4R4OA

Crystal structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamothioyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
molecule keywords Replication protein A 70 kDa DNA-binding subunit
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4oA00
2I5HA 4PZ7A 3K0XA 4DR3Q 1XMQQ 1LM0A 3J81j 1EQRA 1G291 2LXJA 1PA6A 2BH2A 3HOZG 4AH6A 4A93H 4GLVB 4AYBE 4J15A 4LW1A 5ELOA 1Q7YC 2MQHA 5GROA 3U4VA 2ZTCA 1YHBA 1VQIA 2N3SA 1JB7A 3HOWG 1K0RA 3OTOQ 2ZJPA 2OQ0A 2N49A 3KF6A 3TEHB 2UUAQ 1YIJA 3T1YL 3I56A 2A19A 2CWPA 4A3BH 2YV5A 1VQ8A 5LMNQ 4A3DG 3GTJH 4A3JG 4KHPL 3W5OA 2Z0SA 2NVYH 3H0GH 4JI3Q 1PH1A 4IFDJ 3HKSA 5FLMG 4EX5A 4GOPB 4A3CH 4DUYQ 1N36L 3H0GG 2LSSA 1D8LA 2I0QA 4A3KH 1QZHA 3TQYA 4DV5Q 1RL2A 1IZ6A 1X55A 3GDEA 1WCMH 3L0OA 4QJFA 4A3EH 4A3CG 3K80C 4AQYL 2I5LX 1EWIA 1PYBA 1TWCH 2Q2HA 1W2BA 1GM5A 2GVAA 3CCUA 2F3IA 1N8RC 1WCMG 4R4TA 3UDIA 4A3EG 4OX9Q 2R7ZG 3RZOH 4GNXA 1M90C 1MKHA 4MNOA 5C4JH 1FJGQ 2JA5G 2CKZB 5IT9c 4GLAC 1J5EL 1JT8A 4IJLA 4A3IH 2JA6H 1UWVA 1LUZA 3HKZG 3CCEA 1HR0L 3JAMi 2B63H 3GO5A 1X6OA 3I4MH 3J7ZC 1BBUA 3J80i 3I2ZA 5BR8Q 3U4ZA 1CSQA 5JEAJ 1PH3A 1A8VA 3S1QH 1AH9A 4X65Q 4A3IG 2JA6G 3FHWA 1HH2P 1YBYA 2B63G 3I4NH 4B3MQ 4A3MH 4LF6Q 1FGUA 3HFZB 3IRBA 3Q8DA 4O0AA 1VQLA 4ALPA 2NVQH 2WAQE 1DGSA 4DR5Q 4JI7L 4DV6L 2A1AA 5C3EG 4A3MG 1ASYA 2IX1A 2RHSB 2F4VL 2Q2IA 4YWKA 1PH6A 3RZDH 3MEFA 3D31A 2AMCB 1VQ9A 4LFBQ 1B70B 3D0FA 2WB1E 1I94Q 4X66L 1IYJB 4JG2A 1IBKL 3AFPA 4P73A 3T1YQ 3E9IA 2NN6G 4HJ7A 4WJ4A 2VQFQ 3B6YA 1VQ6A 4NB3A 1U0LA 1PH8A 3JC66 4H02A 4HIKA 3HOXG 1YJWA 4B3TQ 3U58A 1SFOH 2XTIA 1EQQA 4DAMA 4IOAA 1AE3A 1MJEA 3TS2A 4IFDG 3PV0A 1OXTA 1PVOA 4DUZL 2K75A 1JJGA 1VQNA 1PV4A 1HNZL 4L5SA 2ATWA 3BU2A 4ME3A 4R4QA 1QZGA 2Y0SG 2C35B 4B3RL 4GOPA 1BVSA 2ZM6L 3KOJA 4YHHQ 3RNUA 1JE5A 5IP7G 5FJ8G 4KI0A 1NMGA 1HZ9A 2AWNA 3AQQA 4DR1L 4AQYQ 1E1TA 2QEXA 2UU9Q 1UEBA 1X3EA 1W3SA 1BBWA 4JI8L 2R7FA 4GN5A 4OXPA 3CCSA 4GN3B 3H15A 1OTCA 2OTLA 1Y1VH 5H1SE 4HJ9A 3GTPH 1Q1BA 4A4IA 3M85A 2UUBQ 4JI5L 4LF8L 2E2HH 3HOYH 1OXSC 1XJVA 3CC4A 1KXLA 2IHFA 1JJ2A 1WFQA 2JJQA 4LF4Q 3GTQH 3GTLH 4OWWB 3K7UC 4UP7A 1N9WA 1GD7A 1I3QH 4BY1G 1VQDA 3HOYG 2GVBA 4DV0L 5GAHC 2UXBL 2RHQB 4PZ8A 2KENA 1N34L 4GNXC 5JEAG 1L0WA 3HOVH 4LF7L 4LF5L 1KHIA 2JEBI 2N78A 1E24A 1T9HA 2LXKA 1VQOA 1VQMA 1XMOQ 1XNRQ 5EAYA 4JI0L 1WOCA 4BY7H 2E5LL 3RLNA 1YITA 1P8LA 4NXNL 4YY3L 4JI7Q 2DUDA 1YJNA 4DV6Q 4LUZA 4LFCL 1ASZA 3RN5A 4QQBX 3HKZE 2F4VQ 4BY7G 1K3RA 1D7QA 3S24A 2PQAB 2UUCQ 2KCMA 4DK3C 3HOWH 1A62A 1XTDA 1YHAA 1HZAA 2VY3A 4IPGA 2PMZE 3ULJA 2VQEL 3T1HL 2NVXH 1N33L 5AJ3L 1VQ5A 1VQJA 5GQOA 4DV7Q 4A76A 3CD6A 1NBWA 3PO3G 4A3DH 4A3JH 1VQGA 2RF4A 3NELA 4DUZQ 1Q8KA 1KC8C 1L1OB 3G48A 1K9MC 3KFUA 4DR4L 1SN8A 2VW9A 4DKAC 1HNZQ 4A3GH 1EIFA 1E3PA 1MJCA 4JI1L 3J81c 1IXRA 2VL6A 5FLMH 3KJOA 2YTXA 5LMUL 2ZM6Q 4B3SQ 4B3RQ 5JJIA 1TXYA 3EBEA 1YEZA 4KLKA 4GKJQ 1Q1EA 2IY5B 3CCMA 5IYCG 1PFSA 4YCVA 1V1QA 2HIVA 5IP9H 1XPOA 4A3GG 4KHZA 4JI4L 4JI8Q 3CCLA 4JOIA 3NEMA 4X62Q 1R9TH 2VUMG 5GAGC 4LFAL 1OXUA 5C0XI 3NENA 4QY7A 1Y1WH 2Z6KA 1SE8A 1UE6A 2BA0A 5GAEC 1X65A 5LMNW 4DV1L 2PI2E 5IP9G 3CCQA 1CKOA 5JJLA 3STBD 2ID0A 1X3GA 4GKKQ 4GOPC 2E2IH 4LF8Q 2R7ZH 4DNIA 3WWVA 3UE0A 1Y1WG 2MO1A 4BA2I 2JA5H 2YU9H 2KCTA 3K81C 4JBMA 4YWMA 1IBMQ 1A0IA 4JYAQ 1CSPA 1OXVA 1VCIA 3HOUG 4BXXH 1N34Q 3BJUA 4LF7Q 3CF5A 2HT1A 3AYHB 4K0KQ 1I50H 1PH9A 3LGJA 4JI0Q 4BXXG 1VQKA 1SRUA 2UXDL 2IT1A 2K5VA 4YY3Q 2IHEA 3F2CA 4DV4Q 4HIMA 4IPCA 4DR2Q 1K8GA 4L5RC 5E7NA 1J6QA 2CWAA 3M4QA 5C3EH 3PF4A 2EXDA 5JJKA 4OO1I 1TWGH 3AFQA 1WI5A 3CCVA 4LUOA 1HNWL 1PH7A 2PQAA 1L2FA 2R7DA 4DV2L 2AWOA 4QL5A 4HIDA 2JA7G 1N33Q 2K14A 1Q46A 1VQCA 1VS0A 2K5NA 4JI2L 1XPUA 4DR6L 3HOXH 1Q81C 3E9HA 1VQHA 4DR4Q 4Y7NH 1N32L 3I4OA 2K50A 4JI1Q 1B7YB 1VQ7A 4P74A 2UXDQ 2PI2A 3CW2C 3L7ZC 1L1OA 5IWAL 5C44H 4KHPQ 3UDFA 2Q2UA 1CKNA 3ULPA 3PCOB 3OW2A 1K73C 3KLWA 1KD1C 2JK8A 5M3FH 1WJJA 5IP7H 5FJ8H 5C44G 4YWLA 3I7FA 1N36Q 4A3LH 5HY6A 5M3FG 3EIVA 1IBLL 2KHJA 4A3FH 1O7IA 4L5QA 3MXNB 3UDGA 1HJPA 4TVAB 1I5FA 5ELNA 4A3LG 1C9OA 4DR3L 1XMQL 5GADC 4IOCA 2R93H 1AE2A 4A3FG 4JOIC 4X6AH 2L15A 2F52A 4NPSA 4NXML 4R4CA 3K7AH 5C0XJ 4BY1H 3GTKH 1CKMA 3OTOL 2RCNA 2R93G 4P72A 3ICEA 4X64L 3G71A 3F2BA 4WJ3M 1GKHA 1SROA 3DLLA 1GO3E 4BBRH 2QA4A 4P75A 4DAYB 1XPRA 5LMNL 1HR0Q 2A8VA 4EQ5A 3PO2G 4UP8A 3CXCA 2OTJA 4R4IA 2JE6I 4BBRG 1SLJA 5IE8A 2ASBA 4JI6Q 3GTMH 2UXCL 1C7YA 2VZAA 3J81i 3CP0A 1TWHH 1B8AA 2JA8H 4DV5L 3H3VI 3G4SA 2ZTDA 3CMAA 4DV2Q 3S2HH 2HHHL 3STBC 1IL2A 1G51A 2JQOA 3K8AA 2MNAA 3TRZA 2JA9A 1TWFH 3RLFA 2JA8G 2K5HA 2OQKA 4HJAA 1G6PA 3CAMA 4YCWA 2K4KA 4JV5L 1PH4A 2MFIA 4X66Q 1IBKQ 1KL9A 2D62A 2YTYA 4JBJA 4MTNA 2OCEA 2NZOA 1PH2A 3TS0A 3PO3H 1N32Q 3VDYA 2NVTH 4O2DA 2KHIA 1YI2A 3G6EA 3S16H 3FKIH 3PUWA 4AIMA 5IY0A 2WAQG 2V1CC 3S17H 4IO9A 1YJ9A 1E1OA 4POGA 1FVIA 4P71A 1KAWA 2N8NA 2ZTEA 4MZ9A 2YYZA 3FKIG 2BH8A 1HZCA 1YHQA 3PF5A 5IYCH 4YCUA 1VQEA 3W1BA 1EFWA 5BR8L 2WB1G 3S1NH 1CKNB 1Z47A 4X65L 2VUMH 3S1MH 3CC2A 2DGYA 1L1OC 2HQLA 4DR1Q 1Q86C 1J5EQ 4LF6L 1WYDA 2GN5A 1M1KC 1JJCB 3ER0A 1SMXA 4OWXB 2ALYB 2D0OA 2EQSA 2FXQA 1NY4A 2EIFA 3NBHB 4PG3A 4DR5L 1EUJA 1A63A 1EIYB 3CCJA 3OYYA 5C4XH 4NXMQ 1XNQL 1UE5A 4GLXA 5C0XG 2XGTA 4IJHA 2ZJRA 4JI5Q 3PUXA 4UPAA 4A93G 4LFBL 4R1JA 4UP9A 1I94L 4X64Q 4DR7L 2Y0SE 3PSIA 3HOUH 5C4XG 1H95A 2JEAI 3RLOA 3A5ZB 3F2DA 2VQFL 1BKBA 1V43A 3PGZA 4XIGS 5HGQA 3CPWA 3U50C 4B3TL 4DV0Q 4LNQA 3A0JA 4FDBA 2UXBQ 1OXXK 3BZCA 4A3BG 1UE7A 4LF5Q 3S2DH 3BZKA 3CQZH 1NJIC 4LF9L 1GVPA 3M3YH 2UXCQ 1Y14B 3W1GA 4HJ5A 1QVCA 2ZJQA 1E22A 3F1ZA 3PUVA 2PNHA 3RR5A 1QUQB 4QGUA 2E5LQ 4DV3L 3GTOH 4NXNQ 5M5WH 2HHHQ 4YHHL 1VQFA 1X54A 4LFCQ 2WP8J 2D0PA 1X56A 4A3KG 2UU9L 2JA7H 4QIWE 4JV5Q 2ES2A 1I6HH 3CPFA 4RG1A 3UDXA 1C0AA 3A5UA 3DM3A 4OO1G 3KDFB 2KBNA 2VQEQ 3T1HQ 2UUBL 2VNUD 5AJ3Q 5IYDH 2R6GA 3L2PA 4LF4L 3PUYA 4C2MH 3M4OH 1K83H 3KYHC 3SGIA 1S40A 5M3MH 1E7ZA 4BBSH 1KRSA 3F8TA 3M4PA 4GN4B 4L5TA 4PZ6A 1FL0A 1KIXA 5IYDG 4UY8C 5LMUQ 1X3FA 2QGQA 3A74A 4JBWA 5M3MG 3S14H 4BBSG 3PIPA 3FP9A 4AYBG 4IPDA 1XMOL 3I4MG 4JC0A 1EYGA 1XNRL 4DPGA 4LWCA 4JI4Q 3S1RH 1NMFA 4PMWA 3CCRA 2VS1A 5FLXc 4HJ8A 4LFAQ 3RN2A 5DLQE 4LUVA 1KRTA 3KJPA 3I4NG 3J7A5 1XNQQ 4DV1Q 2B3GA 3TREA 1HNXL 1U5KA 4POFA 2NN6I 2UUCL 1VQBA 4DR7Q 1PYSB 2AKWB 1V9PA 1VQPA 1KQSA 4C3JH 1MIUA 3M9BA 3JAMc 2YTVA 4C3HH 4DV7L 1S3OA 3KF6B 1PHJA 3AEVA 2H5XA 4IFDI 2Z6KC 3KF8B 3J80c 2CQOA 4GS3A 4C3IH 3PO2H 3M7NA 1K8AC 4LF9Q 2CCZA 2B29A 1PH5A 2UUAL 2Q2TA 1RIPA 1SR3A 4BA1I 1VQ4A 4JI6L 3ZJYC 2WFWA 4B3SL 3GTGH 4DV3Q 4DK6C 4JI3L 1EOVA 4GKJL 1QUQA 1LTLA 1X9NA 1UE1A 1YNXA 3H3VH 4APVA 1CUKA 4X62L 4DUYL 5M5YH 2MO0A 4JBKA 1VQAA 1HNWQ 1Q12A 1HZBA 1HR0W 3ULLA 1QVFA 5M5XH 3GD7A 3CMEA 1YZ6A 4GKKL 5J3BA 4Y52H 3I55A 1JMCA 2R92H 2E8GA 3KDFA 4XTCS 4JI2Q 2OWOA 1Y1VG 1S72A 2HIXA 4DR6Q 4IPHA 5K36G 2IX0A 4GNXB 3ERSX 4OONA 3S15H 1P16A 2CFMA 4TQUS 3CC7A 4OX9L 5IYBH 1IBML 2R92G 3EN2A 3E0EA 1NE3A 4JYAL 1Z9FA 1FJGL 1TWAH 5IWAQ 3PIOA 4RMFA 3PUZA 4JCVE 2BA1A 2K52A 1Q82C 4K0KL 5IYBG 4OWTB 2AHOB 1LYLA 1YVCA 4HIOA 2I5MX 3HOVG 2NZHA 1NTGA 1QVGA 3UE1A 4A75A 4DV4L 4DR2L 3HOZH 2E2JH 1IBLQ 1HNXQ 4B3ML 4R4OA
chains in the Genus database with same CATH superfamily
2I5HA 1D1KA 4HMJA 1XMQQ 1B2TA 1EQRA 1HA5A 2LXJA 3QB3A 3FPUB 2QILA 4A3FB 2LMCB 4LW1A 1STEA 1WTVA 3HOWG 1CHPD 2OQ0A 4EVOA 4C3JB 1YIJA 2EY1A 1PZKD 4XYOA 2DJGC 3K7AB 4C3HB 1MSGA 4O1NA 3PQIA 2Z0SA 3HGBA 5I2YA 4QIWB 4IFDJ 5FLMG 1UEAB 2NTSA 4GOPB 4DUYQ 3RUZA 4KKTA 3Q24A 3Q0AA 3C1EA 5G3LF 3L0OA 2F0HA 3K80C 1I4QA 3D4DA 2LFNA 1TWCH 1TWHB 5EBCA 1HUNA 1N8RC 2B39A 4GNXA 5CV5A 2B8GA 4MNOA 3VYTA 1FJGQ 2JA5G 3CU7A 5EKKA 2CKZB 4HEDA 1JT8A 3URYA 1Q3LA 4A3IH 3CCEA 2NVTB 3AU7A 5BR8Q 1CSQA 2WB1B 3SXHA 4FF3A 3S1QH 4X65Q 4A3IG 4NDXA 1FNUA 4A3MH 1CA5A 3IRBA 4CKCA 1VQLA 2B2UC 3GP7A 3MTSA 4RGOS 2WAQE 4ALPA 3S1NB 1DGSA 2A1AA 4A3MG 1Z7TA 4I65A 1CTMA 2Q2IA 3NQIA 2X6GA 3MEFA 3D31A 2AMCB 1KDAA 4X66L 1GUTA 1IBKL 4P73A 2NN6G 2PO4A 5C4XB 4HJ7A 2VQFQ 1KNEA 3BVGA 1U0LA 5EJWA 5IGCA 1Q8IA 3HOXG 4XXEA 3BDOA 5CGKA 3BZDB 2RBMA 4IOAA 1AE3A 1D5ZC 1PVOA 2PW7A 4ME3A 3ONAB 1JE5A 5IP7G 1J5EL 1NMGA 1HZ9A 2AWNA 1EY8A 2OEOA 2QEXA 3G6JB 3CCSA 1ENFA 3OIPA 5JPNC 4K6DA 2KA7A 2UUBQ 1TWCB 4LF8L 3CC4A 1KXLA 2MGSA 4LF4Q 2K5WA 5JEAH 1VQDA 4DV0L 4FP5D 1TY2A 2RHQB 1DONA 1PLFA 5EPLA 5JEAG 1L0WA 5M3MB 2M00A 4ZRZA 4AYBB 5EAYA 4JI0L 1WOCA 1YITA 4NXNL 1D1IA 2Z4IA 3EQLC 4JI7Q 2HD3A 2F4VQ 3S24A 2UUCQ 2KCMA 4DK3C 3IFDA 1A62A 5FO9B 3D8GA 2VY3A 3T1HL 1G2TA 5AFWA 5AJ3L 3PO3G 2RF4A 3NELA 1KC8C 4DR4L 3KFUA 1HNZQ 4DKAC 4JI1L 1MJCA 5LMUL 3TZUA 2YTXA 5JJIA 1ZKOA 2EY2A 3FDTA 1TXYA 3EBEA 4EGVA 3VR3A 1PFSA 1S5DD 4KJOA 4KHZA 4JOIA 3NEMA 4X62Q 3J81L 1OXUA 2NZ1D 3NENA 1Y1WH 1EY5A 5GAEC 1X65A 5LMNW 3CCQA 5IIFA 1V1PB 4GOPC 1YNJC 3UE0A 1Y1WG 1LTID 5E4XA 2KCTA 1BR9A 1WTQA 5IGGA 1A0IA 4JYAQ 1CSPA 1H9MA 3HOUG 1N34Q 4KD4A 1L0YB 3BYYB 3EROA 1R4PB 4K0KQ 3LGJA 3O13A 3QJYA 3TP8A 3QWNA 4H0LC 2X6LA 1SRUA 1RTOA 4YY3Q 1ESFA 4DV4Q 4HIMA 3TP6A 1J6QA 2DY8A 3AMUA 1WI5A 1EYCA 2PQAA 2R7DA 1E2VA 3HOZB 2K14A 1LV9A 1Q46A 4XQQA 4B9WA 1CZGA 5FO7B 1TIID 2K5DA 2NBFA 3E3XA 4P74A 3KBGA 3L7ZC 5IWAL 4LJZC 4KHPQ 3H94A 1EYAA 3KLWA 1WJJA 1EU4A 2X69A 1HUMA 4YWLA 2HCCA 1N36Q 1EEID 5HY6A 1SYDA 4XT1B 2KHJA 4IURA 1O7IA 5ELFA 5EGTA 4HCEA 1YNND 4E6IA 1C9OA 2F0QA 4DA2A 1XMQL 2L1BA 5GADC 4IOCA 5E3FA 2IJ0A 2Q8TA 1WCMB 2L12A 3GTKH 1CKMA 5J39A 2ICIA 5LHY1 5EPKA 2VB2X 1GKHA 1SROA 1HR0Q 3HKZB 4C3IG 1SYBA 2OTJA 4HMIA 5I6YA 5TSSA 2B63B 2PMZB 1HRJA 3J81i 3QOLA 4RGTA 1B8AA 1AN8A 1R4QB 3H3VI 2KVMA 5COYA 1A2TA 3K8AA 1SJED 1PXUA 3RLFA 4HJAA 4FYDA 4F7XA 2SOBA 1KL9A 3NTHA 3NPPA 1HTPA 4WFN3 1XWEA 3S16H 2KOLA 5A2QE 3PUWA 3RZDB 1SJHD 4IO9A 1E1OA 3PF5A 5IYCH 1VQEA 4U68A 1TS5A 5BR8L 1Z47A 2Y0SB 2WACA 4X65L 2DGYA 1DYQA 2A69C 2RSOA 3K5MA 2GN5A 1SMXA 1WTPA 5DEHA 1EUJA 5EKIA 3CCJA 4NXMQ 2EZVA 2L55A 4L6TB 1BOSA 3PUXA 2XNAC 1ILPA 1EZ8A 4HN7A 2JEAI 1B44D 2VQFL 1CI3M 1V43A 3GTKB 2F0VA 3H3VC 2JN4A 5DNFA 2E2HB 1DCZA 3GTQB 1UE7A 1I3QB 3BZKA 3CQZH 4FXGC 3IFTA 5LL6S 2F0UA 2XWJB 3F1ZA 3RR5A 1QUQB 3OWEB 2EJFC 3FRPB 4ABNA 1VQFA 1X56A 3VA5A 4OO1H 2H4OA 2JA7H 3NWTA 4JV5Q 2ES2A 1I6HH 3CPFA 4G7HC 3DM3A 3K58A 1EY7A 4OO1G 1STGA 2UUBL 3L2PA 4LF4L 4C2MH 1E7ZA 4R8IA 3S16B 1X32A 4NW2A 4ID6A 1X3FA 2QGQA 5IGBA 4JBWA 3S14H 5IGFA 2QDLA 3E6ZX 1EL0A 4XT3B 1PRTB 4A3GB 4JI4Q 1NMFA 5C5MA 3CCRA 1Y8OB 5FLXc 4WRDA 2M2LA 3DWAA 3J7A5 2IL8A 2B3GA 3HG9A 5CV4A 3HZXA 3M7GA 1IYUA 2UUCL 1R9TB 2F0IA 1S4ZA 5ELEA 2BCOA 1GOZA 3L9AX 4IFDI 2EYPA 4R8NA 4LK1C 4LF9Q 2WIIB 2HQEA 2Q2TA 4N9PA 1VQ4A 1EIGA 1LABA 3GTGH 4DV3Q 4CDFC 3J80L 1EOVA 5CYUA 3QG1A 5ELBA 1LTLA 3KLSA 1S5FD 4X62L 1CUKA 3C1FA 5M5XH 1CA6A 1YZ6A 2JA7B 1EWCA 1NUCA 1I6HB 4XTCS 4JI2Q 1Y1VG 3A8KE 4IPHA 4OONA 4ZKBB 1S5ED 5FLXE 4OX9L 1IHZA 5IYBH 4HAEA 4JYAL 2J7ZA 4HSVA 4M8AA 4X3KA 5M9OA 4C2MB 2PQEA 2BA1A 1ICFB 2K52A 4K0KL 5IYBG 4F8MA 1PZJD 3D4WA 2B2VC 3L3OC 4DFAA 3UE1A 1NNXA 5C44B 4A75A 4DV4L 1Q90A 5LL6X 4RCNA 1WTXA 3D6WA 2G5DA 5M3FB 2FFKB 4B3ML 4R4OA 4RKBA 1U4PA 1VDZA 1EFID 3K0XA 2PYKA 1PA6A 3MA2B 4J1MA 2DN8A 4AH6A 4A93H 4J15A 1Q7YC 4FO2A 1JB7A 1JWSD 5D3IB 4R9WA 2R93B 2MHVA 4ZUJA 3KF6A 4K5VA 5KEEA 3MXGA 3T1YL 4UDUC 1SXTA 2A19A 4A3BH 2YV5A 4A3DG 3GTJH 4KHPL 2CQAA 5KNCA 4JI3Q 1BCPD 3HKSA 4BBRB 1HQRD 4A3CH 1N36L 1SNPA 3TQYA 1RL2A 1X55A 4A3EH 4ME5A 4A3CG 2RCFA 2I5LX 1PYBA 1BNZA 1X3QA 1GM5A 2B2WA 2JA8B 2E76C 4A3EG 2R7ZG 2OF1A 4KN7C 1M90C 4NKLA 3VYUA 4CHTB 2F03A 1C4QA 5IT9c 2WAQB 4GLAC 1LUZA 1HR0L 1X6OA 1GUNA 3I4MH 3J80i 5C4HA 3I2ZA 3NXWA 3S17B 5JEAJ 1A8VA 3FHWA 1YBYA 2FJ2A 5ISRA 3I4NH 1QNUA 4LF6Q 5ELCA 3T4AC 3Q8DA 3VYRA 1O80A 2NVQH 2K1BA 3DEOA 4DV6L 5C3EG 1EWHA 1PRTC 2RHSB 1VQ9A 2NUCA 1I94Q 4A93B 4JG2A 1CQFA 4JW0A 3B6YA 2E2DC 4NB3A 3JC66 4ZQ3A 4B3TQ 2XTIA 1EQVA 1OXTA 4A3BB 3GTJB 1PV4A 3BU2A 4B08A 1QZGA 2C35B 1U4MA 3MXUA 4CKEA 1BVSA 4H7BA 2ZM6L 4GOPA 3KOJA 5CV7A 3BDCA 4XQNA 1IKMA 5IT9E 3AQQA 4AQYQ 1E1TA 1UEBA 4JI8L 4OXPA 3GTOB 2F0KA 5H1SE 4HJ9A 2XVSA 3A8IE 1Q1BA 3GTPH 1A3TA 4A4IA 2FINB 4K5XA 3K0YA 3OWFA 2L4NA 3GTLH 4CJ1B 3K7UC 4UP7A 3Q22A 1JORA 4FXDA 2O2LD 5GAHC 2RQXA 1EQTA 3HOVH 1K83B 1KHIA 2JEBI 3OHXC 2KEEA 1XMOQ 3I4MB 4OHJA 4QUFA 3UI2A 4LUZA 1ASZA 3I4NB 3V05A 1K3BC 3S1RB 2NVQB 1CK1A 3HOWH 1LT4D 1HTLD 4IPGA 1LACA 1VQJA 5GQOA 4A76A 1NBWA 2QCPX 4DUZQ 1Q8KA 2EE1A 1L1OB 4V190 1PFBA 1XYIA 2ICEC 5FLMH 4B3RQ 2UXDL 1SNDA 1V8QA 4GKJQ 1Q1EA 1C48A 3CCMA 4YCVA 1V1QA 1XPOA 5FO8B 1FNVA 4JI4L 2LS01 3MXNA 3CCLA 2VUMG 2Z6KA 1UE6A 2PI2E 1TS4A 5JJLA 1A2UA 3STBD 1X3GA 5I6WA 3IL8A 3LWEA 5KYLA 2BDOA 2PZWA 2JA5H 2A68C 3GTPB 4I7ZC 3K81C 3EFXD 4KK7A 4YWMA 3MFYA 2R92B 1OXVA 1VCIA 2ENBA 1UUPA 1H9JA 3BJUA 4LF7Q 2HT1A 1PH9A 4KN4C 5JVG3 3HOVB 2IHEA 2EYFA 4IPCA 1CM9A 4L5RC 5I4DA 2RDFA 1WVLA 1TWGH 1FD7D 3CCVA 1PH7A 4EQNA 1O7ZA 2E2JB 1DOKA 1N33Q 2NN6H 1L0XB 1XPUA 2K5NA 4JI2L 3HOWB 2F0OA 5JOBA 3HOXH 1B50A 4Y7NH 1ML0D 2FMCA 1I4XA 3I4OA 1HXYD 1U9RA 4HR7B 1B7YB 1VQ7A 2ZXOA 1PRTF 1CKNA 3PCOB 5CORA 2JK8A 5C6AA 1RCVD 5IP7H 1X3PA 3W3AA 3DHQA 3WOFA 5BN5A 3EIVA 4L5QA 3MXNB 5BN3A 1GUSA 1V1PA 4UAIA 4KMUC 2RCNA 3IAYA 3ICEA 1SNCA 2JA5B 3F2BA 1QB5D 3DLLA 1GO3E 4P75A 1AZQA 2B2WC 4XYQA 4F87A 4K6LA 3PO2G 2D5DA 3GTMH 4A3IB 2UXCL 1ENCA 3BYTB 2ZTDA 3HS0C 4RHRA 4YIJA 4DV2Q 3S1QB 2K5QA 3S2HH 2K32A 4G7OC 1G51A 3MEHA 4A3MB 3TRZA 3SK8A 1O78A 1TWGB 2Z8LA 3MZ5A 1G6PA 1B53A 3CAMA 1MD2D 2K4KA 1N32Q 2OCEA 2NZOA 3PO3H 2F0DA 2KHIA 3FKIH 5IY0A 2O5IC 1F2MA 2WINB 1GUOA 2MJ8A 1HFGA 4CGYB 5IODA 1FVIA 4P71A 1KAWA 2N8NA 2ZTEA 3R93A 2YYZA 3FKIG 2BH8A 4OIJA 1I4GA 1ENAA 2B2TC 1CKNB 3NBIA 4H44C 1L1OC 2SEBD 4LF6L 4DN4M 1G6ZA 1M1KC 1JJCB 3ER0A 1G2SA 2EQSA 1BBXC 1A63A 1NY4A 3NBHB 3OYYA 1XNQL 2F0LA 1UE5A 1BQQT 5C0XG 4RAUC 1BXTA 1LO5D 5KNDA 4DGZA 3H09A 4JI5Q 4R1JA 4UP9A 1I94L 4X64Q 3U9OA 3PSIA 3HOUH 1BO0A 2QKIC 3F2DA 3PGZA 1LLRD 4B3TL 4QF4A 3A0JA 4DF7A 3PMFA 4N8X1 4L63B 4LF5Q 3M3YH 1Y14B 4RWSC 4Z9CB 3NWSA 5M5WH 2H1EA 2HHHQ 2CVRA 3GTMB 1ONLA 1X54A 4DNTB 4A3KG 1RDPD 2R61A 4QIWE 3UDXA 3TDQA 3A5UA 3KDFB 2KBNA 4KKUA 4HSPA 2XIWA 2PCFB 3TMEA 1DJRD 2B2VA 3PO3B 4PNYA 4BBSH 1KIXA 2IWHA 1FL0A 2V4DA 1ZEQX 3SK6A 3I3CA 3SK5A 4BBSG 1XMOL 1O7YA 4DPGA 2E74C 1KDBA 3TP7A 4PMWA 4OELB 5DLQE 4LUVA 3OMGA 1PYWD 3M4YA 5D3DA 1HNXL 2NN6I 4MTKA 4DR7Q 4I7AA 1PYSB 2AKWB 1V9PA 1Y1WB 1EY6A 1KQSA 4FF1A 5DM63 2YTVA 1WD0A 1B4OA 1KNAA 1S3OA 2Z6KC 3KF8B 1D2BA 1KLGD 4J6HA 3HOUB 4C3IH 5C3WA 2ZXRA 2CCZA 3SE0A 1RIPA 2J4XA 3JAML 1A15A 2VXWA 5EBDA 1NSNS 5E4WC 4DK6C 2AQ3B 1PMRA 4GKJL 1QUQA 2B2YC 3X3NA 3A7LA 3I91A 1XXGA 4OL7A 4APVA 3DMUA 4DUYL 5M5YH 1HNWQ 2FMMA 1HZBA 2ZXPA 4CBVA 3KLSX 3ULLA 1HR0W 1QVFA 4Y52H 3CMEA 4GZYC 3EA6A 1JMCA 1PZID 2E8GA 2DY7A 2F3VA 1SNQA 1BCPB 2HIXA 4DR6Q 2JSOA 4TQUS 1NE3A 1Z9FA 1FJGL 3PUZA 4JCVE 1HCZA 4G4KA 1DZ1A 4QUCA 3SR1A 3S9WA 2MUYA 2NZHA 2AQ2B 2GA4B 4OEMB 1I4RA 3K5OA 4DR3Q 1G291 1SYEA 2Z9HA 2BH2A 5C4ZA 3DM1A 4AYBE 4IUPA 2K6AA 3I90A 2MQHA 2WKDA 1MSHA 2QDBA 2N3SA 3OTOQ 4PQXA 3GV3A 2UUAQ 4K5WA 1IW7C 4TSSA 3I56A 2CWPA 1VQ8A 4A3JG 2XN9C 4C3IB 3H0GH 4P2CB 3SHLA 2BE5C 1W6JA 3NE5B 2DNCA 3Q23A 1UNSA 4EX5A 3H0GG 2LSSA 2K01A 2I0QA 1QZHA 4DV5Q 2F0NA 3VR4A 5DM73 3GDEA 4QJFA 2M9VA 2A6HD 4FVMA 5M5YB 1W2BA 4K14A 2XSCA 2GVAA 4QMGA 3J7YW 3CCUA 3KBXA 3RZOH 1J8IA 1U4RA 2NWGA 4RFBA 1MKHA 1SSOA 1TU2B 2F0GA 2JA6H 1SMYC 3JAMi 3GO5A 4J8QA 1E2ZA 2SNSA 3J7ZC 1EEFD 1PH3A 2JA6G 1CT1D 1FGUA 4O0AA 4ODGA 5D14A 2G9DA 4JI7L 2KJXA 2IX1A 2F4VL 1PH6A 4YWKA 3TBIB 2A6ED 3OOCA 5CMDA 3D0FA 1RHPA 3AFPA 1QJOA 5FOBB 3E9IA 4WJ4A 3KK7A 1VQ6A 1PH8A 1QG7A 3WDNA 1D6EC 3U58A 1SFOH 1KDCA 1PTOD 1WTHA 4DAMA 3TS2A 2K04A 3F2UA 3PV0A 2D9UA 1VQNA 1HNZL 2ATWA 4L5SA 4R4QA 4TKOB 1B1ZA 2J0TD 3ND8A 4ZK9B 3CQZB 5FJ8G 5HURA 3J7AF 2UU9Q 4GN5A 1AW7A 3D4RA 3H15A 1OTCA 3D6CA 2OTLA 1Y1VH 3M85A 4JI5L 3HOYH 3MVVA 1OXSC 1XJVA 2IHFA 1JJ2A 1WFQA 2CW0D 2JJQA 3RZOB 1N9WA 1GD7A 4BY1G 1B3AA 2EYMA 2OXPA 3Q6SA 3HOYG 1IYVA 4B9XA 1EU3A 2GVBA 3W2DA 1BCPC 2KENA 1N34L 1J9OA 3MHBA 4K8JA 4LF5L 1OO9B 2N78A 5IGDA 1T9HA 2LXKA 1VQMA 1U4LA 3NTKA 4U673 1HHVA 3OW7A 4BY7H 3RLNA 2WV6D 1KABA 3LWUA 4RGNA 1P8LA 4YY3L 3K5LA 3S14B 3CKIB 1FNWA 2QEJC 5C5LA 3SVMA 4QQBX 3HKZE 5CBEE 1RD9D 5IOCA 4BY7G 1K3RA 1M8AA 1EY4A 2KUMA 2O5JC 1XTDA 5F2DA 1HZAA 3ULJA 2PMZE 2NVXH 1LTGD 3SDZA 1VQ5A 3P75A 1SYGA 4DV7Q 3CD6A 3H91A 5CC4A 4A3DH 5DAUA 2EYJA 2L9HA 1K9MC 3G48A 3DEPA 1SN8A 1EIFA 1E3PA 1F9RA 3J81c 3KJOA 1IXRA 2VL6A 3RNUA 2RDGA 1SFOB 1TS2A 4JI6Q 4KLKA 1LTBD 3U9SA 2HIVA 4PMBA 1QILA 3R8BA 1FYCA 3GTGB 4QY7A 5J1ZA 4EQOA 2A73B 2L0CA 1TQOA 1CKOA 2KHSA 2ID0A 2PZTA 1A3UA 2E2IH 4LF8Q 2R7ZH 4DNIA 3WWVA 2MO1A 1Y1VB 2YU9H 3N6RA 5M5XB 1EYDA 1LT5D 1IBMQ 5E1FA 4BXXH 2TSSA 3FVQA 5EKLA 1NCVA 1XTCD 4JI0Q 4BXXG 5FK9C 1VQKA 1EIHA 3X3MA 2K5VA 4IZ8A 3F2CA 4KD3A 1SE2A 4DR2Q 2IPKD 3MXPA 5E7NA 3M4QA 5A35A 1K0SA 4ZUIA 5C3EH 3PF4A 1GXDC 4OO1I 3VYSA 4KY7A 3J81E 1HNWL 4LUOA 1EY0A 1VF5C 2KEDA 1JWUD 1I6VC 1ET9A 1VS0A 3A7AB 5JAVA 1SDFA 4IQZA 4IUUA 4DR6L 1STHA 2XWBB 1Q81C 4DR4Q 2B2TA 2K50A 4IALA 4JI1Q 4RA8A 5G3LD 1L1OA 4A3DB 1JQYD 4ZCKA 3UDFA 2AUJD 3ULPA 3OW2A 3E5SA 4XDXA 4FXKC 1TR5A 3I7FA 4A3LH 4A3FH 4A3LG 5ELNA 1QNKA 1GJXA 4DR3L 4A3FG 2PW5A 3QO2A 1Z6HA 2F52A 4A3EB 4NXML 2E2IB 5A2QL 3K7AH 5C0XJ 2R7ZB 3OTOL 5KNBA 3P1HA 4C3JG 1JWMD 4C3HG 4WJWA 2QA4A 4DAYB 4PV1C 4EQ5A 1JB3A 4UP8A 5EQ0A 1RTNA 3CXCA 2JE6I 2JYOA 1SLJA 5IE8A 3D3RA 1MGSA 1C7YA 4V0BA 1TWHH 3I4LA 4DV5L 1RODA 2F0PA 3STBC 2FHTA 1IL2A 1BCPF 1SE3A 4XQJA 2IX3A 1PRTD 5C3EB 2K33A 2MNAA 1TWFH 2OQKA 5JVH3 4YCWA 4JV5L 1ZYRD 1PH4A 2D62A 2F0WA 3TS0A 3VDYA 2NVTH 4Q5VA 4O2DA 1EOTA 4AIMA 2XRQD 1JC7A 2V1CC 3BDLA 4X3SA 1YJ9A 1TT2A 3MWYW 4ULLA 5HGTA 3NSWA 4MZ9A 1HZCA 1YHQA 1WD1A 3W1BA 1EFWA 2WB1G 3S1NH 2VUMH 3S1MH 3CC2A 4KY5A 4DR1Q 1WYDA 3T16A 4DAPA 5I9OA 1H9SB 4OWXB 3NTIA 2D0OA 2EY5A 2FXQA 3SK4A 4PG3A 5C4XH 4CJ2C 4GLXA 2XGTA 4L8JA 2ZJRA 3P20A 3A8JE 4PMCA 3VR6A 5C4XG 3A5ZB 1BKBA 4XIGS 2B2YA 4RH6A 4LNQA 4FDBA 2UXBQ 3BZCA 3GTLB 1ILQA 1BUVT 2ZT9C 3QR8A 4EQPA 1NJIC 4KTAA 4LF9L 1GVPA 3W1GA 3PIO3 4HJ5A 1QVCA 2ZJQA 2KCCA 2BDNA 2E5LQ 4DV3L 2Z6BA 4MIUA 4DU9A 4LFCQ 3I72A 2WP8J 2D0PA 2A74C 2UU9L 5T1GA 3HRZC 4WORA 5L37A 2VQEQ 1TWFB 5IYDH 3FEWX 2R6GA 3PUYA 3NK9A 3SGIA 5I9PA 1S40A 5M3MH 2QW7A 1LTAD 2F0FA 1II3A 4L5TA 3M4PA 4GN4B 1DD2A 2KCNA 5IYDG 2EDGA 2EXZA 5K5PA 3J7AV 2EYOA 5M3MG 4C1NK 1SYCA 3FP9A 4AYBG 1T5XD 3I73A 4IN3A 2HDLA 3BVMA 4BS9A 2VS1A 1EY9A 4MHEA 4LFAQ 3RN2A 2VUMB 1KRTA 2DNEA 3S1MB 4DV1Q 3NBHA 1SEBD 4POFA 1CFMA 2WKCA 3QIAA 1VQBA 5FLXL 4ZAIA 2A68D 3MFGA 3T13A 1DM0B 4DV7L 1PHJA 4FF4A 1KLUD 3AEVA 2H5XA 5NUCA 3J80c 1AP0A 3PO2H 1LTRD 3MAQA 2B29A 2F1MA 1SR3A 4JPBW 3ZJYC 4JI6L 2N88A 5BN4A 1I4PA 2VB3X 4JI3L 5C3XA 3BS1A 2L11A 1ICWA 3HEJA 1UE1A 3H3VH 3V2TA 2D2CC 2MO0A 1Y69U 1VQAA 1PTOH 1BDOA 5J3BA 3I55A 1QOHA 4DNRB 3KDFA 2OWOA 1F9QA 1S72A 4GNXB 1NAPA 3S15H 1P16A 3CC7A 3P7JA 1IBML 3NP8A 3EN2A 1HQMC 2A5HA 1TWAH 2RDHA 3PIOA 4RMFA 3HOXB 1E2WA 3VR2A 3EJIA 4Y7NB 4DK1A 2I5MX 3VR5A 1UAPA 1NTGA 2NYZD 1E0BA 3VA7A 2Z1CA 4DR2L 4RGMA 2HUGA 5KIXA 3J80E 3ZYYX 3HOZH 1IBLQ 4K8IA 1AFPA 4KHVA 3OIQA 4PZ7A 5C0XH 1LM0A 3J81j 3HOZG 4GLVB 5ELOA 3U4VA 5GROA 2ZTCA 1YHBA 2G9HD 1VQIA 4ZKCB 1K0RA 4LMQD 2ZJPA 4QB4A 3TEHB 2N49A 2I07B 3KF8A 3OMCA 5LMNQ 5CV8A 3NUCA 4K2LA 3W5OA 1G91A 2NVYH 3PO2B 3K57A 1PH1A 1STBA 1VMCA 2N55A 4HCSA 1CQVA 1W6KA 5ELDA 3C3LA 1D8LA 4A3KH 3OPOA 1PFNA 3I70A 1IZ6A 1WCMH 4H13C 1WTOA 4AQYL 1YNNC 1EWIA 2Q2HA 1PTOB 3TN2A 5I2XA 3ITPA 2F3IA 3S2HB 1WCMG 4R4TA 3UDIA 4OX9Q 4NMZA 2HDMA 2EYHA 4F88A 3QOJA 1T5EA 5C4JH 4G57A 3RD4A 5J22A 1A3VA 3S15B 1WTWA 2LY7A 2CHBD 4IJLA 1UWVA 3HKZG 4DK0A 2B63H 1MI2A 1TWAB 3FKIB 2K7VA 1BBUA 4FF2A 2Z4HA 3U4ZA 1C8CA 1AH9A 5IT9L 1CZWA 1DXMA 1HH2P 2B63G 3R3OA 4B3MQ 1TKWB 3HFZB 2R3ZA 3DXJC 4DR5Q 1ET6A 4IUNA 1ASYA 2OT2A 1TY0A 3RZDH 2K28A 4JK1C 2CH4A 4LFBQ 1B70B 1YNJD 2C5CA 2WB1E 1IYJB 4C56C 4G7ZC 3T1YQ 4IFDH 1GUGA 4H02A 4HIKA 1YJWA 1EQQA 3GV6A 1MJEA 4IFDG 4RCOA 3CRKC 4M1UB 4MN3A 4DUZL 1SE4A 2K75A 1JJGA 2PZUA 2NVYB 2Y0SG 4B3RL 3A54A 4Q0FA 4YHHQ 4DR1L 4KI0A 5CV6A 3M3YB 1GUWA 3AB9A 4KY6A 2I46A 4K2KA 3T53B 1X3EA 1W3SA 1BBWA 2F0MA 4A3KB 2R7FA 2RKSA 4N8FA 4DXFA 4GN3B 2O4XA 3KUPA 5M5WB 2KECA 1GHKA 2E2HH 3GTQH 4OWWB 2AUKA 1I3QH 3FMCA 5C4JB 3NQTA 2UXBL 4PZ8A 1RJTA 4GNXC 4LF7L 5T1IA 1DOMA 1E24A 4BBSB 5JJZA 1MBYA 4X3TA 4JVZA 1VQOA 1XNRQ 5CBAE 2E5LL 1PFMA 1A6XA 2DUDA 1YJNA 1F2ZA 2EJMA 4DV6Q 4S3SA 4LFCL 2F0TA 3RN5A 1SBBB 3C2PA 1ZXTA 2A6HC 5CR3A 1D7QA 4KV6A 2K05A 1I4HA 2PQAB 2QF7A 1QWYA 1YHAA 3R2TA 2DJFC 2VQEL 1N33L 1MHWC 5D65A 4A3JH 1VQGA 2JXMB 4X3UA 4OGQC 1QCBD 2C9OA 1S5BD 2KQ3A 3DWQA 3TSSA 2VW9A 3BG3A 4A3GH 4B3SQ 2ZM6Q 1YEZA 2IY5B 2AQ1B 5IYCG 5IP9H 4A3GG 3NHHA 4JI8Q 1R9TH 5GAGC 2EOTA 4LFAL 5C0XI 1JOKA 1SE8A 2BA0A 4DV1L 5FKAC 1STYA 1TVXA 4RKLA 5IP9G 4GKKQ 1F2LA 2A6EC 1XX8A 2MPMA 2F0SA 4BA2I 1JOOA 1CHQD 1KAAA 4JBMA 1V1OA 1NR2A 2BOSA 1PTOC 1F2YA 3CF5A 3AYHB 1I50H 3T56B 3I8ZA 2HCIA 2E75C 1K8OA 3BVZA 2IT1A 4TRDA 1QE6A 3V96A 1K8GA 4QCLA 2L5TA 4RHSA 1SNOA 2CWAA 1ESRA 2A69D 2EXDA 5JJKA 1Y8NB 3AFQA 3MC0B 4CDDC 1S5CD 1L2FA 2EVBA 2AWOA 4QL5A 1F77A 4DV2L 4HIDA 2JA7G 1VQCA 5KRUA 2CW0C 1B9MA 5EPJA 3E9HA 1VQHA 1IW7D 3HP3A 1N32L 1D5MC 2F3WA 2UXDQ 2PI2A 3CW2C 5C44H 4A3JB 2BE5D 2Q2UA 1K73C 1KD1C 5M3FH 1TS3A 2F0EA 4CKBA 5FJ8H 5C44G 3H0GB 1DOLA 5M3FG 1IBLL 2XRSD 1HFNA 1IKLA 3DUZA 3UDGA 1HJPA 4TVAB 1I5FA 1B9NA 4DAVA 1BF4A 1STNA 3T51B 2R93H 1AE2A 2Q8IB 4JOIC 4X6AH 2L15A 4NPSA 1WTRA 4R4CA 4BY1H 3EVQA 2R93G 4P72A 4DXGA 4X64L 3G71A 4WJ3M 5IGEA 4BBRH 1XPRA 5LMNL 1SMYD 2A8VA 2NB0A 3R2IA 2RA4A 3RMHA 2EPBA 3ND9A 4R4IA 4BBRG 1I50B 3FPPA 2ASBA 2JA6B 1LT6D 2SDFA 2VZAA 1SAPA 3CP0A 3SEBA 3PIP3 3WOEA 2JA8H 3G4SA 3CMAA 2HHHL 1G8ZD 2JQOA 4ZYSA 2JA9A 1K8MA 2JA8G 2K5HA 3K5NA 1VMPA 1KTKA 3A56A 2MFIA 4X66Q 1SYFA 2YTYA 4MTNA 1IBKQ 4JBJA 1PH2A 1YI2A 3G6EA 1FGBD 2WAQG 3S17H 4IUQA 2B2UA 4POGA 1F9PA 1K28A 4YCUA 4BWGB 1D5XC 3H6MA 3TZDA 4NP5A 4FNFA 3GQBA 4O42A 2HQLA 1J5EQ 1Q86C 1JR0D 2ALYB 4DR5L 2EIFA 1GHJA 1VF7A 3LNNA 1EIYB 1LT3D 4CDEC 4KKSA 5KYIA 3G7LA 1SNMA 1AZPA 4IJHA 4UPAA 2LKVA 4LFBL 4A93G 4DR7L 2Y0SE 1H95A 3RLOA 4HTHA 2K03A 4BY1B 2JP1A 5HGQA 3CPWA 1HA6A 4IUVA 3U50C 4DV0Q 3HOYB 4DAYA 1JICA 1OXXK 4A3BG 3S2DH 3KLRA 1IL8A 2UXCQ 5JPMC 1E22A 3PUVA 4QGUA 2PNHA 3A55A 2IW3A 3GTOH 2EYLA 4NXNQ 4YHHL 1AEXA 1PTOF 2NTTA 2B8FA 4BY7B 3ERQA 1JCKB 2CH4W 4RG1A 1FR3A 2VNUD 3T1HQ 3CRLC 5AJ3Q 4UHVA 1JOQA 3M4OH 1K83H 3KYHC 3N52A 3TP5A 1KRSA 3F8TA 4PZ6A 5KGUA 4UY8C 1C0AA 2NVXB 5LMUQ 1LTTD 2MP1A 3A74A 2EJGC 3PIPA 4IPDA 3I4MG 4JC0A 1EYGA 3IKJA 1XNRL 4LWCA 3S1RH 1F9SA 4HJ8A 1RF2D 3KJPA 3I4NG 1XNQQ 1H9SA 3DWPA 4ZLTF 3TREA 2P5ZX 3K59A 3LX0A 1U5KA 4IUTA 2PPBC 1ZYRC 3OSOA 1O7LA 2RSNA 4C1NI 1VQPA 4C3JH 1MIUA 3M9BA 3JAMc 1NR4A 4C3HH 3KF6B 1H9RA 2CQOA 1JE4A 4GS3A 2F4IA 3M7NA 2YU9B 2Q8RE 1K8AC 2UUAL 1PH5A 1HPCA 2EY6A 3E0JA 4BA1I 2WFWA 4B3SL 3S2DB 1PDQA 1LTSD 4CJ0B 1X9NA 1YNXA 4OIKA 4JBKA 1Q12A 5K36H 3GD7A 4GKKL 4N9TA 2R92H 2SNMA 1B3QA 2IX0A 5K36G 3ERSX 1STAA 2CFMA 4ILWA 3C46A 2RVLA 2R92G 3E0EA 4KJNA 5IWAQ 3M4OB 2F0JA 5CV9A 3CHBD 1Q82C 4LAAA 3K6OA 4OWTB 2AHOB 2TMPA 1LYLA 1YVCA 4HIOA 3HOVG 1QVGA 2PNRC 1M4VA 3JAME 1RKNA 1Y8PB 1H9KA 1EZ6A 2E2JH 1HNXQ 4CDCC
chains in the Genus database with same CATH topology
2I5HA 4PZ7A 3K0XA 4DR3Q 1XMQQ 1LM0A 3J81j 1EQRA 1G291 2LXJA 1PA6A 2BH2A 3HOZG 4AH6A 4A93H 4GLVB 4AYBE 4J15A 4LW1A 5ELOA 1Q7YC 2MQHA 5GROA 3U4VA 2ZTCA 1YHBA 1VQIA 2N3SA 1JB7A 3HOWG 1K0RA 3OTOQ 2ZJPA 2OQ0A 2N49A 3KF6A 3TEHB 2UUAQ 1YIJA 3T1YL 3I56A 2A19A 2CWPA 4A3BH 2YV5A 1VQ8A 5LMNQ 4A3DG 3GTJH 4A3JG 4KHPL 3W5OA 2Z0SA 2NVYH 3H0GH 4JI3Q 1PH1A 4IFDJ 3HKSA 5FLMG 4EX5A 4GOPB 4A3CH 4DUYQ 1N36L 3H0GG 2LSSA 1D8LA 2I0QA 4A3KH 1QZHA 3TQYA 4DV5Q 1RL2A 1IZ6A 1X55A 3GDEA 1WCMH 3L0OA 4QJFA 4A3EH 4A3CG 3K80C 4AQYL 2I5LX 1EWIA 1PYBA 1TWCH 2Q2HA 1W2BA 1GM5A 2GVAA 3CCUA 2F3IA 1N8RC 1WCMG 4R4TA 3UDIA 4A3EG 4OX9Q 2R7ZG 3RZOH 4GNXA 1M90C 1MKHA 4MNOA 5C4JH 1FJGQ 2JA5G 2CKZB 5IT9c 4GLAC 1J5EL 1JT8A 4IJLA 4A3IH 2JA6H 1UWVA 1LUZA 3HKZG 3CCEA 1HR0L 3JAMi 2B63H 3GO5A 1X6OA 3I4MH 3J7ZC 1BBUA 3J80i 3I2ZA 5BR8Q 3U4ZA 1CSQA 5JEAJ 1PH3A 1A8VA 3S1QH 1AH9A 4X65Q 4A3IG 2JA6G 3FHWA 1HH2P 1YBYA 2B63G 3I4NH 4B3MQ 4A3MH 4LF6Q 1FGUA 3HFZB 3IRBA 3Q8DA 4O0AA 1VQLA 4ALPA 2NVQH 2WAQE 1DGSA 4DR5Q 4JI7L 4DV6L 2A1AA 5C3EG 4A3MG 1ASYA 2IX1A 2RHSB 2F4VL 2Q2IA 4YWKA 1PH6A 3RZDH 3MEFA 3D31A 2AMCB 1VQ9A 4LFBQ 1B70B 3D0FA 2WB1E 1I94Q 4X66L 1IYJB 4JG2A 1IBKL 3AFPA 4P73A 3T1YQ 3E9IA 2NN6G 4HJ7A 4WJ4A 2VQFQ 3B6YA 1VQ6A 4NB3A 1U0LA 1PH8A 3JC66 4H02A 4HIKA 3HOXG 1YJWA 4B3TQ 3U58A 1SFOH 2XTIA 1EQQA 4DAMA 4IOAA 1AE3A 1MJEA 3TS2A 4IFDG 3PV0A 1OXTA 1PVOA 4DUZL 2K75A 1JJGA 1VQNA 1PV4A 1HNZL 4L5SA 2ATWA 3BU2A 4ME3A 4R4QA 1QZGA 2Y0SG 2C35B 4B3RL 4GOPA 1BVSA 2ZM6L 3KOJA 4YHHQ 3RNUA 1JE5A 5IP7G 5FJ8G 4KI0A 1NMGA 1HZ9A 2AWNA 3AQQA 4DR1L 4AQYQ 1E1TA 2QEXA 2UU9Q 1UEBA 1X3EA 1W3SA 1BBWA 4JI8L 2R7FA 4GN5A 4OXPA 3CCSA 4GN3B 3H15A 1OTCA 2OTLA 1Y1VH 5H1SE 4HJ9A 3GTPH 1Q1BA 4A4IA 3M85A 2UUBQ 4JI5L 4LF8L 2E2HH 3HOYH 1OXSC 1XJVA 3CC4A 1KXLA 2IHFA 1JJ2A 1WFQA 2JJQA 4LF4Q 3GTQH 3GTLH 4OWWB 3K7UC 4UP7A 1N9WA 1GD7A 1I3QH 4BY1G 1VQDA 3HOYG 2GVBA 4DV0L 5GAHC 2UXBL 2RHQB 4PZ8A 2KENA 1N34L 4GNXC 5JEAG 1L0WA 3HOVH 4LF7L 4LF5L 1KHIA 2JEBI 2N78A 1E24A 1T9HA 2LXKA 1VQOA 1VQMA 1XMOQ 1XNRQ 5EAYA 4JI0L 1WOCA 4BY7H 2E5LL 3RLNA 1YITA 1P8LA 4NXNL 4YY3L 4JI7Q 2DUDA 1YJNA 4DV6Q 4LUZA 4LFCL 1ASZA 3RN5A 4QQBX 3HKZE 2F4VQ 4BY7G 1K3RA 1D7QA 3S24A 2PQAB 2UUCQ 2KCMA 4DK3C 3HOWH 1A62A 1XTDA 1YHAA 1HZAA 2VY3A 4IPGA 2PMZE 3ULJA 2VQEL 3T1HL 2NVXH 1N33L 5AJ3L 1VQ5A 1VQJA 5GQOA 4DV7Q 4A76A 3CD6A 1NBWA 3PO3G 4A3DH 4A3JH 1VQGA 2RF4A 3NELA 4DUZQ 1Q8KA 1KC8C 1L1OB 3G48A 1K9MC 3KFUA 4DR4L 1SN8A 2VW9A 4DKAC 1HNZQ 4A3GH 1EIFA 1E3PA 1MJCA 4JI1L 3J81c 1IXRA 2VL6A 5FLMH 3KJOA 2YTXA 5LMUL 2ZM6Q 4B3SQ 4B3RQ 5JJIA 1TXYA 3EBEA 1YEZA 4KLKA 4GKJQ 1Q1EA 2IY5B 3CCMA 5IYCG 1PFSA 4YCVA 1V1QA 2HIVA 5IP9H 1XPOA 4A3GG 4KHZA 4JI4L 4JI8Q 3CCLA 4JOIA 3NEMA 4X62Q 1R9TH 2VUMG 5GAGC 4LFAL 1OXUA 5C0XI 3NENA 4QY7A 1Y1WH 2Z6KA 1SE8A 1UE6A 2BA0A 5GAEC 1X65A 5LMNW 4DV1L 2PI2E 5IP9G 3CCQA 1CKOA 5JJLA 3STBD 2ID0A 1X3GA 4GKKQ 4GOPC 2E2IH 4LF8Q 2R7ZH 4DNIA 3WWVA 3UE0A 1Y1WG 2MO1A 4BA2I 2JA5H 2YU9H 2KCTA 3K81C 4JBMA 4YWMA 1IBMQ 1A0IA 4JYAQ 1CSPA 1OXVA 1VCIA 3HOUG 4BXXH 1N34Q 3BJUA 4LF7Q 3CF5A 2HT1A 3AYHB 4K0KQ 1I50H 1PH9A 3LGJA 4JI0Q 4BXXG 1VQKA 1SRUA 2UXDL 2IT1A 2K5VA 4YY3Q 2IHEA 3F2CA 4DV4Q 4HIMA 4IPCA 4DR2Q 1K8GA 4L5RC 5E7NA 1J6QA 2CWAA 3M4QA 5C3EH 3PF4A 2EXDA 5JJKA 4OO1I 1TWGH 3AFQA 1WI5A 3CCVA 4LUOA 1HNWL 1PH7A 2PQAA 1L2FA 2R7DA 4DV2L 2AWOA 4QL5A 4HIDA 2JA7G 1N33Q 2K14A 1Q46A 1VQCA 1VS0A 2K5NA 4JI2L 1XPUA 4DR6L 3HOXH 1Q81C 3E9HA 1VQHA 4DR4Q 4Y7NH 1N32L 3I4OA 2K50A 4JI1Q 1B7YB 1VQ7A 4P74A 2UXDQ 2PI2A 3CW2C 3L7ZC 1L1OA 5IWAL 5C44H 4KHPQ 3UDFA 2Q2UA 1CKNA 3ULPA 3PCOB 3OW2A 1K73C 3KLWA 1KD1C 2JK8A 5M3FH 1WJJA 5IP7H 5FJ8H 5C44G 4YWLA 3I7FA 1N36Q 4A3LH 5HY6A 5M3FG 3EIVA 1IBLL 2KHJA 4A3FH 1O7IA 4L5QA 3MXNB 3UDGA 1HJPA 4TVAB 1I5FA 5ELNA 4A3LG 1C9OA 4DR3L 1XMQL 5GADC 4IOCA 2R93H 1AE2A 4A3FG 4JOIC 4X6AH 2L15A 2F52A 4NPSA 4NXML 4R4CA 3K7AH 5C0XJ 4BY1H 3GTKH 1CKMA 3OTOL 2RCNA 2R93G 4P72A 3ICEA 4X64L 3G71A 3F2BA 4WJ3M 1GKHA 1SROA 3DLLA 1GO3E 4BBRH 2QA4A 4P75A 4DAYB 1XPRA 5LMNL 1HR0Q 2A8VA 4EQ5A 3PO2G 4UP8A 3CXCA 2OTJA 4R4IA 2JE6I 4BBRG 1SLJA 5IE8A 2ASBA 4JI6Q 3GTMH 2UXCL 1C7YA 2VZAA 3J81i 3CP0A 1TWHH 1B8AA 2JA8H 4DV5L 3H3VI 3G4SA 2ZTDA 3CMAA 4DV2Q 3S2HH 2HHHL 3STBC 1IL2A 1G51A 2JQOA 3K8AA 2MNAA 3TRZA 2JA9A 1TWFH 3RLFA 2JA8G 2K5HA 2OQKA 4HJAA 1G6PA 3CAMA 4YCWA 2K4KA 4JV5L 1PH4A 2MFIA 4X66Q 1IBKQ 1KL9A 2D62A 2YTYA 4JBJA 4MTNA 2OCEA 2NZOA 1PH2A 3TS0A 3PO3H 1N32Q 3VDYA 2NVTH 4O2DA 2KHIA 1YI2A 3G6EA 3S16H 3FKIH 3PUWA 4AIMA 5IY0A 2WAQG 2V1CC 3S17H 4IO9A 1YJ9A 1E1OA 4POGA 1FVIA 4P71A 1KAWA 2N8NA 2ZTEA 4MZ9A 2YYZA 3FKIG 2BH8A 1HZCA 1YHQA 3PF5A 5IYCH 4YCUA 1VQEA 3W1BA 1EFWA 5BR8L 2WB1G 3S1NH 1CKNB 1Z47A 4X65L 2VUMH 3S1MH 3CC2A 2DGYA 1L1OC 2HQLA 4DR1Q 1Q86C 1J5EQ 4LF6L 1WYDA 2GN5A 1M1KC 1JJCB 3ER0A 1SMXA 4OWXB 2ALYB 2D0OA 2EQSA 2FXQA 1NY4A 2EIFA 3NBHB 4PG3A 4DR5L 1EUJA 1A63A 1EIYB 3CCJA 3OYYA 5C4XH 4NXMQ 1XNQL 1UE5A 4GLXA 5C0XG 2XGTA 4IJHA 2ZJRA 4JI5Q 3PUXA 4UPAA 4A93G 4LFBL 4R1JA 4UP9A 1I94L 4X64Q 4DR7L 2Y0SE 3PSIA 3HOUH 5C4XG 1H95A 2JEAI 3RLOA 3A5ZB 3F2DA 2VQFL 1BKBA 1V43A 3PGZA 4XIGS 5HGQA 3CPWA 3U50C 4B3TL 4DV0Q 4LNQA 3A0JA 4FDBA 2UXBQ 1OXXK 3BZCA 4A3BG 1UE7A 4LF5Q 3S2DH 3BZKA 3CQZH 1NJIC 4LF9L 1GVPA 3M3YH 2UXCQ 1Y14B 3W1GA 4HJ5A 1QVCA 2ZJQA 1E22A 3F1ZA 3PUVA 2PNHA 3RR5A 1QUQB 4QGUA 2E5LQ 4DV3L 3GTOH 4NXNQ 5M5WH 2HHHQ 4YHHL 1VQFA 1X54A 4LFCQ 2WP8J 2D0PA 1X56A 4A3KG 2UU9L 2JA7H 4QIWE 4JV5Q 2ES2A 1I6HH 3CPFA 4RG1A 3UDXA 1C0AA 3A5UA 3DM3A 4OO1G 3KDFB 2KBNA 2VQEQ 3T1HQ 2UUBL 2VNUD 5AJ3Q 5IYDH 2R6GA 3L2PA 4LF4L 3PUYA 4C2MH 3M4OH 1K83H 3KYHC 3SGIA 1S40A 5M3MH 1E7ZA 4BBSH 1KRSA 3F8TA 3M4PA 4GN4B 4L5TA 4PZ6A 1FL0A 1KIXA 5IYDG 4UY8C 5LMUQ 1X3FA 2QGQA 3A74A 4JBWA 5M3MG 3S14H 4BBSG 3PIPA 3FP9A 4AYBG 4IPDA 1XMOL 3I4MG 4JC0A 1EYGA 1XNRL 4DPGA 4LWCA 4JI4Q 3S1RH 1NMFA 4PMWA 3CCRA 2VS1A 5FLXc 4HJ8A 4LFAQ 3RN2A 5DLQE 4LUVA 1KRTA 3KJPA 3I4NG 3J7A5 1XNQQ 4DV1Q 2B3GA 3TREA 1HNXL 1U5KA 4POFA 2NN6I 2UUCL 1VQBA 4DR7Q 1PYSB 2AKWB 1V9PA 1VQPA 1KQSA 4C3JH 1MIUA 3M9BA 3JAMc 2YTVA 4C3HH 4DV7L 1S3OA 3KF6B 1PHJA 3AEVA 2H5XA 4IFDI 2Z6KC 3KF8B 3J80c 2CQOA 4GS3A 4C3IH 3PO2H 3M7NA 1K8AC 4LF9Q 2CCZA 2B29A 1PH5A 2UUAL 2Q2TA 1RIPA 1SR3A 4BA1I 1VQ4A 4JI6L 3ZJYC 2WFWA 4B3SL 3GTGH 4DV3Q 4DK6C 4JI3L 1EOVA 4GKJL 1QUQA 1LTLA 1X9NA 1UE1A 1YNXA 3H3VH 4APVA 1CUKA 4X62L 4DUYL 5M5YH 2MO0A 4JBKA 1VQAA 1HNWQ 1Q12A 1HZBA 1HR0W 3ULLA 1QVFA 5M5XH 3GD7A 3CMEA 1YZ6A 4GKKL 5J3BA 4Y52H 3I55A 1JMCA 2R92H 2E8GA 3KDFA 4XTCS 4JI2Q 2OWOA 1Y1VG 1S72A 2HIXA 4DR6Q 4IPHA 5K36G 2IX0A 4GNXB 3ERSX 4OONA 3S15H 1P16A 2CFMA 4TQUS 3CC7A 4OX9L 5IYBH 1IBML 2R92G 3EN2A 3E0EA 1NE3A 4JYAL 1Z9FA 1FJGL 1TWAH 5IWAQ 3PIOA 4RMFA 3PUZA 4JCVE 2BA1A 2K52A 1Q82C 4K0KL 5IYBG 4OWTB 2AHOB 1LYLA 1YVCA 4HIOA 2I5MX 3HOVG 2NZHA 1NTGA 1QVGA 3UE1A 4A75A 4DV4L 4DR2L 3HOZH 2E2JH 1IBLQ 1HNXQ 4B3ML 4R4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5H A;  4PZ7 A;  3K0X A;  4DR3 Q;  1XMQ Q;  1LM0 A;  3J81 j;  1EQR A;  1G29 1;  2LXJ A;  1PA6 A;  2BH2 A;  3HOZ G;  4AH6 A;  4A93 H;  4GLV B;  4AYB E;  4J15 A;  4LW1 A;  5ELO A;  1Q7Y C;  2MQH A;  5GRO A;  3U4V A;  2ZTC A;  1YHB A;  1VQI A;  2N3S A;  1JB7 A;  3HOW G;  1K0R A;  3OTO Q;  2ZJP A;  2OQ0 A;  2N49 A;  3KF6 A;  3TEH B;  2UUA Q;  1YIJ A;  3T1Y L;  3I56 A;  2A19 A;  2CWP A;  4A3B H;  2YV5 A;  1VQ8 A;  5LMN Q;  4A3D G;  3GTJ H;  4A3J G;  4KHP L;  3W5O A;  2Z0S A;  2NVY H;  3H0G H;  4JI3 Q;  1PH1 A;  4IFD J;  3HKS A;  5FLM G;  4EX5 A;  4GOP B;  4A3C H;  4DUY Q;  1N36 L;  3H0G G;  2LSS A;  1D8L A;  2I0Q A;  4A3K H;  1QZH A;  3TQY A;  4DV5 Q;  1RL2 A;  1IZ6 A;  1X55 A;  3GDE A;  1WCM H;  3L0O A;  4QJF A;  4A3E H;  4A3C G;  3K80 C;  4AQY L;  2I5L X;  1EWI A;  1PYB A;  1TWC H;  2Q2H A;  1W2B A;  1GM5 A;  2GVA A;  3CCU A;  2F3I A;  1N8R C;  1WCM G;  4R4T A;  3UDI A;  4A3E G;  4OX9 Q;  2R7Z G;  3RZO H;  4GNX A;  1M90 C;  1MKH A;  4MNO A;  5C4J H;  1FJG Q;  2JA5 G;  2CKZ B;  5IT9 c;  4GLA C;  1J5E L;  1JT8 A;  4IJL A;  4A3I H;  2JA6 H;  1UWV A;  1LUZ A;  3HKZ G;  3CCE A;  1HR0 L;  3JAM i;  2B63 H;  3GO5 A;  1X6O A;  3I4M H;  3J7Z C;  1BBU A;  3J80 i;  3I2Z A;  5BR8 Q;  3U4Z A;  1CSQ A;  5JEA J;  1PH3 A;  1A8V A;  3S1Q H;  1AH9 A;  4X65 Q;  4A3I G;  2JA6 G;  3FHW A;  1HH2 P;  1YBY A;  2B63 G;  3I4N H;  4B3M Q;  4A3M H;  4LF6 Q;  1FGU A;  3HFZ B;  3IRB A;  3Q8D A;  4O0A A;  1VQL A;  4ALP A;  2NVQ H;  2WAQ E;  1DGS A;  4DR5 Q;  4JI7 L;  4DV6 L;  2A1A A;  5C3E G;  4A3M G;  1ASY A;  2IX1 A;  2RHS B;  2F4V L;  2Q2I A;  4YWK A;  1PH6 A;  3RZD H;  3MEF A;  3D31 A;  2AMC B;  1VQ9 A;  4LFB Q;  1B70 B;  3D0F A;  2WB1 E;  1I94 Q;  4X66 L;  1IYJ B;  4JG2 A;  1IBK L;  3AFP A;  4P73 A;  3T1Y Q;  3E9I A;  2NN6 G;  4HJ7 A;  4WJ4 A;  2VQF Q;  3B6Y A;  1VQ6 A;  4NB3 A;  1U0L A;  1PH8 A;  3JC6 6;  4H02 A;  4HIK A;  3HOX G;  1YJW A;  4B3T Q;  3U58 A;  1SFO H;  2XTI A;  1EQQ A;  4DAM A;  4IOA A;  1AE3 A;  1MJE A;  3TS2 A;  4IFD G;  3PV0 A;  1OXT A;  1PVO A;  4DUZ L;  2K75 A;  1JJG A;  1VQN A;  1PV4 A;  1HNZ L;  4L5S A;  2ATW A;  3BU2 A;  4ME3 A;  4R4Q A;  1QZG A;  2Y0S G;  2C35 B;  4B3R L;  4GOP A;  1BVS A;  2ZM6 L;  3KOJ A;  4YHH Q;  3RNU A;  1JE5 A;  5IP7 G;  5FJ8 G;  4KI0 A;  1NMG A;  1HZ9 A;  2AWN A;  3AQQ A;  4DR1 L;  4AQY Q;  1E1T A;  2QEX A;  2UU9 Q;  1UEB A;  1X3E A;  1W3S A;  1BBW A;  4JI8 L;  2R7F A;  4GN5 A;  4OXP A;  3CCS A;  4GN3 B;  3H15 A;  1OTC A;  2OTL A;  1Y1V H;  5H1S E;  4HJ9 A;  3GTP H;  1Q1B A;  4A4I A;  3M85 A;  2UUB Q;  4JI5 L;  4LF8 L;  2E2H H;  3HOY H;  1OXS C;  1XJV A;  3CC4 A;  1KXL A;  2IHF A;  1JJ2 A;  1WFQ A;  2JJQ A;  4LF4 Q;  3GTQ H;  3GTL H;  4OWW B;  3K7U C;  4UP7 A;  1N9W A;  1GD7 A;  1I3Q H;  4BY1 G;  1VQD A;  3HOY G;  2GVB A;  4DV0 L;  5GAH C;  2UXB L;  2RHQ B;  4PZ8 A;  2KEN A;  1N34 L;  4GNX C;  5JEA G;  1L0W A;  3HOV H;  4LF7 L;  4LF5 L;  1KHI A;  2JEB I;  2N78 A;  1E24 A;  1T9H A;  2LXK A;  1VQO A;  1VQM A;  1XMO Q;  1XNR Q;  5EAY A;  4JI0 L;  1WOC A;  4BY7 H;  2E5L L;  3RLN A;  1YIT A;  1P8L A;  4NXN L;  4YY3 L;  4JI7 Q;  2DUD A;  1YJN A;  4DV6 Q;  4LUZ A;  4LFC L;  1ASZ A;  3RN5 A;  4QQB X;  3HKZ E;  2F4V Q;  4BY7 G;  1K3R A;  1D7Q A;  3S24 A;  2PQA B;  2UUC Q;  2KCM A;  4DK3 C;  3HOW H;  1A62 A;  1XTD A;  1YHA A;  1HZA A;  2VY3 A;  4IPG A;  2PMZ E;  3ULJ A;  2VQE L;  3T1H L;  2NVX H;  1N33 L;  5AJ3 L;  1VQ5 A;  1VQJ A;  5GQO A;  4DV7 Q;  4A76 A;  3CD6 A;  1NBW A;  3PO3 G;  4A3D H;  4A3J H;  1VQG A;  2RF4 A;  3NEL A;  4DUZ Q;  1Q8K A;  1KC8 C;  1L1O B;  3G48 A;  1K9M C;  3KFU A;  4DR4 L;  1SN8 A;  2VW9 A;  4DKA C;  1HNZ Q;  4A3G H;  1EIF A;  1E3P A;  1MJC A;  4JI1 L;  3J81 c;  1IXR A;  2VL6 A;  5FLM H;  3KJO A;  2YTX A;  5LMU L;  2ZM6 Q;  4B3S Q;  4B3R Q;  5JJI A;  1TXY A;  3EBE A;  1YEZ A;  4KLK A;  4GKJ Q;  1Q1E A;  2IY5 B;  3CCM A;  5IYC G;  1PFS A;  4YCV A;  1V1Q A;  2HIV A;  5IP9 H;  1XPO A;  4A3G G;  4KHZ A;  4JI4 L;  4JI8 Q;  3CCL A;  4JOI A;  3NEM A;  4X62 Q;  1R9T H;  2VUM G;  5GAG C;  4LFA L;  1OXU A;  5C0X I;  3NEN A;  4QY7 A;  1Y1W H;  2Z6K A;  1SE8 A;  1UE6 A;  2BA0 A;  5GAE C;  1X65 A;  5LMN W;  4DV1 L;  2PI2 E;  5IP9 G;  3CCQ A;  1CKO A;  5JJL A;  3STB D;  2ID0 A;  1X3G A;  4GKK Q;  4GOP C;  2E2I H;  4LF8 Q;  2R7Z H;  4DNI A;  3WWV A;  3UE0 A;  1Y1W G;  2MO1 A;  4BA2 I;  2JA5 H;  2YU9 H;  2KCT A;  3K81 C;  4JBM A;  4YWM A;  1IBM Q;  1A0I A;  4JYA Q;  1CSP A;  1OXV A;  1VCI A;  3HOU G;  4BXX H;  1N34 Q;  3BJU A;  4LF7 Q;  3CF5 A;  2HT1 A;  3AYH B;  4K0K Q;  1I50 H;  1PH9 A;  3LGJ A;  4JI0 Q;  4BXX G;  1VQK A;  1SRU A;  2UXD L;  2IT1 A;  2K5V A;  4YY3 Q;  2IHE A;  3F2C A;  4DV4 Q;  4HIM A;  4IPC A;  4DR2 Q;  1K8G A;  4L5R C;  5E7N A;  1J6Q A;  2CWA A;  3M4Q A;  5C3E H;  3PF4 A;  2EXD A;  5JJK A;  4OO1 I;  1TWG H;  3AFQ A;  1WI5 A;  3CCV A;  4LUO A;  1HNW L;  1PH7 A;  2PQA A;  1L2F A;  2R7D A;  4DV2 L;  2AWO A;  4QL5 A;  4HID A;  2JA7 G;  1N33 Q;  2K14 A;  1Q46 A;  1VQC A;  1VS0 A;  2K5N A;  4JI2 L;  1XPU A;  4DR6 L;  3HOX H;  1Q81 C;  3E9H A;  1VQH A;  4DR4 Q;  4Y7N H;  1N32 L;  3I4O A;  2K50 A;  4JI1 Q;  1B7Y B;  1VQ7 A;  4P74 A;  2UXD Q;  2PI2 A;  3CW2 C;  3L7Z C;  1L1O A;  5IWA L;  5C44 H;  4KHP Q;  3UDF A;  2Q2U A;  1CKN A;  3ULP A;  3PCO B;  3OW2 A;  1K73 C;  3KLW A;  1KD1 C;  2JK8 A;  5M3F H;  1WJJ A;  5IP7 H;  5FJ8 H;  5C44 G;  4YWL A;  3I7F A;  1N36 Q;  4A3L H;  5HY6 A;  5M3F G;  3EIV A;  1IBL L;  2KHJ A;  4A3F H;  1O7I A;  4L5Q A;  3MXN B;  3UDG A;  1HJP A;  4TVA B;  1I5F A;  5ELN A;  4A3L G;  1C9O A;  4DR3 L;  1XMQ L;  5GAD C;  4IOC A;  2R93 H;  1AE2 A;  4A3F G;  4JOI C;  4X6A H;  2L15 A;  2F52 A;  4NPS A;  4NXM L;  4R4C A;  3K7A H;  5C0X J;  4BY1 H;  3GTK H;  1CKM A;  3OTO L;  2RCN A;  2R93 G;  4P72 A;  3ICE A;  4X64 L;  3G71 A;  3F2B A;  4WJ3 M;  1GKH A;  1SRO A;  3DLL A;  1GO3 E;  4BBR H;  2QA4 A;  4P75 A;  4DAY B;  1XPR A;  5LMN L;  1HR0 Q;  2A8V A;  4EQ5 A;  3PO2 G;  4UP8 A;  3CXC A;  2OTJ A;  4R4I A;  2JE6 I;  4BBR G;  1SLJ A;  5IE8 A;  2ASB A;  4JI6 Q;  3GTM H;  2UXC L;  1C7Y A;  2VZA A;  3J81 i;  3CP0 A;  1TWH H;  1B8A A;  2JA8 H;  4DV5 L;  3H3V I;  3G4S A;  2ZTD A;  3CMA A;  4DV2 Q;  3S2H H;  2HHH L;  3STB C;  1IL2 A;  1G51 A;  2JQO A;  3K8A A;  2MNA A;  3TRZ A;  2JA9 A;  1TWF H;  3RLF A;  2JA8 G;  2K5H A;  2OQK A;  4HJA A;  1G6P A;  3CAM A;  4YCW A;  2K4K A;  4JV5 L;  1PH4 A;  2MFI A;  4X66 Q;  1IBK Q;  1KL9 A;  2D62 A;  2YTY A;  4JBJ A;  4MTN A;  2OCE A;  2NZO A;  1PH2 A;  3TS0 A;  3PO3 H;  1N32 Q;  3VDY A;  2NVT H;  4O2D A;  2KHI A;  1YI2 A;  3G6E A;  3S16 H;  3FKI H;  3PUW A;  4AIM A;  5IY0 A;  2WAQ G;  2V1C C;  3S17 H;  4IO9 A;  1YJ9 A;  1E1O A;  4POG A;  1FVI A;  4P71 A;  1KAW A;  2N8N A;  2ZTE A;  4MZ9 A;  2YYZ A;  3FKI G;  2BH8 A;  1HZC A;  1YHQ A;  3PF5 A;  5IYC H;  4YCU A;  1VQE A;  3W1B A;  1EFW A;  5BR8 L;  2WB1 G;  3S1N H;  1CKN B;  1Z47 A;  4X65 L;  2VUM H;  3S1M H;  3CC2 A;  2DGY A;  1L1O C;  2HQL A;  4DR1 Q;  1Q86 C;  1J5E Q;  4LF6 L;  1WYD A;  2GN5 A;  1M1K C;  1JJC B;  3ER0 A;  1SMX A;  4OWX B;  2ALY B;  2D0O A;  2EQS A;  2FXQ A;  1NY4 A;  2EIF A;  3NBH B;  4PG3 A;  4DR5 L;  1EUJ A;  1A63 A;  1EIY B;  3CCJ A;  3OYY A;  5C4X H;  4NXM Q;  1XNQ L;  1UE5 A;  4GLX A;  5C0X G;  2XGT A;  4IJH A;  2ZJR A;  4JI5 Q;  3PUX A;  4UPA A;  4A93 G;  4LFB L;  4R1J A;  4UP9 A;  1I94 L;  4X64 Q;  4DR7 L;  2Y0S E;  3PSI A;  3HOU H;  5C4X G;  1H95 A;  2JEA I;  3RLO A;  3A5Z B;  3F2D A;  2VQF L;  1BKB A;  1V43 A;  3PGZ A;  4XIG S;  5HGQ A;  3CPW A;  3U50 C;  4B3T L;  4DV0 Q;  4LNQ A;  3A0J A;  4FDB A;  2UXB Q;  1OXX K;  3BZC A;  4A3B G;  1UE7 A;  4LF5 Q;  3S2D H;  3BZK A;  3CQZ H;  1NJI C;  4LF9 L;  1GVP A;  3M3Y H;  2UXC Q;  1Y14 B;  3W1G A;  4HJ5 A;  1QVC A;  2ZJQ A;  1E22 A;  3F1Z A;  3PUV A;  2PNH A;  3RR5 A;  1QUQ B;  4QGU A;  2E5L Q;  4DV3 L;  3GTO H;  4NXN Q;  5M5W H;  2HHH Q;  4YHH L;  1VQF A;  1X54 A;  4LFC Q;  2WP8 J;  2D0P A;  1X56 A;  4A3K G;  2UU9 L;  2JA7 H;  4QIW E;  4JV5 Q;  2ES2 A;  1I6H H;  3CPF A;  4RG1 A;  3UDX A;  1C0A A;  3A5U A;  3DM3 A;  4OO1 G;  3KDF B;  2KBN A;  2VQE Q;  3T1H Q;  2UUB L;  2VNU D;  5AJ3 Q;  5IYD H;  2R6G A;  3L2P A;  4LF4 L;  3PUY A;  4C2M H;  3M4O H;  1K83 H;  3KYH C;  3SGI A;  1S40 A;  5M3M H;  1E7Z A;  4BBS H;  1KRS A;  3F8T A;  3M4P A;  4GN4 B;  4L5T A;  4PZ6 A;  1FL0 A;  1KIX A;  5IYD G;  4UY8 C;  5LMU Q;  1X3F A;  2QGQ A;  3A74 A;  4JBW A;  5M3M G;  3S14 H;  4BBS G;  3PIP A;  3FP9 A;  4AYB G;  4IPD A;  1XMO L;  3I4M G;  4JC0 A;  1EYG A;  1XNR L;  4DPG A;  4LWC A;  4JI4 Q;  3S1R H;  1NMF A;  4PMW A;  3CCR A;  2VS1 A;  5FLX c;  4HJ8 A;  4LFA Q;  3RN2 A;  5DLQ E;  4LUV A;  1KRT A;  3KJP A;  3I4N G;  3J7A 5;  1XNQ Q;  4DV1 Q;  2B3G A;  3TRE A;  1HNX L;  1U5K A;  4POF A;  2NN6 I;  2UUC L;  1VQB A;  4DR7 Q;  1PYS B;  2AKW B;  1V9P A;  1VQP A;  1KQS A;  4C3J H;  1MIU A;  3M9B A;  3JAM c;  2YTV A;  4C3H H;  4DV7 L;  1S3O A;  3KF6 B;  1PHJ A;  3AEV A;  2H5X A;  4IFD I;  2Z6K C;  3KF8 B;  3J80 c;  2CQO A;  4GS3 A;  4C3I H;  3PO2 H;  3M7N A;  1K8A C;  4LF9 Q;  2CCZ A;  2B29 A;  1PH5 A;  2UUA L;  2Q2T A;  1RIP A;  1SR3 A;  4BA1 I;  1VQ4 A;  4JI6 L;  3ZJY C;  2WFW A;  4B3S L;  3GTG H;  4DV3 Q;  4DK6 C;  4JI3 L;  1EOV A;  4GKJ L;  1QUQ A;  1LTL A;  1X9N A;  1UE1 A;  1YNX A;  3H3V H;  4APV A;  1CUK A;  4X62 L;  4DUY L;  5M5Y H;  2MO0 A;  4JBK A;  1VQA A;  1HNW Q;  1Q12 A;  1HZB A;  1HR0 W;  3ULL A;  1QVF A;  5M5X H;  3GD7 A;  3CME A;  1YZ6 A;  4GKK L;  5J3B A;  4Y52 H;  3I55 A;  1JMC A;  2R92 H;  2E8G A;  3KDF A;  4XTC S;  4JI2 Q;  2OWO A;  1Y1V G;  1S72 A;  2HIX A;  4DR6 Q;  4IPH A;  5K36 G;  2IX0 A;  4GNX B;  3ERS X;  4OON A;  3S15 H;  1P16 A;  2CFM A;  4TQU S;  3CC7 A;  4OX9 L;  5IYB H;  1IBM L;  2R92 G;  3EN2 A;  3E0E A;  1NE3 A;  4JYA L;  1Z9F A;  1FJG L;  1TWA H;  5IWA Q;  3PIO A;  4RMF A;  3PUZ A;  4JCV E;  2BA1 A;  2K52 A;  1Q82 C;  4K0K L;  5IYB G;  4OWT B;  2AHO B;  1LYL A;  1YVC A;  4HIO A;  2I5M X;  3HOV G;  2NZH A;  1NTG A;  1QVG A;  3UE1 A;  4A75 A;  4DV4 L;  4DR2 L;  3HOZ H;  2E2J H;  1IBL Q;  1HNX Q;  4B3M L;  4R4O A; 
#chains in the Genus database with same CATH topology
 2I5H A;  1D1K A;  4HMJ A;  1XMQ Q;  1B2T A;  1EQR A;  1HA5 A;  2LXJ A;  3QB3 A;  3FPU B;  2QIL A;  4A3F B;  2LMC B;  4LW1 A;  1STE A;  1WTV A;  3HOW G;  1CHP D;  2OQ0 A;  4EVO A;  4C3J B;  1YIJ A;  2EY1 A;  1PZK D;  4XYO A;  2DJG C;  3K7A B;  4C3H B;  1MSG A;  4O1N A;  3PQI A;  2Z0S A;  3HGB A;  5I2Y A;  4QIW B;  4IFD J;  5FLM G;  1UEA B;  2NTS A;  4GOP B;  4DUY Q;  3RUZ A;  4KKT A;  3Q24 A;  3Q0A A;  3C1E A;  5G3L F;  3L0O A;  2F0H A;  3K80 C;  1I4Q A;  3D4D A;  2LFN A;  1TWC H;  1TWH B;  5EBC A;  1HUN A;  1N8R C;  2B39 A;  4GNX A;  5CV5 A;  2B8G A;  4MNO A;  3VYT A;  1FJG Q;  2JA5 G;  3CU7 A;  5EKK A;  2CKZ B;  4HED A;  1JT8 A;  3URY A;  1Q3L A;  4A3I H;  3CCE A;  2NVT B;  3AU7 A;  5BR8 Q;  1CSQ A;  2WB1 B;  3SXH A;  4FF3 A;  3S1Q H;  4X65 Q;  4A3I G;  4NDX A;  1FNU A;  4A3M H;  1CA5 A;  3IRB A;  4CKC A;  1VQL A;  2B2U C;  3GP7 A;  3MTS A;  4RGO S;  2WAQ E;  4ALP A;  3S1N B;  1DGS A;  2A1A A;  4A3M G;  1Z7T A;  4I65 A;  1CTM A;  2Q2I A;  3NQI A;  2X6G A;  3MEF A;  3D31 A;  2AMC B;  1KDA A;  4X66 L;  1GUT A;  1IBK L;  4P73 A;  2NN6 G;  2PO4 A;  5C4X B;  4HJ7 A;  2VQF Q;  1KNE A;  3BVG A;  1U0L A;  5EJW A;  5IGC A;  1Q8I A;  3HOX G;  4XXE A;  3BDO A;  5CGK A;  3BZD B;  2RBM A;  4IOA A;  1AE3 A;  1D5Z C;  1PVO A;  2PW7 A;  4ME3 A;  3ONA B;  1JE5 A;  5IP7 G;  1J5E L;  1NMG A;  1HZ9 A;  2AWN A;  1EY8 A;  2OEO A;  2QEX A;  3G6J B;  3CCS A;  1ENF A;  3OIP A;  5JPN C;  4K6D A;  2KA7 A;  2UUB Q;  1TWC B;  4LF8 L;  3CC4 A;  1KXL A;  2MGS A;  4LF4 Q;  2K5W A;  5JEA H;  1VQD A;  4DV0 L;  4FP5 D;  1TY2 A;  2RHQ B;  1DON A;  1PLF A;  5EPL A;  5JEA G;  1L0W A;  5M3M B;  2M00 A;  4ZRZ A;  4AYB B;  5EAY A;  4JI0 L;  1WOC A;  1YIT A;  4NXN L;  1D1I A;  2Z4I A;  3EQL C;  4JI7 Q;  2HD3 A;  2F4V Q;  3S24 A;  2UUC Q;  2KCM A;  4DK3 C;  3IFD A;  1A62 A;  5FO9 B;  3D8G A;  2VY3 A;  3T1H L;  1G2T A;  5AFW A;  5AJ3 L;  3PO3 G;  2RF4 A;  3NEL A;  1KC8 C;  4DR4 L;  3KFU A;  1HNZ Q;  4DKA C;  4JI1 L;  1MJC A;  5LMU L;  3TZU A;  2YTX A;  5JJI A;  1ZKO A;  2EY2 A;  3FDT A;  1TXY A;  3EBE A;  4EGV A;  3VR3 A;  1PFS A;  1S5D D;  4KJO A;  4KHZ A;  4JOI A;  3NEM A;  4X62 Q;  3J81 L;  1OXU A;  2NZ1 D;  3NEN A;  1Y1W H;  1EY5 A;  5GAE C;  1X65 A;  5LMN W;  3CCQ A;  5IIF A;  1V1P B;  4GOP C;  1YNJ C;  3UE0 A;  1Y1W G;  1LTI D;  5E4X A;  2KCT A;  1BR9 A;  1WTQ A;  5IGG A;  1A0I A;  4JYA Q;  1CSP A;  1H9M A;  3HOU G;  1N34 Q;  4KD4 A;  1L0Y B;  3BYY B;  3ERO A;  1R4P B;  4K0K Q;  3LGJ A;  3O13 A;  3QJY A;  3TP8 A;  3QWN A;  4H0L C;  2X6L A;  1SRU A;  1RTO A;  4YY3 Q;  1ESF A;  4DV4 Q;  4HIM A;  3TP6 A;  1J6Q A;  2DY8 A;  3AMU A;  1WI5 A;  1EYC A;  2PQA A;  2R7D A;  1E2V A;  3HOZ B;  2K14 A;  1LV9 A;  1Q46 A;  4XQQ A;  4B9W A;  1CZG A;  5FO7 B;  1TII D;  2K5D A;  2NBF A;  3E3X A;  4P74 A;  3KBG A;  3L7Z C;  5IWA L;  4LJZ C;  4KHP Q;  3H94 A;  1EYA A;  3KLW A;  1WJJ A;  1EU4 A;  2X69 A;  1HUM A;  4YWL A;  2HCC A;  1N36 Q;  1EEI D;  5HY6 A;  1SYD A;  4XT1 B;  2KHJ A;  4IUR A;  1O7I A;  5ELF A;  5EGT A;  4HCE A;  1YNN D;  4E6I A;  1C9O A;  2F0Q A;  4DA2 A;  1XMQ L;  2L1B A;  5GAD C;  4IOC A;  5E3F A;  2IJ0 A;  2Q8T A;  1WCM B;  2L12 A;  3GTK H;  1CKM A;  5J39 A;  2ICI A;  5LHY 1;  5EPK A;  2VB2 X;  1GKH A;  1SRO A;  1HR0 Q;  3HKZ B;  4C3I G;  1SYB A;  2OTJ A;  4HMI A;  5I6Y A;  5TSS A;  2B63 B;  2PMZ B;  1HRJ A;  3J81 i;  3QOL A;  4RGT A;  1B8A A;  1AN8 A;  1R4Q B;  3H3V I;  2KVM A;  5COY A;  1A2T A;  3K8A A;  1SJE D;  1PXU A;  3RLF A;  4HJA A;  4FYD A;  4F7X A;  2SOB A;  1KL9 A;  3NTH A;  3NPP A;  1HTP A;  4WFN 3;  1XWE A;  3S16 H;  2KOL A;  5A2Q E;  3PUW A;  3RZD B;  1SJH D;  4IO9 A;  1E1O A;  3PF5 A;  5IYC H;  1VQE A;  4U68 A;  1TS5 A;  5BR8 L;  1Z47 A;  2Y0S B;  2WAC A;  4X65 L;  2DGY A;  1DYQ A;  2A69 C;  2RSO A;  3K5M A;  2GN5 A;  1SMX A;  1WTP A;  5DEH A;  1EUJ A;  5EKI A;  3CCJ A;  4NXM Q;  2EZV A;  2L55 A;  4L6T B;  1BOS A;  3PUX A;  2XNA C;  1ILP A;  1EZ8 A;  4HN7 A;  2JEA I;  1B44 D;  2VQF L;  1CI3 M;  1V43 A;  3GTK B;  2F0V A;  3H3V C;  2JN4 A;  5DNF A;  2E2H B;  1DCZ A;  3GTQ B;  1UE7 A;  1I3Q B;  3BZK A;  3CQZ H;  4FXG C;  3IFT A;  5LL6 S;  2F0U A;  2XWJ B;  3F1Z A;  3RR5 A;  1QUQ B;  3OWE B;  2EJF C;  3FRP B;  4ABN A;  1VQF A;  1X56 A;  3VA5 A;  4OO1 H;  2H4O A;  2JA7 H;  3NWT A;  4JV5 Q;  2ES2 A;  1I6H H;  3CPF A;  4G7H C;  3DM3 A;  3K58 A;  1EY7 A;  4OO1 G;  1STG A;  2UUB L;  3L2P A;  4LF4 L;  4C2M H;  1E7Z A;  4R8I A;  3S16 B;  1X32 A;  4NW2 A;  4ID6 A;  1X3F A;  2QGQ A;  5IGB A;  4JBW A;  3S14 H;  5IGF A;  2QDL A;  3E6Z X;  1EL0 A;  4XT3 B;  1PRT B;  4A3G B;  4JI4 Q;  1NMF A;  5C5M A;  3CCR A;  1Y8O B;  5FLX c;  4WRD A;  2M2L A;  3DWA A;  3J7A 5;  2IL8 A;  2B3G A;  3HG9 A;  5CV4 A;  3HZX A;  3M7G A;  1IYU A;  2UUC L;  1R9T B;  2F0I A;  1S4Z A;  5ELE A;  2BCO A;  1GOZ A;  3L9A X;  4IFD I;  2EYP A;  4R8N A;  4LK1 C;  4LF9 Q;  2WII B;  2HQE A;  2Q2T A;  4N9P A;  1VQ4 A;  1EIG A;  1LAB A;  3GTG H;  4DV3 Q;  4CDF C;  3J80 L;  1EOV A;  5CYU A;  3QG1 A;  5ELB A;  1LTL A;  3KLS A;  1S5F D;  4X62 L;  1CUK A;  3C1F A;  5M5X H;  1CA6 A;  1YZ6 A;  2JA7 B;  1EWC A;  1NUC A;  1I6H B;  4XTC S;  4JI2 Q;  1Y1V G;  3A8K E;  4IPH A;  4OON A;  4ZKB B;  1S5E D;  5FLX E;  4OX9 L;  1IHZ A;  5IYB H;  4HAE A;  4JYA L;  2J7Z A;  4HSV A;  4M8A A;  4X3K A;  5M9O A;  4C2M B;  2PQE A;  2BA1 A;  1ICF B;  2K52 A;  4K0K L;  5IYB G;  4F8M A;  1PZJ D;  3D4W A;  2B2V C;  3L3O C;  4DFA A;  3UE1 A;  1NNX A;  5C44 B;  4A75 A;  4DV4 L;  1Q90 A;  5LL6 X;  4RCN A;  1WTX A;  3D6W A;  2G5D A;  5M3F B;  2FFK B;  4B3M L;  4R4O A;  4RKB A;  1U4P A;  1VDZ A;  1EFI D;  3K0X A;  2PYK A;  1PA6 A;  3MA2 B;  4J1M A;  2DN8 A;  4AH6 A;  4A93 H;  4J15 A;  1Q7Y C;  4FO2 A;  1JB7 A;  1JWS D;  5D3I B;  4R9W A;  2R93 B;  2MHV A;  4ZUJ A;  3KF6 A;  4K5V A;  5KEE A;  3MXG A;  3T1Y L;  4UDU C;  1SXT A;  2A19 A;  4A3B H;  2YV5 A;  4A3D G;  3GTJ H;  4KHP L;  2CQA A;  5KNC A;  4JI3 Q;  1BCP D;  3HKS A;  4BBR B;  1HQR D;  4A3C H;  1N36 L;  1SNP A;  3TQY A;  1RL2 A;  1X55 A;  4A3E H;  4ME5 A;  4A3C G;  2RCF A;  2I5L X;  1PYB A;  1BNZ A;  1X3Q A;  1GM5 A;  2B2W A;  2JA8 B;  2E76 C;  4A3E G;  2R7Z G;  2OF1 A;  4KN7 C;  1M90 C;  4NKL A;  3VYU A;  4CHT B;  2F03 A;  1C4Q A;  5IT9 c;  2WAQ B;  4GLA C;  1LUZ A;  1HR0 L;  1X6O A;  1GUN A;  3I4M H;  3J80 i;  5C4H A;  3I2Z A;  3NXW A;  3S17 B;  5JEA J;  1A8V A;  3FHW A;  1YBY A;  2FJ2 A;  5ISR A;  3I4N H;  1QNU A;  4LF6 Q;  5ELC A;  3T4A C;  3Q8D A;  3VYR A;  1O80 A;  2NVQ H;  2K1B A;  3DEO A;  4DV6 L;  5C3E G;  1EWH A;  1PRT C;  2RHS B;  1VQ9 A;  2NUC A;  1I94 Q;  4A93 B;  4JG2 A;  1CQF A;  4JW0 A;  3B6Y A;  2E2D C;  4NB3 A;  3JC6 6;  4ZQ3 A;  4B3T Q;  2XTI A;  1EQV A;  1OXT A;  4A3B B;  3GTJ B;  1PV4 A;  3BU2 A;  4B08 A;  1QZG A;  2C35 B;  1U4M A;  3MXU A;  4CKE A;  1BVS A;  4H7B A;  2ZM6 L;  4GOP A;  3KOJ A;  5CV7 A;  3BDC A;  4XQN A;  1IKM A;  5IT9 E;  3AQQ A;  4AQY Q;  1E1T A;  1UEB A;  4JI8 L;  4OXP A;  3GTO B;  2F0K A;  5H1S E;  4HJ9 A;  2XVS A;  3A8I E;  1Q1B A;  3GTP H;  1A3T A;  4A4I A;  2FIN B;  4K5X A;  3K0Y A;  3OWF A;  2L4N A;  3GTL H;  4CJ1 B;  3K7U C;  4UP7 A;  3Q22 A;  1JOR A;  4FXD A;  2O2L D;  5GAH C;  2RQX A;  1EQT A;  3HOV H;  1K83 B;  1KHI A;  2JEB I;  3OHX C;  2KEE A;  1XMO Q;  3I4M B;  4OHJ A;  4QUF A;  3UI2 A;  4LUZ A;  1ASZ A;  3I4N B;  3V05 A;  1K3B C;  3S1R B;  2NVQ B;  1CK1 A;  3HOW H;  1LT4 D;  1HTL D;  4IPG A;  1LAC A;  1VQJ A;  5GQO A;  4A76 A;  1NBW A;  2QCP X;  4DUZ Q;  1Q8K A;  2EE1 A;  1L1O B;  4V19 0;  1PFB A;  1XYI A;  2ICE C;  5FLM H;  4B3R Q;  2UXD L;  1SND A;  1V8Q A;  4GKJ Q;  1Q1E A;  1C48 A;  3CCM A;  4YCV A;  1V1Q A;  1XPO A;  5FO8 B;  1FNV A;  4JI4 L;  2LS0 1;  3MXN A;  3CCL A;  2VUM G;  2Z6K A;  1UE6 A;  2PI2 E;  1TS4 A;  5JJL A;  1A2U A;  3STB D;  1X3G A;  5I6W A;  3IL8 A;  3LWE A;  5KYL A;  2BDO A;  2PZW A;  2JA5 H;  2A68 C;  3GTP B;  4I7Z C;  3K81 C;  3EFX D;  4KK7 A;  4YWM A;  3MFY A;  2R92 B;  1OXV A;  1VCI A;  2ENB A;  1UUP A;  1H9J A;  3BJU A;  4LF7 Q;  2HT1 A;  1PH9 A;  4KN4 C;  5JVG 3;  3HOV B;  2IHE A;  2EYF A;  4IPC A;  1CM9 A;  4L5R C;  5I4D A;  2RDF A;  1WVL A;  1TWG H;  1FD7 D;  3CCV A;  1PH7 A;  4EQN A;  1O7Z A;  2E2J B;  1DOK A;  1N33 Q;  2NN6 H;  1L0X B;  1XPU A;  2K5N A;  4JI2 L;  3HOW B;  2F0O A;  5JOB A;  3HOX H;  1B50 A;  4Y7N H;  1ML0 D;  2FMC A;  1I4X A;  3I4O A;  1HXY D;  1U9R A;  4HR7 B;  1B7Y B;  1VQ7 A;  2ZXO A;  1PRT F;  1CKN A;  3PCO B;  5COR A;  2JK8 A;  5C6A A;  1RCV D;  5IP7 H;  1X3P A;  3W3A A;  3DHQ A;  3WOF A;  5BN5 A;  3EIV A;  4L5Q A;  3MXN B;  5BN3 A;  1GUS A;  1V1P A;  4UAI A;  4KMU C;  2RCN A;  3IAY A;  3ICE A;  1SNC A;  2JA5 B;  3F2B A;  1QB5 D;  3DLL A;  1GO3 E;  4P75 A;  1AZQ A;  2B2W C;  4XYQ A;  4F87 A;  4K6L A;  3PO2 G;  2D5D A;  3GTM H;  4A3I B;  2UXC L;  1ENC A;  3BYT B;  2ZTD A;  3HS0 C;  4RHR A;  4YIJ A;  4DV2 Q;  3S1Q B;  2K5Q A;  3S2H H;  2K32 A;  4G7O C;  1G51 A;  3MEH A;  4A3M B;  3TRZ A;  3SK8 A;  1O78 A;  1TWG B;  2Z8L A;  3MZ5 A;  1G6P A;  1B53 A;  3CAM A;  1MD2 D;  2K4K A;  1N32 Q;  2OCE A;  2NZO A;  3PO3 H;  2F0D A;  2KHI A;  3FKI H;  5IY0 A;  2O5I C;  1F2M A;  2WIN B;  1GUO A;  2MJ8 A;  1HFG A;  4CGY B;  5IOD A;  1FVI A;  4P71 A;  1KAW A;  2N8N A;  2ZTE A;  3R93 A;  2YYZ A;  3FKI G;  2BH8 A;  4OIJ A;  1I4G A;  1ENA A;  2B2T C;  1CKN B;  3NBI A;  4H44 C;  1L1O C;  2SEB D;  4LF6 L;  4DN4 M;  1G6Z A;  1M1K C;  1JJC B;  3ER0 A;  1G2S A;  2EQS A;  1BBX C;  1A63 A;  1NY4 A;  3NBH B;  3OYY A;  1XNQ L;  2F0L A;  1UE5 A;  1BQQ T;  5C0X G;  4RAU C;  1BXT A;  1LO5 D;  5KND A;  4DGZ A;  3H09 A;  4JI5 Q;  4R1J A;  4UP9 A;  1I94 L;  4X64 Q;  3U9O A;  3PSI A;  3HOU H;  1BO0 A;  2QKI C;  3F2D A;  3PGZ A;  1LLR D;  4B3T L;  4QF4 A;  3A0J A;  4DF7 A;  3PMF A;  4N8X 1;  4L63 B;  4LF5 Q;  3M3Y H;  1Y14 B;  4RWS C;  4Z9C B;  3NWS A;  5M5W H;  2H1E A;  2HHH Q;  2CVR A;  3GTM B;  1ONL A;  1X54 A;  4DNT B;  4A3K G;  1RDP D;  2R61 A;  4QIW E;  3UDX A;  3TDQ A;  3A5U A;  3KDF B;  2KBN A;  4KKU A;  4HSP A;  2XIW A;  2PCF B;  3TME A;  1DJR D;  2B2V A;  3PO3 B;  4PNY A;  4BBS H;  1KIX A;  2IWH A;  1FL0 A;  2V4D A;  1ZEQ X;  3SK6 A;  3I3C A;  3SK5 A;  4BBS G;  1XMO L;  1O7Y A;  4DPG A;  2E74 C;  1KDB A;  3TP7 A;  4PMW A;  4OEL B;  5DLQ E;  4LUV A;  3OMG A;  1PYW D;  3M4Y A;  5D3D A;  1HNX L;  2NN6 I;  4MTK A;  4DR7 Q;  4I7A A;  1PYS B;  2AKW B;  1V9P A;  1Y1W B;  1EY6 A;  1KQS A;  4FF1 A;  5DM6 3;  2YTV A;  1WD0 A;  1B4O A;  1KNA A;  1S3O A;  2Z6K C;  3KF8 B;  1D2B A;  1KLG D;  4J6H A;  3HOU B;  4C3I H;  5C3W A;  2ZXR A;  2CCZ A;  3SE0 A;  1RIP A;  2J4X A;  3JAM L;  1A15 A;  2VXW A;  5EBD A;  1NSN S;  5E4W C;  4DK6 C;  2AQ3 B;  1PMR A;  4GKJ L;  1QUQ A;  2B2Y C;  3X3N A;  3A7L A;  3I91 A;  1XXG A;  4OL7 A;  4APV A;  3DMU A;  4DUY L;  5M5Y H;  1HNW Q;  2FMM A;  1HZB A;  2ZXP A;  4CBV A;  3KLS X;  3ULL A;  1HR0 W;  1QVF A;  4Y52 H;  3CME A;  4GZY C;  3EA6 A;  1JMC A;  1PZI D;  2E8G A;  2DY7 A;  2F3V A;  1SNQ A;  1BCP B;  2HIX A;  4DR6 Q;  2JSO A;  4TQU S;  1NE3 A;  1Z9F A;  1FJG L;  3PUZ A;  4JCV E;  1HCZ A;  4G4K A;  1DZ1 A;  4QUC A;  3SR1 A;  3S9W A;  2MUY A;  2NZH A;  2AQ2 B;  2GA4 B;  4OEM B;  1I4R A;  3K5O A;  4DR3 Q;  1G29 1;  1SYE A;  2Z9H A;  2BH2 A;  5C4Z A;  3DM1 A;  4AYB E;  4IUP A;  2K6A A;  3I90 A;  2MQH A;  2WKD A;  1MSH A;  2QDB A;  2N3S A;  3OTO Q;  4PQX A;  3GV3 A;  2UUA Q;  4K5W A;  1IW7 C;  4TSS A;  3I56 A;  2CWP A;  1VQ8 A;  4A3J G;  2XN9 C;  4C3I B;  3H0G H;  4P2C B;  3SHL A;  2BE5 C;  1W6J A;  3NE5 B;  2DNC A;  3Q23 A;  1UNS A;  4EX5 A;  3H0G G;  2LSS A;  2K01 A;  2I0Q A;  1QZH A;  4DV5 Q;  2F0N A;  3VR4 A;  5DM7 3;  3GDE A;  4QJF A;  2M9V A;  2A6H D;  4FVM A;  5M5Y B;  1W2B A;  4K14 A;  2XSC A;  2GVA A;  4QMG A;  3J7Y W;  3CCU A;  3KBX A;  3RZO H;  1J8I A;  1U4R A;  2NWG A;  4RFB A;  1MKH A;  1SSO A;  1TU2 B;  2F0G A;  2JA6 H;  1SMY C;  3JAM i;  3GO5 A;  4J8Q A;  1E2Z A;  2SNS A;  3J7Z C;  1EEF D;  1PH3 A;  2JA6 G;  1CT1 D;  1FGU A;  4O0A A;  4ODG A;  5D14 A;  2G9D A;  4JI7 L;  2KJX A;  2IX1 A;  2F4V L;  1PH6 A;  4YWK A;  3TBI B;  2A6E D;  3OOC A;  5CMD A;  3D0F A;  1RHP A;  3AFP A;  1QJO A;  5FOB B;  3E9I A;  4WJ4 A;  3KK7 A;  1VQ6 A;  1PH8 A;  1QG7 A;  3WDN A;  1D6E C;  3U58 A;  1SFO H;  1KDC A;  1PTO D;  1WTH A;  4DAM A;  3TS2 A;  2K04 A;  3F2U A;  3PV0 A;  2D9U A;  1VQN A;  1HNZ L;  2ATW A;  4L5S A;  4R4Q A;  4TKO B;  1B1Z A;  2J0T D;  3ND8 A;  4ZK9 B;  3CQZ B;  5FJ8 G;  5HUR A;  3J7A F;  2UU9 Q;  4GN5 A;  1AW7 A;  3D4R A;  3H15 A;  1OTC A;  3D6C A;  2OTL A;  1Y1V H;  3M85 A;  4JI5 L;  3HOY H;  3MVV A;  1OXS C;  1XJV A;  2IHF A;  1JJ2 A;  1WFQ A;  2CW0 D;  2JJQ A;  3RZO B;  1N9W A;  1GD7 A;  4BY1 G;  1B3A A;  2EYM A;  2OXP A;  3Q6S A;  3HOY G;  1IYV A;  4B9X A;  1EU3 A;  2GVB A;  3W2D A;  1BCP C;  2KEN A;  1N34 L;  1J9O A;  3MHB A;  4K8J A;  4LF5 L;  1OO9 B;  2N78 A;  5IGD A;  1T9H A;  2LXK A;  1VQM A;  1U4L A;  3NTK A;  4U67 3;  1HHV A;  3OW7 A;  4BY7 H;  3RLN A;  2WV6 D;  1KAB A;  3LWU A;  4RGN A;  1P8L A;  4YY3 L;  3K5L A;  3S14 B;  3CKI B;  1FNW A;  2QEJ C;  5C5L A;  3SVM A;  4QQB X;  3HKZ E;  5CBE E;  1RD9 D;  5IOC A;  4BY7 G;  1K3R A;  1M8A A;  1EY4 A;  2KUM A;  2O5J C;  1XTD A;  5F2D A;  1HZA A;  3ULJ A;  2PMZ E;  2NVX H;  1LTG D;  3SDZ A;  1VQ5 A;  3P75 A;  1SYG A;  4DV7 Q;  3CD6 A;  3H91 A;  5CC4 A;  4A3D H;  5DAU A;  2EYJ A;  2L9H A;  1K9M C;  3G48 A;  3DEP A;  1SN8 A;  1EIF A;  1E3P A;  1F9R A;  3J81 c;  3KJO A;  1IXR A;  2VL6 A;  3RNU A;  2RDG A;  1SFO B;  1TS2 A;  4JI6 Q;  4KLK A;  1LTB D;  3U9S A;  2HIV A;  4PMB A;  1QIL A;  3R8B A;  1FYC A;  3GTG B;  4QY7 A;  5J1Z A;  4EQO A;  2A73 B;  2L0C A;  1TQO A;  1CKO A;  2KHS A;  2ID0 A;  2PZT A;  1A3U A;  2E2I H;  4LF8 Q;  2R7Z H;  4DNI A;  3WWV A;  2MO1 A;  1Y1V B;  2YU9 H;  3N6R A;  5M5X B;  1EYD A;  1LT5 D;  1IBM Q;  5E1F A;  4BXX H;  2TSS A;  3FVQ A;  5EKL A;  1NCV A;  1XTC D;  4JI0 Q;  4BXX G;  5FK9 C;  1VQK A;  1EIH A;  3X3M A;  2K5V A;  4IZ8 A;  3F2C A;  4KD3 A;  1SE2 A;  4DR2 Q;  2IPK D;  3MXP A;  5E7N A;  3M4Q A;  5A35 A;  1K0S A;  4ZUI A;  5C3E H;  3PF4 A;  1GXD C;  4OO1 I;  3VYS A;  4KY7 A;  3J81 E;  1HNW L;  4LUO A;  1EY0 A;  1VF5 C;  2KED A;  1JWU D;  1I6V C;  1ET9 A;  1VS0 A;  3A7A B;  5JAV A;  1SDF A;  4IQZ A;  4IUU A;  4DR6 L;  1STH A;  2XWB B;  1Q81 C;  4DR4 Q;  2B2T A;  2K50 A;  4IAL A;  4JI1 Q;  4RA8 A;  5G3L D;  1L1O A;  4A3D B;  1JQY D;  4ZCK A;  3UDF A;  2AUJ D;  3ULP A;  3OW2 A;  3E5S A;  4XDX A;  4FXK C;  1TR5 A;  3I7F A;  4A3L H;  4A3F H;  4A3L G;  5ELN A;  1QNK A;  1GJX A;  4DR3 L;  4A3F G;  2PW5 A;  3QO2 A;  1Z6H A;  2F52 A;  4A3E B;  4NXM L;  2E2I B;  5A2Q L;  3K7A H;  5C0X J;  2R7Z B;  3OTO L;  5KNB A;  3P1H A;  4C3J G;  1JWM D;  4C3H G;  4WJW A;  2QA4 A;  4DAY B;  4PV1 C;  4EQ5 A;  1JB3 A;  4UP8 A;  5EQ0 A;  1RTN A;  3CXC A;  2JE6 I;  2JYO A;  1SLJ A;  5IE8 A;  3D3R A;  1MGS A;  1C7Y A;  4V0B A;  1TWH H;  3I4L A;  4DV5 L;  1ROD A;  2F0P A;  3STB C;  2FHT A;  1IL2 A;  1BCP F;  1SE3 A;  4XQJ A;  2IX3 A;  1PRT D;  5C3E B;  2K33 A;  2MNA A;  1TWF H;  2OQK A;  5JVH 3;  4YCW A;  4JV5 L;  1ZYR D;  1PH4 A;  2D62 A;  2F0W A;  3TS0 A;  3VDY A;  2NVT H;  4Q5V A;  4O2D A;  1EOT A;  4AIM A;  2XRQ D;  1JC7 A;  2V1C C;  3BDL A;  4X3S A;  1YJ9 A;  1TT2 A;  3MWY W;  4ULL A;  5HGT A;  3NSW A;  4MZ9 A;  1HZC A;  1YHQ A;  1WD1 A;  3W1B A;  1EFW A;  2WB1 G;  3S1N H;  2VUM H;  3S1M H;  3CC2 A;  4KY5 A;  4DR1 Q;  1WYD A;  3T16 A;  4DAP A;  5I9O A;  1H9S B;  4OWX B;  3NTI A;  2D0O A;  2EY5 A;  2FXQ A;  3SK4 A;  4PG3 A;  5C4X H;  4CJ2 C;  4GLX A;  2XGT A;  4L8J A;  2ZJR A;  3P20 A;  3A8J E;  4PMC A;  3VR6 A;  5C4X G;  3A5Z B;  1BKB A;  4XIG S;  2B2Y A;  4RH6 A;  4LNQ A;  4FDB A;  2UXB Q;  3BZC A;  3GTL B;  1ILQ A;  1BUV T;  2ZT9 C;  3QR8 A;  4EQP A;  1NJI C;  4KTA A;  4LF9 L;  1GVP A;  3W1G A;  3PIO 3;  4HJ5 A;  1QVC A;  2ZJQ A;  2KCC A;  2BDN A;  2E5L Q;  4DV3 L;  2Z6B A;  4MIU A;  4DU9 A;  4LFC Q;  3I72 A;  2WP8 J;  2D0P A;  2A74 C;  2UU9 L;  5T1G A;  3HRZ C;  4WOR A;  5L37 A;  2VQE Q;  1TWF B;  5IYD H;  3FEW X;  2R6G A;  3PUY A;  3NK9 A;  3SGI A;  5I9P A;  1S40 A;  5M3M H;  2QW7 A;  1LTA D;  2F0F A;  1II3 A;  4L5T A;  3M4P A;  4GN4 B;  1DD2 A;  2KCN A;  5IYD G;  2EDG A;  2EXZ A;  5K5P A;  3J7A V;  2EYO A;  5M3M G;  4C1N K;  1SYC A;  3FP9 A;  4AYB G;  1T5X D;  3I73 A;  4IN3 A;  2HDL A;  3BVM A;  4BS9 A;  2VS1 A;  1EY9 A;  4MHE A;  4LFA Q;  3RN2 A;  2VUM B;  1KRT A;  2DNE A;  3S1M B;  4DV1 Q;  3NBH A;  1SEB D;  4POF A;  1CFM A;  2WKC A;  3QIA A;  1VQB A;  5FLX L;  4ZAI A;  2A68 D;  3MFG A;  3T13 A;  1DM0 B;  4DV7 L;  1PHJ A;  4FF4 A;  1KLU D;  3AEV A;  2H5X A;  5NUC A;  3J80 c;  1AP0 A;  3PO2 H;  1LTR D;  3MAQ A;  2B29 A;  2F1M A;  1SR3 A;  4JPB W;  3ZJY C;  4JI6 L;  2N88 A;  5BN4 A;  1I4P A;  2VB3 X;  4JI3 L;  5C3X A;  3BS1 A;  2L11 A;  1ICW A;  3HEJ A;  1UE1 A;  3H3V H;  3V2T A;  2D2C C;  2MO0 A;  1Y69 U;  1VQA A;  1PTO H;  1BDO A;  5J3B A;  3I55 A;  1QOH A;  4DNR B;  3KDF A;  2OWO A;  1F9Q A;  1S72 A;  4GNX B;  1NAP A;  3S15 H;  1P16 A;  3CC7 A;  3P7J A;  1IBM L;  3NP8 A;  3EN2 A;  1HQM C;  2A5H A;  1TWA H;  2RDH A;  3PIO A;  4RMF A;  3HOX B;  1E2W A;  3VR2 A;  3EJI A;  4Y7N B;  4DK1 A;  2I5M X;  3VR5 A;  1UAP A;  1NTG A;  2NYZ D;  1E0B A;  3VA7 A;  2Z1C A;  4DR2 L;  4RGM A;  2HUG A;  5KIX A;  3J80 E;  3ZYY X;  3HOZ H;  1IBL Q;  4K8I A;  1AFP A;  4KHV A;  3OIQ A;  4PZ7 A;  5C0X H;  1LM0 A;  3J81 j;  3HOZ G;  4GLV B;  5ELO A;  3U4V A;  5GRO A;  2ZTC A;  1YHB A;  2G9H D;  1VQI A;  4ZKC B;  1K0R A;  4LMQ D;  2ZJP A;  4QB4 A;  3TEH B;  2N49 A;  2I07 B;  3KF8 A;  3OMC A;  5LMN Q;  5CV8 A;  3NUC A;  4K2L A;  3W5O A;  1G91 A;  2NVY H;  3PO2 B;  3K57 A;  1PH1 A;  1STB A;  1VMC A;  2N55 A;  4HCS A;  1CQV A;  1W6K A;  5ELD A;  3C3L A;  1D8L A;  4A3K H;  3OPO A;  1PFN A;  3I70 A;  1IZ6 A;  1WCM H;  4H13 C;  1WTO A;  4AQY L;  1YNN C;  1EWI A;  2Q2H A;  1PTO B;  3TN2 A;  5I2X A;  3ITP A;  2F3I A;  3S2H B;  1WCM G;  4R4T A;  3UDI A;  4OX9 Q;  4NMZ A;  2HDM A;  2EYH A;  4F88 A;  3QOJ A;  1T5E A;  5C4J H;  4G57 A;  3RD4 A;  5J22 A;  1A3V A;  3S15 B;  1WTW A;  2LY7 A;  2CHB D;  4IJL A;  1UWV A;  3HKZ G;  4DK0 A;  2B63 H;  1MI2 A;  1TWA B;  3FKI B;  2K7V A;  1BBU A;  4FF2 A;  2Z4H A;  3U4Z A;  1C8C A;  1AH9 A;  5IT9 L;  1CZW A;  1DXM A;  1HH2 P;  2B63 G;  3R3O A;  4B3M Q;  1TKW B;  3HFZ B;  2R3Z A;  3DXJ C;  4DR5 Q;  1ET6 A;  4IUN A;  1ASY A;  2OT2 A;  1TY0 A;  3RZD H;  2K28 A;  4JK1 C;  2CH4 A;  4LFB Q;  1B70 B;  1YNJ D;  2C5C A;  2WB1 E;  1IYJ B;  4C56 C;  4G7Z C;  3T1Y Q;  4IFD H;  1GUG A;  4H02 A;  4HIK A;  1YJW A;  1EQQ A;  3GV6 A;  1MJE A;  4IFD G;  4RCO A;  3CRK C;  4M1U B;  4MN3 A;  4DUZ L;  1SE4 A;  2K75 A;  1JJG A;  2PZU A;  2NVY B;  2Y0S G;  4B3R L;  3A54 A;  4Q0F A;  4YHH Q;  4DR1 L;  4KI0 A;  5CV6 A;  3M3Y B;  1GUW A;  3AB9 A;  4KY6 A;  2I46 A;  4K2K A;  3T53 B;  1X3E A;  1W3S A;  1BBW A;  2F0M A;  4A3K B;  2R7F A;  2RKS A;  4N8F A;  4DXF A;  4GN3 B;  2O4X A;  3KUP A;  5M5W B;  2KEC A;  1GHK A;  2E2H H;  3GTQ H;  4OWW B;  2AUK A;  1I3Q H;  3FMC A;  5C4J B;  3NQT A;  2UXB L;  4PZ8 A;  1RJT A;  4GNX C;  4LF7 L;  5T1I A;  1DOM A;  1E24 A;  4BBS B;  5JJZ A;  1MBY A;  4X3T A;  4JVZ A;  1VQO A;  1XNR Q;  5CBA E;  2E5L L;  1PFM A;  1A6X A;  2DUD A;  1YJN A;  1F2Z A;  2EJM A;  4DV6 Q;  4S3S A;  4LFC L;  2F0T A;  3RN5 A;  1SBB B;  3C2P A;  1ZXT A;  2A6H C;  5CR3 A;  1D7Q A;  4KV6 A;  2K05 A;  1I4H A;  2PQA B;  2QF7 A;  1QWY A;  1YHA A;  3R2T A;  2DJF C;  2VQE L;  1N33 L;  1MHW C;  5D65 A;  4A3J H;  1VQG A;  2JXM B;  4X3U A;  4OGQ C;  1QCB D;  2C9O A;  1S5B D;  2KQ3 A;  3DWQ A;  3TSS A;  2VW9 A;  3BG3 A;  4A3G H;  4B3S Q;  2ZM6 Q;  1YEZ A;  2IY5 B;  2AQ1 B;  5IYC G;  5IP9 H;  4A3G G;  3NHH A;  4JI8 Q;  1R9T H;  5GAG C;  2EOT A;  4LFA L;  5C0X I;  1JOK A;  1SE8 A;  2BA0 A;  4DV1 L;  5FKA C;  1STY A;  1TVX A;  4RKL A;  5IP9 G;  4GKK Q;  1F2L A;  2A6E C;  1XX8 A;  2MPM A;  2F0S A;  4BA2 I;  1JOO A;  1CHQ D;  1KAA A;  4JBM A;  1V1O A;  1NR2 A;  2BOS A;  1PTO C;  1F2Y A;  3CF5 A;  3AYH B;  1I50 H;  3T56 B;  3I8Z A;  2HCI A;  2E75 C;  1K8O A;  3BVZ A;  2IT1 A;  4TRD A;  1QE6 A;  3V96 A;  1K8G A;  4QCL A;  2L5T A;  4RHS A;  1SNO A;  2CWA A;  1ESR A;  2A69 D;  2EXD A;  5JJK A;  1Y8N B;  3AFQ A;  3MC0 B;  4CDD C;  1S5C D;  1L2F A;  2EVB A;  2AWO A;  4QL5 A;  1F77 A;  4DV2 L;  4HID A;  2JA7 G;  1VQC A;  5KRU A;  2CW0 C;  1B9M A;  5EPJ A;  3E9H A;  1VQH A;  1IW7 D;  3HP3 A;  1N32 L;  1D5M C;  2F3W A;  2UXD Q;  2PI2 A;  3CW2 C;  5C44 H;  4A3J B;  2BE5 D;  2Q2U A;  1K73 C;  1KD1 C;  5M3F H;  1TS3 A;  2F0E A;  4CKB A;  5FJ8 H;  5C44 G;  3H0G B;  1DOL A;  5M3F G;  1IBL L;  2XRS D;  1HFN A;  1IKL A;  3DUZ A;  3UDG A;  1HJP A;  4TVA B;  1I5F A;  1B9N A;  4DAV A;  1BF4 A;  1STN A;  3T51 B;  2R93 H;  1AE2 A;  2Q8I B;  4JOI C;  4X6A H;  2L15 A;  4NPS A;  1WTR A;  4R4C A;  4BY1 H;  3EVQ A;  2R93 G;  4P72 A;  4DXG A;  4X64 L;  3G71 A;  4WJ3 M;  5IGE A;  4BBR H;  1XPR A;  5LMN L;  1SMY D;  2A8V A;  2NB0 A;  3R2I A;  2RA4 A;  3RMH A;  2EPB A;  3ND9 A;  4R4I A;  4BBR G;  1I50 B;  3FPP A;  2ASB A;  2JA6 B;  1LT6 D;  2SDF A;  2VZA A;  1SAP A;  3CP0 A;  3SEB A;  3PIP 3;  3WOE A;  2JA8 H;  3G4S A;  3CMA A;  2HHH L;  1G8Z D;  2JQO A;  4ZYS A;  2JA9 A;  1K8M A;  2JA8 G;  2K5H A;  3K5N A;  1VMP A;  1KTK A;  3A56 A;  2MFI A;  4X66 Q;  1SYF A;  2YTY A;  4MTN A;  1IBK Q;  4JBJ A;  1PH2 A;  1YI2 A;  3G6E A;  1FGB D;  2WAQ G;  3S17 H;  4IUQ A;  2B2U A;  4POG A;  1F9P A;  1K28 A;  4YCU A;  4BWG B;  1D5X C;  3H6M A;  3TZD A;  4NP5 A;  4FNF A;  3GQB A;  4O42 A;  2HQL A;  1J5E Q;  1Q86 C;  1JR0 D;  2ALY B;  4DR5 L;  2EIF A;  1GHJ A;  1VF7 A;  3LNN A;  1EIY B;  1LT3 D;  4CDE C;  4KKS A;  5KYI A;  3G7L A;  1SNM A;  1AZP A;  4IJH A;  4UPA A;  2LKV A;  4LFB L;  4A93 G;  4DR7 L;  2Y0S E;  1H95 A;  3RLO A;  4HTH A;  2K03 A;  4BY1 B;  2JP1 A;  5HGQ A;  3CPW A;  1HA6 A;  4IUV A;  3U50 C;  4DV0 Q;  3HOY B;  4DAY A;  1JIC A;  1OXX K;  4A3B G;  3S2D H;  3KLR A;  1IL8 A;  2UXC Q;  5JPM C;  1E22 A;  3PUV A;  4QGU A;  2PNH A;  3A55 A;  2IW3 A;  3GTO H;  2EYL A;  4NXN Q;  4YHH L;  1AEX A;  1PTO F;  2NTT A;  2B8F A;  4BY7 B;  3ERQ A;  1JCK B;  2CH4 W;  4RG1 A;  1FR3 A;  2VNU D;  3T1H Q;  3CRL C;  5AJ3 Q;  4UHV A;  1JOQ A;  3M4O H;  1K83 H;  3KYH C;  3N52 A;  3TP5 A;  1KRS A;  3F8T A;  4PZ6 A;  5KGU A;  4UY8 C;  1C0A A;  2NVX B;  5LMU Q;  1LTT D;  2MP1 A;  3A74 A;  2EJG C;  3PIP A;  4IPD A;  3I4M G;  4JC0 A;  1EYG A;  3IKJ A;  1XNR L;  4LWC A;  3S1R H;  1F9S A;  4HJ8 A;  1RF2 D;  3KJP A;  3I4N G;  1XNQ Q;  1H9S A;  3DWP A;  4ZLT F;  3TRE A;  2P5Z X;  3K59 A;  3LX0 A;  1U5K A;  4IUT A;  2PPB C;  1ZYR C;  3OSO A;  1O7L A;  2RSN A;  4C1N I;  1VQP A;  4C3J H;  1MIU A;  3M9B A;  3JAM c;  1NR4 A;  4C3H H;  3KF6 B;  1H9R A;  2CQO A;  1JE4 A;  4GS3 A;  2F4I A;  3M7N A;  2YU9 B;  2Q8R E;  1K8A C;  2UUA L;  1PH5 A;  1HPC A;  2EY6 A;  3E0J A;  4BA1 I;  2WFW A;  4B3S L;  3S2D B;  1PDQ A;  1LTS D;  4CJ0 B;  1X9N A;  1YNX A;  4OIK A;  4JBK A;  1Q12 A;  5K36 H;  3GD7 A;  4GKK L;  4N9T A;  2R92 H;  2SNM A;  1B3Q A;  2IX0 A;  5K36 G;  3ERS X;  1STA A;  2CFM A;  4ILW A;  3C46 A;  2RVL A;  2R92 G;  3E0E A;  4KJN A;  5IWA Q;  3M4O B;  2F0J A;  5CV9 A;  3CHB D;  1Q82 C;  4LAA A;  3K6O A;  4OWT B;  2AHO B;  2TMP A;  1LYL A;  1YVC A;  4HIO A;  3HOV G;  1QVG A;  2PNR C;  1M4V A;  3JAM E;  1RKN A;  1Y8P B;  1H9K A;  1EZ6 A;  2E2J H;  1HNX Q;  4CDC C; 
#chains in the Genus database with same CATH homology
 2I5H A;  4PZ7 A;  3K0X A;  4DR3 Q;  1XMQ Q;  1LM0 A;  3J81 j;  1EQR A;  1G29 1;  2LXJ A;  1PA6 A;  2BH2 A;  3HOZ G;  4AH6 A;  4A93 H;  4GLV B;  4AYB E;  4J15 A;  4LW1 A;  5ELO A;  1Q7Y C;  2MQH A;  5GRO A;  3U4V A;  2ZTC A;  1YHB A;  1VQI A;  2N3S A;  1JB7 A;  3HOW G;  1K0R A;  3OTO Q;  2ZJP A;  2OQ0 A;  2N49 A;  3KF6 A;  3TEH B;  2UUA Q;  1YIJ A;  3T1Y L;  3I56 A;  2A19 A;  2CWP A;  4A3B H;  2YV5 A;  1VQ8 A;  5LMN Q;  4A3D G;  3GTJ H;  4A3J G;  4KHP L;  3W5O A;  2Z0S A;  2NVY H;  3H0G H;  4JI3 Q;  1PH1 A;  4IFD J;  3HKS A;  5FLM G;  4EX5 A;  4GOP B;  4A3C H;  4DUY Q;  1N36 L;  3H0G G;  2LSS A;  1D8L A;  2I0Q A;  4A3K H;  1QZH A;  3TQY A;  4DV5 Q;  1RL2 A;  1IZ6 A;  1X55 A;  3GDE A;  1WCM H;  3L0O A;  4QJF A;  4A3E H;  4A3C G;  3K80 C;  4AQY L;  2I5L X;  1EWI A;  1PYB A;  1TWC H;  2Q2H A;  1W2B A;  1GM5 A;  2GVA A;  3CCU A;  2F3I A;  1N8R C;  1WCM G;  4R4T A;  3UDI A;  4A3E G;  4OX9 Q;  2R7Z G;  3RZO H;  4GNX A;  1M90 C;  1MKH A;  4MNO A;  5C4J H;  1FJG Q;  2JA5 G;  2CKZ B;  5IT9 c;  4GLA C;  1J5E L;  1JT8 A;  4IJL A;  4A3I H;  2JA6 H;  1UWV A;  1LUZ A;  3HKZ G;  3CCE A;  1HR0 L;  3JAM i;  2B63 H;  3GO5 A;  1X6O A;  3I4M H;  3J7Z C;  1BBU A;  3J80 i;  3I2Z A;  5BR8 Q;  3U4Z A;  1CSQ A;  5JEA J;  1PH3 A;  1A8V A;  3S1Q H;  1AH9 A;  4X65 Q;  4A3I G;  2JA6 G;  3FHW A;  1HH2 P;  1YBY A;  2B63 G;  3I4N H;  4B3M Q;  4A3M H;  4LF6 Q;  1FGU A;  3HFZ B;  3IRB A;  3Q8D A;  4O0A A;  1VQL A;  4ALP A;  2NVQ H;  2WAQ E;  1DGS A;  4DR5 Q;  4JI7 L;  4DV6 L;  2A1A A;  5C3E G;  4A3M G;  1ASY A;  2IX1 A;  2RHS B;  2F4V L;  2Q2I A;  4YWK A;  1PH6 A;  3RZD H;  3MEF A;  3D31 A;  2AMC B;  1VQ9 A;  4LFB Q;  1B70 B;  3D0F A;  2WB1 E;  1I94 Q;  4X66 L;  1IYJ B;  4JG2 A;  1IBK L;  3AFP A;  4P73 A;  3T1Y Q;  3E9I A;  2NN6 G;  4HJ7 A;  4WJ4 A;  2VQF Q;  3B6Y A;  1VQ6 A;  4NB3 A;  1U0L A;  1PH8 A;  3JC6 6;  4H02 A;  4HIK A;  3HOX G;  1YJW A;  4B3T Q;  3U58 A;  1SFO H;  2XTI A;  1EQQ A;  4DAM A;  4IOA A;  1AE3 A;  1MJE A;  3TS2 A;  4IFD G;  3PV0 A;  1OXT A;  1PVO A;  4DUZ L;  2K75 A;  1JJG A;  1VQN A;  1PV4 A;  1HNZ L;  4L5S A;  2ATW A;  3BU2 A;  4ME3 A;  4R4Q A;  1QZG A;  2Y0S G;  2C35 B;  4B3R L;  4GOP A;  1BVS A;  2ZM6 L;  3KOJ A;  4YHH Q;  3RNU A;  1JE5 A;  5IP7 G;  5FJ8 G;  4KI0 A;  1NMG A;  1HZ9 A;  2AWN A;  3AQQ A;  4DR1 L;  4AQY Q;  1E1T A;  2QEX A;  2UU9 Q;  1UEB A;  1X3E A;  1W3S A;  1BBW A;  4JI8 L;  2R7F A;  4GN5 A;  4OXP A;  3CCS A;  4GN3 B;  3H15 A;  1OTC A;  2OTL A;  1Y1V H;  5H1S E;  4HJ9 A;  3GTP H;  1Q1B A;  4A4I A;  3M85 A;  2UUB Q;  4JI5 L;  4LF8 L;  2E2H H;  3HOY H;  1OXS C;  1XJV A;  3CC4 A;  1KXL A;  2IHF A;  1JJ2 A;  1WFQ A;  2JJQ A;  4LF4 Q;  3GTQ H;  3GTL H;  4OWW B;  3K7U C;  4UP7 A;  1N9W A;  1GD7 A;  1I3Q H;  4BY1 G;  1VQD A;  3HOY G;  2GVB A;  4DV0 L;  5GAH C;  2UXB L;  2RHQ B;  4PZ8 A;  2KEN A;  1N34 L;  4GNX C;  5JEA G;  1L0W A;  3HOV H;  4LF7 L;  4LF5 L;  1KHI A;  2JEB I;  2N78 A;  1E24 A;  1T9H A;  2LXK A;  1VQO A;  1VQM A;  1XMO Q;  1XNR Q;  5EAY A;  4JI0 L;  1WOC A;  4BY7 H;  2E5L L;  3RLN A;  1YIT A;  1P8L A;  4NXN L;  4YY3 L;  4JI7 Q;  2DUD A;  1YJN A;  4DV6 Q;  4LUZ A;  4LFC L;  1ASZ A;  3RN5 A;  4QQB X;  3HKZ E;  2F4V Q;  4BY7 G;  1K3R A;  1D7Q A;  3S24 A;  2PQA B;  2UUC Q;  2KCM A;  4DK3 C;  3HOW H;  1A62 A;  1XTD A;  1YHA A;  1HZA A;  2VY3 A;  4IPG A;  2PMZ E;  3ULJ A;  2VQE L;  3T1H L;  2NVX H;  1N33 L;  5AJ3 L;  1VQ5 A;  1VQJ A;  5GQO A;  4DV7 Q;  4A76 A;  3CD6 A;  1NBW A;  3PO3 G;  4A3D H;  4A3J H;  1VQG A;  2RF4 A;  3NEL A;  4DUZ Q;  1Q8K A;  1KC8 C;  1L1O B;  3G48 A;  1K9M C;  3KFU A;  4DR4 L;  1SN8 A;  2VW9 A;  4DKA C;  1HNZ Q;  4A3G H;  1EIF A;  1E3P A;  1MJC A;  4JI1 L;  3J81 c;  1IXR A;  2VL6 A;  5FLM H;  3KJO A;  2YTX A;  5LMU L;  2ZM6 Q;  4B3S Q;  4B3R Q;  5JJI A;  1TXY A;  3EBE A;  1YEZ A;  4KLK A;  4GKJ Q;  1Q1E A;  2IY5 B;  3CCM A;  5IYC G;  1PFS A;  4YCV A;  1V1Q A;  2HIV A;  5IP9 H;  1XPO A;  4A3G G;  4KHZ A;  4JI4 L;  4JI8 Q;  3CCL A;  4JOI A;  3NEM A;  4X62 Q;  1R9T H;  2VUM G;  5GAG C;  4LFA L;  1OXU A;  5C0X I;  3NEN A;  4QY7 A;  1Y1W H;  2Z6K A;  1SE8 A;  1UE6 A;  2BA0 A;  5GAE C;  1X65 A;  5LMN W;  4DV1 L;  2PI2 E;  5IP9 G;  3CCQ A;  1CKO A;  5JJL A;  3STB D;  2ID0 A;  1X3G A;  4GKK Q;  4GOP C;  2E2I H;  4LF8 Q;  2R7Z H;  4DNI A;  3WWV A;  3UE0 A;  1Y1W G;  2MO1 A;  4BA2 I;  2JA5 H;  2YU9 H;  2KCT A;  3K81 C;  4JBM A;  4YWM A;  1IBM Q;  1A0I A;  4JYA Q;  1CSP A;  1OXV A;  1VCI A;  3HOU G;  4BXX H;  1N34 Q;  3BJU A;  4LF7 Q;  3CF5 A;  2HT1 A;  3AYH B;  4K0K Q;  1I50 H;  1PH9 A;  3LGJ A;  4JI0 Q;  4BXX G;  1VQK A;  1SRU A;  2UXD L;  2IT1 A;  2K5V A;  4YY3 Q;  2IHE A;  3F2C A;  4DV4 Q;  4HIM A;  4IPC A;  4DR2 Q;  1K8G A;  4L5R C;  5E7N A;  1J6Q A;  2CWA A;  3M4Q A;  5C3E H;  3PF4 A;  2EXD A;  5JJK A;  4OO1 I;  1TWG H;  3AFQ A;  1WI5 A;  3CCV A;  4LUO A;  1HNW L;  1PH7 A;  2PQA A;  1L2F A;  2R7D A;  4DV2 L;  2AWO A;  4QL5 A;  4HID A;  2JA7 G;  1N33 Q;  2K14 A;  1Q46 A;  1VQC A;  1VS0 A;  2K5N A;  4JI2 L;  1XPU A;  4DR6 L;  3HOX H;  1Q81 C;  3E9H A;  1VQH A;  4DR4 Q;  4Y7N H;  1N32 L;  3I4O A;  2K50 A;  4JI1 Q;  1B7Y B;  1VQ7 A;  4P74 A;  2UXD Q;  2PI2 A;  3CW2 C;  3L7Z C;  1L1O A;  5IWA L;  5C44 H;  4KHP Q;  3UDF A;  2Q2U A;  1CKN A;  3ULP A;  3PCO B;  3OW2 A;  1K73 C;  3KLW A;  1KD1 C;  2JK8 A;  5M3F H;  1WJJ A;  5IP7 H;  5FJ8 H;  5C44 G;  4YWL A;  3I7F A;  1N36 Q;  4A3L H;  5HY6 A;  5M3F G;  3EIV A;  1IBL L;  2KHJ A;  4A3F H;  1O7I A;  4L5Q A;  3MXN B;  3UDG A;  1HJP A;  4TVA B;  1I5F A;  5ELN A;  4A3L G;  1C9O A;  4DR3 L;  1XMQ L;  5GAD C;  4IOC A;  2R93 H;  1AE2 A;  4A3F G;  4JOI C;  4X6A H;  2L15 A;  2F52 A;  4NPS A;  4NXM L;  4R4C A;  3K7A H;  5C0X J;  4BY1 H;  3GTK H;  1CKM A;  3OTO L;  2RCN A;  2R93 G;  4P72 A;  3ICE A;  4X64 L;  3G71 A;  3F2B A;  4WJ3 M;  1GKH A;  1SRO A;  3DLL A;  1GO3 E;  4BBR H;  2QA4 A;  4P75 A;  4DAY B;  1XPR A;  5LMN L;  1HR0 Q;  2A8V A;  4EQ5 A;  3PO2 G;  4UP8 A;  3CXC A;  2OTJ A;  4R4I A;  2JE6 I;  4BBR G;  1SLJ A;  5IE8 A;  2ASB A;  4JI6 Q;  3GTM H;  2UXC L;  1C7Y A;  2VZA A;  3J81 i;  3CP0 A;  1TWH H;  1B8A A;  2JA8 H;  4DV5 L;  3H3V I;  3G4S A;  2ZTD A;  3CMA A;  4DV2 Q;  3S2H H;  2HHH L;  3STB C;  1IL2 A;  1G51 A;  2JQO A;  3K8A A;  2MNA A;  3TRZ A;  2JA9 A;  1TWF H;  3RLF A;  2JA8 G;  2K5H A;  2OQK A;  4HJA A;  1G6P A;  3CAM A;  4YCW A;  2K4K A;  4JV5 L;  1PH4 A;  2MFI A;  4X66 Q;  1IBK Q;  1KL9 A;  2D62 A;  2YTY A;  4JBJ A;  4MTN A;  2OCE A;  2NZO A;  1PH2 A;  3TS0 A;  3PO3 H;  1N32 Q;  3VDY A;  2NVT H;  4O2D A;  2KHI A;  1YI2 A;  3G6E A;  3S16 H;  3FKI H;  3PUW A;  4AIM A;  5IY0 A;  2WAQ G;  2V1C C;  3S17 H;  4IO9 A;  1YJ9 A;  1E1O A;  4POG A;  1FVI A;  4P71 A;  1KAW A;  2N8N A;  2ZTE A;  4MZ9 A;  2YYZ A;  3FKI G;  2BH8 A;  1HZC A;  1YHQ A;  3PF5 A;  5IYC H;  4YCU A;  1VQE A;  3W1B A;  1EFW A;  5BR8 L;  2WB1 G;  3S1N H;  1CKN B;  1Z47 A;  4X65 L;  2VUM H;  3S1M H;  3CC2 A;  2DGY A;  1L1O C;  2HQL A;  4DR1 Q;  1Q86 C;  1J5E Q;  4LF6 L;  1WYD A;  2GN5 A;  1M1K C;  1JJC B;  3ER0 A;  1SMX A;  4OWX B;  2ALY B;  2D0O A;  2EQS A;  2FXQ A;  1NY4 A;  2EIF A;  3NBH B;  4PG3 A;  4DR5 L;  1EUJ A;  1A63 A;  1EIY B;  3CCJ A;  3OYY A;  5C4X H;  4NXM Q;  1XNQ L;  1UE5 A;  4GLX A;  5C0X G;  2XGT A;  4IJH A;  2ZJR A;  4JI5 Q;  3PUX A;  4UPA A;  4A93 G;  4LFB L;  4R1J A;  4UP9 A;  1I94 L;  4X64 Q;  4DR7 L;  2Y0S E;  3PSI A;  3HOU H;  5C4X G;  1H95 A;  2JEA I;  3RLO A;  3A5Z B;  3F2D A;  2VQF L;  1BKB A;  1V43 A;  3PGZ A;  4XIG S;  5HGQ A;  3CPW A;  3U50 C;  4B3T L;  4DV0 Q;  4LNQ A;  3A0J A;  4FDB A;  2UXB Q;  1OXX K;  3BZC A;  4A3B G;  1UE7 A;  4LF5 Q;  3S2D H;  3BZK A;  3CQZ H;  1NJI C;  4LF9 L;  1GVP A;  3M3Y H;  2UXC Q;  1Y14 B;  3W1G A;  4HJ5 A;  1QVC A;  2ZJQ A;  1E22 A;  3F1Z A;  3PUV A;  2PNH A;  3RR5 A;  1QUQ B;  4QGU A;  2E5L Q;  4DV3 L;  3GTO H;  4NXN Q;  5M5W H;  2HHH Q;  4YHH L;  1VQF A;  1X54 A;  4LFC Q;  2WP8 J;  2D0P A;  1X56 A;  4A3K G;  2UU9 L;  2JA7 H;  4QIW E;  4JV5 Q;  2ES2 A;  1I6H H;  3CPF A;  4RG1 A;  3UDX A;  1C0A A;  3A5U A;  3DM3 A;  4OO1 G;  3KDF B;  2KBN A;  2VQE Q;  3T1H Q;  2UUB L;  2VNU D;  5AJ3 Q;  5IYD H;  2R6G A;  3L2P A;  4LF4 L;  3PUY A;  4C2M H;  3M4O H;  1K83 H;  3KYH C;  3SGI A;  1S40 A;  5M3M H;  1E7Z A;  4BBS H;  1KRS A;  3F8T A;  3M4P A;  4GN4 B;  4L5T A;  4PZ6 A;  1FL0 A;  1KIX A;  5IYD G;  4UY8 C;  5LMU Q;  1X3F A;  2QGQ A;  3A74 A;  4JBW A;  5M3M G;  3S14 H;  4BBS G;  3PIP A;  3FP9 A;  4AYB G;  4IPD A;  1XMO L;  3I4M G;  4JC0 A;  1EYG A;  1XNR L;  4DPG A;  4LWC A;  4JI4 Q;  3S1R H;  1NMF A;  4PMW A;  3CCR A;  2VS1 A;  5FLX c;  4HJ8 A;  4LFA Q;  3RN2 A;  5DLQ E;  4LUV A;  1KRT A;  3KJP A;  3I4N G;  3J7A 5;  1XNQ Q;  4DV1 Q;  2B3G A;  3TRE A;  1HNX L;  1U5K A;  4POF A;  2NN6 I;  2UUC L;  1VQB A;  4DR7 Q;  1PYS B;  2AKW B;  1V9P A;  1VQP A;  1KQS A;  4C3J H;  1MIU A;  3M9B A;  3JAM c;  2YTV A;  4C3H H;  4DV7 L;  1S3O A;  3KF6 B;  1PHJ A;  3AEV A;  2H5X A;  4IFD I;  2Z6K C;  3KF8 B;  3J80 c;  2CQO A;  4GS3 A;  4C3I H;  3PO2 H;  3M7N A;  1K8A C;  4LF9 Q;  2CCZ A;  2B29 A;  1PH5 A;  2UUA L;  2Q2T A;  1RIP A;  1SR3 A;  4BA1 I;  1VQ4 A;  4JI6 L;  3ZJY C;  2WFW A;  4B3S L;  3GTG H;  4DV3 Q;  4DK6 C;  4JI3 L;  1EOV A;  4GKJ L;  1QUQ A;  1LTL A;  1X9N A;  1UE1 A;  1YNX A;  3H3V H;  4APV A;  1CUK A;  4X62 L;  4DUY L;  5M5Y H;  2MO0 A;  4JBK A;  1VQA A;  1HNW Q;  1Q12 A;  1HZB A;  1HR0 W;  3ULL A;  1QVF A;  5M5X H;  3GD7 A;  3CME A;  1YZ6 A;  4GKK L;  5J3B A;  4Y52 H;  3I55 A;  1JMC A;  2R92 H;  2E8G A;  3KDF A;  4XTC S;  4JI2 Q;  2OWO A;  1Y1V G;  1S72 A;  2HIX A;  4DR6 Q;  4IPH A;  5K36 G;  2IX0 A;  4GNX B;  3ERS X;  4OON A;  3S15 H;  1P16 A;  2CFM A;  4TQU S;  3CC7 A;  4OX9 L;  5IYB H;  1IBM L;  2R92 G;  3EN2 A;  3E0E A;  1NE3 A;  4JYA L;  1Z9F A;  1FJG L;  1TWA H;  5IWA Q;  3PIO A;  4RMF A;  3PUZ A;  4JCV E;  2BA1 A;  2K52 A;  1Q82 C;  4K0K L;  5IYB G;  4OWT B;  2AHO B;  1LYL A;  1YVC A;  4HIO A;  2I5M X;  3HOV G;  2NZH A;  1NTG A;  1QVG A;  3UE1 A;  4A75 A;  4DV4 L;  4DR2 L;  3HOZ H;  2E2J H;  1IBL Q;  1HNX Q;  4B3M L;  4R4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...