Q 4RHSA 3QR8A 1WTHA 2B2TA 4FF3A 2XRSD 3EQLC 5D3IB 4A3IG 5T1IA 1SEBD 1JR0D 4PZ7A 4C2MH 4FXGC 1J6QA 2O5IC 4XQQA 3VYUA 2E2HB 1S3OA 2R93H 3PIOA 1LT4D 5IT9E 2OXPA 2XTIA 3NE5B 3GV6A 4H0LC 4OO1I 1MKHA 1A3VA 4FNFA 4CJ1B 4IUPA 4UHVA 1Q8IA 2MJ8A 3HGBA 4JBJA 2AMCB 4DR5L 4RGOS 1JJGA 1JMCA 1LTBD 4AQYL 1EY4A 3NWTA 2NVXB 2E2IH 4ZKBB 1AP0A 1I4HA 5IODA 3ITPA 4DR6Q 1SNPA 3PO3G 1TQOA 3NSWA 2B2UC 1ENFA 3KF6B 3K58A 1SNCA 4DV2L 2WKCA 4YWMA 3OWFA 1U4MA 2FHTA 3CMEA 4DV4Q 3T1YQ 3KBGA 3BVZA 3L7ZC 1GHJA 5M3FB 3KF6A 3PO2G 2I0QA 1FJGQ 1YZ6A 4IFDI 4HIOA 3OW2A 2HHHQ 1N32L 4B3MQ 1SYFA 4ZK9B 3A56A 2I5HA 2JA7G 2JA6H 2AHOB 1Y1WB 2PQAB 3I4OA 2B63G 1SFOB 2F0FA 1MJEA 4DUZL 1EY8A 1IYUA 3KJOA 3A74A 1HZBA 1H9SB 1V8QA 4X65Q 1N33Q 3H3VC 4KK7A 3RN5A 3J7AF 1DYQA 4YCWA 5C0XJ 5CV6A 2GN5A 1PFNA 4HMIA 5M3FH 1OXXK 4JK1C 4WRDA 4JI1L 2H1EA 3BVMA 3RLNA 5ELBA 2KUMA 2PQAA 3BJUA 2Q8IB 4UY8C 2WB1G 1VQ8A 3J81j 4HJ7A 2VQEQ 3GD7A 5C3EG 1H9SA 1KDBA 1RODA 2C5CA 4LFCQ 2EE1A 2YV5A 1Q86C 3DWPA 3TP5A 1YJWA 4A3GH 1HZAA 4Y7NH 1KIXA 4C3JG 2F3VA 2V1CC 4JW0A 4V190 5J39A 4C3HG 1RF2D 4JI3Q 2Z4IA 4LF6L 1G6ZA 1SDFA 1LABA 4JV5L 2PNHA 2PZUA 1PA6A 3HS0C 4HCSA 2JA9A 2WV6D 5AJ3L 2QEJC 1VQPA 3HOVB 4M1UB 4JI2Q 3S1RH 1CHQD 2FXQA 3I4LA 5I6YA 3LWEA 1G91A 4LUOA 2VUMH 3HZXA 1GO3E 4DNRB 1SXTA 3KUPA 1K0SA 4O2DA 2WINB 3SVMA 1Q1BA 1LTID 1IKMA 5HGQA 2NN6I 4YIJA 1ILQA 4A93H 4GLVB 4GKJQ 1PYWD 4X62L 3TREA 2R7ZG 1EIHA 5M5YH 2AUJD 3ULLA 2ZXRA 4E6IA 3FPUB 1QCBD 1PH9A 1KLUD 2F0MA 1KC8C 1TS5A 1HTPA 2JYOA 2NZHA 4CJ0B 3K7AH 1F2YA 1HQRD 2ZTCA 2CW0D 2LY7A 2LMCB 4QF4A 4LF7L 3I4NB 3CC4A 4DF7A 1KRTA 2CQOA 3WWVA 1VQIA 1HQMC 5JJLA 1PYSB 3H91A 5IP9H 1WTOA 4ZUIA 1D1KA 1N36L 4H7BA 4POFA 3S2DH 1HA6A 1VQ4A 3FKIG 1KAAA 3JAME 1OO9B 1SE2A 4UP8A 2E2JH 1KXLA 3KOJA 2PO4A 4UP7A 1VQ6A 3FVQA 4QL5A 2OWOA 2BCOA 3GTLB 1K9MC 1HJPA 1A2UA 1TWHH 5M3MG 5C0XG 1PTOC 3DM1A 4O1NA 4ULLA 4XYQA 1JORA 1Y8OB 4DR3Q 1BXTA 1BBXC 2B2WA 2YU9B 1B44D 2SEBD 4C3IG 2K33A 3QWNA 4DV5L 3J80L 1DD2A 5C44G 3D31A 1ZXTA 4HN7A 2LXJA 1AZQA 4CDCC 4DV6L 3S15B 4DKAC 3VYSA 5IYBG 5IGFA 1VQCA 2F0QA 3HKZB 4B3TQ 4PMWA 4LF9L 2P5ZX 4FF2A 1E2ZA 1IZ6A 1NMGA 1K3RA 5EKKA 4CDDC 5DLQE 1SYGA 3SK4A 2UU9L 2JSOA 2NZOA 3TMEA 3VR4A 5JJZA 1EIYB 1NNXA 4LF6Q 4L8JA 4RKLA 4DR7L 4QCLA 1XWEA 3GTJB 1MSGA 5AJ3Q 4A3EG 1VQFA 3A0JA 5LMNQ 3HOYB 3PIP3 4WJWA 3AFQA 2JA8H 4DXGA 3CPWA 5C5MA 1O7ZA 3I91A 5IE8A 4DAVA 3HEJA 1BR9A 4B3SL 2IHEA 1TIID 5IP7H 1EL0A 5IYCH 4GNXC 1HFGA 4JI0Q 3S2HB 3P20A 4JI4Q 1TS2A 1F2LA 1JC7A 2B2VA 4IFDH 2F4VQ 5C0XI 3MC0B 3T1HQ 1YNND 3OMGA 1A8VA 2F0SA 2JA5G 4G7OC 4ZCKA 4HIDA 4LF7Q 3CCLA 5CYUA 4PQXA 2MO0A 4JOIC 2B2UA 3EJIA 2KCMA 1B70B 2PW5A 3IL8A 3GTKB 1MJCA 4LJZC 1FR3A 2F0NA 1PH2A 3OWEB 5GAGC 5C4XB 1C8CA 3RZOB 3OTOL 2OQ0A 3M4OB 1YJNA 4RCOA 4RGMA 2IHFA 2R93G 5D65A 5C4JH 5JJIA 5JPNC 2KOLA 4JYAL 2PI2A 4KHZA 4CDFC 4J6HA 1CZGA
chains in the Genus database with same CATH topology
3PGZA 3PUZA 4UP9A 1X6OA 3S16H 4QQBX 2ZJRA 2WP8J 1PHJA 4KI0A 4AYBG 1AE2A 1XNQL 2GVBA 1YIJA 5C4XH 4DR1L 3OYYA 2Z6KA 3BZKA 2E5LQ 5M3MH 3U58A 2K50A 2E2HH 3M4OH 2IY5B 3CCSA 3I4MH 4IJLA 5FLXc 4MTNA 4GOPB 1VQGA 1L1OB 1C7YA 3I4MG 4KHPL 4DV3Q 4DUYQ 3HOUH 4A4IA 4TVAB 1PVOA 2K14A 3EN2A 3H3VH 1LM0A 5ELOA 3S24A 3HOUG 1G51A 4OWWB 4C3IH 5JEAG 1IYJB 2IX0A 1PH6A 1N9WA 4DNIA 4IPGA 1K0RA 3W5OA 1CSPA 2YTYA 3AQQA 2HQLA 4DV3L 3KJPA 4KLKA 4DUYL 4GOPA 3H15A 1L1OA 4A3DH 1UE6A 5JJKA 4LUZA 2MQHA 1PH1A 4LF9Q 4A3DG 3B6YA 4OXPA 1HNXQ 2NVXH 3G71A 2JEBI 2C35B 2NN6G 2N8NA 1KAWA 1VQ5A 3GTQH 3PUVA 1IBKQ 1Q81C 1NE3A 1TWFH 2CWAA 5ELNA 3RNUA 1PH8A 4OO1G 1E1TA 4DV4L 1BBWA 3G48A 1HNXL 3K80C 1G6PA 2RCNA 4MNOA 5IYDG 2D62A 2F52A 2YYZA 3ZJYC 4DR7Q 4A76A 1YBYA 1FJGL 5LMUL 4DR2Q 1X56A 1UE5A 2HHHL 4A3FH 2JQOA 1I5FA 4X64Q 3CMAA 1WFQA 4A3FG 1UE1A 3U50C 1WYDA 2LXKA 2DGYA 4YHHQ 4LFBQ 2CCZA 3KLWA 2CFMA 3FP9A 5GADC 4A3EH 1BBUA 1FGUA 3PUWA 4L5QA 4DR2L 2WB1E 5M5XH 3PF5A 2KHJA 1S40A 1X3EA 1XJVA 1DGSA 1Y1VH 5M3FG 4X64L 4DR4Q 4BBSH 4RMFA 1I50H 1Y1VG 4YHHL 1NMFA 1QVFA 4LFBL 4WJ3M 1EOVA 4LUVA 1Y1WH 1C9OA 2QGQA 4JG2A 2OQKA 3RLOA 3JAMi 4H02A 3CD6A 1Y1WG 2A1AA 1SFOH 4HJ8A 2OTLA 1KD1C 4DR4L 1WCMG 3ERSX 4JBMA 4QJFA 1J5EQ 2VS1A 1NY4A 1GM5A 1HNZQ 4JOIA 1IBML 4A3CH 3M9BA 4B3RQ 3D0FA 1JJCB 1OXVA 4RG1A 3CAMA 2XGTA 2JK8A 4A3CG 3J80i 3ULJA 4LFCL 5BR8Q 2K5NA 1BVSA 1OXSC 3HKZE 1EWIA 3NELA 5LMNW 1JJ2A 1ASYA 4BBRH 4HIKA 1J5EL 5GQOA 3GDEA 3CCUA 4R1JA 1HNZL 4TQUS 4X66Q 4BY1H 3K0XA 3BZCA 4BBRG 4B3RL 2JA5H 1UWVA 4OWTB 2KBNA 4BY1G 4L5SA 4NXNL 5BR8L 2A19A 1CKNA 3PUYA 2VW9A 3S14H 1EYGA 3W1BA 3CCJA 1KQSA 4OONA 2ATWA 5IY0A 1GD7A 4HJ5A 3H3VI 3KFUA 3TRZA 1VQEA 3K8AA 2YTXA 4X66L 2K75A 4PG3A 4DK6C 4JC0A 1XPOA 3S1NH 4HJ9A 4DAYB 1YITA 4GLAC 1XMOL 1PH7A 2EIFA 4OWXB 4JI8Q 4R4OA 1XPUA 3CC7A 4A3IH 2N49A 3U4VA 2UUCQ 4BA2I 3MXNB 4BA1I 3HOZH 1N8RC 3S17H 4A3IG 4IOAA 2E8GA 4PZ7A 4C2MH 3HOZG 2GVAA 1YHQA 1J6QA 3I2ZA 1S3OA 1K8GA 1H95A 1RL2A 4JI8L 3G4SA 2R93H 3PIOA 2NVYH 2XTIA 2NVTH 1V43A 4DR5Q 1JE5A 4OO1I 1MKHA 3KDFA 1Z9FA 3A5UA 3HOVH 2K4KA 4AQYQ 2ES2A 1VQBA 1P8LA 3NENA 4APVA 1JB7A 3HOVG 3KYHC 3I7FA 3PV0A 4JBJA 2AMCB 4DR5L 4R4IA 2JEAI 1JJGA 1JMCA 1FL0A 1P16A 4NPSA 4KHPQ 4AQYL 2N3SA 4HIMA 2E2IH 1QUQB 3RN2A 1Q1EA 1CKOA 4DR6Q 4DV2Q 1YJ9A 3TEHB 2Q2TA 3PO3H 5IP9G 1SN8A 1EIFA 3PO3G 2UXCQ 1B7YB 4R4CA 3TQYA 3KF6B 2QA4A 4JI5L 4PZ8A 4DR6L 4DV2L 4BXXH 1QUQA 2RHQB 4GN5A 1XPRA 1CUKA 1TXYA 4BXXG 3I4NH 1N32Q 4YWMA 2UXCL 1T9HA 2UUAQ 4EQ5A 3CMEA 3I4NG 1Z47A 4DV4Q 3T1YQ 1EUJA 3L7ZC 4OX9L 3I56A 1XNRQ 4ME3A 2JJQA 2VQFQ 3PO2G 3KF6A 4UPAA 3M3YH 2I0QA 1FJGQ 5LMUQ 1YZ6A 4IFDI 4DUZQ 4HIOA 4GNXB 3OW2A 2HHHQ 1N32L 2R7FA 4B3MQ 5IYDH 2UUAL 3EBEA 4GLXA 3T1YL 2I5HA 3S1QH 5GAEC 2JA7G 2B63H 1XNRL 2MFIA 2AHOB 2JA6H 4JCVE 2VQFL 1NBWA 2PQAB 3I4OA 4YY3L 4JI6Q 2B63G 2BH2A 1MJEA 2JA6G 4DUZL 1CKMA 4J15A 1O7IA 4JI1Q 3KJOA 3A74A 1HZBA 1Q12A 1UEBA 2ZM6Q 4B3ML 2R92G 4LFAL 4X65Q 3GTLH 4GNXA 1N33Q 1KRSA 1Q82C 3RN5A 4YCWA 5C0XJ 3PF4A 3S1MH 2GN5A 2LSSA 4PZ6A 5M3FH 1OXXK 3CW2C 4JI6L 4IPDA 1KHIA 3STBC 4JI1L 3RLNA 4A3GH 3Q8DA 2PQAA 3BJUA 3U4ZA 5C3EH 4EX5A 2ZM6L 3F8TA 2WB1G 4X65L 1VQ8A 4UY8C 2I5MX 4P74A 3J81j 2VQEQ 4HJ7A 3GD7A 1N33L 5C3EG 1IBMQ 4LF8Q 2KHIA 4GKKQ 1IXRA 2PMZE 3M4PA 2YU9H 1XTDA 1WCMH 2VL6A 2VY3A 4GOPC 3H0GH 4DV0L 4LFCQ 2YV5A 1L1OC 1Q86C 2UXDL 2Q2HA 1YJWA 3H0GG 4C3JH 4XIGS 5M5WH 1HZAA 3NEMA 2VQEL 2D0OA 1SROA 4Y7NH 4LF8L 4JV5Q 2VNUD 1KIXA 1KL9A 4GKKL 4A3GG 1CKNB 1SR3A 1VQHA 1VQOA 2V1CC 4A3LG 4BY7G 1QZGA 4C3HH 4DV7Q 1VQMA 4NXNQ 3S15H 1RIPA 1SRUA 2D0PA 1E24A 1YEZA 3HKSA 4R4QA 4L5TA 4JI3Q 3HOWH 4LF6L 1NJIC 3HKZG 3M4QA 1U0LA 1HR0Q 2PNHA 1N34Q 4JV5L 1PA6A 1VS0A 3HOWG 4LF4Q 4MZ9A 2JA9A 1X3FA 5H1SE 1XMOQ 4DV7L 5AJ3L 5K36G 1W2BA 1QVCA 1VQPA 1Q46A 2B29A 3EIVA 4JI3L 2R6GA 4JI2Q 2BA0A 2ASBA 2UXBQ 3S1RH 1HH2P 1X3GA 2FXQA 1N34L 1HR0L 3NBHB 3F2BA 1HNWL 4LUOA 4LF4L 1X9NA 5IYCG 1AH9A 2ID0A 2VUMH 1GO3E 2I5LX 3KDFB 3GTJH 4A75A 2UUBQ 3I55A 4O2DA 4A3KG 3BU2A 4X62Q 2VUMG 4JI2L 1Q1BA 1QZHA 4A3MH 1AE3A 3HOYH 2UXBL 4AIMA 1YVCA 5HGQA 2NN6I 1PH3A 4HJAA 3HOYG 4A3MG 4A93H 3UDXA 4GLVB 1VQKA 3GTPH 4GKJQ 2R7ZH 2UUBL 4A93G 3A5ZB 3TS2A 4X62L 3TREA 2BH8A 2R7ZG 3J7A5 1ASZA 5M5YH 2AWNA 3ULLA 3DM3A 5E7NA 3S2HH 3ICEA 2UXDQ 2AWOA 2B3GA 1Q7YC 1PH9A 4GKJL 1QVGA 1KC8C 1MIUA 3UDFA 1BKBA 2Q2IA 2NZHA 3CCRA 4LNQA 3K7AH 1LUZA 2VZAA 2ZTCA 3J81i 4LF7L 3CC4A 1K8AC 1VQ9A 2OCEA 1N36Q 1KRTA 2CQOA 3AYHB 1VQIA 3WWVA 2K5HA 5JJLA 3L0OA 2ZJQA 1PYSB 4JI5Q 2WAQE 5IP9H 3UE0A 2A8VA 4K0KL 3F2DA 3CPFA 2WAQG 2CWPA 3TS0A 1N36L 3K7UC 4POFA 3S2DH 4FDBA 1VQ4A 1FVIA 3FKIG 4IJHA 4GN4B 3E9HA 4OX9Q 4AYBE 4UP8A 2BA1A 2E2JH 3GTKH 3CCVA 1WOCA 1KXLA 4YWKA 3KOJA 1G291 4UP7A 2DUDA 3CC2A 1VQ6A 4QL5A 2PI2E 2OWOA 1U5KA 3RZOH 1IBLL 5EAYA 1K9MC 3PO2H 1SLJA 1PH5A 5C4XG 4JI7L 1HJPA 4Y52H 1TWHH 5M3MG 2RHSB 5C0XG 1EQQA 4YY3Q 4DV5Q 1L2FA 2ALYB 3E0EA 2JA7H 3RR5A 2MNAA 2E5LL 4LFAQ 4DR3Q 1CSQA 1K83H 1WJJA 4DV1Q 3UDGA 4WJ4A 2AKWB 1X54A 1M1KC 4DV6Q 2OTJA 3GTGH 2QEXA 1LYLA 1OXTA 1NTGA 1SE8A 2JE6I 3GO5A 5C44H 4DV5L 1I3QH 2R92H 1YHBA 3J81c 3PIPA 5C44G 2K52A 1VQLA 4LWCA 4DR3L 3D31A 4DPGA 1I6HH 2Z6KC 2LXJA 4IO9A 4DV1L 5GAHC 4LF5Q 5IYBH 3CCMA 3RZDH 3F1ZA 4DV6L 1E22A 1TWGH 4P71A 4DKAC 3G6EA 2UU9Q 5IYBG 1VQCA 2EXDA 2HIXA 1A0IA 4B3TQ 4DV0Q 4PMWA 4YWLA 4LF9L 1X55A 1L0WA 1PV4A 1C0AA 1VQJA 3FHWA 1VQNA 4O0AA 5JEAJ 1R9TH 1IZ6A 1NMGA 1B8AA 4LF5L 2Q2UA 3CXCA 2HT1A 3GTMH 1K3RA 4X6AH 4P73A 4IPHA 5DLQE 4P72A 2UU9L 3VDYA 1D7QA 1S72A 1IBKL 3PCOB 2NZOA 4DAMA 4B3TL 3DLLA 3STBD 4LW1A 1JT8A 1E7ZA 1EIYB 5FJ8H 2RF4A 3ER0A 4LF6Q 4A3LH 4BY7H 3SGIA 1HZ9A 2N78A 1A63A 1OTCA 4DR7L 5FJ8G 4AH6A 2KCTA 1GKHA 1SMXA 5AJ3Q 3HOXH 1VQFA 2K5VA 1Y14B 4A3EG 3A0JA 5LMNQ 4IPCA 4R4TA 5J3BA 4B3SQ 1D8LA 3HOXG 3HFZB 4POGA 1V9PA 3F2CA 4BBSG 1HNWQ 3AFQA 2JA8H 3CPWA 2WFWA 2ZJPA 4QGUA 5IE8A 1VQ7A 2JA8G 4QIWE 2EQSA 5LMNL 4L5RC 4A3BH 3CCEA 2ZTDA 4B3SL 2IHEA 5IP7H 4QY7A 3RLFA 3L2PA 3MEFA 2IX1A 3PSIA 5IYCH 4GNXC 4A3BG 4JI0Q 5IP7G 4NXMQ 1K73C 1EFWA 1YNXA 5GROA 3JC66 4A3KH 4JBKA 4GS3A 4NB3A 4JI4Q 5IT9c 1XMQQ 4P75A 2YTVA 4IOCA 1PH4A 2NVQH 1A62A 2F4VQ 5C0XI 3K81C 3T1HQ 1HR0W 4JI0L 5IWAQ 4NXML 3UDIA 4IFDG 1A8VA 4GN3B 3E9IA 3W1GA 2JA5G 4JI4L 1XMQL 1OXUA 2Z0SA 3GTOH 2KENA 4DK3C 1YHAA 1EQRA 3PUXA 4HIDA 2F4VL 1VCIA 4A3JH 3T1HL 4LF7Q 3M85A 5IWAL 4ALPA 3CCLA 2MO0A 4JOIC 3M7NA 2MO1A 2Y0SE 1LTLA 2H5XA 3OTOQ 3CCQA 2KCMA 4A3JG 1B70B 2IT1A 3AFPA 1E3PA 4XTCS 3CQZH 2R7DA 1X65A 2Y0SG 1MJCA 1PFSA 1PYBA 4YCUA 1PH2A 3J7ZC 3UE1A 5GAGC 3ULPA 1VQDA 4K0KQ 4IFDJ 2CKZB 2L15A 2OQ0A 4YCVA 3OTOL 1YJNA 5HY6A 3AEVA 1W3SA 1E1OA 3IRBA 4JYAQ 5FLMH 3JAMc 3CP0A 3LGJA 2UUCL 2IHFA 3CF5A 1I94Q 1TWCH 4JBWA 2R93G 5FLMG 1IL2A 1UE7A 1M90C 1VQAA 5C4JH 2ZTEA 3KF8B 5JJIA 1XNQQ 1GVPA 1Q8KA 4DR1Q 2F3IA 3FKIH 1V1QA 2HIVA 4JYAL 1TWAH 2PI2A 4KHZA 1IBLQ 1HZCA 1WI5A 3J80c 1YI2A 4JI7Q 1I94L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGZ A;  3PUZ A;  4UP9 A;  1X6O A;  3S16 H;  4QQB X;  2ZJR A;  2WP8 J;  1PHJ A;  4KI0 A;  4AYB G;  1AE2 A;  1XNQ L;  2GVB A;  1YIJ A;  5C4X H;  4DR1 L;  3OYY A;  2Z6K A;  3BZK A;  2E5L Q;  5M3M H;  3U58 A;  2K50 A;  2E2H H;  3M4O H;  2IY5 B;  3CCS A;  3I4M H;  4IJL A;  5FLX c;  4MTN A;  4GOP B;  1VQG A;  1L1O B;  1C7Y A;  3I4M G;  4KHP L;  4DV3 Q;  4DUY Q;  3HOU H;  4A4I A;  4TVA B;  1PVO A;  2K14 A;  3EN2 A;  3H3V H;  1LM0 A;  5ELO A;  3S24 A;  3HOU G;  1G51 A;  4OWW B;  4C3I H;  5JEA G;  1IYJ B;  2IX0 A;  1PH6 A;  1N9W A;  4DNI A;  4IPG A;  1K0R A;  3W5O A;  1CSP A;  2YTY A;  3AQQ A;  2HQL A;  4DV3 L;  3KJP A;  4KLK A;  4DUY L;  4GOP A;  3H15 A;  1L1O A;  4A3D H;  1UE6 A;  5JJK A;  4LUZ A;  2MQH A;  1PH1 A;  4LF9 Q;  4A3D G;  3B6Y A;  4OXP A;  1HNX Q;  2NVX H;  3G71 A;  2JEB I;  2C35 B;  2NN6 G;  2N8N A;  1KAW A;  1VQ5 A;  3GTQ H;  3PUV A;  1IBK Q;  1Q81 C;  1NE3 A;  1TWF H;  2CWA A;  5ELN A;  3RNU A;  1PH8 A;  4OO1 G;  1E1T A;  4DV4 L;  1BBW A;  3G48 A;  1HNX L;  3K80 C;  1G6P A;  2RCN A;  4MNO A;  5IYD G;  2D62 A;  2F52 A;  2YYZ A;  3ZJY C;  4DR7 Q;  4A76 A;  1YBY A;  1FJG L;  5LMU L;  4DR2 Q;  1X56 A;  1UE5 A;  2HHH L;  4A3F H;  2JQO A;  1I5F A;  4X64 Q;  3CMA A;  1WFQ A;  4A3F G;  1UE1 A;  3U50 C;  1WYD A;  2LXK A;  2DGY A;  4YHH Q;  4LFB Q;  2CCZ A;  3KLW A;  2CFM A;  3FP9 A;  5GAD C;  4A3E H;  1BBU A;  1FGU A;  3PUW A;  4L5Q A;  4DR2 L;  2WB1 E;  5M5X H;  3PF5 A;  2KHJ A;  1S40 A;  1X3E A;  1XJV A;  1DGS A;  1Y1V H;  5M3F G;  4X64 L;  4DR4 Q;  4BBS H;  4RMF A;  1I50 H;  1Y1V G;  4YHH L;  1NMF A;  1QVF A;  4LFB L;  4WJ3 M;  1EOV A;  4LUV A;  1Y1W H;  1C9O A;  2QGQ A;  4JG2 A;  2OQK A;  3RLO A;  3JAM i;  4H02 A;  3CD6 A;  1Y1W G;  2A1A A;  1SFO H;  4HJ8 A;  2OTL A;  1KD1 C;  4DR4 L;  1WCM G;  3ERS X;  4JBM A;  4QJF A;  1J5E Q;  2VS1 A;  1NY4 A;  1GM5 A;  1HNZ Q;  4JOI A;  1IBM L;  4A3C H;  3M9B A;  4B3R Q;  3D0F A;  1JJC B;  1OXV A;  4RG1 A;  3CAM A;  2XGT A;  2JK8 A;  4A3C G;  3J80 i;  3ULJ A;  4LFC L;  5BR8 Q;  2K5N A;  1BVS A;  1OXS C;  3HKZ E;  1EWI A;  3NEL A;  5LMN W;  1JJ2 A;  1ASY A;  4BBR H;  4HIK A;  1J5E L;  5GQO A;  3GDE A;  3CCU A;  4R1J A;  1HNZ L;  4TQU S;  4X66 Q;  4BY1 H;  3K0X A;  3BZC A;  4BBR G;  4B3R L;  2JA5 H;  1UWV A;  4OWT B;  2KBN A;  4BY1 G;  4L5S A;  4NXN L;  5BR8 L;  2A19 A;  1CKN A;  3PUY A;  2VW9 A;  3S14 H;  1EYG A;  3W1B A;  3CCJ A;  1KQS A;  4OON A;  2ATW A;  5IY0 A;  1GD7 A;  4HJ5 A;  3H3V I;  3KFU A;  3TRZ A;  1VQE A;  3K8A A;  2YTX A;  4X66 L;  2K75 A;  4PG3 A;  4DK6 C;  4JC0 A;  1XPO A;  3S1N H;  4HJ9 A;  4DAY B;  1YIT A;  4GLA C;  1XMO L;  1PH7 A;  2EIF A;  4OWX B;  4JI8 Q;  4R4O A;  1XPU A;  3CC7 A;  4A3I H;  2N49 A;  3U4V A;  2UUC Q;  4BA2 I;  3MXN B;  4BA1 I;  3HOZ H;  1N8R C;  3S17 H;  4A3I G;  4IOA A;  2E8G A;  4PZ7 A;  4C2M H;  3HOZ G;  2GVA A;  1YHQ A;  1J6Q A;  3I2Z A;  1S3O A;  1K8G A;  1H95 A;  1RL2 A;  4JI8 L;  3G4S A;  2R93 H;  3PIO A;  2NVY H;  2XTI A;  2NVT H;  1V43 A;  4DR5 Q;  1JE5 A;  4OO1 I;  1MKH A;  3KDF A;  1Z9F A;  3A5U A;  3HOV H;  2K4K A;  4AQY Q;  2ES2 A;  1VQB A;  1P8L A;  3NEN A;  4APV A;  1JB7 A;  3HOV G;  3KYH C;  3I7F A;  3PV0 A;  4JBJ A;  2AMC B;  4DR5 L;  4R4I A;  2JEA I;  1JJG A;  1JMC A;  1FL0 A;  1P16 A;  4NPS A;  4KHP Q;  4AQY L;  2N3S A;  4HIM A;  2E2I H;  1QUQ B;  3RN2 A;  1Q1E A;  1CKO A;  4DR6 Q;  4DV2 Q;  1YJ9 A;  3TEH B;  2Q2T A;  3PO3 H;  5IP9 G;  1SN8 A;  1EIF A;  3PO3 G;  2UXC Q;  1B7Y B;  4R4C A;  3TQY A;  3KF6 B;  2QA4 A;  4JI5 L;  4PZ8 A;  4DR6 L;  4DV2 L;  4BXX H;  1QUQ A;  2RHQ B;  4GN5 A;  1XPR A;  1CUK A;  1TXY A;  4BXX G;  3I4N H;  1N32 Q;  4YWM A;  2UXC L;  1T9H A;  2UUA Q;  4EQ5 A;  3CME A;  3I4N G;  1Z47 A;  4DV4 Q;  3T1Y Q;  1EUJ A;  3L7Z C;  4OX9 L;  3I56 A;  1XNR Q;  4ME3 A;  2JJQ A;  2VQF Q;  3PO2 G;  3KF6 A;  4UPA A;  3M3Y H;  2I0Q A;  1FJG Q;  5LMU Q;  1YZ6 A;  4IFD I;  4DUZ Q;  4HIO A;  4GNX B;  3OW2 A;  2HHH Q;  1N32 L;  2R7F A;  4B3M Q;  5IYD H;  2UUA L;  3EBE A;  4GLX A;  3T1Y L;  2I5H A;  3S1Q H;  5GAE C;  2JA7 G;  2B63 H;  1XNR L;  2MFI A;  2AHO B;  2JA6 H;  4JCV E;  2VQF L;  1NBW A;  2PQA B;  3I4O A;  4YY3 L;  4JI6 Q;  2B63 G;  2BH2 A;  1MJE A;  2JA6 G;  4DUZ L;  1CKM A;  4J15 A;  1O7I A;  4JI1 Q;  3KJO A;  3A74 A;  1HZB A;  1Q12 A;  1UEB A;  2ZM6 Q;  4B3M L;  2R92 G;  4LFA L;  4X65 Q;  3GTL H;  4GNX A;  1N33 Q;  1KRS A;  1Q82 C;  3RN5 A;  4YCW A;  5C0X J;  3PF4 A;  3S1M H;  2GN5 A;  2LSS A;  4PZ6 A;  5M3F H;  1OXX K;  3CW2 C;  4JI6 L;  4IPD A;  1KHI A;  3STB C;  4JI1 L;  3RLN A;  4A3G H;  3Q8D A;  2PQA A;  3BJU A;  3U4Z A;  5C3E H;  4EX5 A;  2ZM6 L;  3F8T A;  2WB1 G;  4X65 L;  1VQ8 A;  4UY8 C;  2I5M X;  4P74 A;  3J81 j;  2VQE Q;  4HJ7 A;  3GD7 A;  1N33 L;  5C3E G;  1IBM Q;  4LF8 Q;  2KHI A;  4GKK Q;  1IXR A;  2PMZ E;  3M4P A;  2YU9 H;  1XTD A;  1WCM H;  2VL6 A;  2VY3 A;  4GOP C;  3H0G H;  4DV0 L;  4LFC Q;  2YV5 A;  1L1O C;  1Q86 C;  2UXD L;  2Q2H A;  1YJW A;  3H0G G;  4C3J H;  4XIG S;  5M5W H;  1HZA A;  3NEM A;  2VQE L;  2D0O A;  1SRO A;  4Y7N H;  4LF8 L;  4JV5 Q;  2VNU D;  1KIX A;  1KL9 A;  4GKK L;  4A3G G;  1CKN B;  1SR3 A;  1VQH A;  1VQO A;  2V1C C;  4A3L G;  4BY7 G;  1QZG A;  4C3H H;  4DV7 Q;  1VQM A;  4NXN Q;  3S15 H;  1RIP A;  1SRU A;  2D0P A;  1E24 A;  1YEZ A;  3HKS A;  4R4Q A;  4L5T A;  4JI3 Q;  3HOW H;  4LF6 L;  1NJI C;  3HKZ G;  3M4Q A;  1U0L A;  1HR0 Q;  2PNH A;  1N34 Q;  4JV5 L;  1PA6 A;  1VS0 A;  3HOW G;  4LF4 Q;  4MZ9 A;  2JA9 A;  1X3F A;  5H1S E;  1XMO Q;  4DV7 L;  5AJ3 L;  5K36 G;  1W2B A;  1QVC A;  1VQP A;  1Q46 A;  2B29 A;  3EIV A;  4JI3 L;  2R6G A;  4JI2 Q;  2BA0 A;  2ASB A;  2UXB Q;  3S1R H;  1HH2 P;  1X3G A;  2FXQ A;  1N34 L;  1HR0 L;  3NBH B;  3F2B A;  1HNW L;  4LUO A;  4LF4 L;  1X9N A;  5IYC G;  1AH9 A;  2ID0 A;  2VUM H;  1GO3 E;  2I5L X;  3KDF B;  3GTJ H;  4A75 A;  2UUB Q;  3I55 A;  4O2D A;  4A3K G;  3BU2 A;  4X62 Q;  2VUM G;  4JI2 L;  1Q1B A;  1QZH A;  4A3M H;  1AE3 A;  3HOY H;  2UXB L;  4AIM A;  1YVC A;  5HGQ A;  2NN6 I;  1PH3 A;  4HJA A;  3HOY G;  4A3M G;  4A93 H;  3UDX A;  4GLV B;  1VQK A;  3GTP H;  4GKJ Q;  2R7Z H;  2UUB L;  4A93 G;  3A5Z B;  3TS2 A;  4X62 L;  3TRE A;  2BH8 A;  2R7Z G;  3J7A 5;  1ASZ A;  5M5Y H;  2AWN A;  3ULL A;  3DM3 A;  5E7N A;  3S2H H;  3ICE A;  2UXD Q;  2AWO A;  2B3G A;  1Q7Y C;  1PH9 A;  4GKJ L;  1QVG A;  1KC8 C;  1MIU A;  3UDF A;  1BKB A;  2Q2I A;  2NZH A;  3CCR A;  4LNQ A;  3K7A H;  1LUZ A;  2VZA A;  2ZTC A;  3J81 i;  4LF7 L;  3CC4 A;  1K8A C;  1VQ9 A;  2OCE A;  1N36 Q;  1KRT A;  2CQO A;  3AYH B;  1VQI A;  3WWV A;  2K5H A;  5JJL A;  3L0O A;  2ZJQ A;  1PYS B;  4JI5 Q;  2WAQ E;  5IP9 H;  3UE0 A;  2A8V A;  4K0K L;  3F2D A;  3CPF A;  2WAQ G;  2CWP A;  3TS0 A;  1N36 L;  3K7U C;  4POF A;  3S2D H;  4FDB A;  1VQ4 A;  1FVI A;  3FKI G;  4IJH A;  4GN4 B;  3E9H A;  4OX9 Q;  4AYB E;  4UP8 A;  2BA1 A;  2E2J H;  3GTK H;  3CCV A;  1WOC A;  1KXL A;  4YWK A;  3KOJ A;  1G29 1;  4UP7 A;  2DUD A;  3CC2 A;  1VQ6 A;  4QL5 A;  2PI2 E;  2OWO A;  1U5K A;  3RZO H;  1IBL L;  5EAY A;  1K9M C;  3PO2 H;  1SLJ A;  1PH5 A;  5C4X G;  4JI7 L;  1HJP A;  4Y52 H;  1TWH H;  5M3M G;  2RHS B;  5C0X G;  1EQQ A;  4YY3 Q;  4DV5 Q;  1L2F A;  2ALY B;  3E0E A;  2JA7 H;  3RR5 A;  2MNA A;  2E5L L;  4LFA Q;  4DR3 Q;  1CSQ A;  1K83 H;  1WJJ A;  4DV1 Q;  3UDG A;  4WJ4 A;  2AKW B;  1X54 A;  1M1K C;  4DV6 Q;  2OTJ A;  3GTG H;  2QEX A;  1LYL A;  1OXT A;  1NTG A;  1SE8 A;  2JE6 I;  3GO5 A;  5C44 H;  4DV5 L;  1I3Q H;  2R92 H;  1YHB A;  3J81 c;  3PIP A;  5C44 G;  2K52 A;  1VQL A;  4LWC A;  4DR3 L;  3D31 A;  4DPG A;  1I6H H;  2Z6K C;  2LXJ A;  4IO9 A;  4DV1 L;  5GAH C;  4LF5 Q;  5IYB H;  3CCM A;  3RZD H;  3F1Z A;  4DV6 L;  1E22 A;  1TWG H;  4P71 A;  4DKA C;  3G6E A;  2UU9 Q;  5IYB G;  1VQC A;  2EXD A;  2HIX A;  1A0I A;  4B3T Q;  4DV0 Q;  4PMW A;  4YWL A;  4LF9 L;  1X55 A;  1L0W A;  1PV4 A;  1C0A A;  1VQJ A;  3FHW A;  1VQN A;  4O0A A;  5JEA J;  1R9T H;  1IZ6 A;  1NMG A;  1B8A A;  4LF5 L;  2Q2U A;  3CXC A;  2HT1 A;  3GTM H;  1K3R A;  4X6A H;  4P73 A;  4IPH A;  5DLQ E;  4P72 A;  2UU9 L;  3VDY A;  1D7Q A;  1S72 A;  1IBK L;  3PCO B;  2NZO A;  4DAM A;  4B3T L;  3DLL A;  3STB D;  4LW1 A;  1JT8 A;  1E7Z A;  1EIY B;  5FJ8 H;  2RF4 A;  3ER0 A;  4LF6 Q;  4A3L H;  4BY7 H;  3SGI A;  1HZ9 A;  2N78 A;  1A63 A;  1OTC A;  4DR7 L;  5FJ8 G;  4AH6 A;  2KCT A;  1GKH A;  1SMX A;  5AJ3 Q;  3HOX H;  1VQF A;  2K5V A;  1Y14 B;  4A3E G;  3A0J A;  5LMN Q;  4IPC A;  4R4T A;  5J3B A;  4B3S Q;  1D8L A;  3HOX G;  3HFZ B;  4POG A;  1V9P A;  3F2C A;  4BBS G;  1HNW Q;  3AFQ A;  2JA8 H;  3CPW A;  2WFW A;  2ZJP A;  4QGU A;  5IE8 A;  1VQ7 A;  2JA8 G;  4QIW E;  2EQS A;  5LMN L;  4L5R C;  4A3B H;  3CCE A;  2ZTD A;  4B3S L;  2IHE A;  5IP7 H;  4QY7 A;  3RLF A;  3L2P A;  3MEF A;  2IX1 A;  3PSI A;  5IYC H;  4GNX C;  4A3B G;  4JI0 Q;  5IP7 G;  4NXM Q;  1K73 C;  1EFW A;  1YNX A;  5GRO A;  3JC6 6;  4A3K H;  4JBK A;  4GS3 A;  4NB3 A;  4JI4 Q;  5IT9 c;  1XMQ Q;  4P75 A;  2YTV A;  4IOC A;  1PH4 A;  2NVQ H;  1A62 A;  2F4V Q;  5C0X I;  3K81 C;  3T1H Q;  1HR0 W;  4JI0 L;  5IWA Q;  4NXM L;  3UDI A;  4IFD G;  1A8V A;  4GN3 B;  3E9I A;  3W1G A;  2JA5 G;  4JI4 L;  1XMQ L;  1OXU A;  2Z0S A;  3GTO H;  2KEN A;  4DK3 C;  1YHA A;  1EQR A;  3PUX A;  4HID A;  2F4V L;  1VCI A;  4A3J H;  3T1H L;  4LF7 Q;  3M85 A;  5IWA L;  4ALP A;  3CCL A;  2MO0 A;  4JOI C;  3M7N A;  2MO1 A;  2Y0S E;  1LTL A;  2H5X A;  3OTO Q;  3CCQ A;  2KCM A;  4A3J G;  1B70 B;  2IT1 A;  3AFP A;  1E3P A;  4XTC S;  3CQZ H;  2R7D A;  1X65 A;  2Y0S G;  1MJC A;  1PFS A;  1PYB A;  4YCU A;  1PH2 A;  3J7Z C;  3UE1 A;  5GAG C;  3ULP A;  1VQD A;  4K0K Q;  4IFD J;  2CKZ B;  2L15 A;  2OQ0 A;  4YCV A;  3OTO L;  1YJN A;  5HY6 A;  3AEV A;  1W3S A;  1E1O A;  3IRB A;  4JYA Q;  5FLM H;  3JAM c;  3CP0 A;  3LGJ A;  2UUC L;  2IHF A;  3CF5 A;  1I94 Q;  1TWC H;  4JBW A;  2R93 G;  5FLM G;  1IL2 A;  1UE7 A;  1M90 C;  1VQA A;  5C4J H;  2ZTE A;  3KF8 B;  5JJI A;  1XNQ Q;  1GVP A;  1Q8K A;  4DR1 Q;  2F3I A;  3FKI H;  1V1Q A;  2HIV A;  4JYA L;  1TWA H;  2PI2 A;  4KHZ A;  1IBL Q;  1HZC A;  1WI5 A;  3J80 c;  1YI2 A;  4JI7 Q;  1I94 L; 
#chains in the Genus database with same CATH topology
 1SYE A;  3PUZ A;  5CBE E;  2B2T C;  5EPL A;  5G3L D;  4TSS A;  2ZJR A;  2WP8 J;  1B9M A;  4RH6 A;  1XNQ L;  2GVB A;  1CM9 A;  5C4X H;  4DR1 L;  1I6H B;  2IY5 B;  3M4O H;  1SJH D;  4XXE A;  1PFB A;  1J8I A;  1JCK B;  5K5P A;  2XWB B;  3GTQ B;  4KHP L;  4DV3 Q;  4TVA B;  2BE5 D;  3EN2 A;  5FKA C;  3H3V H;  4OHJ A;  5JVG 3;  3R8B A;  2CQA A;  2O2L D;  2EZV A;  1CSP A;  2HQL A;  1PRT F;  2ENB A;  4C56 C;  5JJK A;  1HPC A;  4LUZ A;  4LF9 Q;  3B6Y A;  1I4P A;  2JP1 A;  4KKU A;  3G71 A;  1LTT D;  3I8Z A;  4K6L A;  3RMH A;  1VQ5 A;  3HOX B;  2RVL A;  3GTQ H;  3PUV A;  2TMP A;  4BBS B;  5ELN A;  3IAY A;  1PH8 A;  1BBW A;  1SYD A;  2RCN A;  4B9W A;  2D62 A;  2PZW A;  1JWU D;  4DR7 Q;  3ZJY C;  5EPK A;  4A76 A;  1YBY A;  3IFT A;  3UI2 A;  4HAE A;  1X56 A;  1STA A;  2JQO A;  1I5F A;  4NKL A;  1G2S A;  1MBY A;  1UE1 A;  1WYD A;  2AQ2 B;  3KLW A;  5GAD C;  1FGU A;  4L5Q A;  4DR2 L;  2WB1 E;  5KYL A;  3SR1 A;  1X3E A;  1K8M A;  4PNY A;  4X64 L;  5M3F G;  4BBS H;  1BQQ T;  1EOV A;  1VF7 A;  2NWG A;  3JAM i;  4H02 A;  3CD6 A;  1Y1W G;  1XXG A;  1KD1 C;  4G57 A;  4QJF A;  1J5E Q;  4A3J B;  2VS1 A;  1NY4 A;  4DK1 A;  4A3C H;  4B3R Q;  2RDH A;  2Y0S B;  3CAM A;  2XGT A;  3CQZ B;  3ULJ A;  3OIQ A;  2K5N A;  1KLG D;  2OEO A;  2E74 C;  1EWI A;  3NEL A;  5LMN W;  4HIK A;  3D6C A;  3MVV A;  4X3S A;  2ASB A;  4FF1 A;  3P7J A;  1SAP A;  1BCP C;  4L5S A;  1DXM A;  4NXN L;  1CKN A;  1WD0 A;  1ONL A;  1NUC A;  3HG9 A;  3MXP A;  3TRZ A;  3PMF A;  4PG3 A;  1EQV A;  3S1N H;  2D9U A;  3LNN A;  4DAY B;  4RGT A;  3QIA A;  1XPU A;  3CC7 A;  3U4V A;  3HOZ H;  3MXG A;  1N8R C;  3S16 B;  3K6O A;  2E8G A;  4LAA A;  3R3O A;  1K8G A;  3OHX C;  1H95 A;  4JI8 L;  4DAY A;  2NVY H;  2Z1C A;  1V43 A;  5I9P A;  3KLS A;  3KDF A;  4JVZ A;  1ZEQ X;  4IUR A;  1Z9F A;  3A5U A;  3K5M A;  3HOV G;  1JB7 A;  3KYH C;  2J7Z A;  1WTW A;  2NTT A;  1T5E A;  1ESR A;  3NUC A;  1FL0 A;  4A3D B;  5IT9 L;  4KHP Q;  4EQO A;  2N3S A;  2ICI A;  1TVX A;  1LLR D;  5CBA E;  2DJG C;  1QUQ B;  3RN2 A;  2F1M A;  1YJ9 A;  1D6E C;  2Q2T A;  3DEP A;  5IP9 G;  1TWF B;  5JVH 3;  5ELF A;  1K3B C;  2RSO A;  3TP7 A;  3TQY A;  3WOF A;  2QA4 A;  4DR6 L;  1QUQ A;  3C1F A;  1CUK A;  4BXX G;  1ML0 D;  1EYD A;  2NTS A;  2UUA Q;  4EQ5 A;  5HGT A;  4ABN A;  3I4N G;  1Z47 A;  1EUJ A;  1VMC A;  2R61 A;  1T5X D;  3CRL C;  2VQF Q;  2N88 A;  1Y1V B;  4GNX B;  3V05 A;  3EBE A;  2BOS A;  5IGC A;  4K8I A;  3T1Y L;  2XNA C;  2MFI A;  4YY3 L;  3PQI A;  1XX8 A;  1O7I A;  1TY0 A;  4B3M L;  2ZM6 Q;  2K5W A;  2L11 A;  2RBM A;  4LFA L;  4GNX A;  5CMD A;  2XN9 C;  3PF4 A;  4FXD A;  3S1M H;  2MP1 A;  2XWJ B;  4IPD A;  3STB C;  1LT5 D;  2Z8L A;  4X65 L;  1N33 L;  2I5M X;  1D1I A;  2KHI A;  2X6G A;  4GKK Q;  3M4P A;  5DM6 3;  2EY2 A;  3RD4 A;  3H0G H;  4HR7 B;  1L1O C;  3TN2 A;  3T51 B;  3AMU A;  4XIG S;  5M5W H;  2VQE L;  1SRO A;  5ELD A;  2VNU D;  2F03 A;  1VQH A;  2J4X A;  1QZG A;  4DV7 Q;  1VQM A;  2LKV A;  4NXN Q;  2D0P A;  1E0B A;  1GUO A;  4R4Q A;  3HKS A;  5C5L A;  4L5T A;  3HOW H;  2A6E C;  1TS4 A;  3HKZ G;  4C2M B;  3GTP B;  2A73 B;  5H1S E;  5COR A;  5K36 G;  3K5N A;  1W2B A;  1A3T A;  3EIV A;  5BN4 A;  4JI3 L;  2R6G A;  2UXB Q;  1HH2 P;  3NBH B;  3FMC A;  3F2B A;  2KEE A;  1X9N A;  5IYC G;  2KCC A;  2ID0 A;  2UUB Q;  3I55 A;  1I4Q A;  3TDQ A;  4JI2 L;  1JOQ A;  4A3M H;  5F2D A;  1KAB A;  2Z9H A;  4KN7 C;  5G3L F;  3HOY G;  2E2I B;  3NBH A;  3GTP H;  1YNJ C;  2BH8 A;  1WTQ A;  4F88 A;  1SYB A;  4GKJ L;  2CH4 W;  2WII B;  4RHR A;  2NB0 A;  3VR5 A;  4LNQ A;  1MIU A;  1BKB A;  2N55 A;  2VZA A;  1V1P B;  2B2V C;  2B39 A;  1RKN A;  3J7Y W;  2OCE A;  2J0T D;  4XT1 B;  3AYH B;  4KKS A;  2K5H A;  3I90 A;  3L0O A;  1HCZ A;  1D5M C;  1IKL A;  2WAQ E;  3MXU A;  1SNM A;  4NMZ A;  2EJF C;  2A8V A;  3CPF A;  3NQT A;  2V4D A;  2CWP A;  2NUC A;  1V1P A;  5ELC A;  3TS0 A;  1K83 B;  1R4P B;  1KDC A;  2JA6 B;  2BDN A;  1CA5 A;  1PDQ A;  3K5O A;  1TS3 A;  3SHL A;  2DUD A;  3CC2 A;  2F0W A;  4IUV A;  1U5K A;  1SLJ A;  2L5T A;  5C4X G;  3VYR A;  4IZ8 A;  5EKL A;  1O78 A;  4IUQ A;  3R2T A;  4YY3 Q;  3JAM L;  1SND A;  1ICW A;  2ZXO A;  3CHB D;  2AQ1 B;  5EGT A;  4LFA Q;  1K83 H;  1ZYR D;  4DV1 Q;  3UDG A;  4WJ4 A;  2A68 D;  1DJR D;  5FLX E;  4KY7 A;  2OTJ A;  1OXT A;  2JE6 I;  3FEW X;  3GO5 A;  3J81 c;  4A3G B;  4DR3 L;  1BCP B;  4Y7N B;  2XVS A;  5EPJ A;  3DXJ C;  3RZD H;  1EZ8 A;  2PYK A;  2HIX A;  1A0I A;  5EBD A;  1SSO A;  1AW7 A;  2X69 A;  1VQN A;  5JEA J;  3GTM H;  1B8A A;  2Q2U A;  2DJF C;  4IAL A;  4FF4 A;  4IPH A;  1C4Q A;  1STG A;  1PRT D;  1JWS D;  3VDY A;  1S72 A;  1IBK L;  3PCO B;  4B3T L;  4KV6 A;  3A55 A;  1JT8 A;  1E7Z A;  3VA5 A;  5FJ8 H;  3ER0 A;  3S1R B;  1NSN S;  4A3L H;  1FNV A;  1HZ9 A;  2N78 A;  5EJW A;  5KGU A;  5A35 A;  4AH6 A;  1GKH A;  2EYJ A;  2VUM B;  5NUC A;  3U9S A;  2K05 A;  2RSN A;  4IPC A;  5CV7 A;  2MHV A;  4PV1 C;  3HOX G;  4BBS G;  4A93 B;  2A6H D;  2EVB A;  4DK0 A;  2PPB C;  1SNQ A;  2EYO A;  3IFD A;  5LMN L;  1LTG D;  3CCE A;  4A3B H;  4QY7 A;  5M5Y B;  1CT1 D;  3L2P A;  2IX1 A;  3PSI A;  4OGQ C;  1AN8 A;  2F0E A;  1YNX A;  5GRO A;  4EGV A;  3JC6 6;  1XMQ Q;  3K7A B;  2QKI C;  3ZYY X;  4IOC A;  1PH4 A;  1A62 A;  3P1H A;  4MTK A;  4JI0 L;  1FD7 D;  1I4X A;  1B3A A;  1STB A;  2F0U A;  3N6R A;  3W1G A;  4DFA A;  3ND8 A;  4JI4 L;  3DWQ A;  1OXU A;  4L6T B;  3E6Z X;  2KEN A;  3D4R A;  3NTH A;  2F4V L;  2EXZ A;  1VCI A;  3AU7 A;  3T1H L;  4KY5 A;  3S2D B;  4XDX A;  4N8F A;  4BS9 A;  4A3J G;  2HDM A;  4XTC S;  4N9T A;  1O7L A;  2Y0S G;  3QJY A;  1PFS A;  4YCU A;  2E2J B;  3UE1 A;  3ULP A;  1VQD A;  3P75 A;  5FOB B;  2A69 D;  2L15 A;  4Z9C B;  1E1O A;  1QB5 D;  1ZKO A;  5FLM H;  1TWH B;  2CW0 C;  3CP0 A;  2I07 B;  2R3Z A;  1G2T A;  2EY5 A;  1IL2 A;  3HOU B;  4KJO A;  1UE7 A;  5KYI A;  1I4G A;  3Q0A A;  2F3I A;  5IGG A;  1B3Q A;  2HIV A;  4CKE A;  3J80 c;  1LO5 D;  1EY9 A;  1QNK A;  3OYY A;  3ERQ A;  3U58 A;  2K50 A;  3CCS A;  3I4M H;  1CA6 A;  4IJL A;  1L1O B;  4EQP A;  4DUY Q;  3HOU H;  1H9J A;  2K14 A;  4XQJ A;  5CGK A;  1LM0 A;  5ELO A;  1PLF A;  3S24 A;  5JEA G;  3EVQ A;  1PH6 A;  2PMZ B;  4DN4 M;  4DV3 L;  3H15 A;  1L1O A;  1PTO D;  1UE6 A;  1PH1 A;  1Z6H A;  2MQH A;  4I7A A;  4A3D G;  2PZT A;  4OXP A;  3VA7 A;  1HNX Q;  1JIC A;  2EJM A;  2C35 B;  5CV4 A;  1H9K A;  2N8N A;  1KAW A;  3H09 A;  3S9W A;  2B8G A;  3V96 A;  1IBK Q;  4OO1 H;  1NE3 A;  3DWA A;  3RNU A;  1SMY D;  4FVM A;  5BN5 A;  3G48 A;  3FRP B;  3K80 C;  2JA8 B;  2YYZ A;  3QG1 A;  1EOT A;  5I9O A;  3NPP A;  5LMU L;  1PZK D;  1CFM A;  2SOB A;  4A3F H;  5DM7 3;  5EQ0 A;  3TP8 A;  1RTO A;  2LXK A;  4IN3 A;  4K8J A;  1VF5 C;  4YHH Q;  3MTS A;  3FP9 A;  5E1F A;  4X3U A;  2KHJ A;  2SDF A;  4OEL B;  3QOJ A;  4DR4 Q;  3J81 E;  1Y1V G;  2IX3 A;  4LUV A;  3RLO A;  5FO8 B;  3TZD A;  4HJ8 A;  3ERS X;  5FK9 C;  2I46 A;  1J9O A;  3NTK A;  2B8F A;  3M9B A;  5KND A;  3VR2 A;  4LK1 C;  5BR8 Q;  1BVS A;  3HKZ E;  1ASY A;  4BBR H;  1NR2 A;  1J5E L;  1CQV A;  5GQO A;  4BY1 H;  4TQU S;  4B3R L;  3T13 A;  3S14 H;  2NVT B;  1EYG A;  1AFP A;  2ATW A;  1SE3 A;  2K7V A;  1VQE A;  5C4J B;  4DK6 C;  4JC0 A;  3TSS A;  4HJ9 A;  4ZUJ A;  1UEA B;  4OWX B;  2JXM B;  1PH7 A;  4MHE A;  2K28 A;  2QDB A;  4A3I H;  1EY0 A;  2N49 A;  2L12 A;  1SBB B;  2RA4 A;  2RCF A;  3MXN B;  4BA1 I;  5ELE A;  4AYB B;  4BA2 I;  1EY6 A;  5LHY 1;  3S17 H;  4IOA A;  3I2Z A;  1G8Z D;  1RL2 A;  2KA7 A;  3G4S A;  5J22 A;  1I4R A;  4KY6 A;  2NVT H;  1JE5 A;  3NP8 A;  2K4K A;  3MXN A;  1VQB A;  3NEN A;  2MUY A;  1MHW C;  3PV0 A;  2JEA I;  1U4R A;  3W2D A;  1CQF A;  4NPS A;  2BDO A;  3Q24 A;  4IQZ A;  1U4L A;  1Q90 A;  4HIM A;  1GUW A;  3OIP A;  1GUN A;  1Q1E A;  3TEH B;  3ONA B;  3PO3 H;  4FYD A;  4OIK A;  1ET6 A;  1S4Z A;  2UXC Q;  1B9N A;  4O42 A;  3S1Q B;  1EU3 A;  2AUK A;  2EDG A;  1EWH A;  4OIJ A;  4JI5 L;  4PZ8 A;  3O13 A;  4XYO A;  2RHQ B;  4GN5 A;  1XPR A;  5KRU A;  4H13 C;  2NN6 H;  2QW7 A;  1XNR Q;  2JJQ A;  1D5X C;  5FO7 B;  1STN A;  4UPA A;  5LMU Q;  2DY8 A;  4G4K A;  5C6A A;  5C3W A;  1RHP A;  2UUA L;  3NHH A;  1F2M A;  1IW7 C;  3LWU A;  3S1Q H;  5GAE C;  2B63 H;  1BF4 A;  4JCV E;  2VQF L;  2BH2 A;  2JA6 G;  4JI6 Q;  4QIW B;  1CKM A;  1Q12 A;  4B08 A;  2NYZ D;  5BN3 A;  3A7A B;  5IOC A;  3D6W A;  2LSS A;  1D5Z C;  3CW2 C;  5A2Q E;  3BYY B;  2MPM A;  3Q8D A;  5C3E H;  2ZM6 L;  2UXD Q;  2F3W A;  4P74 A;  1XYI A;  2HD3 A;  4LF8 Q;  1IXR A;  3G7L A;  1XTD A;  5FO9 B;  1STE A;  2VY3 A;  4GOP C;  4DV0 L;  4C3J H;  2D0O A;  3S1N B;  1KL9 A;  5TSS A;  4G7Z C;  1CKN B;  1SR3 A;  4A3G G;  4A3L G;  4GKK L;  4C3H H;  1RIP A;  1SRU A;  5LL6 S;  3HOZ B;  1E24 A;  4J1M A;  1ET9 A;  5C3X A;  3M4Q A;  1U0L A;  1HR0 Q;  1N34 Q;  3SK6 A;  1VS0 A;  3SDZ A;  2CH4 A;  5DAU A;  4MZ9 A;  4LF4 Q;  1X3F A;  4DV7 L;  3QB3 A;  2M2L A;  2NVY B;  3NTI A;  1Q46 A;  1HA5 A;  2K6A A;  1W6K A;  2BA0 A;  2F4I A;  1X3G A;  2NZ1 D;  3A7L A;  2F0D A;  1AH9 A;  1MSH A;  2QF7 A;  4EQN A;  1A2T A;  3KDF B;  1BCP D;  3OMC A;  3BU2 A;  2VUM G;  4OEM B;  1D2B A;  2UXB L;  4DNT B;  1YVC A;  2K04 A;  5KIX A;  2HQE A;  4HJA A;  3TP6 A;  3UDX A;  1B50 A;  2R7Z H;  2UUB L;  4A93 G;  3TS2 A;  5D3D A;  5JPM C;  2O5J C;  2AWN A;  3DM3 A;  5E7N A;  3ICE A;  2B3G A;  1IYV A;  1Q7Y C;  2A74 C;  2KVM A;  4U67 3;  1CK1 A;  3CCR A;  5DEH A;  2HUG A;  3J81 i;  1K8A C;  3NWS A;  1PTO F;  1CI3 M;  2ZJQ A;  4JI5 Q;  2IWH A;  3UE0 A;  5L37 A;  1B4O A;  1HTL D;  2TSS A;  4K0K L;  2EYL A;  2VXW A;  1ENC A;  1GUT A;  4GN4 B;  3E9H A;  4HSP A;  2FIN B;  1UAP A;  2BA1 A;  3CCV A;  1WOC A;  2R92 B;  3FPP A;  4YWK A;  3R93 A;  1EQT A;  1G29 1;  2E2D C;  5C4H A;  4WFN 3;  5E4X A;  2EY6 A;  1IBL L;  5C0X H;  5EAY A;  1Q3L A;  4JI7 L;  3S1M B;  4FP5 D;  4K14 A;  1S5B D;  2K32 A;  1EQQ A;  1L2F A;  2ALY B;  2RKS A;  1F77 A;  1LTR D;  3ND9 A;  1X54 A;  1M1K C;  2QEX A;  1GOZ A;  1NTG A;  1SE8 A;  3BYT B;  3H0G B;  5C44 H;  3C3L A;  2R92 H;  2C9O A;  1YHB A;  2K03 A;  2KEC A;  3PIP A;  5M5W B;  1VQL A;  4BY7 B;  1FNU A;  4DPG A;  4DV1 L;  5GAH C;  4LF5 Q;  5IYB H;  3CCM A;  1TWG H;  2CVR A;  2EXD A;  1DOK A;  5FLX L;  4DV0 Q;  1WD1 A;  1X55 A;  3HOW B;  3FHW A;  3A54 A;  4EVO A;  2F0L A;  1R9T H;  3BG3 A;  1F9P A;  1EU4 A;  4X6A H;  2DN8 A;  1TR5 A;  4K5W A;  1A3U A;  4P72 A;  1D7Q A;  3E5S A;  3DLL A;  3STB D;  4LW1 A;  5J1Z A;  2E76 C;  3HP3 A;  4BY7 H;  2Z4H A;  1OTC A;  4A3K B;  4NDX A;  4U68 A;  1SMX A;  3H6M A;  3MZ5 A;  3BS1 A;  2K5V A;  1Y14 B;  2L1B A;  4J8Q A;  3C1E A;  4R4T A;  4KHV A;  5J3B A;  1BDO A;  4A3M B;  2B2Y C;  3A8I E;  3T16 A;  2O4X A;  1V9P A;  3R2I A;  3F2C A;  1UUP A;  3GP7 A;  2WFW A;  2ZJP A;  4QGU A;  3D4W A;  1GHK A;  2JA8 G;  2EQS A;  3GTO B;  3RLF A;  1NAP A;  4FXK C;  1I94 L;  1TKW B;  3X3M A;  5IP7 G;  4NXM Q;  1K73 C;  1EFW A;  1DM0 B;  4R8I A;  4A3K H;  4R8N A;  4JBK A;  4NB3 A;  2EY1 A;  2G5D A;  3D3R A;  2FFK B;  3K81 C;  1HR0 W;  5IWA Q;  3UDI A;  4IFD G;  3OOC A;  4GN3 B;  3E9I A;  1XMQ L;  1NCV A;  3H94 A;  2WAQ B;  2QCP X;  3GTO H;  4DK3 C;  1EQR A;  1L0X B;  3PUX A;  4ALP A;  3M7N A;  1EYC A;  3CCQ A;  1LTL A;  1TWA B;  2H5X A;  1QE6 A;  3AFP A;  1E3P A;  3A8J E;  2R7D A;  1PFM A;  4LMQ D;  1PYB A;  1X3Q A;  1YNJ D;  4K0K Q;  3DUZ A;  3SE0 A;  2ICE C;  4YCV A;  5HY6 A;  1W3S A;  3IRB A;  4CBV A;  3JAM c;  2UUC L;  3LGJ A;  1TWC H;  4JBW A;  4DU9 A;  1II3 A;  2RQX A;  2ZTE A;  1QOH A;  3KF8 B;  1CZW A;  4ZYS A;  1EY5 A;  1V1Q A;  1TWA H;  4RGN A;  4TRD A;  1IBL Q;  1HZC A;  1WI5 A;  1LT6 D;  4JI7 Q;  4UP9 A;  4KI0 A;  1JOK A;  1AE2 A;  4AYB G;  1YIJ A;  2Z6K A;  3BZK A;  3KF8 A;  2E2H H;  5IGE A;  5E4W C;  3RZD B;  2EOT A;  4GOP B;  4RA8 A;  2HDL A;  4A4I A;  4ODG A;  2Q8R E;  1G51 A;  3GTM B;  1IYJ B;  4DNI A;  5T1G A;  3W5O A;  1KNE A;  3AQQ A;  4K6D A;  4GOP A;  3KJP A;  4DUY L;  1NR4 A;  1QG7 A;  1ZYR C;  1MGS A;  4UAI A;  2A68 C;  2NVX H;  3I72 A;  3KBX A;  3BZD B;  3J7A V;  2NN6 G;  5M5X B;  3V2T A;  1AEX A;  2SNM A;  1Q81 C;  2FJ2 A;  1I50 B;  1E1T A;  4HMJ A;  1HNX L;  4MNO A;  2F52 A;  1QNU A;  4A3B B;  1CHP D;  1SYC A;  2L4N A;  3CMA A;  2NBF A;  4UDU C;  3URY A;  1WFQ A;  1LAC A;  4LFB Q;  2CCZ A;  1ICF B;  1PRT C;  2CFM A;  3PUW A;  5M5X H;  3PF5 A;  4HSV A;  5I2X A;  1XJV A;  1BCP F;  1FNW A;  4S3S A;  4RMF A;  1EFI D;  1I50 H;  1TY2 A;  1NMF A;  2IPK D;  4YHH L;  1QVF A;  1Y1W H;  3QO2 A;  1C9O A;  2F0K A;  4KN4 C;  2A1A A;  1SFO H;  1WTV A;  2OTL A;  3HRZ C;  4DR4 L;  2FMM A;  4IUT A;  5CV8 A;  5CR3 A;  2A6H C;  1HNZ Q;  1IBM L;  3J81 L;  4BWG B;  2FMC A;  1JJC B;  1OXV A;  1MI2 A;  4A3C G;  2JK8 A;  3MEH A;  1RCV D;  1OXS C;  1S5E D;  2RDG A;  2F0V A;  4Q0F A;  2F0G A;  1H9M A;  1DZ1 A;  3CCU A;  3GDE A;  4R1J A;  1BNZ A;  4X66 Q;  3K0X A;  3BZC A;  1PZJ D;  2F0O A;  3FDT A;  2KBN A;  3I73 A;  4DGZ A;  5BR8 L;  3PUY A;  3D4D A;  1MD2 D;  3W1B A;  4OON A;  3N52 A;  3H3V I;  1ENA A;  1GD7 A;  2YTX A;  2K75 A;  1F9S A;  1O80 A;  1XPO A;  1YIT A;  4GLA C;  1XMO L;  2EIF A;  5ISR A;  4R4O A;  2UUC Q;  2E75 C;  2XRQ D;  1XTC D;  3HOZ G;  2GVA A;  3BDC A;  1YHQ A;  3KLS X;  4CKB A;  1WVL A;  3WDN A;  1RTN A;  5CV5 A;  3I4M B;  1DON A;  4L63 B;  3IKJ A;  4DR5 Q;  1KDA A;  4I7Z C;  1KNA A;  1LV9 A;  1A15 A;  3HOV H;  2A69 C;  1EEI D;  1JWM D;  4AQY Q;  2ES2 A;  1P8L A;  4ZQ3 A;  4APV A;  3VR6 A;  3M7G A;  2KHS A;  2K1B A;  3I7F A;  1M8A A;  4R4I A;  1P16 A;  4ZAI A;  1HUM A;  2VB2 X;  3DMU A;  3SEB A;  1LTS D;  2OT2 A;  4CDE C;  5CV9 A;  2L0C A;  3BVG A;  3DHQ A;  1CKO A;  1GUG A;  3M3Y B;  4DV2 Q;  1UNS A;  1GJX A;  1SN8 A;  1EIF A;  1F9Q A;  4KTA A;  4KKT A;  1B7Y B;  2ZXP A;  4R4C A;  2AQ3 B;  2XSC A;  4BXX H;  1EZ6 A;  1C48 A;  1HHV A;  1S5F D;  4DA2 A;  4A3F B;  1TXY A;  3I4N H;  4KD3 A;  1N32 Q;  3I3C A;  1QIL A;  2UXC L;  1T9H A;  4RCN A;  4FO2 A;  4OX9 L;  1B53 A;  3I56 A;  4ME3 A;  1QWY A;  1AZP A;  3M3Y H;  4OL7 A;  2IL8 A;  4DUZ Q;  2R7F A;  4F8M A;  3QOL A;  2B2Y A;  5IYD H;  2L55 A;  4GLX A;  2K5Q A;  1XNR L;  1NBW A;  1WCM B;  3LX0 A;  4ID6 A;  2WKD A;  1SMY C;  4J15 A;  4K2K A;  4JI1 Q;  1UEB A;  2R92 G;  3GTL H;  3X3N A;  2RDF A;  1KRS A;  1Q82 C;  2MGS A;  3GV3 A;  1EEF D;  4PZ6 A;  4JI6 L;  1KHI A;  4BBR B;  1K8O A;  1X32 A;  3U4Z A;  3SK5 A;  4EX5 A;  4WJ3 M;  3F8T A;  4BY1 B;  1IBM Q;  3K5L A;  1E2V A;  1KTK A;  2YU9 H;  2PMZ E;  3S14 B;  1SNO A;  3Q23 A;  1WCM H;  2VL6 A;  3T56 B;  1Z7T A;  2UXD L;  2Q2H A;  1I6V C;  3EA6 A;  4JPB W;  5A2Q L;  4QUF A;  3H0G G;  3NEM A;  4JV5 Q;  4LF8 L;  1BO0 A;  3U9O A;  1VQO A;  4BY7 G;  4K5V A;  5DNF A;  5KEE A;  3DEO A;  3S15 H;  1Y69 U;  4A3I B;  2M9V A;  1YEZ A;  1WTR A;  3S17 B;  4P2C B;  3BDO A;  4IUU A;  4NP5 A;  1NJI C;  4K2L A;  5K36 H;  4MIU A;  2JN4 A;  3HOW G;  3KK7 A;  1XMO Q;  1S5C D;  5M9O A;  4C1N I;  1QVC A;  2B29 A;  3NQI A;  1YNN C;  3NK9 A;  1BOS A;  3C46 A;  1HR0 L;  1HNW L;  1N34 L;  3MWY W;  4M8A A;  4LF4 L;  2K01 A;  2I5L X;  3G6J B;  3GTJ H;  2VB3 X;  4A75 A;  3NXW A;  4A3K G;  1K28 A;  1E2W A;  2F0T A;  4X62 Q;  1QZH A;  3HOY H;  1AE3 A;  4AIM A;  1PH3 A;  1JB3 A;  4A3M G;  1VQK A;  4G7H C;  1PXU A;  3A5Z B;  4ZKC B;  3PO3 B;  4XQN A;  1ASZ A;  3J7A 5;  3VYT A;  3S2H H;  1GXD C;  2LFN A;  2AWO A;  1EYA A;  3MHB A;  1QVG A;  1WTX A;  3UDF A;  2Q2I A;  1LUZ A;  2XIW A;  3E0J A;  1VQ9 A;  1N36 Q;  4DXF A;  5I2Y A;  3PO2 B;  4ME5 A;  3KLR A;  2F0J A;  3AB9 A;  3F2D A;  2WAQ G;  2JA7 B;  1PRT B;  3K7U C;  4FDB A;  1O7Y A;  4KJN A;  4F87 A;  2B63 B;  1FVI A;  4ZRZ A;  4IJH A;  4OX9 Q;  3GTG B;  3PIO 3;  4AYB E;  4CHT B;  4CGY B;  3GTK H;  1GUS A;  1I3Q B;  2BE5 C;  2K5D A;  3T53 B;  4CJ2 C;  2ZT9 C;  1DOM A;  3M4Y A;  4B9X A;  2PI2 E;  1V1O A;  3RZO H;  1L0Y B;  1B1Z A;  3PO2 H;  1PH5 A;  1QJO A;  4PMC A;  4Y52 H;  3J80 E;  2RHS B;  1RDP D;  2WB1 B;  2G9D A;  4DV5 Q;  5C3E B;  3E0E A;  2JA7 H;  3RR5 A;  2MNA A;  2E5L L;  1CSQ A;  1WJJ A;  3OPO A;  5JOB A;  2AKW B;  3EFX D;  4DV6 Q;  3GTG H;  1LYL A;  2X6L A;  3OW7 A;  1I3Q H;  3RUZ A;  2A5H A;  3L9A X;  1RD9 D;  2SNS A;  4C3J B;  2K52 A;  4LWC A;  1I6H H;  2Z6K C;  4IO9 A;  1B2T A;  1IW7 D;  1PMR A;  1X3P A;  3F1Z A;  4C3H B;  1E22 A;  5HUR A;  1DOL A;  2PCF B;  4P71 A;  5AFW A;  3G6E A;  2UU9 Q;  4YWL A;  1CTM A;  1L0W A;  4DAP A;  1PV4 A;  1C0A A;  1VQJ A;  2OF1 A;  4O0A A;  4QMG A;  4MN3 A;  4LF5 L;  3CXC A;  2HT1 A;  2G9H D;  3K57 A;  4P73 A;  4F7X A;  1EWC A;  3BDL A;  3E3X A;  4RKB A;  5IGD A;  2GA4 B;  4DAM A;  1A6X A;  2F0P A;  1TT2 A;  2RF4 A;  1HFN A;  2F0I A;  3Q22 A;  3SGI A;  3W3A A;  1A63 A;  2HCI A;  4QB4 A;  5E3F A;  5FJ8 G;  2KCT A;  4WOR A;  1Y8N B;  1U9R A;  4X3T A;  1R4Q B;  1JOO A;  3HOX H;  2KCN A;  2NVQ B;  3MAQ A;  4B3S Q;  1D8L A;  3HFZ B;  4POG A;  1JE4 A;  1HNW Q;  3C2P A;  2PQE A;  2F0H A;  1VQ7 A;  2R7Z B;  4QIW E;  4RWS C;  5COY A;  4L5R C;  2D2C C;  2ZTD A;  3WOE A;  2QDL A;  3MEF A;  2KQ3 A;  5EKI A;  4A3B G;  2PW7 A;  3VR3 A;  5IIF A;  3D8G A;  4GS3 A;  5IT9 c;  4N9P A;  4IUN A;  1F2Z A;  4P75 A;  2YTV A;  4H44 C;  2NVQ H;  4CKC A;  4NXM L;  3SXH A;  1HXY D;  2Z0S A;  5JAV A;  4XT3 B;  1YHA A;  2CHB D;  4QUC A;  4A3J H;  3M85 A;  5IWA L;  4ZLT F;  3FKI B;  2MO1 A;  2Y0S E;  3OTO Q;  4GZY C;  2IT1 A;  1PTO B;  3CQZ H;  1BUV T;  1X65 A;  3J7Z C;  2L9H A;  4IFD J;  2CKZ B;  5M3M B;  3AEV A;  4JYA Q;  5LL6 X;  5I6W A;  4RFB A;  3CF5 A;  1I94 Q;  5EBC A;  4R9W A;  5FLM G;  1SJE D;  5D14 A;  3MA2 B;  1M90 C;  1VQA A;  1XNQ Q;  2Z6B A;  1GVP A;  1Q8K A;  2H4O A;  3FKI H;  2IJ0 A;  4HCE A;  4C3I B;  4DR1 Q;  2KJX A;  1PTO H;  4I65 A;  1YI2 A;  2DY7 A;  3PGZ A;  5C44 B;  1STY A;  4RAU C;  1H9R A;  2LS0 1;  1X6O A;  3S16 H;  4QQB X;  1PHJ A;  4PMB A;  1JQY D;  2E5L Q;  5M3M H;  2HCC A;  3CU7 A;  1VDZ A;  3NBI A;  5C4Z A;  2EYM A;  5FLX c;  4MTN A;  1TWG B;  1VQG A;  1C7Y A;  1LT3 D;  3I4M G;  1PZI D;  1PVO A;  1FYC A;  5JEA H;  3Q6S A;  1ILP A;  3HOU G;  1R9T B;  3I70 A;  4OWW B;  4C3I H;  1U4P A;  2IX0 A;  1N9W A;  2WAC A;  4IPG A;  1K0R A;  2YTY A;  1SE4 A;  4A3D H;  4KLK A;  1IHZ A;  2Q8T A;  1Y8P B;  1WTP A;  2EPB A;  2QIL A;  1LTA D;  4A3E B;  2JEB I;  4X3K A;  5KNC A;  1IL8 A;  2DNC A;  1TWF H;  2CWA A;  1ESF A;  4OO1 G;  4DV4 L;  1G6P A;  3CRK C;  1TU2 B;  4HTH A;  5IYD G;  4V0B A;  1HRJ A;  3T4A C;  1FJG L;  2EYP A;  4DR2 Q;  1EY7 A;  1UE5 A;  2HHH L;  5IGB A;  4X64 Q;  3OSO A;  3CKI B;  4A3F G;  3U50 C;  2DGY A;  4A3E H;  1BBU A;  2DNE A;  4K5X A;  1S40 A;  1STH A;  1DGS A;  1Y1V H;  4HED A;  4ILW A;  5KNB A;  4C1N K;  3MFY A;  2JA5 B;  2EJG C;  4LFB L;  2PNR C;  3K0Y A;  2B2W C;  3TBI B;  4KMU C;  2IW3 A;  2QGQ A;  4JG2 A;  1W6J A;  1DCZ A;  3MFG A;  5CC4 A;  2OQK A;  3K59 A;  2EYF A;  1WCM G;  4JBM A;  4N8X 1;  1GM5 A;  4JOI A;  3L3O C;  1RJT A;  2A6E D;  3D0F A;  4RG1 A;  1M4V A;  3J80 i;  2EYH A;  4LFC L;  3GQB A;  4KD4 A;  1FGB D;  1JJ2 A;  3A8K E;  3SK8 A;  1HUN A;  1HNZ L;  2KED A;  1F9R A;  4BBR G;  2JA5 H;  1UWV A;  4OWT B;  3ERO A;  4BY1 G;  2R93 B;  2A19 A;  2VW9 A;  4Q5V A;  1VMP A;  4NW2 A;  3CCJ A;  1KQS A;  4TKO B;  1TWC B;  2M00 A;  5IY0 A;  4HJ5 A;  2D5D A;  5I4D A;  3KFU A;  3K8A A;  4X66 L;  3F2U A;  1EIG A;  1S5D D;  3TZU A;  4JI8 Q;  4RHS A;  3QR8 A;  1WTH A;  2B2T A;  4FF3 A;  2XRS D;  3EQL C;  5D3I B;  4A3I G;  5T1I A;  1SEB D;  1JR0 D;  4PZ7 A;  4C2M H;  4FXG C;  1J6Q A;  2O5I C;  4XQQ A;  3VYU A;  2E2H B;  1S3O A;  2R93 H;  3PIO A;  1LT4 D;  5IT9 E;  2OXP A;  2XTI A;  3NE5 B;  3GV6 A;  4H0L C;  4OO1 I;  1MKH A;  1A3V A;  4FNF A;  4CJ1 B;  4IUP A;  4UHV A;  1Q8I A;  2MJ8 A;  3HGB A;  4JBJ A;  2AMC B;  4DR5 L;  4RGO S;  1JJG A;  1JMC A;  1LTB D;  4AQY L;  1EY4 A;  3NWT A;  2NVX B;  2E2I H;  4ZKB B;  1AP0 A;  1I4H A;  5IOD A;  3ITP A;  4DR6 Q;  1SNP A;  3PO3 G;  1TQO A;  3NSW A;  2B2U C;  1ENF A;  3KF6 B;  3K58 A;  1SNC A;  4DV2 L;  2WKC A;  4YWM A;  3OWF A;  1U4M A;  2FHT A;  3CME A;  4DV4 Q;  3T1Y Q;  3KBG A;  3BVZ A;  3L7Z C;  1GHJ A;  5M3F B;  3KF6 A;  3PO2 G;  2I0Q A;  1FJG Q;  1YZ6 A;  4IFD I;  4HIO A;  3OW2 A;  2HHH Q;  1N32 L;  4B3M Q;  1SYF A;  4ZK9 B;  3A56 A;  2I5H A;  2JA7 G;  2JA6 H;  2AHO B;  1Y1W B;  2PQA B;  3I4O A;  2B63 G;  1SFO B;  2F0F A;  1MJE A;  4DUZ L;  1EY8 A;  1IYU A;  3KJO A;  3A74 A;  1HZB A;  1H9S B;  1V8Q A;  4X65 Q;  1N33 Q;  3H3V C;  4KK7 A;  3RN5 A;  3J7A F;  1DYQ A;  4YCW A;  5C0X J;  5CV6 A;  2GN5 A;  1PFN A;  4HMI A;  5M3F H;  1OXX K;  4JK1 C;  4WRD A;  4JI1 L;  2H1E A;  3BVM A;  3RLN A;  5ELB A;  2KUM A;  2PQA A;  3BJU A;  2Q8I B;  4UY8 C;  2WB1 G;  1VQ8 A;  3J81 j;  4HJ7 A;  2VQE Q;  3GD7 A;  5C3E G;  1H9S A;  1KDB A;  1ROD A;  2C5C A;  4LFC Q;  2EE1 A;  2YV5 A;  1Q86 C;  3DWP A;  3TP5 A;  1YJW A;  4A3G H;  1HZA A;  4Y7N H;  1KIX A;  4C3J G;  2F3V A;  2V1C C;  4JW0 A;  4V19 0;  5J39 A;  4C3H G;  1RF2 D;  4JI3 Q;  2Z4I A;  4LF6 L;  1G6Z A;  1SDF A;  1LAB A;  4JV5 L;  2PNH A;  2PZU A;  1PA6 A;  3HS0 C;  4HCS A;  2JA9 A;  2WV6 D;  5AJ3 L;  2QEJ C;  1VQP A;  3HOV B;  4M1U B;  4JI2 Q;  3S1R H;  1CHQ D;  2FXQ A;  3I4L A;  5I6Y A;  3LWE A;  1G91 A;  4LUO A;  2VUM H;  3HZX A;  1GO3 E;  4DNR B;  1SXT A;  3KUP A;  1K0S A;  4O2D A;  2WIN B;  3SVM A;  1Q1B A;  1LTI D;  1IKM A;  5HGQ A;  2NN6 I;  4YIJ A;  1ILQ A;  4A93 H;  4GLV B;  4GKJ Q;  1PYW D;  4X62 L;  3TRE A;  2R7Z G;  1EIH A;  5M5Y H;  2AUJ D;  3ULL A;  2ZXR A;  4E6I A;  3FPU B;  1QCB D;  1PH9 A;  1KLU D;  2F0M A;  1KC8 C;  1TS5 A;  1HTP A;  2JYO A;  2NZH A;  4CJ0 B;  3K7A H;  1F2Y A;  1HQR D;  2ZTC A;  2CW0 D;  2LY7 A;  2LMC B;  4QF4 A;  4LF7 L;  3I4N B;  3CC4 A;  4DF7 A;  1KRT A;  2CQO A;  3WWV A;  1VQI A;  1HQM C;  5JJL A;  1PYS B;  3H91 A;  5IP9 H;  1WTO A;  4ZUI A;  1D1K A;  1N36 L;  4H7B A;  4POF A;  3S2D H;  1HA6 A;  1VQ4 A;  3FKI G;  1KAA A;  3JAM E;  1OO9 B;  1SE2 A;  4UP8 A;  2E2J H;  1KXL A;  3KOJ A;  2PO4 A;  4UP7 A;  1VQ6 A;  3FVQ A;  4QL5 A;  2OWO A;  2BCO A;  3GTL B;  1K9M C;  1HJP A;  1A2U A;  1TWH H;  5M3M G;  5C0X G;  1PTO C;  3DM1 A;  4O1N A;  4ULL A;  4XYQ A;  1JOR A;  1Y8O B;  4DR3 Q;  1BXT A;  1BBX C;  2B2W A;  2YU9 B;  1B44 D;  2SEB D;  4C3I G;  2K33 A;  3QWN A;  4DV5 L;  3J80 L;  1DD2 A;  5C44 G;  3D31 A;  1ZXT A;  4HN7 A;  2LXJ A;  1AZQ A;  4CDC C;  4DV6 L;  3S15 B;  4DKA C;  3VYS A;  5IYB G;  5IGF A;  1VQC A;  2F0Q A;  3HKZ B;  4B3T Q;  4PMW A;  4LF9 L;  2P5Z X;  4FF2 A;  1E2Z A;  1IZ6 A;  1NMG A;  1K3R A;  5EKK A;  4CDD C;  5DLQ E;  1SYG A;  3SK4 A;  2UU9 L;  2JSO A;  2NZO A;  3TME A;  3VR4 A;  5JJZ A;  1EIY B;  1NNX A;  4LF6 Q;  4L8J A;  4RKL A;  4DR7 L;  4QCL A;  1XWE A;  3GTJ B;  1MSG A;  5AJ3 Q;  4A3E G;  1VQF A;  3A0J A;  5LMN Q;  3HOY B;  3PIP 3;  4WJW A;  3AFQ A;  2JA8 H;  4DXG A;  3CPW A;  5C5M A;  1O7Z A;  3I91 A;  5IE8 A;  4DAV A;  3HEJ A;  1BR9 A;  4B3S L;  2IHE A;  1TII D;  5IP7 H;  1EL0 A;  5IYC H;  4GNX C;  1HFG A;  4JI0 Q;  3S2H B;  3P20 A;  4JI4 Q;  1TS2 A;  1F2L A;  1JC7 A;  2B2V A;  4IFD H;  2F4V Q;  5C0X I;  3MC0 B;  3T1H Q;  1YNN D;  3OMG A;  1A8V A;  2F0S A;  2JA5 G;  4G7O C;  4ZCK A;  4HID A;  4LF7 Q;  3CCL A;  5CYU A;  4PQX A;  2MO0 A;  4JOI C;  2B2U A;  3EJI A;  2KCM A;  1B70 B;  2PW5 A;  3IL8 A;  3GTK B;  1MJC A;  4LJZ C;  1FR3 A;  2F0N A;  1PH2 A;  3OWE B;  5GAG C;  5C4X B;  1C8C A;  3RZO B;  3OTO L;  2OQ0 A;  3M4O B;  1YJN A;  4RCO A;  4RGM A;  2IHF A;  2R93 G;  5D65 A;  5C4J H;  5JJI A;  5JPN C;  2KOL A;  4JYA L;  2PI2 A;  4KHZ A;  4CDF C;  4J6H A;  1CZG A; 
#chains in the Genus database with same CATH homology
 3PGZ A;  3PUZ A;  4UP9 A;  1X6O A;  3S16 H;  4QQB X;  2ZJR A;  2WP8 J;  1PHJ A;  4KI0 A;  4AYB G;  1AE2 A;  1XNQ L;  2GVB A;  1YIJ A;  5C4X H;  4DR1 L;  3OYY A;  2Z6K A;  3BZK A;  2E5L Q;  5M3M H;  3U58 A;  2K50 A;  2E2H H;  3M4O H;  2IY5 B;  3CCS A;  3I4M H;  4IJL A;  5FLX c;  4MTN A;  4GOP B;  1VQG A;  1L1O B;  1C7Y A;  3I4M G;  4KHP L;  4DV3 Q;  4DUY Q;  3HOU H;  4A4I A;  4TVA B;  1PVO A;  2K14 A;  3EN2 A;  3H3V H;  1LM0 A;  5ELO A;  3S24 A;  3HOU G;  1G51 A;  4OWW B;  4C3I H;  5JEA G;  1IYJ B;  2IX0 A;  1PH6 A;  1N9W A;  4DNI A;  4IPG A;  1K0R A;  3W5O A;  1CSP A;  2YTY A;  3AQQ A;  2HQL A;  4DV3 L;  3KJP A;  4KLK A;  4DUY L;  4GOP A;  3H15 A;  1L1O A;  4A3D H;  1UE6 A;  5JJK A;  4LUZ A;  2MQH A;  1PH1 A;  4LF9 Q;  4A3D G;  3B6Y A;  4OXP A;  1HNX Q;  2NVX H;  3G71 A;  2JEB I;  2C35 B;  2NN6 G;  2N8N A;  1KAW A;  1VQ5 A;  3GTQ H;  3PUV A;  1IBK Q;  1Q81 C;  1NE3 A;  1TWF H;  2CWA A;  5ELN A;  3RNU A;  1PH8 A;  4OO1 G;  1E1T A;  4DV4 L;  1BBW A;  3G48 A;  1HNX L;  3K80 C;  1G6P A;  2RCN A;  4MNO A;  5IYD G;  2D62 A;  2F52 A;  2YYZ A;  3ZJY C;  4DR7 Q;  4A76 A;  1YBY A;  1FJG L;  5LMU L;  4DR2 Q;  1X56 A;  1UE5 A;  2HHH L;  4A3F H;  2JQO A;  1I5F A;  4X64 Q;  3CMA A;  1WFQ A;  4A3F G;  1UE1 A;  3U50 C;  1WYD A;  2LXK A;  2DGY A;  4YHH Q;  4LFB Q;  2CCZ A;  3KLW A;  2CFM A;  3FP9 A;  5GAD C;  4A3E H;  1BBU A;  1FGU A;  3PUW A;  4L5Q A;  4DR2 L;  2WB1 E;  5M5X H;  3PF5 A;  2KHJ A;  1S40 A;  1X3E A;  1XJV A;  1DGS A;  1Y1V H;  5M3F G;  4X64 L;  4DR4 Q;  4BBS H;  4RMF A;  1I50 H;  1Y1V G;  4YHH L;  1NMF A;  1QVF A;  4LFB L;  4WJ3 M;  1EOV A;  4LUV A;  1Y1W H;  1C9O A;  2QGQ A;  4JG2 A;  2OQK A;  3RLO A;  3JAM i;  4H02 A;  3CD6 A;  1Y1W G;  2A1A A;  1SFO H;  4HJ8 A;  2OTL A;  1KD1 C;  4DR4 L;  1WCM G;  3ERS X;  4JBM A;  4QJF A;  1J5E Q;  2VS1 A;  1NY4 A;  1GM5 A;  1HNZ Q;  4JOI A;  1IBM L;  4A3C H;  3M9B A;  4B3R Q;  3D0F A;  1JJC B;  1OXV A;  4RG1 A;  3CAM A;  2XGT A;  2JK8 A;  4A3C G;  3J80 i;  3ULJ A;  4LFC L;  5BR8 Q;  2K5N A;  1BVS A;  1OXS C;  3HKZ E;  1EWI A;  3NEL A;  5LMN W;  1JJ2 A;  1ASY A;  4BBR H;  4HIK A;  1J5E L;  5GQO A;  3GDE A;  3CCU A;  4R1J A;  1HNZ L;  4TQU S;  4X66 Q;  4BY1 H;  3K0X A;  3BZC A;  4BBR G;  4B3R L;  2JA5 H;  1UWV A;  4OWT B;  2KBN A;  4BY1 G;  4L5S A;  4NXN L;  5BR8 L;  2A19 A;  1CKN A;  3PUY A;  2VW9 A;  3S14 H;  1EYG A;  3W1B A;  3CCJ A;  1KQS A;  4OON A;  2ATW A;  5IY0 A;  1GD7 A;  4HJ5 A;  3H3V I;  3KFU A;  3TRZ A;  1VQE A;  3K8A A;  2YTX A;  4X66 L;  2K75 A;  4PG3 A;  4DK6 C;  4JC0 A;  1XPO A;  3S1N H;  4HJ9 A;  4DAY B;  1YIT A;  4GLA C;  1XMO L;  1PH7 A;  2EIF A;  4OWX B;  4JI8 Q;  4R4O A;  1XPU A;  3CC7 A;  4A3I H;  2N49 A;  3U4V A;  2UUC Q;  4BA2 I;  3MXN B;  4BA1 I;  3HOZ H;  1N8R C;  3S17 H;  4A3I G;  4IOA A;  2E8G A;  4PZ7 A;  4C2M H;  3HOZ G;  2GVA A;  1YHQ A;  1J6Q A;  3I2Z A;  1S3O A;  1K8G A;  1H95 A;  1RL2 A;  4JI8 L;  3G4S A;  2R93 H;  3PIO A;  2NVY H;  2XTI A;  2NVT H;  1V43 A;  4DR5 Q;  1JE5 A;  4OO1 I;  1MKH A;  3KDF A;  1Z9F A;  3A5U A;  3HOV H;  2K4K A;  4AQY Q;  2ES2 A;  1VQB A;  1P8L A;  3NEN A;  4APV A;  1JB7 A;  3HOV G;  3KYH C;  3I7F A;  3PV0 A;  4JBJ A;  2AMC B;  4DR5 L;  4R4I A;  2JEA I;  1JJG A;  1JMC A;  1FL0 A;  1P16 A;  4NPS A;  4KHP Q;  4AQY L;  2N3S A;  4HIM A;  2E2I H;  1QUQ B;  3RN2 A;  1Q1E A;  1CKO A;  4DR6 Q;  4DV2 Q;  1YJ9 A;  3TEH B;  2Q2T A;  3PO3 H;  5IP9 G;  1SN8 A;  1EIF A;  3PO3 G;  2UXC Q;  1B7Y B;  4R4C A;  3TQY A;  3KF6 B;  2QA4 A;  4JI5 L;  4PZ8 A;  4DR6 L;  4DV2 L;  4BXX H;  1QUQ A;  2RHQ B;  4GN5 A;  1XPR A;  1CUK A;  1TXY A;  4BXX G;  3I4N H;  1N32 Q;  4YWM A;  2UXC L;  1T9H A;  2UUA Q;  4EQ5 A;  3CME A;  3I4N G;  1Z47 A;  4DV4 Q;  3T1Y Q;  1EUJ A;  3L7Z C;  4OX9 L;  3I56 A;  1XNR Q;  4ME3 A;  2JJQ A;  2VQF Q;  3PO2 G;  3KF6 A;  4UPA A;  3M3Y H;  2I0Q A;  1FJG Q;  5LMU Q;  1YZ6 A;  4IFD I;  4DUZ Q;  4HIO A;  4GNX B;  3OW2 A;  2HHH Q;  1N32 L;  2R7F A;  4B3M Q;  5IYD H;  2UUA L;  3EBE A;  4GLX A;  3T1Y L;  2I5H A;  3S1Q H;  5GAE C;  2JA7 G;  2B63 H;  1XNR L;  2MFI A;  2AHO B;  2JA6 H;  4JCV E;  2VQF L;  1NBW A;  2PQA B;  3I4O A;  4YY3 L;  4JI6 Q;  2B63 G;  2BH2 A;  1MJE A;  2JA6 G;  4DUZ L;  1CKM A;  4J15 A;  1O7I A;  4JI1 Q;  3KJO A;  3A74 A;  1HZB A;  1Q12 A;  1UEB A;  2ZM6 Q;  4B3M L;  2R92 G;  4LFA L;  4X65 Q;  3GTL H;  4GNX A;  1N33 Q;  1KRS A;  1Q82 C;  3RN5 A;  4YCW A;  5C0X J;  3PF4 A;  3S1M H;  2GN5 A;  2LSS A;  4PZ6 A;  5M3F H;  1OXX K;  3CW2 C;  4JI6 L;  4IPD A;  1KHI A;  3STB C;  4JI1 L;  3RLN A;  4A3G H;  3Q8D A;  2PQA A;  3BJU A;  3U4Z A;  5C3E H;  4EX5 A;  2ZM6 L;  3F8T A;  2WB1 G;  4X65 L;  1VQ8 A;  4UY8 C;  2I5M X;  4P74 A;  3J81 j;  2VQE Q;  4HJ7 A;  3GD7 A;  1N33 L;  5C3E G;  1IBM Q;  4LF8 Q;  2KHI A;  4GKK Q;  1IXR A;  2PMZ E;  3M4P A;  2YU9 H;  1XTD A;  1WCM H;  2VL6 A;  2VY3 A;  4GOP C;  3H0G H;  4DV0 L;  4LFC Q;  2YV5 A;  1L1O C;  1Q86 C;  2UXD L;  2Q2H A;  1YJW A;  3H0G G;  4C3J H;  4XIG S;  5M5W H;  1HZA A;  3NEM A;  2VQE L;  2D0O A;  1SRO A;  4Y7N H;  4LF8 L;  4JV5 Q;  2VNU D;  1KIX A;  1KL9 A;  4GKK L;  4A3G G;  1CKN B;  1SR3 A;  1VQH A;  1VQO A;  2V1C C;  4A3L G;  4BY7 G;  1QZG A;  4C3H H;  4DV7 Q;  1VQM A;  4NXN Q;  3S15 H;  1RIP A;  1SRU A;  2D0P A;  1E24 A;  1YEZ A;  3HKS A;  4R4Q A;  4L5T A;  4JI3 Q;  3HOW H;  4LF6 L;  1NJI C;  3HKZ G;  3M4Q A;  1U0L A;  1HR0 Q;  2PNH A;  1N34 Q;  4JV5 L;  1PA6 A;  1VS0 A;  3HOW G;  4LF4 Q;  4MZ9 A;  2JA9 A;  1X3F A;  5H1S E;  1XMO Q;  4DV7 L;  5AJ3 L;  5K36 G;  1W2B A;  1QVC A;  1VQP A;  1Q46 A;  2B29 A;  3EIV A;  4JI3 L;  2R6G A;  4JI2 Q;  2BA0 A;  2ASB A;  2UXB Q;  3S1R H;  1HH2 P;  1X3G A;  2FXQ A;  1N34 L;  1HR0 L;  3NBH B;  3F2B A;  1HNW L;  4LUO A;  4LF4 L;  1X9N A;  5IYC G;  1AH9 A;  2ID0 A;  2VUM H;  1GO3 E;  2I5L X;  3KDF B;  3GTJ H;  4A75 A;  2UUB Q;  3I55 A;  4O2D A;  4A3K G;  3BU2 A;  4X62 Q;  2VUM G;  4JI2 L;  1Q1B A;  1QZH A;  4A3M H;  1AE3 A;  3HOY H;  2UXB L;  4AIM A;  1YVC A;  5HGQ A;  2NN6 I;  1PH3 A;  4HJA A;  3HOY G;  4A3M G;  4A93 H;  3UDX A;  4GLV B;  1VQK A;  3GTP H;  4GKJ Q;  2R7Z H;  2UUB L;  4A93 G;  3A5Z B;  3TS2 A;  4X62 L;  3TRE A;  2BH8 A;  2R7Z G;  3J7A 5;  1ASZ A;  5M5Y H;  2AWN A;  3ULL A;  3DM3 A;  5E7N A;  3S2H H;  3ICE A;  2UXD Q;  2AWO A;  2B3G A;  1Q7Y C;  1PH9 A;  4GKJ L;  1QVG A;  1KC8 C;  1MIU A;  3UDF A;  1BKB A;  2Q2I A;  2NZH A;  3CCR A;  4LNQ A;  3K7A H;  1LUZ A;  2VZA A;  2ZTC A;  3J81 i;  4LF7 L;  3CC4 A;  1K8A C;  1VQ9 A;  2OCE A;  1N36 Q;  1KRT A;  2CQO A;  3AYH B;  1VQI A;  3WWV A;  2K5H A;  5JJL A;  3L0O A;  2ZJQ A;  1PYS B;  4JI5 Q;  2WAQ E;  5IP9 H;  3UE0 A;  2A8V A;  4K0K L;  3F2D A;  3CPF A;  2WAQ G;  2CWP A;  3TS0 A;  1N36 L;  3K7U C;  4POF A;  3S2D H;  4FDB A;  1VQ4 A;  1FVI A;  3FKI G;  4IJH A;  4GN4 B;  3E9H A;  4OX9 Q;  4AYB E;  4UP8 A;  2BA1 A;  2E2J H;  3GTK H;  3CCV A;  1WOC A;  1KXL A;  4YWK A;  3KOJ A;  1G29 1;  4UP7 A;  2DUD A;  3CC2 A;  1VQ6 A;  4QL5 A;  2PI2 E;  2OWO A;  1U5K A;  3RZO H;  1IBL L;  5EAY A;  1K9M C;  3PO2 H;  1SLJ A;  1PH5 A;  5C4X G;  4JI7 L;  1HJP A;  4Y52 H;  1TWH H;  5M3M G;  2RHS B;  5C0X G;  1EQQ A;  4YY3 Q;  4DV5 Q;  1L2F A;  2ALY B;  3E0E A;  2JA7 H;  3RR5 A;  2MNA A;  2E5L L;  4LFA Q;  4DR3 Q;  1CSQ A;  1K83 H;  1WJJ A;  4DV1 Q;  3UDG A;  4WJ4 A;  2AKW B;  1X54 A;  1M1K C;  4DV6 Q;  2OTJ A;  3GTG H;  2QEX A;  1LYL A;  1OXT A;  1NTG A;  1SE8 A;  2JE6 I;  3GO5 A;  5C44 H;  4DV5 L;  1I3Q H;  2R92 H;  1YHB A;  3J81 c;  3PIP A;  5C44 G;  2K52 A;  1VQL A;  4LWC A;  4DR3 L;  3D31 A;  4DPG A;  1I6H H;  2Z6K C;  2LXJ A;  4IO9 A;  4DV1 L;  5GAH C;  4LF5 Q;  5IYB H;  3CCM A;  3RZD H;  3F1Z A;  4DV6 L;  1E22 A;  1TWG H;  4P71 A;  4DKA C;  3G6E A;  2UU9 Q;  5IYB G;  1VQC A;  2EXD A;  2HIX A;  1A0I A;  4B3T Q;  4DV0 Q;  4PMW A;  4YWL A;  4LF9 L;  1X55 A;  1L0W A;  1PV4 A;  1C0A A;  1VQJ A;  3FHW A;  1VQN A;  4O0A A;  5JEA J;  1R9T H;  1IZ6 A;  1NMG A;  1B8A A;  4LF5 L;  2Q2U A;  3CXC A;  2HT1 A;  3GTM H;  1K3R A;  4X6A H;  4P73 A;  4IPH A;  5DLQ E;  4P72 A;  2UU9 L;  3VDY A;  1D7Q A;  1S72 A;  1IBK L;  3PCO B;  2NZO A;  4DAM A;  4B3T L;  3DLL A;  3STB D;  4LW1 A;  1JT8 A;  1E7Z A;  1EIY B;  5FJ8 H;  2RF4 A;  3ER0 A;  4LF6 Q;  4A3L H;  4BY7 H;  3SGI A;  1HZ9 A;  2N78 A;  1A63 A;  1OTC A;  4DR7 L;  5FJ8 G;  4AH6 A;  2KCT A;  1GKH A;  1SMX A;  5AJ3 Q;  3HOX H;  1VQF A;  2K5V A;  1Y14 B;  4A3E G;  3A0J A;  5LMN Q;  4IPC A;  4R4T A;  5J3B A;  4B3S Q;  1D8L A;  3HOX G;  3HFZ B;  4POG A;  1V9P A;  3F2C A;  4BBS G;  1HNW Q;  3AFQ A;  2JA8 H;  3CPW A;  2WFW A;  2ZJP A;  4QGU A;  5IE8 A;  1VQ7 A;  2JA8 G;  4QIW E;  2EQS A;  5LMN L;  4L5R C;  4A3B H;  3CCE A;  2ZTD A;  4B3S L;  2IHE A;  5IP7 H;  4QY7 A;  3RLF A;  3L2P A;  3MEF A;  2IX1 A;  3PSI A;  5IYC H;  4GNX C;  4A3B G;  4JI0 Q;  5IP7 G;  4NXM Q;  1K73 C;  1EFW A;  1YNX A;  5GRO A;  3JC6 6;  4A3K H;  4JBK A;  4GS3 A;  4NB3 A;  4JI4 Q;  5IT9 c;  1XMQ Q;  4P75 A;  2YTV A;  4IOC A;  1PH4 A;  2NVQ H;  1A62 A;  2F4V Q;  5C0X I;  3K81 C;  3T1H Q;  1HR0 W;  4JI0 L;  5IWA Q;  4NXM L;  3UDI A;  4IFD G;  1A8V A;  4GN3 B;  3E9I A;  3W1G A;  2JA5 G;  4JI4 L;  1XMQ L;  1OXU A;  2Z0S A;  3GTO H;  2KEN A;  4DK3 C;  1YHA A;  1EQR A;  3PUX A;  4HID A;  2F4V L;  1VCI A;  4A3J H;  3T1H L;  4LF7 Q;  3M85 A;  5IWA L;  4ALP A;  3CCL A;  2MO0 A;  4JOI C;  3M7N A;  2MO1 A;  2Y0S E;  1LTL A;  2H5X A;  3OTO Q;  3CCQ A;  2KCM A;  4A3J G;  1B70 B;  2IT1 A;  3AFP A;  1E3P A;  4XTC S;  3CQZ H;  2R7D A;  1X65 A;  2Y0S G;  1MJC A;  1PFS A;  1PYB A;  4YCU A;  1PH2 A;  3J7Z C;  3UE1 A;  5GAG C;  3ULP A;  1VQD A;  4K0K Q;  4IFD J;  2CKZ B;  2L15 A;  2OQ0 A;  4YCV A;  3OTO L;  1YJN A;  5HY6 A;  3AEV A;  1W3S A;  1E1O A;  3IRB A;  4JYA Q;  5FLM H;  3JAM c;  3CP0 A;  3LGJ A;  2UUC L;  2IHF A;  3CF5 A;  1I94 Q;  1TWC H;  4JBW A;  2R93 G;  5FLM G;  1IL2 A;  1UE7 A;  1M90 C;  1VQA A;  5C4J H;  2ZTE A;  3KF8 B;  5JJI A;  1XNQ Q;  1GVP A;  1Q8K A;  4DR1 Q;  2F3I A;  3FKI H;  1V1Q A;  2HIV A;  4JYA L;  1TWA H;  2PI2 A;  4KHZ A;  1IBL Q;  1HZC A;  1WI5 A;  3J80 c;  1YI2 A;  4JI7 Q;  1I94 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...