4R4OA

Crystal structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamothioyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4oA00
1N33L 4C2MH 1S3OA 3HOVH 1QZHA 3AQQA 3IRBA 3KF6B 1HNXQ 1X56A 4GN4B 3JAMc 3F2BA 4ALPA 4JI0L 3H3VI 2R93H 4GKJQ 4DV7L 2KCMA 3JAMi 1XMOQ 4DR5Q 4JG2A 2VQFQ 3PUVA 5GAGC 1HNXL 1YJNA 4A3DH 3M4QA 3T1HQ 4TVAB 2RCNA 1VS0A 2JA7H 5JJKA 2ZTEA 1G51A 1XMOL 1N36L 4DR5L 1OXSC 2VQFL 2E5LL 1UE6A 4X62Q 2OCEA 4X65Q 1VQDA 3KLWA 3T1HL 1UWVA 3TS0A 1AE2A 3PO2G 1E7ZA 5C0XJ 2CCZA 1EUJA 3A0JA 2VS1A 2OWOA 4X62L 2NN6G 4X65L 2EXDA 3CMEA 4A3JG 3DM3A 4HJ5A 4OO1I 2Z0SA 3TEHB 5M3FG 1A0IA 1KIXA 3CQZH 1VQ5A 1CKNB 4A3FG 3PF5A 1XNQL 4BA2I 4A3KH 1KXLA 4UP9A 1NTGA 3S1NH 1C0AA 3CCEA 1EWIA 5IY0A 3PIPA 4GNXA 3PO2H 1UEBA 3K7AH 4XTCS 3OW2A 1IBMQ 1SMXA 4A3JH 2OTLA 5LMNW 4GN3B 1PVOA 4POFA 5M3FH 3TRZA 1MIUA 1I3QH 2A1AA 4YCWA 4A3FH 3TREA 4DR6Q 2AMCB 4NB3A 3B6YA 4FDBA 1YHQA 2IX1A 5FJ8H 4C3JH 5JJLA 1H95A 3PUYA 4AYBE 4DR6L 2K52A 3GTGH 1VQEA 1VQHA 3GO5A 3S2HH 2DGYA 2UUBQ 4KHPQ 1CKNA 3E0EA 1J5EQ 4DR4Q 3CXCA 4L5RC 5IWAQ 4LF9Q 3I56A 1L1OC 1WCMG 1HNZQ 1KHIA 1VCIA 2Z6KC 3UDGA 3S15H 1J5EL 1HNWL 4DR4L 4O0AA 3KOJA 2ZTCA 4O2DA 5IWAL 2I5LX 3GTMH 1QUQA 2MO1A 3NEMA 4A75A 1IZ6A 2WAQE 4DR2Q 4NXML 1X3EA 3I4NG 2EQSA 1Q1EA 3E9IA 4DR3Q 1VQNA 3ULJA 4BA1I 4A3CH 1WCMH 1U5KA 4JI7Q 1K3RA 1A62A 4DV5Q 2F3IA 2CFMA 1W2BA 1XJVA 1DGSA 1E1OA 2YTXA 4IJLA 4QJFA 3W5OA 1NJIC 4JI7L 4DV2L 3AFPA 1KQSA 1PH9A 3I4NH 2CKZB 2KCTA 4DV4Q 2GN5A 1Y1WG 1I50H 5IYCG 1GD7A 1M90C 2WB1E 3VDYA 1YBYA 4DV6Q 2ES2A 1KAWA 1EIYB 4X66Q 3U50C 2BH2A 3ERSX 3E9HA 5FLMG 4GOPB 3OYYA 2ZM6Q 1VQ4A 3S16H 3SGIA 1LYLA 2I5MX 2CWPA 3CCJA 4DUYL 1TWCH 4HIKA 1VQPA 5M5XH 3EN2A 5LMUQ 4EX5A 4JI1Q 1Y1WH 1A63A 5IYCH 5IP9H 2K5HA 2UXBQ 4PG3A 3AEVA 5LMUL 1KC8C 4JI1L 3HOXG 1V9PA 4MTNA 5FLMH 4GKKQ 4B3TL 2UXBL 5J3BA 4JI8Q 1YI2A 5JEAJ 1IXRA 3S1QH 1XPRA 3I2ZA 5IP7G 4LF7Q 1Q82C 2VY3A 3NELA 4RMFA 1HZCA 1K73C 4JI8L 2NZHA 5BR8Q 2R6GA 4JI2L 5ELOA 3MXNB 4DV0Q 1EQQA 3BZKA 4LF5L 2D62A 4QL5A 4HJ9A 2HHHQ 5BR8L 4LWCA 1CKOA 2JEBI 1QVGA 1OXTA 4DV0L 4HJ7A 1Q81C 3I4OA 4LF6Q 5HY6A 3G6EA 1PH3A 4JBKA 2HHHL 5IP7H 1E22A 2E2JH 2OQKA 4JOIA 3PUXA 1PA6A 3J81j 4A3LG 4YCVA 2D0PA 4A3EG 4LF6L 3NBHB 5ELNA 5GQOA 3CCQA 1EFWA 1VQLA 3FP9A 1X54A 4JI5Q 4JCVE 1UE1A 3J81c 1HR0L 2NVQH 1J6QA 1OXXK 4JBJA 3J81i 4JI5L 1L2FA 2CWAA 1OTCA 1X55A 2ASBA 2VNUD 1HH2P 3DLLA 2VZAA 4APVA 4A3LH 4YHHL 1Q1BA 4GLAC 2ZJRA 1PH6A 4A3EH 1K8GA 1FGUA 3J7ZC 1PH7A 3AYHB 4GOPC 2VL6A 4GNXB 4OWWB 4A3MG 3UE1A 1Q12A 1FJGQ 1P16A 3D31A 2OQ0A 4GKJL 2IHEA 3ULPA 3GTJH 4BBSG 2LXKA 1JE5A 4R4QA 1MJCA 1VQ9A 1FJGL 4B3RQ 4KHZA 2FXQA 1D7QA 3H0GG 4LW1A 1VQ7A 2HIXA 4IFDI 3K8AA 4JV5Q 1VQ8A 1E24A 1I5FA 1SRUA 1TWGH 4LNQA 1NBWA 4A3MH 3J7A5 1Q86C 4JV5L 1Q7YC 1NE3A 1Z9FA 1SE8A 2WAQG 4BBSH 4IOAA 1NMFA 4JI4Q 3H0GH 1YVCA 3TQYA 2K4KA 2N8NA 1PHJA 4L5TA 2E8GA 1QUQB 4A4IA 4JI4L 3A5UA 2Y0SE 5M5YH 1B7YB 1HR0W 1TWAH 1IBML 4QIWE 1M1KC 2Q2HA 4A76A 1O7IA 1Y1VG 5C0XG 3M4OH 3CCRA 4Y52H 3HKZG 1CSQA 1EIFA 4PMWA 5IYDG 4J15A 5GAHC 3RZOH 4R1JA 2UXDQ 4EQ5A 1L0WA 2K5VA 1D8LA 3KJOA 2QA4A 4Y7NH 4YWKA 2Q2UA 1BBUA 3EBEA 2HQLA 1CSPA 3H15A 2JA5G 4DR1Q 3GTOH 2RF4A 1NMGA 1ASYA 4HIDA 1U0LA 2K14A 3W1GA 4AQYQ 1Y1VH 2UUBL 4KHPL 4UPAA 1TWHH 2JJQA 4DAMA 5IT9c 2B3GA 1YITA 3CCLA 4LF9L 1YNXA 2WFWA 1VQ6A 3GTKH 4DR1L 4IFDJ 1HNZL 5IYDH 3G4SA 4ME3A 4AQYL 3RZDH 1UE5A 5M5WH 4HJAA 4PZ8A 1PFSA 4LFCQ 3CCMA 2IY5B 1PH5A 2OTJA 4GNXC 5JJIA 5M3MG 4DR2L 1JJ2A 3I4MG 4IPGA 2JA5H 2NVTH 2N3SA 5C4JH 1EOVA 1A8VA 1Q46A 4DR3L 4PZ6A 3UE0A 2H5XA 2E2IH 4DV5L 1SLJA 1IBKQ 3PCOB 5EAYA 3KFUA 1OXUA 2AWNA 5H1SE 2YYZA 1E3PA 5IE8A 5M3MH 1IL2A 1IBKL 1X6OA 4BXXG 3H3VH 1VQMA 4DV4L 4JI6Q 3A74A 2XTIA 3PIOA 1PH1A 2WP8J 4OO1G 3G48A 4DV6L 2UU9Q 4X66L 4QGUA 1Y14B 4YWLA 4OXPA 1VQOA 2PNHA 1N34Q 1B70B 2ZM6L 1VQFA 2IX0A 4P71A 4AIMA 3CC7A 1EYGA 1JJGA 4B3SQ 4BXXH 4JYAQ 2ALYB 4IOCA 1FL0A 3RNUA 1IYJB 5IYBG 1N34L 2R7ZG 1KL9A 1VQJA 1XMQQ 1YHAA 3CCUA 1V1QA 3HFZB 1K9MC 4A3GG 4B3SL 1XNRQ 5LMNL 3CPFA 4JYAL 5GAEC 4C3IH 4HJ8A 3S14H 1LTLA 1E1TA 2IT1A 1XMQL 4DV3Q 3KDFA 4GKKL 1LM0A 4L5SA 4C3HH 1XNRL 4UP7A 2JA6G 4B3MQ 2JQOA 3PV0A 3GDEA 5C3EG 5AJ3Q 1SN8A 1KRSA 2NN6I 2R7DA 3BZCA 5IYBH 4DV3L 4LF7L 3HOXH 4LF4Q 4A3GH 1HZBA 4HIMA 3ICEA 5AJ3L 1WOCA 1I94Q 3UDXA 4JI3Q 1VQAA 4BBRG 4LF4L 3GTPH 3LGJA 4GLXA 1C7YA 4KLKA 2JA6H 1I94L 2F4VQ 4P74A 4LFAQ 4JI3L 5C3EH 3GD7A 3RR5A 4TQUS 2VUMG 3BU2A 1YEZA 5JEAG 3RLFA 3W1BA 3CC2A 2F4VL 1VQCA 4LFAL 2PQAA 4XIGS 5DLQE 1N9WA 1I6HH 4BBRH 3K80C 5FLXc 3S1RH 1VQGA 4JBMA 4IO9A 3Q8DA 4IJHA 3HOWG 2JE6I 3NENA 2HT1A 4NXNQ 1JMCA 2VUMH 3HOVG 1YZ6A 1PYBA 3JC66 1GKHA 1ASZA 1X3GA 1LUZA 4RG1A 2KHJA 3G71A 4NXNL 2BH8A 3EIVA 4AYBG 1N33Q 4A3DG 5HGQA 1FVIA 4IPHA 3HOWH 3T1YQ 4HIOA 4JI0Q 4GS3A 2R92G 3CD6A 2UXCQ 3A5ZB 2PI2E 3K81C 4JOIC 4DV7Q 2ID0A 3S2DH 4B3RL 1YJWA 1S40A 2MO0A 3T1YL 2UXCL 2Q2IA 4P75A 4DAYB 3U58A 1N36Q 1JJCB 4DKAC 2E5LQ 2B63G 1AH9A 2LXJA 3RLNA 4JBWA 4L5QA 2AWOA 4DUZQ 3F2DA 3M7NA 5C4XG 1PH2A 4R4TA 2R92H 3RLOA 3GTQH 1YHBA 2EIFA 4DPGA 4A3KG 4DUZL 1SR3A 3PF4A 2LSSA 1S72A 1PH4A 2A8VA 1K83H 4H02A 4QY7A 4R4OA 1L1OA 3M3YH 3STBD 3PO3G 2Z6KA 4IPDA 2JA8G 1TWFH 2B63H 4MNOA 1XNQQ 2DUDA 3KF6A 5C4XH 4DNIA 3CPWA 3WWVA 1HZAA 1B8AA 2YV5A 3F2CA 3U4ZA 1KD1C 1R9TH 1VQIA 2KBNA 2WB1G 1Z47A 2A19A 3AFQA 2YU9H 2C35B 5FJ8G 4UY8C 3I55A 2UXDL 2BA1A 2KHIA 1K0RA 1K8AC 2K5NA 3U4VA 1XTDA 1KRTA 1C9OA 2JK8A 4NPSA 4GN5A 3HOZG 1BVSA 5GADC 3S1MH 1PYSB 3L2PA 3PO3H 3S24A 2JA8H 4DK3C 4P73A 2HIVA 1WFQA 2D0OA 3PSIA 2Q2TA 4LUVA 3BJUA 4MZ9A 1UE7A 1VQBA 3M4PA 3PUWA 3CCSA 3KJPA 2ZJQA 1BKBA 2K75A 2AHOB 4LFCL 1V43A 3PGZA 4WJ3M 3HOZH 1PV4A 2UUAQ 1T9HA 1P8LA 4BY7G 1QVCA 3M9BA 3RN5A 1HNWQ 4UP8A 3J80c 1OXVA 1XPUA 2YTVA 4A3CG 5K36G 3MEFA 1VQKA 3J80i 2UUAL 4LF8Q 1BBWA 3F8TA 3UDIA 3CC4A 4NXMQ 3L0OA 2KENA 3ER0A 2ZTDA 1EQRA 1GVPA 4DK6C 3I4MH 2QEXA 4LF8L 2V1CC 4IFDG 3KDFB 3CF5A 1N8RC 4YWMA 1NY4A 4X64Q 4BY7H 3CCVA 2N78A 1X3FA 3HOUG 2GVBA 3PUZA 1WJJA 4P72A 3GTLH 3I7FA 1GO3E 5GROA 1QZGA 3HKSA 4X64L 4YY3Q 4DV2Q 2XGTA 4JI6L 3CP0A 3TS2A 1TXYA 4DV1Q 1YJ9A 1HJPA 4KI0A 2R7FA 2YTYA 2MNAA 2UU9L 3K0XA 3S17H 3HKZE 3ZJYC 2NVXH 4YY3L 1G6PA 4OX9Q 3KYHC 1RIPA 4DV1L 1IBLQ 5C44G 4BY1G 4OWXB 2JEAI 3HOUH 5IP9G 3CW2C 1CKMA 4R4IA 3HOYG 4POGA 4OX9L 2UUCQ 2VQEQ 1IBLL 4JC0A 1QVFA 3RN2A 4DUYQ 4WJ4A 3F1ZA 2PQAB 2JA9A 2L15A 1W3SA 1PH8A 3KF8B 2VQEL 2UUCL 4A3IG 3M85A 4A93G 2N49A 2R7ZH 2B29A 5C44H 1MJEA 4IPCA 4BY1H 1WYDA 4YCUA 4B3ML 2MQHA 1Q8KA 4DR7Q 3HOYH 4LFBQ 3CMAA 4B3TQ 2IHFA 4PZ7A 2F52A 2I0QA 2K50A 2NVYH 1N32Q 4DR7L 3L7ZC 4AH6A 4LFBL 3ULLA 1YIJA 3FKIG 3UDFA 2PMZE 3OTOQ 2ZJPA 4JI2Q 3FHWA 5E7NA 4A3IH 1SFOH 1JB7A 1X65A 2AKWB 4A93H 4K0KQ 1SROA 1N32L 2GVAA 4X6AH 4LF5Q 4OONA 4GOPA 3OTOL 1RL2A 4K0KL 5C0XI 4A3BG 1GM5A 2ATWA 2NZOA 1HZ9A 1MKHA 4R4CA 2E2HH 2MFIA 3STBC 2PI2A 1WI5A 4GLVB 3FKIH 4OWTB 2Y0SG 4LUZA 2I5HA 2RHSB 2BA0A 3K7UC 1JT8A 2QGQA 2CQOA 4LUOA 2R93G 4A3BH 5LMNQ 4QQBX 1G291 2VW9A 1XPOA 1HR0Q 3D0FA 1X9NA 1AE3A 1CUKA 1L1OB 2JA7G 3CAMA 2RHQB 4YHHQ
chains in the Genus database with same CATH superfamily
1Q90A 1EZ6A 1S3OA 3E5SA 3AQQA 1HNXQ 5DM73 1U9RA 1X56A 1D1IA 3MA2B 4JI0L 2HCIA 2G9DA 1SYCA 1EIGA 2KCMA 2VQFQ 3PO2B 1HNXL 1WTXA 2KCCA 3K7AB 1CK1A 2A69D 2ZTEA 2PPBC 2CH4A 2JYOA 2QILA 2VQFL 1VQDA 4HTHA 2L12A 4A3FB 1EUJA 3NTKA 3K5NA 2VS1A 5JVH3 4OO1I 3TEHB 4F7XA 3S2HB 1AP0A 1CKNB 1B1ZA 4A3KH 4C3JG 4GNXA 5EPJA 1HUMA 4XTCS 1IBMQ 3GTMB 4A3JH 4GN3B 1PVOA 4POFA 3OOCA 2A1AA 4X3KA 1O7ZA 3V96A 1GXDC 4NB3A 4ZRZA 1JICA 1Z6HA 5FJ8H 5COYA 5IODA 1D2BA 1H95A 3K0YA 1DM0B 3VR3A 2K52A 1CKNA 2HQEA 3E0EA 4LF9Q 1TU2B 1EYDA 1KHIA 1VCIA 5J1ZA 2NB0A 3KOJA 4O2DA 1MBYA 1QUQA 2MO1A 1GUWA 2K33A 1IZ6A 2WAQE 4NXML 1X3EA 2EXZA 3I4NG 2EQSA 3PIO3 3K59A 1PXUA 4X3UA 2H1EA 5CV6A 4DR3Q 1EU4A 3ULJA 4A3CH 1U5KA 2QW7A 4DV5Q 4QJFA 2YTXA 3W5OA 1WTPA 5FLXE 3NTIA 2VB2X 4DV2L 1KQSA 4HMJA 4ZYSA 3Q23A 2CKZB 3DWAA 4QMGA 1TR5A 1EY9A 1Y1WG 2D2CC 1I50H 1WTWA 1M90C 4A93B 3CRLC 2WB1E 2ES2A 2L11A 3R93A 4EQOA 3ERSX 5EBDA 2B2WA 1VQ4A 2SNSA 4DUYL 2F0WA 3NP8A 1ILQA 2UXBQ 4PV1C 2E2JB 1STBA 3HOXG 4B3TL 2UXBL 3TDQA 1FR3A 1XPRA 4LF7Q 4RGOS 3A54A 3NELA 5CGKA 2NZHA 2NVQB 5T1GA 1W6JA 3MXPA 4RHRA 1Q81C 3NE5B 5HY6A 5IP7H 4A3LG 4DA2A 3VR2A 3NBHB 1VQLA 5EKKA 3FP9A 3AB9A 3P75A 4XQNA 4JBJA 3DLLA 4Z9CB 4YHHL 1Q1BA 3HZXA 3U9OA 4Q5VA 4A3EH 1PH6A 3S1NB 5L37A 4R8IA 1HQRD 3ONAB 3UE1A 1FJGQ 4CJ1B 3TP5A 3NTHA 4B9WA 4CJ0B 1JE5A 1I3QB 1FJGL 4EGVA 1D7QA 4LW1A 1VQ7A 1C48A 4IN3A 3M4OB 3KBXA 3RZOB 1B53A 4A3MH 2Q8IB 2IL8A 3QOLA 3LNNA 3PIP3 1NMFA 3ND8A 4I7AA 4MHEA 1Y1VB 3H0GH 3TQYA 4L5TA 1WTOA 1CQVA 3KK7A 2OT2A 3D4RA 1EEFD 1STEA 4QB4A 5CBEE 3CCRA 2LFNA 1CSQA 2NVTB 1S5CD 4IQZA 2UXDQ 3O13A 2K5VA 5J22A 2RDFA 2C9OA 4YWKA 2E2IB 3I73A 2JA5G 2RF4A 1WD0A 2RBMA 1ASYA 1U0LA 4KHPL 1HUNA 2JJQA 2XWBB 5IOCA 3CCLA 1VQ6A 5IYDH 1HNZL 1BDOA 3RZDH 5M5WH 1QCBD 4HJAA 1PFSA 3OPOA 2OTJA 1B50A 1JOOA 1Q8IA 3MWYW 4DK0A 4KTAA 5M3MG 3LWUA 1II3A 2K5DA 4MN3A 1G8ZD 2B8FA 1EOVA 4DNTB 2ZT9C 1PDQA 1JWMD 1SLJA 1IBKQ 1Y8NB 4IUNA 1LTGD 1O7YA 3DEPA 1IBKL 3TN2A 1SMYD 2PZTA 3H3VH 3U9SA 2DJFC 4C3HB 4DV4L 2KCNA 3G48A 3NSWA 4RH6A 4X66L 3HOXB 2F1MA 4HMIA 3I70A 2KEDA 1N34Q 1B70B 2IPKD 2IX0A 5IGDA 4CGYB 3VA5A 4JYAQ 1QNKA 5IYBG 1N34L 2R7ZG 1VQJA 3A7LA 3JAME 1XMQQ 1GUNA 4A3GG 4JYAL 3CPFA 4C3IH 1XMQL 2RKSA 3E3XA 4GKKL 1EQVA 3RD4A 5FOBB 1I6HB 4ZKCB 3SK4A 3S9WA 3PV0A 1F9PA 1R4PB 5AJ3Q 1SN8A 5KYIA 1LTRD 4LF4Q 5CV5A 5KGUA 2RDGA 5AJ3L 1YNJC 2G5DA 2Z1CA 3UDXA 4LF4L 3GTPH 2BDNA 3FPUB 2JA6H 5KYLA 2MUYA 5E4WC 3DWQA 2F4VQ 4TQUS 1H9SB 2VUMG 1A2TA 2F4VL 1VQCA 1UAPA 2PQAA 4XIGS 2K28A 1WTRA 1IL8A 3H94A 4OHJA 2JE6I 1PRTD 1JMCA 1ET9A 1X3GA 1KNAA 2A6EC 1GJXA 3EIVA 1N33Q 3BDOA 3HOWH 1S5ED 2WACA 2UXCQ 2PI2E 4B3RL 4DV7Q 2ID0A 1YJWA 1S40A 3MEHA 4C56C 4CBVA 2MO0A 2UXCL 2Q2IA 4P75A 1KNEA 2RA4A 3SK8A 2B63G 1K8MA 2AWOA 2A68D 1B9NA 3M7NA 1J9OA 2L55A 1VF5C 2LMCB 2N88A 4EQNA 2RSOA 4A3KG 3J7AF 5IT9L 1F2LA 1K83H 4R4OA 1PLFA 1D5XC 1V1PA 2JA8G 2JA5B 4E6IA 5F2DA 3KF6A 2XWJB 5C4XH 4DNIA 3WWVA 1AZQA 3F2CA 3U4ZA 1KD1C 3AFQA 1Z47A 1AN8A 1EEID 5FJ8G 3NBIA 3D4WA 1K8AC 3ND9A 4KV6A 5DNFA 2JK8A 3HP3A 5EGTA 3L2PA 2MHVA 3X3MA 4U673 1VMCA 1QWYA 1LLRD 3CCSA 3GTLB 4ZKBB 4XT3B 3HOZH 2ZXRA 1T9HA 3KLSA 4BY7G 5I6YA 4UP8A 2KUMA 3X3NA 3J80c 4A3CG 1B3QA 1SEBD 4LF8Q 1LTBD 3UDIA 3CC4A 4L8JA 3ER0A 2ZTDA 4RAUC 1EQRA 4DK6C 1ESRA 4LF8L 2F0DA 1N8RC 4YWMA 1DOMA 3CRKC 1NR2A 1X3FA 3HOUG 1W6KA 3I7FA 3N52A 5AFWA 3Q22A 2R7ZB 2F0EA 1QZGA 5JPNC 3P1HA 5I4DA 2R7FA 2UU9L 2AQ3B 3K0XA 3ZJYC 1ICFB 4DN4M 2NVYB 1A6XA 1G6PA 2E76C 1E2ZA 4CKCA 1DCZA 3CW2C 4R4IA 3HOYG 2KJXA 3AMUA 3RN2A 1I6VC 1F9SA 2PCFB 2EY2A 2K32A 3KF8B 5T1IA 4A3IG 1HFNA 1PZJD 1MJEA 1HRJA 5CR3A 1MSHA 1Z7TA 4ZK9B 2K50A 1IKMA 2LKVA 5DM63 1NNXA 3ULLA 5FK9C 1GUGA 4JI2Q 5C6AA 2AKWB 5JAVA 2NVXB 4X6AH 1TQOA 3KF8A 4P2CB 4QIWB 4K8JA 1GM5A 1JOKA 4R4CA 3STBC 4LJZC 4KN7C 3FKIH 4OWTB 1LV9A 2BA0A 1EIHA 1F77A 1SYFA 3UI2A 1JT8A 2QGQA 4A3BH 5D3DA 1X9NA 1L1OB 1K73C 2RHQB 1DOLA 2XIWA 5CV7A 4GN4B 3H3VI 3V05A 4A3KB 1XMOQ 3Q0AA 1YJNA 4RGTA 3T1HQ 4TVAB 2CQAA 2JA7H 1IYUA 1SNDA 3E0JA 1FNWA 1QE6A 1XMOL 4A3JB 2E5LL 1EU3A 1LO5D 1LT4D 4X62Q 2OCEA 4X65Q 2ZXOA 3T1HL 3TS0A 3PO2G 4XYOA 1KDBA 3W3AA 3A0JA 5CMDA 4X62L 2NN6G 4X65L 3DM3A 4HJ5A 2Z0SA 5M3FG 1KIXA 3CQZH 5DEHA 4A3FG 3ZYYX 2NTSA 1KXLA 1C0AA 3Q24A 1WTHA 4CDCC 1SMXA 5CBAE 1MIUA 2PW5A 2JSOA 2X69A 5JVG3 4DR6Q 2AMCB 1QB5D 2B2YA 4KN4C 2IX1A 1YHQA 5JJLA 2I07B 3BG3A 1CZWA 4DR6L 3GO5A 1VQHA 4DR4Q 2KOLA 4L5RC 2EZVA 1L1OC 3A8IE 2Z6KC 3IKJA 3OMGA 4Q0FA 3S15H 4DR4L 1I50B 1CA5A 2I5LX 4N9TA 1A3TA 1C8CA 4BA1I 5K36H 3EJIA 1WCMH 1K3RA 2CFMA 1W2BA 4IJLA 3K57A 3A7AB 1ENCA 3I90A 3AFPA 1BOSA 5HURA 1QOHA 2GN5A 4OGQC 4DFAA 5IYCG 1GD7A 1F9RA 3VDYA 3D4DA 4DV6Q 1KAWA 4RHSA 5ELBA 5ISRA 4GOPB 3OYYA 1MSGA 2I5MX 2CWPA 1TWCH 3HRZC 5ELEA 5M5XH 1SDFA 3EN2A 5LMUQ 1JR0D 4PG3A 5LMUL 2K1BA 1KC8C 2TMPA 1V9PA 1RTNA 4MTNA 5FLMH 5J3BA 3BVZA 1YI2A 1I4HA 4WFN3 3S1QH 1HCZA 3I2ZA 3GV6A 1Q82C 2NBFA 5BR8Q 2HDMA 2JP1A 5ELOA 1EY8A 1F2YA 4DV0Q 1SNQA 3D8GA 2D62A 4QL5A 4IUVA 2AUKA 5BR8L 4A3EB 4K5VA 4LWCA 1QVGA 2B2TC 4DV0L 4HJ7A 3QJYA 5JPMC 4LF6Q 5LL6X 4JBKA 3OSOA 1PH3A 2VB3X 1V8QA 2J4XA 2NYZD 4JOIA 3OIQA 3PUXA 4LF6L 5BN3A 5GQOA 1EFWA 4RFBA 2B2VC 2M2LA 2F0UA 3J81c 1PMRA 1HR0L 2CWAA 5G3LF 1X55A 2VZAA 4GLAC 4K6LA 1EQTA 1FGUA 3J7ZC 1PH7A 4XQJA 3AYHB 4GOPC 2VL6A 4GNXB 1BO0A 1FYCA 2OQ0A 3D31A 4I65A 3J7AV 3GTJH 1BCPB 5M3FB 4C1NK 1MJCA 1PZKD 1K3BC 3PMFA 1VQ9A 2FXQA 2XSCA 3SK6A 1VMPA 3VYRA 4JV5Q 3OHXC 1E24A 1A3VA 3RMHA 4XDXA 2KEEA 4KKTA 1S5DD 4FF2A 4JV5L 2BE5D 4WJWA 4BBSH 4G7OC 4DGZA 1RTOA 3J80L 1Y69U 2N8NA 3HKZB 5KNCA 1QUQB 3R8BA 4A4IA 3RZDB 2L9HA 5M5WB 1B7YB 5EKIA 1TWAH 1IBML 1M1KC 4FXDA 2Q2HA 4XT1B 1Y1VG 3MHBA 4PMWA 4ABNA 4R1JA 3VYTA 1CZGA 5EPLA 1CT1D 3EBEA 3T13A 1SE3A 2HQLA 1WD1A 3GTOH 1UNSA 4DR1Q 4AQYQ 3W1GA 5C0XH 5IT9c 4LF9L 1YITA 2B3GA 2E74C 4DR1L 1ET6A 3KLRA 3G4SA 4ME3A 4AQYL 3CCMA 1F9QA 1PH5A 4F87A 4GNXC 2EOTA 2O5IC 3BVGA 1QNUA 2ENBA 5ELDA 1BCPC 4HCEA 1FD7D 4DR3L 3UE0A 3LX0A 3NQIA 4DV5L 2K5QA 2XNAC 2AWNA 4WRDA 2YYZA 1E3PA 1CI3M 1VQMA 4JI6Q 3A74A 1AW7A 2XTIA 3PIOA 2WP8J 4OO1G 2F0NA 4XQQA 4QGUA 5EBCA 3OW7A 1VQOA 2PNHA 1VQFA 4C3HG 4CKBA 5I9PA 4BXXH 2F0GA 2ALYB 4IOCA 3GTPB 3RNUA 1IYJB 4CHTB 2JA6B 3TBIB 4K6DA 5GAEC 4UAIA 5LHY1 4HJ8A 3S14H 3L9AX 3TZUA 2EY1A 1IHZA 4DV3Q 1LM0A 4UP7A 4TKOB 1LT3D 4DV3L 4LF7L 1I4GA 4ODGA 3H3VC 1B3AA 2L5TA 4HIMA 3ICEA 1CHQD 1WOCA 4FF1A 3T4AC 3I8ZA 2B2WC 5BN5A 4P74A 4LFAQ 5C3EH 3GD7A 1TT2A 4HN7A 2K03A 4TRDA 3RLFA 3W1BA 3HOWB 3A56A 4LFAL 2NTTA 1N9WA 3MXUA 1JWSD 4BBRH 5FLXc 4IO9A 4F8MA 1ZEQX 3R2IA 4AYBB 1U4LA 1TIID 4NXNQ 4FXKC 1LTSD 1B44D 1PYBA 3JC66 5JEAH 5C4HA 1GKHA 1ASZA 1CM9A 4RG1A 2KHJA 3G71A 4NXNL 2BH8A 1TY0A 1K83B 3FEWX 3CD6A 5C4XB 5A2QE 1AZPA 4LK1C 3EROA 3TP7A 3U58A 1N36Q 4DKAC 1AH9A 4JBWA 4L63B 3F2DA 1SYBA 1PH2A 1E2WA 4R4TA 2R92H 3QB3A 3GTQH 3GTKB 1SR3A 4QY7A 4KY7A 3KLSX 3F2UA 1SMYC 1XNQQ 2DUDA 1PRTB 5C4JB 3HOZB 2F0MA 1BCPF 3CPWA 1B8AA 2YV5A 4K5XA 1VQIA 2KBNA 3DUZA 2C35B 2UXDL 5D65A 2K5NA 3FPPA 4NPSA 3S1MH 4GN5A 2XN9C 5GADC 3PO3H 4DK3C 3C2PA 1ZKOA 3PSIA 2D0OA 2KVMA 2Q2TA 3K5LA 1S5FD 3BJUA 4MZ9A 3WDNA 1VQBA 3M4PA 1T5EA 1V1OA 5IGCA 2K75A 1V43A 4WJ3M 2AUJD 1JC7A 3HS0C 4KK7A 1HNWQ 1BUVT 2EYPA 1GOZA 2YTVA 5CYUA 5K36G 3J80i 3F8TA 2K7VA 3L0OA 2KENA 1HTPA 1GVPA 3I4MH 1IKLA 2V1CC 3T51B 5EJWA 2EY6A 3PUZA 4L6TB 3QO2A 2IWHA 1KLGD 1GO3E 1KLUD 4YY3Q 2XGTA 3CP0A 3TS2A 4DV1Q 2PW7A 1YJ9A 2YTYA 2NUCA 3S17H 4YY3L 4IFDH 3KYHC 4DV1L 1PRTC 4X3SA 3T56B 4POGA 4K5WA 4RCNA 4WJ4A 2PQAB 2JA9A 1X3QA 4NMZA 1ENFA 5HGTA 1EY6A 3A8KE 1PH8A 1RDPD 2CH4W 5E1FA 3S1RB 3J81L 5C44H 4BY1H 4NW2A 4YCUA 2MQHA 2DN8A 3NHHA 3K5OA 4A3BB 1JB7A 4A93H 4K0KQ 1SFOH 1STHA 5I9OA 4LF5Q 1E0BA 4OONA 2Y0SB 4ZAIA 4XYQA 4K0KL 5C0XI 2ATWA 1HZ9A 1MKHA 2LS01 2E2HH 3A8JE 2PI2A 1WI5A 3DXJC 1XWEA 2JA7B 3A55A 1SYDA 3K7UC 1LTID 2K04A 2CQOA 5IGFA 5LMNQ 4QQBX 1NR4A 5LMNL 4G7HC 1N33L 1V1PB 1DZ1A 3MXNA 1QZHA 3CQZB 3IRBA 3KF6B 3JAMc 2R93H 4ALPA 3QWNA 4GKJQ 4DV7L 1CA6A 4A3DH 3PUVA 1DOKA 5GAGC 4DXFA 2EYFA 3K58A 4RKLA 2RCNA 4KJOA 3NWTA 5JJKA 3MTSA 1LTTD 1OXSC 2QDBA 3IAYA 1UE6A 1SE4A 2EDGA 1K8OA 5DAUA 4EQPA 4IZ8A 1AE2A 1E7ZA 4IUTA 1YNJD 1PTOB 2XRQD 4A3JG 3EFXD 4C1NI 2X6LA 5C3WA 4DAVA 1H9RA 3HEJA 3S1NH 1EWIA 3S15B 5IY0A 1KDCA 1UEBA 2EVBA 3OW2A 4K2KA 4DF7A 2SNMA 1EYAA 1SYEA 1PFNA 2RCFA 2PZUA 3TRZA 1I3QH 4YCWA 3TREA 1T5XD 3B6YA 4R8NA 1G2SA 2CHBD 4C3JH 2K6AA 1WCMB 2XVSA 5EQ0A 3GTGH 3DM1A 1KABA 2DGYA 2UUBQ 2A6ED 2F0SA 1TVXA 2HUGA 3E6ZX 5IWAQ 3I56A 1WTVA 4QCLA 5NUCA 3SR1A 1JB3A 1NAPA 2I46A 3UDGA 1E2VA 4O0AA 1ESFA 5IWAL 2QKIC 1CQFA 3TSSA 4DR2Q 3C1EA 4ME5A 2F0FA 1Q1EA 3E9IA 1VQNA 1RF2D 2NWGA 1TWCB 1KAAA 2H4OA 5M5XB 4JI7Q 1A62A 1BBXC 2F3IA 3GP7A 2RQXA 4KJNA 1XJVA 4V190 5BN4A 1XTCD 4N8X1 5C4ZA 2EYJA 1Q3LA 1NJIC 4JI7L 1IW7D 1HXYD 5CV9A 1JE4A 2RVLA 1PH9A 3I4NH 3BYTB 1PTOC 2IW3A 1S4ZA 3SEBA 4PQXA 3S1QB 1YNNC 4HR7B 1EIYB 2BH2A 2EYLA 2ZM6Q 4IUQA 3S16H 4HIKA 2A6HC 1VQPA 2WKDA 4EX5A 4JI1Q 1Y1WH 1X32A 5FLXL 4M8AA 2R3ZA 4JI1L 1MI2A 3SE0A 1OO9B 1JOQA 1IXRA 3BVMA 4LMQD 1HFGA 2NZ1D 5IP7G 4RMFA 5JOBA 4IURA 1ILPA 4JI2L 3QOJA 1B9MA 1EQQA 2DNCA 5A35A 3P20A 5KEEA 2HHHQ 4ZQ3A 1CKOA 1EY5A 1X3PA 1RJTA 3CU7A 3I4OA 2HHHL 1EY7A 2RSNA 1PA6A 5ELFA 3GTJB 2D0PA 4A3EG 5ELNA 5CORA 3CCQA 2EYMA 1X54A 2DY7A 1J6QA 1OXXK 3J81i 1OTCA 1VF7A 2ASBA 2VNUD 1HH2P 4A3LH 2EE1A 3VYUA 1K8GA 2EY5A 4BBSB 1SXTA 3QG1A 1AFPA 2F3WA 4A3MG 3W2DA 2IHEA 1LACA 3ULPA 4N8FA 1SBBB 1TWAB 2LXKA 5FO8B 4KHZA 3H0GG 3VR5A 4IFDI 1VQ8A 4F88A 1TWGH 1SRUA 4LNQA 3WOEA 4G7ZC 2P5ZX 5IGGA 1Q86C 1NE3A 1Z9FA 4QUCA 1SE8A 2WAQG 1WTQA 4IOAA 1YVCA 5D3IB 2K4KA 5IIFA 2ICIA 3A5UA 1Y8PB 5M5YH 1HR0W 4QIWE 4ID6A 4A76A 1O7IA 2QCPX 4Y52H 3HKZG 1EIFA 5GAHC 5IYDG 4J15A 1M8AA 2CW0D 4CJ2C 1L0WA 3KJOA 4DAYA 4Y7NH 3H15A 4IUPA 1PTOF 4HIDA 2K14A 2A74C 1ONLA 4UPAA 1TWHH 4DAMA 2WFWA 2F3VA 4LFCQ 2J7ZA 1WVLA 4PZ8A 2PMZB 1I4PA 3I4MG 2JA5H 2N3SA 5E4XA 1J8IA 1A8VA 1LTAD 3QR8A 3MC0B 5E3FA 2B2YC 3PCOB 3ITPA 3KFUA 4MIUA 4PMCA 1OXUA 1KTKA 3NPPA 1BF4A 1ZYRD 5TSSA 3S14B 5M3MH 1X6OA 2FINB 5G3LD 4PMBA 5KNBA 1PH1A 1EL0A 4NDXA 4DV6L 4C3IG 3SDZA 1Y14B 1I4RA 2B2UA 2OXPA 3SVMA 1I4XA 4OXPA 4O42A 4P71A 3CC7A 3NUCA 1TS2A 2SEBD 3EA6A 2EJMA 2WINB 2JXMB 1SYGA 2X6GA 1KL9A 1YHAA 3CCUA 1V1QA 1JCKB 5C3EB 1K0SA 1E1TA 4NKLA 2IT1A 2A69C 1IYVA 3KDFA 2JA6G 4B3MQ 2JQOA 3GDEA 4BBRB 2F0IA 4ULLA 5IYBH 2QDLA 4A3GH 1HZBA 4RGNA 1I94Q 1A2UA 2O2LD 1VQAA 3JAML 4FO2A 2F0JA 4KLKA 4V0BA 1I94L 1TKWB 2BE5C 4H0LC 3RR5A 1SSOA 1K28A 1YEZA 3CC2A 2MPMA 2HCCA 4A3MB 3I72A 3K80C 2L4NA 1GUTA 3K6OA 4JBMA 4FP5D 2Z4IA 1SJED 3Q8DA 3HOWG 1PFBA 1ENAA 2VUMH 1YZ6A 3H0GB 2F0VA 2D9UA 2N55A 2HD3A 3T53B 2R92B 3GTQB 3H09A 1DONA 1BR9A 2KECA 4AYBG 4A3DG 1FVIA 4IPHA 4IALA 2WAQB 1H9MA 4JI0Q 3A5ZB 4JOIC 3S2DH 5I6WA 4FVMA 3DHQA 4B9XA 1DD2A 1JJCB 2ICEC 4DUZQ 4OIKA 3S1MB 5C4XG 1ZXTA 3PO3B 3RLOA 1YHBA 3J7YW 2EIFA 3Q6SA 4DUZL 3PF4A 2LSSA 1STGA 1PH4A 2IX3A 3M3YH 2WB1B 4G57A 2WIIB 2PYKA 1TWFH 3H91A 5KIXA 2B63H 1S5BD 5FO7B 2F0HA 1R9TH 3IL8A 2YU9H 1K0RA 1XTDA 1KRTA 3HOZG 1BVSA 1PYSB 2Q8RE 3S24A 2JA8H 3I4MB 1B2TA 4P73A 2HIVA 4LUVA 2VXWA 1STYA 4M1UB 3PUWA 2ZJQA 1BKBA 2AHOB 4ZUIA 3D3RA 3PGZA 5KNDA 1EYCA 1P8LA 2BOSA 3M9BA 4GZYC 3S17B 1QG7A 2A5HA 1XPUA 4MTKA 3MEFA 3FRPB 4H13C 4BWGB 4NXMQ 1M4VA 3OWEB 3DMUA 4C3IB 4KD3A 2QEXA 2AQ2B 4X64Q 4QF4A 4BY7H 2GVBA 4P72A 5GROA 4JI6L 5C44B 3HKSA 4X64L 4DV2Q 4BY1B 1TXYA 1EY0A 2MNAA 4KI0A 3HKZE 2NVXH 4S3SA 1IBLQ 3AU7A 3HOUH 1CKMA 1SFOB 1IBLL 4JC0A 4DUYQ 2K05A 3P7JA 1W3SA 4ZLTF 2E2HB 3M85A 2FMCA 4J8QA 1NSNS 3FDTA 4LFBQ 3HOYH 3CMAA 4B3TQ 2IHFA 4PZ7A 3D6WA 4U68A 2PO4A 4LFBL 3L7ZC 1A3UA 4AH6A 4J6HA 3ERQA 1YIJA 3FKIG 3OTOQ 4A3IH 2CVRA 5E7NA 3MFGA 1SROA 1PZID 2GVAA 3OMCA 1BCPD 1HHVA 3OIPA 1RL2A 5EPKA 3OTOL 2O5JC 4A3BG 1L0XB 4B08A 2MFIA 1SNCA 2R93B 3BDLA 4A3DB 1G91A 2Y0SG 3OWFA 2QEJC 3C46A 2I5HA 2RHSB 2IJ0A 5C5LA 4TSSA 3C3LA 4LUOA 2RDHA 3CHBD 1G291 1XPOA 1JWUD 2BDOA 5JJZA 2JA7G 2F4IA 4DAPA 1U4MA 4YHHQ 4HEDA 4C2MH 4KKSA 1DXMA 3HOVH 1C4QA 1DYQA 2F0PA 2Z9HA 3I91A 3F2BA 1Y8OB 1F2MA 2SDFA 3JAMi 4DR5Q 4JG2A 1EY4A 3M4QA 1VDZA 1VS0A 1G51A 3FVQA 1N36L 4DR5L 3NBHA 3KLWA 1UWVA 4JW0A 1I4QA 4K8IA 4RKBA 5C0XJ 2CCZA 4CKEA 3SK5A 5CV8A 4C3JB 2OWOA 2PQEA 2EXDA 3CMEA 3GTGB 3BYYB 1VQ5A 1A0IA 3DWPA 1TS4A 3PF5A 3R3OA 1EOTA 4H7BA 1XNQL 4BA2I 4UP9A 1NTGA 3CCEA 3PIPA 3PO2H 3K7AH 3NWSA 2NN6H 2OTLA 5ELCA 2E75C 3URYA 5LMNW 5M3FH 3TZDA 4A3FH 4FDBA 1MGSA 3PUYA 4AYBE 1EZ8A 4FYDA 1VQEA 3S2HH 2F0TA 2B39A 1BQQT 4KHPQ 1J5EQ 2L1BA 4DNRB 3CXCA 4ZUJA 3I4NB 3BDCA 1WCMG 1D6EC 1HNZQ 1NUCA 1RKNA 1J5EL 1HNWL 1TS5A 2L0CA 2ZTCA 3GTMH 4A75A 3NEMA 3RUZA 5I2XA 4G4KA 4K14A 1HTLD 2GA4B 3S16B 3H6MA 1Y1WB 1DGSA 1E1OA 2O4XA 3G6JB 4DU9A 2KCTA 4DV4Q 3L3OC 3PQIA 4FNFA 3VR4A 2DY8A 1RHPA 1YBYA 3TMEA 4X66Q 3U50C 2EYHA 3E9HA 1AEXA 5FLMG 2A73B 1CFMA 3SGIA 1LYLA 3CCJA 3SXHA 1A63A 3FKIB 4O1NA 5IYCH 1HPCA 2K5HA 5IP9H 1U4PA 3AEVA 2F0OA 1DJRD 2M00A 4GKKQ 4H44C 4JI8Q 4HAEA 5JEAJ 3MAQA 2A68C 1RODA 2VY3A 3M7GA 1HZCA 4RGMA 4CDEC 4JI8L 2R6GA 1LT6D 3R2TA 3MXNB 3BZKA 4LF5L 4HJ9A 1U4RA 1QILA 2JEBI 1H9JA 1OXTA 1MHWC 5M9OA 3G6EA 1E22A 1H9KA 2E2JH 2OQKA 3G7LA 2F03A 3J81j 1EWHA 3FMCA 4YCVA 4KD4A 1B4OA 1HA5A 1RCVD 4JI5Q 3NK9A 4JCVE 1UE1A 1TWGB 2XRSD 2NVQH 4JI5L 1L2FA 2PZWA 4J1MA 4APVA 2EPBA 2ZJRA 4X3TA 4OWWB 1D5ZC 3IFTA 1Q12A 2FJ2A 1P16A 2KQ3A 4GKJL 3MFYA 3J80E 3MZ5A 1O7LA 1H9SA 4WORA 4EVOA 4BBSG 5M5YB 4R4QA 4B3RQ 1CTMA 2HIXA 2EYOA 1D1KA 1JORA 3K8AA 1L0YB 2V4DA 1I5FA 2LY7A 1NBWA 2PNRC 3IFDA 3J7A5 1A15A 4Y7NB 1Q7YC 1PYWD 1KDAA 4RCOA 5KRUA 2EJGC 4JI4Q 1EFID 2TSSA 1TWHB 1PHJA 1STAA 2E8GA 1IW7C 4JI4L 3HGBA 1XX8A 2Y0SE 3EVQA 4DK1A 3CKIB 5C0XG 3M4OH 3RZOH 2HDLA 4EQ5A 4KMUC 5IGBA 2ZXPA 1D8LA 2QA4A 1SNPA 2Q2UA 1BBUA 1ICWA 4OELB 4OIJA 1CSPA 1UEAB 1NMGA 2UUBL 1SNMA 1Y1VH 3VYSA 1PRTF 5M3MB 5EKLA 1YNXA 3GTKH 1QJOA 4CDDC 4IFDJ 1UE5A 2IY5B 5JJIA 3MXGA 1STNA 2D5DA 4DR2L 1JJ2A 4IPGA 2NVTH 2MP1A 2B8GA 5C4JH 1Q46A 4K2LA 4PZ6A 2H5XA 5K5PA 2Q8TA 2E2IH 1FNVA 4HSPA 5EAYA 3WOFA 3V2TA 5H1SE 5IE8A 1IL2A 4KY5A 4BXXG 3EQLC 2Z6BA 3BS1A 3D6CA 2UU9Q 1SAPA 4XXEA 4YWLA 4CDFC 4A3GB 1PFMA 1EWCA 2ZM6L 1SE2A 4AIMA 4YIJA 1EYGA 1JJGA 2FMMA 4NP5A 4B3SQ 1FL0A 1K9MC 3HFZB 4OO1H 4B3SL 4UHVA 1XNRQ 1LTLA 5LL6S 1G2TA 4FF3A 4L5SA 1XNRL 4C3HH 2C5CA 3TP8A 2F0LA 3VA7A 1GUSA 5C3EG 3BZCA 1KRSA 2NN6I 2R7DA 3NXWA 3HOXH 4HSVA 1CHPD 2DJGC 4QUFA 4BS9A 2VUMB 4JI3Q 4BBRG 3LGJA 4GLXA 1C7YA 2EJFC 3VR6A 4JI3L 2KA7A 1SNOA 2OEOA 3BU2A 3I4LA 2K5WA 4ZCKA 3KUPA 5JEAG 2R61A 4RA8A 5DLQE 1O80A 1I6HH 3S2DB 1JQYD 3S1RH 1VQGA 5CV4A 4I7ZC 1PTOD 4IJHA 3SHLA 3NENA 2HT1A 3HOVG 3LWEA 1YNND 2CW0C 4JPBW 1LUZA 2MGSA 2SOBA 1MD2D 4KKUA 5HGQA 4OEMB 2A6HD 3M3YB 4PNYA 3T1YQ 4HIOA 1LABA 1TWFB 4GS3A 2B63B 2R92G 5IGEA 1XYIA 3K81C 3M4YA 5C5MA 3BZDB 3T16A 4KY6A 3T1YL 1R9TB 2YU9B 3K5MA 1BXTA 4DAYB 3GTOB 2E5LQ 2LXJA 3RLNA 4L5QA 2JA8B 2DNEA 1SJHD 4DPGA 1S72A 2A8VA 4H02A 1L1OA 1ZYRC 3STBD 3PO3G 4HCSA 2Z6KA 4IPDA 5A2QL 4MNOA 5FO9B 2Z4HA 2G9HD 1HZAA 2JN4A 1G6ZA 2WB1G 4UY8C 2A19A 2KHSA 4LAAA 3I55A 2BA1A 2KHIA 4DXGA 3U4VA 1C9OA 3C1FA 2BCOA 2K01A 1UUPA 1WFQA 4BY7B 1UE7A 1ML0D 1TS3A 2E2DC 1D5MC 3GV3A 3KJPA 2OF1A 4LFCL 1PTOH 1PV4A 2UUAQ 5D14A 1QVCA 3RN5A 4OL7A 2Z8LA 1OXVA 4KHVA 4FF4A 1VQKA 2UUAL 3GQBA 1BBWA 2F0QA 3HOUB 3DEOA 3QIAA 2MJ8A 4IFDG 2QF7A 3KDFB 3CF5A 4FXGC 1NY4A 4UDUC 3CCVA 1HQMC 2N78A 4JK1C 4R9WA 3GTLH 1WJJA 1XXGA 2M9VA 2WKCA 4N9PA 4ILWA 1HJPA 3J81E 3HOYB 1BNZA 4OX9Q 1RIPA 4IUUA 5C44G 4BY1G 4OWXB 2JEAI 3NQTA 4A3IB 5IP9G 1R4QB 4OX9L 2UUCQ 2VQEQ 1QVFA 1FGBD 2B2TA 1FNUA 3F1ZA 1GHKA 2L15A 2UUCL 2VQEL 4A93G 2N49A 2R7ZH 2B29A 1O78A 4IPCA 1F2ZA 1WYDA 4B3ML 3KBGA 3TP6A 1Q8KA 4DR7Q 2J0TD 2WV6D 1LT5D 2F52A 3I3CA 1TY2A 2B2VA 3N6RA 2NVYH 2I0QA 1N32Q 4DR7L 2B2UC 3UDFA 2PMZE 4RWSC 2ZJPA 3FHWA 1X65A 1N32L 3MVVA 5J39A 4C2MB 4GOPA 3HOVB 5CC4A 2NZOA 2FFKB 1HA6A 4GLVB 5I2YA 5C3XA 5FKAC 1RD9D 4LUZA 1GHJA 1NCVA 2R93G 3HG9A 2F0KA 2FHTA 2AQ1B 2VW9A 1HR0Q 3D0FA 5IT9E 1AE3A 1CUKA 3CAMA 4JVZA 1GUOA
chains in the Genus database with same CATH topology
1N33L 4C2MH 1S3OA 3HOVH 1QZHA 3AQQA 3IRBA 3KF6B 1HNXQ 1X56A 4GN4B 3JAMc 3F2BA 4ALPA 4JI0L 3H3VI 2R93H 4GKJQ 4DV7L 2KCMA 3JAMi 1XMOQ 4DR5Q 4JG2A 2VQFQ 3PUVA 5GAGC 1HNXL 1YJNA 4A3DH 3M4QA 3T1HQ 4TVAB 2RCNA 1VS0A 2JA7H 5JJKA 2ZTEA 1G51A 1XMOL 1N36L 4DR5L 1OXSC 2VQFL 2E5LL 1UE6A 4X62Q 2OCEA 4X65Q 1VQDA 3KLWA 3T1HL 1UWVA 3TS0A 1AE2A 3PO2G 1E7ZA 5C0XJ 2CCZA 1EUJA 3A0JA 2VS1A 2OWOA 4X62L 2NN6G 4X65L 2EXDA 3CMEA 4A3JG 3DM3A 4HJ5A 4OO1I 2Z0SA 3TEHB 5M3FG 1A0IA 1KIXA 3CQZH 1VQ5A 1CKNB 4A3FG 3PF5A 1XNQL 4BA2I 4A3KH 1KXLA 4UP9A 1NTGA 3S1NH 1C0AA 3CCEA 1EWIA 5IY0A 3PIPA 4GNXA 3PO2H 1UEBA 3K7AH 4XTCS 3OW2A 1IBMQ 1SMXA 4A3JH 2OTLA 5LMNW 4GN3B 1PVOA 4POFA 5M3FH 3TRZA 1MIUA 1I3QH 2A1AA 4YCWA 4A3FH 3TREA 4DR6Q 2AMCB 4NB3A 3B6YA 4FDBA 1YHQA 2IX1A 5FJ8H 4C3JH 5JJLA 1H95A 3PUYA 4AYBE 4DR6L 2K52A 3GTGH 1VQEA 1VQHA 3GO5A 3S2HH 2DGYA 2UUBQ 4KHPQ 1CKNA 3E0EA 1J5EQ 4DR4Q 3CXCA 4L5RC 5IWAQ 4LF9Q 3I56A 1L1OC 1WCMG 1HNZQ 1KHIA 1VCIA 2Z6KC 3UDGA 3S15H 1J5EL 1HNWL 4DR4L 4O0AA 3KOJA 2ZTCA 4O2DA 5IWAL 2I5LX 3GTMH 1QUQA 2MO1A 3NEMA 4A75A 1IZ6A 2WAQE 4DR2Q 4NXML 1X3EA 3I4NG 2EQSA 1Q1EA 3E9IA 4DR3Q 1VQNA 3ULJA 4BA1I 4A3CH 1WCMH 1U5KA 4JI7Q 1K3RA 1A62A 4DV5Q 2F3IA 2CFMA 1W2BA 1XJVA 1DGSA 1E1OA 2YTXA 4IJLA 4QJFA 3W5OA 1NJIC 4JI7L 4DV2L 3AFPA 1KQSA 1PH9A 3I4NH 2CKZB 2KCTA 4DV4Q 2GN5A 1Y1WG 1I50H 5IYCG 1GD7A 1M90C 2WB1E 3VDYA 1YBYA 4DV6Q 2ES2A 1KAWA 1EIYB 4X66Q 3U50C 2BH2A 3ERSX 3E9HA 5FLMG 4GOPB 3OYYA 2ZM6Q 1VQ4A 3S16H 3SGIA 1LYLA 2I5MX 2CWPA 3CCJA 4DUYL 1TWCH 4HIKA 1VQPA 5M5XH 3EN2A 5LMUQ 4EX5A 4JI1Q 1Y1WH 1A63A 5IYCH 5IP9H 2K5HA 2UXBQ 4PG3A 3AEVA 5LMUL 1KC8C 4JI1L 3HOXG 1V9PA 4MTNA 5FLMH 4GKKQ 4B3TL 2UXBL 5J3BA 4JI8Q 1YI2A 5JEAJ 1IXRA 3S1QH 1XPRA 3I2ZA 5IP7G 4LF7Q 1Q82C 2VY3A 3NELA 4RMFA 1HZCA 1K73C 4JI8L 2NZHA 5BR8Q 2R6GA 4JI2L 5ELOA 3MXNB 4DV0Q 1EQQA 3BZKA 4LF5L 2D62A 4QL5A 4HJ9A 2HHHQ 5BR8L 4LWCA 1CKOA 2JEBI 1QVGA 1OXTA 4DV0L 4HJ7A 1Q81C 3I4OA 4LF6Q 5HY6A 3G6EA 1PH3A 4JBKA 2HHHL 5IP7H 1E22A 2E2JH 2OQKA 4JOIA 3PUXA 1PA6A 3J81j 4A3LG 4YCVA 2D0PA 4A3EG 4LF6L 3NBHB 5ELNA 5GQOA 3CCQA 1EFWA 1VQLA 3FP9A 1X54A 4JI5Q 4JCVE 1UE1A 3J81c 1HR0L 2NVQH 1J6QA 1OXXK 4JBJA 3J81i 4JI5L 1L2FA 2CWAA 1OTCA 1X55A 2ASBA 2VNUD 1HH2P 3DLLA 2VZAA 4APVA 4A3LH 4YHHL 1Q1BA 4GLAC 2ZJRA 1PH6A 4A3EH 1K8GA 1FGUA 3J7ZC 1PH7A 3AYHB 4GOPC 2VL6A 4GNXB 4OWWB 4A3MG 3UE1A 1Q12A 1FJGQ 1P16A 3D31A 2OQ0A 4GKJL 2IHEA 3ULPA 3GTJH 4BBSG 2LXKA 1JE5A 4R4QA 1MJCA 1VQ9A 1FJGL 4B3RQ 4KHZA 2FXQA 1D7QA 3H0GG 4LW1A 1VQ7A 2HIXA 4IFDI 3K8AA 4JV5Q 1VQ8A 1E24A 1I5FA 1SRUA 1TWGH 4LNQA 1NBWA 4A3MH 3J7A5 1Q86C 4JV5L 1Q7YC 1NE3A 1Z9FA 1SE8A 2WAQG 4BBSH 4IOAA 1NMFA 4JI4Q 3H0GH 1YVCA 3TQYA 2K4KA 2N8NA 1PHJA 4L5TA 2E8GA 1QUQB 4A4IA 4JI4L 3A5UA 2Y0SE 5M5YH 1B7YB 1HR0W 1TWAH 1IBML 4QIWE 1M1KC 2Q2HA 4A76A 1O7IA 1Y1VG 5C0XG 3M4OH 3CCRA 4Y52H 3HKZG 1CSQA 1EIFA 4PMWA 5IYDG 4J15A 5GAHC 3RZOH 4R1JA 2UXDQ 4EQ5A 1L0WA 2K5VA 1D8LA 3KJOA 2QA4A 4Y7NH 4YWKA 2Q2UA 1BBUA 3EBEA 2HQLA 1CSPA 3H15A 2JA5G 4DR1Q 3GTOH 2RF4A 1NMGA 1ASYA 4HIDA 1U0LA 2K14A 3W1GA 4AQYQ 1Y1VH 2UUBL 4KHPL 4UPAA 1TWHH 2JJQA 4DAMA 5IT9c 2B3GA 1YITA 3CCLA 4LF9L 1YNXA 2WFWA 1VQ6A 3GTKH 4DR1L 4IFDJ 1HNZL 5IYDH 3G4SA 4ME3A 4AQYL 3RZDH 1UE5A 5M5WH 4HJAA 4PZ8A 1PFSA 4LFCQ 3CCMA 2IY5B 1PH5A 2OTJA 4GNXC 5JJIA 5M3MG 4DR2L 1JJ2A 3I4MG 4IPGA 2JA5H 2NVTH 2N3SA 5C4JH 1EOVA 1A8VA 1Q46A 4DR3L 4PZ6A 3UE0A 2H5XA 2E2IH 4DV5L 1SLJA 1IBKQ 3PCOB 5EAYA 3KFUA 1OXUA 2AWNA 5H1SE 2YYZA 1E3PA 5IE8A 5M3MH 1IL2A 1IBKL 1X6OA 4BXXG 3H3VH 1VQMA 4DV4L 4JI6Q 3A74A 2XTIA 3PIOA 1PH1A 2WP8J 4OO1G 3G48A 4DV6L 2UU9Q 4X66L 4QGUA 1Y14B 4YWLA 4OXPA 1VQOA 2PNHA 1N34Q 1B70B 2ZM6L 1VQFA 2IX0A 4P71A 4AIMA 3CC7A 1EYGA 1JJGA 4B3SQ 4BXXH 4JYAQ 2ALYB 4IOCA 1FL0A 3RNUA 1IYJB 5IYBG 1N34L 2R7ZG 1KL9A 1VQJA 1XMQQ 1YHAA 3CCUA 1V1QA 3HFZB 1K9MC 4A3GG 4B3SL 1XNRQ 5LMNL 3CPFA 4JYAL 5GAEC 4C3IH 4HJ8A 3S14H 1LTLA 1E1TA 2IT1A 1XMQL 4DV3Q 3KDFA 4GKKL 1LM0A 4L5SA 4C3HH 1XNRL 4UP7A 2JA6G 4B3MQ 2JQOA 3PV0A 3GDEA 5C3EG 5AJ3Q 1SN8A 1KRSA 2NN6I 2R7DA 3BZCA 5IYBH 4DV3L 4LF7L 3HOXH 4LF4Q 4A3GH 1HZBA 4HIMA 3ICEA 5AJ3L 1WOCA 1I94Q 3UDXA 4JI3Q 1VQAA 4BBRG 4LF4L 3GTPH 3LGJA 4GLXA 1C7YA 4KLKA 2JA6H 1I94L 2F4VQ 4P74A 4LFAQ 4JI3L 5C3EH 3GD7A 3RR5A 4TQUS 2VUMG 3BU2A 1YEZA 5JEAG 3RLFA 3W1BA 3CC2A 2F4VL 1VQCA 4LFAL 2PQAA 4XIGS 5DLQE 1N9WA 1I6HH 4BBRH 3K80C 5FLXc 3S1RH 1VQGA 4JBMA 4IO9A 3Q8DA 4IJHA 3HOWG 2JE6I 3NENA 2HT1A 4NXNQ 1JMCA 2VUMH 3HOVG 1YZ6A 1PYBA 3JC66 1GKHA 1ASZA 1X3GA 1LUZA 4RG1A 2KHJA 3G71A 4NXNL 2BH8A 3EIVA 4AYBG 1N33Q 4A3DG 5HGQA 1FVIA 4IPHA 3HOWH 3T1YQ 4HIOA 4JI0Q 4GS3A 2R92G 3CD6A 2UXCQ 3A5ZB 2PI2E 3K81C 4JOIC 4DV7Q 2ID0A 3S2DH 4B3RL 1YJWA 1S40A 2MO0A 3T1YL 2UXCL 2Q2IA 4P75A 4DAYB 3U58A 1N36Q 1JJCB 4DKAC 2E5LQ 2B63G 1AH9A 2LXJA 3RLNA 4JBWA 4L5QA 2AWOA 4DUZQ 3F2DA 3M7NA 5C4XG 1PH2A 4R4TA 2R92H 3RLOA 3GTQH 1YHBA 2EIFA 4DPGA 4A3KG 4DUZL 1SR3A 3PF4A 2LSSA 1S72A 1PH4A 2A8VA 1K83H 4H02A 4QY7A 4R4OA 1L1OA 3M3YH 3STBD 3PO3G 2Z6KA 4IPDA 2JA8G 1TWFH 2B63H 4MNOA 1XNQQ 2DUDA 3KF6A 5C4XH 4DNIA 3CPWA 3WWVA 1HZAA 1B8AA 2YV5A 3F2CA 3U4ZA 1KD1C 1R9TH 1VQIA 2KBNA 2WB1G 1Z47A 2A19A 3AFQA 2YU9H 2C35B 5FJ8G 4UY8C 3I55A 2UXDL 2BA1A 2KHIA 1K0RA 1K8AC 2K5NA 3U4VA 1XTDA 1KRTA 1C9OA 2JK8A 4NPSA 4GN5A 3HOZG 1BVSA 5GADC 3S1MH 1PYSB 3L2PA 3PO3H 3S24A 2JA8H 4DK3C 4P73A 2HIVA 1WFQA 2D0OA 3PSIA 2Q2TA 4LUVA 3BJUA 4MZ9A 1UE7A 1VQBA 3M4PA 3PUWA 3CCSA 3KJPA 2ZJQA 1BKBA 2K75A 2AHOB 4LFCL 1V43A 3PGZA 4WJ3M 3HOZH 1PV4A 2UUAQ 1T9HA 1P8LA 4BY7G 1QVCA 3M9BA 3RN5A 1HNWQ 4UP8A 3J80c 1OXVA 1XPUA 2YTVA 4A3CG 5K36G 3MEFA 1VQKA 3J80i 2UUAL 4LF8Q 1BBWA 3F8TA 3UDIA 3CC4A 4NXMQ 3L0OA 2KENA 3ER0A 2ZTDA 1EQRA 1GVPA 4DK6C 3I4MH 2QEXA 4LF8L 2V1CC 4IFDG 3KDFB 3CF5A 1N8RC 4YWMA 1NY4A 4X64Q 4BY7H 3CCVA 2N78A 1X3FA 3HOUG 2GVBA 3PUZA 1WJJA 4P72A 3GTLH 3I7FA 1GO3E 5GROA 1QZGA 3HKSA 4X64L 4YY3Q 4DV2Q 2XGTA 4JI6L 3CP0A 3TS2A 1TXYA 4DV1Q 1YJ9A 1HJPA 4KI0A 2R7FA 2YTYA 2MNAA 2UU9L 3K0XA 3S17H 3HKZE 3ZJYC 2NVXH 4YY3L 1G6PA 4OX9Q 3KYHC 1RIPA 4DV1L 1IBLQ 5C44G 4BY1G 4OWXB 2JEAI 3HOUH 5IP9G 3CW2C 1CKMA 4R4IA 3HOYG 4POGA 4OX9L 2UUCQ 2VQEQ 1IBLL 4JC0A 1QVFA 3RN2A 4DUYQ 4WJ4A 3F1ZA 2PQAB 2JA9A 2L15A 1W3SA 1PH8A 3KF8B 2VQEL 2UUCL 4A3IG 3M85A 4A93G 2N49A 2R7ZH 2B29A 5C44H 1MJEA 4IPCA 4BY1H 1WYDA 4YCUA 4B3ML 2MQHA 1Q8KA 4DR7Q 3HOYH 4LFBQ 3CMAA 4B3TQ 2IHFA 4PZ7A 2F52A 2I0QA 2K50A 2NVYH 1N32Q 4DR7L 3L7ZC 4AH6A 4LFBL 3ULLA 1YIJA 3FKIG 3UDFA 2PMZE 3OTOQ 2ZJPA 4JI2Q 3FHWA 5E7NA 4A3IH 1SFOH 1JB7A 1X65A 2AKWB 4A93H 4K0KQ 1SROA 1N32L 2GVAA 4X6AH 4LF5Q 4OONA 4GOPA 3OTOL 1RL2A 4K0KL 5C0XI 4A3BG 1GM5A 2ATWA 2NZOA 1HZ9A 1MKHA 4R4CA 2E2HH 2MFIA 3STBC 2PI2A 1WI5A 4GLVB 3FKIH 4OWTB 2Y0SG 4LUZA 2I5HA 2RHSB 2BA0A 3K7UC 1JT8A 2QGQA 2CQOA 4LUOA 2R93G 4A3BH 5LMNQ 4QQBX 1G291 2VW9A 1XPOA 1HR0Q 3D0FA 1X9NA 1AE3A 1CUKA 1L1OB 2JA7G 3CAMA 2RHQB 4YHHQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 L;  4C2M H;  1S3O A;  3HOV H;  1QZH A;  3AQQ A;  3IRB A;  3KF6 B;  1HNX Q;  1X56 A;  4GN4 B;  3JAM c;  3F2B A;  4ALP A;  4JI0 L;  3H3V I;  2R93 H;  4GKJ Q;  4DV7 L;  2KCM A;  3JAM i;  1XMO Q;  4DR5 Q;  4JG2 A;  2VQF Q;  3PUV A;  5GAG C;  1HNX L;  1YJN A;  4A3D H;  3M4Q A;  3T1H Q;  4TVA B;  2RCN A;  1VS0 A;  2JA7 H;  5JJK A;  2ZTE A;  1G51 A;  1XMO L;  1N36 L;  4DR5 L;  1OXS C;  2VQF L;  2E5L L;  1UE6 A;  4X62 Q;  2OCE A;  4X65 Q;  1VQD A;  3KLW A;  3T1H L;  1UWV A;  3TS0 A;  1AE2 A;  3PO2 G;  1E7Z A;  5C0X J;  2CCZ A;  1EUJ A;  3A0J A;  2VS1 A;  2OWO A;  4X62 L;  2NN6 G;  4X65 L;  2EXD A;  3CME A;  4A3J G;  3DM3 A;  4HJ5 A;  4OO1 I;  2Z0S A;  3TEH B;  5M3F G;  1A0I A;  1KIX A;  3CQZ H;  1VQ5 A;  1CKN B;  4A3F G;  3PF5 A;  1XNQ L;  4BA2 I;  4A3K H;  1KXL A;  4UP9 A;  1NTG A;  3S1N H;  1C0A A;  3CCE A;  1EWI A;  5IY0 A;  3PIP A;  4GNX A;  3PO2 H;  1UEB A;  3K7A H;  4XTC S;  3OW2 A;  1IBM Q;  1SMX A;  4A3J H;  2OTL A;  5LMN W;  4GN3 B;  1PVO A;  4POF A;  5M3F H;  3TRZ A;  1MIU A;  1I3Q H;  2A1A A;  4YCW A;  4A3F H;  3TRE A;  4DR6 Q;  2AMC B;  4NB3 A;  3B6Y A;  4FDB A;  1YHQ A;  2IX1 A;  5FJ8 H;  4C3J H;  5JJL A;  1H95 A;  3PUY A;  4AYB E;  4DR6 L;  2K52 A;  3GTG H;  1VQE A;  1VQH A;  3GO5 A;  3S2H H;  2DGY A;  2UUB Q;  4KHP Q;  1CKN A;  3E0E A;  1J5E Q;  4DR4 Q;  3CXC A;  4L5R C;  5IWA Q;  4LF9 Q;  3I56 A;  1L1O C;  1WCM G;  1HNZ Q;  1KHI A;  1VCI A;  2Z6K C;  3UDG A;  3S15 H;  1J5E L;  1HNW L;  4DR4 L;  4O0A A;  3KOJ A;  2ZTC A;  4O2D A;  5IWA L;  2I5L X;  3GTM H;  1QUQ A;  2MO1 A;  3NEM A;  4A75 A;  1IZ6 A;  2WAQ E;  4DR2 Q;  4NXM L;  1X3E A;  3I4N G;  2EQS A;  1Q1E A;  3E9I A;  4DR3 Q;  1VQN A;  3ULJ A;  4BA1 I;  4A3C H;  1WCM H;  1U5K A;  4JI7 Q;  1K3R A;  1A62 A;  4DV5 Q;  2F3I A;  2CFM A;  1W2B A;  1XJV A;  1DGS A;  1E1O A;  2YTX A;  4IJL A;  4QJF A;  3W5O A;  1NJI C;  4JI7 L;  4DV2 L;  3AFP A;  1KQS A;  1PH9 A;  3I4N H;  2CKZ B;  2KCT A;  4DV4 Q;  2GN5 A;  1Y1W G;  1I50 H;  5IYC G;  1GD7 A;  1M90 C;  2WB1 E;  3VDY A;  1YBY A;  4DV6 Q;  2ES2 A;  1KAW A;  1EIY B;  4X66 Q;  3U50 C;  2BH2 A;  3ERS X;  3E9H A;  5FLM G;  4GOP B;  3OYY A;  2ZM6 Q;  1VQ4 A;  3S16 H;  3SGI A;  1LYL A;  2I5M X;  2CWP A;  3CCJ A;  4DUY L;  1TWC H;  4HIK A;  1VQP A;  5M5X H;  3EN2 A;  5LMU Q;  4EX5 A;  4JI1 Q;  1Y1W H;  1A63 A;  5IYC H;  5IP9 H;  2K5H A;  2UXB Q;  4PG3 A;  3AEV A;  5LMU L;  1KC8 C;  4JI1 L;  3HOX G;  1V9P A;  4MTN A;  5FLM H;  4GKK Q;  4B3T L;  2UXB L;  5J3B A;  4JI8 Q;  1YI2 A;  5JEA J;  1IXR A;  3S1Q H;  1XPR A;  3I2Z A;  5IP7 G;  4LF7 Q;  1Q82 C;  2VY3 A;  3NEL A;  4RMF A;  1HZC A;  1K73 C;  4JI8 L;  2NZH A;  5BR8 Q;  2R6G A;  4JI2 L;  5ELO A;  3MXN B;  4DV0 Q;  1EQQ A;  3BZK A;  4LF5 L;  2D62 A;  4QL5 A;  4HJ9 A;  2HHH Q;  5BR8 L;  4LWC A;  1CKO A;  2JEB I;  1QVG A;  1OXT A;  4DV0 L;  4HJ7 A;  1Q81 C;  3I4O A;  4LF6 Q;  5HY6 A;  3G6E A;  1PH3 A;  4JBK A;  2HHH L;  5IP7 H;  1E22 A;  2E2J H;  2OQK A;  4JOI A;  3PUX A;  1PA6 A;  3J81 j;  4A3L G;  4YCV A;  2D0P A;  4A3E G;  4LF6 L;  3NBH B;  5ELN A;  5GQO A;  3CCQ A;  1EFW A;  1VQL A;  3FP9 A;  1X54 A;  4JI5 Q;  4JCV E;  1UE1 A;  3J81 c;  1HR0 L;  2NVQ H;  1J6Q A;  1OXX K;  4JBJ A;  3J81 i;  4JI5 L;  1L2F A;  2CWA A;  1OTC A;  1X55 A;  2ASB A;  2VNU D;  1HH2 P;  3DLL A;  2VZA A;  4APV A;  4A3L H;  4YHH L;  1Q1B A;  4GLA C;  2ZJR A;  1PH6 A;  4A3E H;  1K8G A;  1FGU A;  3J7Z C;  1PH7 A;  3AYH B;  4GOP C;  2VL6 A;  4GNX B;  4OWW B;  4A3M G;  3UE1 A;  1Q12 A;  1FJG Q;  1P16 A;  3D31 A;  2OQ0 A;  4GKJ L;  2IHE A;  3ULP A;  3GTJ H;  4BBS G;  2LXK A;  1JE5 A;  4R4Q A;  1MJC A;  1VQ9 A;  1FJG L;  4B3R Q;  4KHZ A;  2FXQ A;  1D7Q A;  3H0G G;  4LW1 A;  1VQ7 A;  2HIX A;  4IFD I;  3K8A A;  4JV5 Q;  1VQ8 A;  1E24 A;  1I5F A;  1SRU A;  1TWG H;  4LNQ A;  1NBW A;  4A3M H;  3J7A 5;  1Q86 C;  4JV5 L;  1Q7Y C;  1NE3 A;  1Z9F A;  1SE8 A;  2WAQ G;  4BBS H;  4IOA A;  1NMF A;  4JI4 Q;  3H0G H;  1YVC A;  3TQY A;  2K4K A;  2N8N A;  1PHJ A;  4L5T A;  2E8G A;  1QUQ B;  4A4I A;  4JI4 L;  3A5U A;  2Y0S E;  5M5Y H;  1B7Y B;  1HR0 W;  1TWA H;  1IBM L;  4QIW E;  1M1K C;  2Q2H A;  4A76 A;  1O7I A;  1Y1V G;  5C0X G;  3M4O H;  3CCR A;  4Y52 H;  3HKZ G;  1CSQ A;  1EIF A;  4PMW A;  5IYD G;  4J15 A;  5GAH C;  3RZO H;  4R1J A;  2UXD Q;  4EQ5 A;  1L0W A;  2K5V A;  1D8L A;  3KJO A;  2QA4 A;  4Y7N H;  4YWK A;  2Q2U A;  1BBU A;  3EBE A;  2HQL A;  1CSP A;  3H15 A;  2JA5 G;  4DR1 Q;  3GTO H;  2RF4 A;  1NMG A;  1ASY A;  4HID A;  1U0L A;  2K14 A;  3W1G A;  4AQY Q;  1Y1V H;  2UUB L;  4KHP L;  4UPA A;  1TWH H;  2JJQ A;  4DAM A;  5IT9 c;  2B3G A;  1YIT A;  3CCL A;  4LF9 L;  1YNX A;  2WFW A;  1VQ6 A;  3GTK H;  4DR1 L;  4IFD J;  1HNZ L;  5IYD H;  3G4S A;  4ME3 A;  4AQY L;  3RZD H;  1UE5 A;  5M5W H;  4HJA A;  4PZ8 A;  1PFS A;  4LFC Q;  3CCM A;  2IY5 B;  1PH5 A;  2OTJ A;  4GNX C;  5JJI A;  5M3M G;  4DR2 L;  1JJ2 A;  3I4M G;  4IPG A;  2JA5 H;  2NVT H;  2N3S A;  5C4J H;  1EOV A;  1A8V A;  1Q46 A;  4DR3 L;  4PZ6 A;  3UE0 A;  2H5X A;  2E2I H;  4DV5 L;  1SLJ A;  1IBK Q;  3PCO B;  5EAY A;  3KFU A;  1OXU A;  2AWN A;  5H1S E;  2YYZ A;  1E3P A;  5IE8 A;  5M3M H;  1IL2 A;  1IBK L;  1X6O A;  4BXX G;  3H3V H;  1VQM A;  4DV4 L;  4JI6 Q;  3A74 A;  2XTI A;  3PIO A;  1PH1 A;  2WP8 J;  4OO1 G;  3G48 A;  4DV6 L;  2UU9 Q;  4X66 L;  4QGU A;  1Y14 B;  4YWL A;  4OXP A;  1VQO A;  2PNH A;  1N34 Q;  1B70 B;  2ZM6 L;  1VQF A;  2IX0 A;  4P71 A;  4AIM A;  3CC7 A;  1EYG A;  1JJG A;  4B3S Q;  4BXX H;  4JYA Q;  2ALY B;  4IOC A;  1FL0 A;  3RNU A;  1IYJ B;  5IYB G;  1N34 L;  2R7Z G;  1KL9 A;  1VQJ A;  1XMQ Q;  1YHA A;  3CCU A;  1V1Q A;  3HFZ B;  1K9M C;  4A3G G;  4B3S L;  1XNR Q;  5LMN L;  3CPF A;  4JYA L;  5GAE C;  4C3I H;  4HJ8 A;  3S14 H;  1LTL A;  1E1T A;  2IT1 A;  1XMQ L;  4DV3 Q;  3KDF A;  4GKK L;  1LM0 A;  4L5S A;  4C3H H;  1XNR L;  4UP7 A;  2JA6 G;  4B3M Q;  2JQO A;  3PV0 A;  3GDE A;  5C3E G;  5AJ3 Q;  1SN8 A;  1KRS A;  2NN6 I;  2R7D A;  3BZC A;  5IYB H;  4DV3 L;  4LF7 L;  3HOX H;  4LF4 Q;  4A3G H;  1HZB A;  4HIM A;  3ICE A;  5AJ3 L;  1WOC A;  1I94 Q;  3UDX A;  4JI3 Q;  1VQA A;  4BBR G;  4LF4 L;  3GTP H;  3LGJ A;  4GLX A;  1C7Y A;  4KLK A;  2JA6 H;  1I94 L;  2F4V Q;  4P74 A;  4LFA Q;  4JI3 L;  5C3E H;  3GD7 A;  3RR5 A;  4TQU S;  2VUM G;  3BU2 A;  1YEZ A;  5JEA G;  3RLF A;  3W1B A;  3CC2 A;  2F4V L;  1VQC A;  4LFA L;  2PQA A;  4XIG S;  5DLQ E;  1N9W A;  1I6H H;  4BBR H;  3K80 C;  5FLX c;  3S1R H;  1VQG A;  4JBM A;  4IO9 A;  3Q8D A;  4IJH A;  3HOW G;  2JE6 I;  3NEN A;  2HT1 A;  4NXN Q;  1JMC A;  2VUM H;  3HOV G;  1YZ6 A;  1PYB A;  3JC6 6;  1GKH A;  1ASZ A;  1X3G A;  1LUZ A;  4RG1 A;  2KHJ A;  3G71 A;  4NXN L;  2BH8 A;  3EIV A;  4AYB G;  1N33 Q;  4A3D G;  5HGQ A;  1FVI A;  4IPH A;  3HOW H;  3T1Y Q;  4HIO A;  4JI0 Q;  4GS3 A;  2R92 G;  3CD6 A;  2UXC Q;  3A5Z B;  2PI2 E;  3K81 C;  4JOI C;  4DV7 Q;  2ID0 A;  3S2D H;  4B3R L;  1YJW A;  1S40 A;  2MO0 A;  3T1Y L;  2UXC L;  2Q2I A;  4P75 A;  4DAY B;  3U58 A;  1N36 Q;  1JJC B;  4DKA C;  2E5L Q;  2B63 G;  1AH9 A;  2LXJ A;  3RLN A;  4JBW A;  4L5Q A;  2AWO A;  4DUZ Q;  3F2D A;  3M7N A;  5C4X G;  1PH2 A;  4R4T A;  2R92 H;  3RLO A;  3GTQ H;  1YHB A;  2EIF A;  4DPG A;  4A3K G;  4DUZ L;  1SR3 A;  3PF4 A;  2LSS A;  1S72 A;  1PH4 A;  2A8V A;  1K83 H;  4H02 A;  4QY7 A;  4R4O A;  1L1O A;  3M3Y H;  3STB D;  3PO3 G;  2Z6K A;  4IPD A;  2JA8 G;  1TWF H;  2B63 H;  4MNO A;  1XNQ Q;  2DUD A;  3KF6 A;  5C4X H;  4DNI A;  3CPW A;  3WWV A;  1HZA A;  1B8A A;  2YV5 A;  3F2C A;  3U4Z A;  1KD1 C;  1R9T H;  1VQI A;  2KBN A;  2WB1 G;  1Z47 A;  2A19 A;  3AFQ A;  2YU9 H;  2C35 B;  5FJ8 G;  4UY8 C;  3I55 A;  2UXD L;  2BA1 A;  2KHI A;  1K0R A;  1K8A C;  2K5N A;  3U4V A;  1XTD A;  1KRT A;  1C9O A;  2JK8 A;  4NPS A;  4GN5 A;  3HOZ G;  1BVS A;  5GAD C;  3S1M H;  1PYS B;  3L2P A;  3PO3 H;  3S24 A;  2JA8 H;  4DK3 C;  4P73 A;  2HIV A;  1WFQ A;  2D0O A;  3PSI A;  2Q2T A;  4LUV A;  3BJU A;  4MZ9 A;  1UE7 A;  1VQB A;  3M4P A;  3PUW A;  3CCS A;  3KJP A;  2ZJQ A;  1BKB A;  2K75 A;  2AHO B;  4LFC L;  1V43 A;  3PGZ A;  4WJ3 M;  3HOZ H;  1PV4 A;  2UUA Q;  1T9H A;  1P8L A;  4BY7 G;  1QVC A;  3M9B A;  3RN5 A;  1HNW Q;  4UP8 A;  3J80 c;  1OXV A;  1XPU A;  2YTV A;  4A3C G;  5K36 G;  3MEF A;  1VQK A;  3J80 i;  2UUA L;  4LF8 Q;  1BBW A;  3F8T A;  3UDI A;  3CC4 A;  4NXM Q;  3L0O A;  2KEN A;  3ER0 A;  2ZTD A;  1EQR A;  1GVP A;  4DK6 C;  3I4M H;  2QEX A;  4LF8 L;  2V1C C;  4IFD G;  3KDF B;  3CF5 A;  1N8R C;  4YWM A;  1NY4 A;  4X64 Q;  4BY7 H;  3CCV A;  2N78 A;  1X3F A;  3HOU G;  2GVB A;  3PUZ A;  1WJJ A;  4P72 A;  3GTL H;  3I7F A;  1GO3 E;  5GRO A;  1QZG A;  3HKS A;  4X64 L;  4YY3 Q;  4DV2 Q;  2XGT A;  4JI6 L;  3CP0 A;  3TS2 A;  1TXY A;  4DV1 Q;  1YJ9 A;  1HJP A;  4KI0 A;  2R7F A;  2YTY A;  2MNA A;  2UU9 L;  3K0X A;  3S17 H;  3HKZ E;  3ZJY C;  2NVX H;  4YY3 L;  1G6P A;  4OX9 Q;  3KYH C;  1RIP A;  4DV1 L;  1IBL Q;  5C44 G;  4BY1 G;  4OWX B;  2JEA I;  3HOU H;  5IP9 G;  3CW2 C;  1CKM A;  4R4I A;  3HOY G;  4POG A;  4OX9 L;  2UUC Q;  2VQE Q;  1IBL L;  4JC0 A;  1QVF A;  3RN2 A;  4DUY Q;  4WJ4 A;  3F1Z A;  2PQA B;  2JA9 A;  2L15 A;  1W3S A;  1PH8 A;  3KF8 B;  2VQE L;  2UUC L;  4A3I G;  3M85 A;  4A93 G;  2N49 A;  2R7Z H;  2B29 A;  5C44 H;  1MJE A;  4IPC A;  4BY1 H;  1WYD A;  4YCU A;  4B3M L;  2MQH A;  1Q8K A;  4DR7 Q;  3HOY H;  4LFB Q;  3CMA A;  4B3T Q;  2IHF A;  4PZ7 A;  2F52 A;  2I0Q A;  2K50 A;  2NVY H;  1N32 Q;  4DR7 L;  3L7Z C;  4AH6 A;  4LFB L;  3ULL A;  1YIJ A;  3FKI G;  3UDF A;  2PMZ E;  3OTO Q;  2ZJP A;  4JI2 Q;  3FHW A;  5E7N A;  4A3I H;  1SFO H;  1JB7 A;  1X65 A;  2AKW B;  4A93 H;  4K0K Q;  1SRO A;  1N32 L;  2GVA A;  4X6A H;  4LF5 Q;  4OON A;  4GOP A;  3OTO L;  1RL2 A;  4K0K L;  5C0X I;  4A3B G;  1GM5 A;  2ATW A;  2NZO A;  1HZ9 A;  1MKH A;  4R4C A;  2E2H H;  2MFI A;  3STB C;  2PI2 A;  1WI5 A;  4GLV B;  3FKI H;  4OWT B;  2Y0S G;  4LUZ A;  2I5H A;  2RHS B;  2BA0 A;  3K7U C;  1JT8 A;  2QGQ A;  2CQO A;  4LUO A;  2R93 G;  4A3B H;  5LMN Q;  4QQB X;  1G29 1;  2VW9 A;  1XPO A;  1HR0 Q;  3D0F A;  1X9N A;  1AE3 A;  1CUK A;  1L1O B;  2JA7 G;  3CAM A;  2RHQ B;  4YHH Q; 
#chains in the Genus database with same CATH topology
 1Q90 A;  1EZ6 A;  1S3O A;  3E5S A;  3AQQ A;  1HNX Q;  5DM7 3;  1U9R A;  1X56 A;  1D1I A;  3MA2 B;  4JI0 L;  2HCI A;  2G9D A;  1SYC A;  1EIG A;  2KCM A;  2VQF Q;  3PO2 B;  1HNX L;  1WTX A;  2KCC A;  3K7A B;  1CK1 A;  2A69 D;  2ZTE A;  2PPB C;  2CH4 A;  2JYO A;  2QIL A;  2VQF L;  1VQD A;  4HTH A;  2L12 A;  4A3F B;  1EUJ A;  3NTK A;  3K5N A;  2VS1 A;  5JVH 3;  4OO1 I;  3TEH B;  4F7X A;  3S2H B;  1AP0 A;  1CKN B;  1B1Z A;  4A3K H;  4C3J G;  4GNX A;  5EPJ A;  1HUM A;  4XTC S;  1IBM Q;  3GTM B;  4A3J H;  4GN3 B;  1PVO A;  4POF A;  3OOC A;  2A1A A;  4X3K A;  1O7Z A;  3V96 A;  1GXD C;  4NB3 A;  4ZRZ A;  1JIC A;  1Z6H A;  5FJ8 H;  5COY A;  5IOD A;  1D2B A;  1H95 A;  3K0Y A;  1DM0 B;  3VR3 A;  2K52 A;  1CKN A;  2HQE A;  3E0E A;  4LF9 Q;  1TU2 B;  1EYD A;  1KHI A;  1VCI A;  5J1Z A;  2NB0 A;  3KOJ A;  4O2D A;  1MBY A;  1QUQ A;  2MO1 A;  1GUW A;  2K33 A;  1IZ6 A;  2WAQ E;  4NXM L;  1X3E A;  2EXZ A;  3I4N G;  2EQS A;  3PIO 3;  3K59 A;  1PXU A;  4X3U A;  2H1E A;  5CV6 A;  4DR3 Q;  1EU4 A;  3ULJ A;  4A3C H;  1U5K A;  2QW7 A;  4DV5 Q;  4QJF A;  2YTX A;  3W5O A;  1WTP A;  5FLX E;  3NTI A;  2VB2 X;  4DV2 L;  1KQS A;  4HMJ A;  4ZYS A;  3Q23 A;  2CKZ B;  3DWA A;  4QMG A;  1TR5 A;  1EY9 A;  1Y1W G;  2D2C C;  1I50 H;  1WTW A;  1M90 C;  4A93 B;  3CRL C;  2WB1 E;  2ES2 A;  2L11 A;  3R93 A;  4EQO A;  3ERS X;  5EBD A;  2B2W A;  1VQ4 A;  2SNS A;  4DUY L;  2F0W A;  3NP8 A;  1ILQ A;  2UXB Q;  4PV1 C;  2E2J B;  1STB A;  3HOX G;  4B3T L;  2UXB L;  3TDQ A;  1FR3 A;  1XPR A;  4LF7 Q;  4RGO S;  3A54 A;  3NEL A;  5CGK A;  2NZH A;  2NVQ B;  5T1G A;  1W6J A;  3MXP A;  4RHR A;  1Q81 C;  3NE5 B;  5HY6 A;  5IP7 H;  4A3L G;  4DA2 A;  3VR2 A;  3NBH B;  1VQL A;  5EKK A;  3FP9 A;  3AB9 A;  3P75 A;  4XQN A;  4JBJ A;  3DLL A;  4Z9C B;  4YHH L;  1Q1B A;  3HZX A;  3U9O A;  4Q5V A;  4A3E H;  1PH6 A;  3S1N B;  5L37 A;  4R8I A;  1HQR D;  3ONA B;  3UE1 A;  1FJG Q;  4CJ1 B;  3TP5 A;  3NTH A;  4B9W A;  4CJ0 B;  1JE5 A;  1I3Q B;  1FJG L;  4EGV A;  1D7Q A;  4LW1 A;  1VQ7 A;  1C48 A;  4IN3 A;  3M4O B;  3KBX A;  3RZO B;  1B53 A;  4A3M H;  2Q8I B;  2IL8 A;  3QOL A;  3LNN A;  3PIP 3;  1NMF A;  3ND8 A;  4I7A A;  4MHE A;  1Y1V B;  3H0G H;  3TQY A;  4L5T A;  1WTO A;  1CQV A;  3KK7 A;  2OT2 A;  3D4R A;  1EEF D;  1STE A;  4QB4 A;  5CBE E;  3CCR A;  2LFN A;  1CSQ A;  2NVT B;  1S5C D;  4IQZ A;  2UXD Q;  3O13 A;  2K5V A;  5J22 A;  2RDF A;  2C9O A;  4YWK A;  2E2I B;  3I73 A;  2JA5 G;  2RF4 A;  1WD0 A;  2RBM A;  1ASY A;  1U0L A;  4KHP L;  1HUN A;  2JJQ A;  2XWB B;  5IOC A;  3CCL A;  1VQ6 A;  5IYD H;  1HNZ L;  1BDO A;  3RZD H;  5M5W H;  1QCB D;  4HJA A;  1PFS A;  3OPO A;  2OTJ A;  1B50 A;  1JOO A;  1Q8I A;  3MWY W;  4DK0 A;  4KTA A;  5M3M G;  3LWU A;  1II3 A;  2K5D A;  4MN3 A;  1G8Z D;  2B8F A;  1EOV A;  4DNT B;  2ZT9 C;  1PDQ A;  1JWM D;  1SLJ A;  1IBK Q;  1Y8N B;  4IUN A;  1LTG D;  1O7Y A;  3DEP A;  1IBK L;  3TN2 A;  1SMY D;  2PZT A;  3H3V H;  3U9S A;  2DJF C;  4C3H B;  4DV4 L;  2KCN A;  3G48 A;  3NSW A;  4RH6 A;  4X66 L;  3HOX B;  2F1M A;  4HMI A;  3I70 A;  2KED A;  1N34 Q;  1B70 B;  2IPK D;  2IX0 A;  5IGD A;  4CGY B;  3VA5 A;  4JYA Q;  1QNK A;  5IYB G;  1N34 L;  2R7Z G;  1VQJ A;  3A7L A;  3JAM E;  1XMQ Q;  1GUN A;  4A3G G;  4JYA L;  3CPF A;  4C3I H;  1XMQ L;  2RKS A;  3E3X A;  4GKK L;  1EQV A;  3RD4 A;  5FOB B;  1I6H B;  4ZKC B;  3SK4 A;  3S9W A;  3PV0 A;  1F9P A;  1R4P B;  5AJ3 Q;  1SN8 A;  5KYI A;  1LTR D;  4LF4 Q;  5CV5 A;  5KGU A;  2RDG A;  5AJ3 L;  1YNJ C;  2G5D A;  2Z1C A;  3UDX A;  4LF4 L;  3GTP H;  2BDN A;  3FPU B;  2JA6 H;  5KYL A;  2MUY A;  5E4W C;  3DWQ A;  2F4V Q;  4TQU S;  1H9S B;  2VUM G;  1A2T A;  2F4V L;  1VQC A;  1UAP A;  2PQA A;  4XIG S;  2K28 A;  1WTR A;  1IL8 A;  3H94 A;  4OHJ A;  2JE6 I;  1PRT D;  1JMC A;  1ET9 A;  1X3G A;  1KNA A;  2A6E C;  1GJX A;  3EIV A;  1N33 Q;  3BDO A;  3HOW H;  1S5E D;  2WAC A;  2UXC Q;  2PI2 E;  4B3R L;  4DV7 Q;  2ID0 A;  1YJW A;  1S40 A;  3MEH A;  4C56 C;  4CBV A;  2MO0 A;  2UXC L;  2Q2I A;  4P75 A;  1KNE A;  2RA4 A;  3SK8 A;  2B63 G;  1K8M A;  2AWO A;  2A68 D;  1B9N A;  3M7N A;  1J9O A;  2L55 A;  1VF5 C;  2LMC B;  2N88 A;  4EQN A;  2RSO A;  4A3K G;  3J7A F;  5IT9 L;  1F2L A;  1K83 H;  4R4O A;  1PLF A;  1D5X C;  1V1P A;  2JA8 G;  2JA5 B;  4E6I A;  5F2D A;  3KF6 A;  2XWJ B;  5C4X H;  4DNI A;  3WWV A;  1AZQ A;  3F2C A;  3U4Z A;  1KD1 C;  3AFQ A;  1Z47 A;  1AN8 A;  1EEI D;  5FJ8 G;  3NBI A;  3D4W A;  1K8A C;  3ND9 A;  4KV6 A;  5DNF A;  2JK8 A;  3HP3 A;  5EGT A;  3L2P A;  2MHV A;  3X3M A;  4U67 3;  1VMC A;  1QWY A;  1LLR D;  3CCS A;  3GTL B;  4ZKB B;  4XT3 B;  3HOZ H;  2ZXR A;  1T9H A;  3KLS A;  4BY7 G;  5I6Y A;  4UP8 A;  2KUM A;  3X3N A;  3J80 c;  4A3C G;  1B3Q A;  1SEB D;  4LF8 Q;  1LTB D;  3UDI A;  3CC4 A;  4L8J A;  3ER0 A;  2ZTD A;  4RAU C;  1EQR A;  4DK6 C;  1ESR A;  4LF8 L;  2F0D A;  1N8R C;  4YWM A;  1DOM A;  3CRK C;  1NR2 A;  1X3F A;  3HOU G;  1W6K A;  3I7F A;  3N52 A;  5AFW A;  3Q22 A;  2R7Z B;  2F0E A;  1QZG A;  5JPN C;  3P1H A;  5I4D A;  2R7F A;  2UU9 L;  2AQ3 B;  3K0X A;  3ZJY C;  1ICF B;  4DN4 M;  2NVY B;  1A6X A;  1G6P A;  2E76 C;  1E2Z A;  4CKC A;  1DCZ A;  3CW2 C;  4R4I A;  3HOY G;  2KJX A;  3AMU A;  3RN2 A;  1I6V C;  1F9S A;  2PCF B;  2EY2 A;  2K32 A;  3KF8 B;  5T1I A;  4A3I G;  1HFN A;  1PZJ D;  1MJE A;  1HRJ A;  5CR3 A;  1MSH A;  1Z7T A;  4ZK9 B;  2K50 A;  1IKM A;  2LKV A;  5DM6 3;  1NNX A;  3ULL A;  5FK9 C;  1GUG A;  4JI2 Q;  5C6A A;  2AKW B;  5JAV A;  2NVX B;  4X6A H;  1TQO A;  3KF8 A;  4P2C B;  4QIW B;  4K8J A;  1GM5 A;  1JOK A;  4R4C A;  3STB C;  4LJZ C;  4KN7 C;  3FKI H;  4OWT B;  1LV9 A;  2BA0 A;  1EIH A;  1F77 A;  1SYF A;  3UI2 A;  1JT8 A;  2QGQ A;  4A3B H;  5D3D A;  1X9N A;  1L1O B;  1K73 C;  2RHQ B;  1DOL A;  2XIW A;  5CV7 A;  4GN4 B;  3H3V I;  3V05 A;  4A3K B;  1XMO Q;  3Q0A A;  1YJN A;  4RGT A;  3T1H Q;  4TVA B;  2CQA A;  2JA7 H;  1IYU A;  1SND A;  3E0J A;  1FNW A;  1QE6 A;  1XMO L;  4A3J B;  2E5L L;  1EU3 A;  1LO5 D;  1LT4 D;  4X62 Q;  2OCE A;  4X65 Q;  2ZXO A;  3T1H L;  3TS0 A;  3PO2 G;  4XYO A;  1KDB A;  3W3A A;  3A0J A;  5CMD A;  4X62 L;  2NN6 G;  4X65 L;  3DM3 A;  4HJ5 A;  2Z0S A;  5M3F G;  1KIX A;  3CQZ H;  5DEH A;  4A3F G;  3ZYY X;  2NTS A;  1KXL A;  1C0A A;  3Q24 A;  1WTH A;  4CDC C;  1SMX A;  5CBA E;  1MIU A;  2PW5 A;  2JSO A;  2X69 A;  5JVG 3;  4DR6 Q;  2AMC B;  1QB5 D;  2B2Y A;  4KN4 C;  2IX1 A;  1YHQ A;  5JJL A;  2I07 B;  3BG3 A;  1CZW A;  4DR6 L;  3GO5 A;  1VQH A;  4DR4 Q;  2KOL A;  4L5R C;  2EZV A;  1L1O C;  3A8I E;  2Z6K C;  3IKJ A;  3OMG A;  4Q0F A;  3S15 H;  4DR4 L;  1I50 B;  1CA5 A;  2I5L X;  4N9T A;  1A3T A;  1C8C A;  4BA1 I;  5K36 H;  3EJI A;  1WCM H;  1K3R A;  2CFM A;  1W2B A;  4IJL A;  3K57 A;  3A7A B;  1ENC A;  3I90 A;  3AFP A;  1BOS A;  5HUR A;  1QOH A;  2GN5 A;  4OGQ C;  4DFA A;  5IYC G;  1GD7 A;  1F9R A;  3VDY A;  3D4D A;  4DV6 Q;  1KAW A;  4RHS A;  5ELB A;  5ISR A;  4GOP B;  3OYY A;  1MSG A;  2I5M X;  2CWP A;  1TWC H;  3HRZ C;  5ELE A;  5M5X H;  1SDF A;  3EN2 A;  5LMU Q;  1JR0 D;  4PG3 A;  5LMU L;  2K1B A;  1KC8 C;  2TMP A;  1V9P A;  1RTN A;  4MTN A;  5FLM H;  5J3B A;  3BVZ A;  1YI2 A;  1I4H A;  4WFN 3;  3S1Q H;  1HCZ A;  3I2Z A;  3GV6 A;  1Q82 C;  2NBF A;  5BR8 Q;  2HDM A;  2JP1 A;  5ELO A;  1EY8 A;  1F2Y A;  4DV0 Q;  1SNQ A;  3D8G A;  2D62 A;  4QL5 A;  4IUV A;  2AUK A;  5BR8 L;  4A3E B;  4K5V A;  4LWC A;  1QVG A;  2B2T C;  4DV0 L;  4HJ7 A;  3QJY A;  5JPM C;  4LF6 Q;  5LL6 X;  4JBK A;  3OSO A;  1PH3 A;  2VB3 X;  1V8Q A;  2J4X A;  2NYZ D;  4JOI A;  3OIQ A;  3PUX A;  4LF6 L;  5BN3 A;  5GQO A;  1EFW A;  4RFB A;  2B2V C;  2M2L A;  2F0U A;  3J81 c;  1PMR A;  1HR0 L;  2CWA A;  5G3L F;  1X55 A;  2VZA A;  4GLA C;  4K6L A;  1EQT A;  1FGU A;  3J7Z C;  1PH7 A;  4XQJ A;  3AYH B;  4GOP C;  2VL6 A;  4GNX B;  1BO0 A;  1FYC A;  2OQ0 A;  3D31 A;  4I65 A;  3J7A V;  3GTJ H;  1BCP B;  5M3F B;  4C1N K;  1MJC A;  1PZK D;  1K3B C;  3PMF A;  1VQ9 A;  2FXQ A;  2XSC A;  3SK6 A;  1VMP A;  3VYR A;  4JV5 Q;  3OHX C;  1E24 A;  1A3V A;  3RMH A;  4XDX A;  2KEE A;  4KKT A;  1S5D D;  4FF2 A;  4JV5 L;  2BE5 D;  4WJW A;  4BBS H;  4G7O C;  4DGZ A;  1RTO A;  3J80 L;  1Y69 U;  2N8N A;  3HKZ B;  5KNC A;  1QUQ B;  3R8B A;  4A4I A;  3RZD B;  2L9H A;  5M5W B;  1B7Y B;  5EKI A;  1TWA H;  1IBM L;  1M1K C;  4FXD A;  2Q2H A;  4XT1 B;  1Y1V G;  3MHB A;  4PMW A;  4ABN A;  4R1J A;  3VYT A;  1CZG A;  5EPL A;  1CT1 D;  3EBE A;  3T13 A;  1SE3 A;  2HQL A;  1WD1 A;  3GTO H;  1UNS A;  4DR1 Q;  4AQY Q;  3W1G A;  5C0X H;  5IT9 c;  4LF9 L;  1YIT A;  2B3G A;  2E74 C;  4DR1 L;  1ET6 A;  3KLR A;  3G4S A;  4ME3 A;  4AQY L;  3CCM A;  1F9Q A;  1PH5 A;  4F87 A;  4GNX C;  2EOT A;  2O5I C;  3BVG A;  1QNU A;  2ENB A;  5ELD A;  1BCP C;  4HCE A;  1FD7 D;  4DR3 L;  3UE0 A;  3LX0 A;  3NQI A;  4DV5 L;  2K5Q A;  2XNA C;  2AWN A;  4WRD A;  2YYZ A;  1E3P A;  1CI3 M;  1VQM A;  4JI6 Q;  3A74 A;  1AW7 A;  2XTI A;  3PIO A;  2WP8 J;  4OO1 G;  2F0N A;  4XQQ A;  4QGU A;  5EBC A;  3OW7 A;  1VQO A;  2PNH A;  1VQF A;  4C3H G;  4CKB A;  5I9P A;  4BXX H;  2F0G A;  2ALY B;  4IOC A;  3GTP B;  3RNU A;  1IYJ B;  4CHT B;  2JA6 B;  3TBI B;  4K6D A;  5GAE C;  4UAI A;  5LHY 1;  4HJ8 A;  3S14 H;  3L9A X;  3TZU A;  2EY1 A;  1IHZ A;  4DV3 Q;  1LM0 A;  4UP7 A;  4TKO B;  1LT3 D;  4DV3 L;  4LF7 L;  1I4G A;  4ODG A;  3H3V C;  1B3A A;  2L5T A;  4HIM A;  3ICE A;  1CHQ D;  1WOC A;  4FF1 A;  3T4A C;  3I8Z A;  2B2W C;  5BN5 A;  4P74 A;  4LFA Q;  5C3E H;  3GD7 A;  1TT2 A;  4HN7 A;  2K03 A;  4TRD A;  3RLF A;  3W1B A;  3HOW B;  3A56 A;  4LFA L;  2NTT A;  1N9W A;  3MXU A;  1JWS D;  4BBR H;  5FLX c;  4IO9 A;  4F8M A;  1ZEQ X;  3R2I A;  4AYB B;  1U4L A;  1TII D;  4NXN Q;  4FXK C;  1LTS D;  1B44 D;  1PYB A;  3JC6 6;  5JEA H;  5C4H A;  1GKH A;  1ASZ A;  1CM9 A;  4RG1 A;  2KHJ A;  3G71 A;  4NXN L;  2BH8 A;  1TY0 A;  1K83 B;  3FEW X;  3CD6 A;  5C4X B;  5A2Q E;  1AZP A;  4LK1 C;  3ERO A;  3TP7 A;  3U58 A;  1N36 Q;  4DKA C;  1AH9 A;  4JBW A;  4L63 B;  3F2D A;  1SYB A;  1PH2 A;  1E2W A;  4R4T A;  2R92 H;  3QB3 A;  3GTQ H;  3GTK B;  1SR3 A;  4QY7 A;  4KY7 A;  3KLS X;  3F2U A;  1SMY C;  1XNQ Q;  2DUD A;  1PRT B;  5C4J B;  3HOZ B;  2F0M A;  1BCP F;  3CPW A;  1B8A A;  2YV5 A;  4K5X A;  1VQI A;  2KBN A;  3DUZ A;  2C35 B;  2UXD L;  5D65 A;  2K5N A;  3FPP A;  4NPS A;  3S1M H;  4GN5 A;  2XN9 C;  5GAD C;  3PO3 H;  4DK3 C;  3C2P A;  1ZKO A;  3PSI A;  2D0O A;  2KVM A;  2Q2T A;  3K5L A;  1S5F D;  3BJU A;  4MZ9 A;  3WDN A;  1VQB A;  3M4P A;  1T5E A;  1V1O A;  5IGC A;  2K75 A;  1V43 A;  4WJ3 M;  2AUJ D;  1JC7 A;  3HS0 C;  4KK7 A;  1HNW Q;  1BUV T;  2EYP A;  1GOZ A;  2YTV A;  5CYU A;  5K36 G;  3J80 i;  3F8T A;  2K7V A;  3L0O A;  2KEN A;  1HTP A;  1GVP A;  3I4M H;  1IKL A;  2V1C C;  3T51 B;  5EJW A;  2EY6 A;  3PUZ A;  4L6T B;  3QO2 A;  2IWH A;  1KLG D;  1GO3 E;  1KLU D;  4YY3 Q;  2XGT A;  3CP0 A;  3TS2 A;  4DV1 Q;  2PW7 A;  1YJ9 A;  2YTY A;  2NUC A;  3S17 H;  4YY3 L;  4IFD H;  3KYH C;  4DV1 L;  1PRT C;  4X3S A;  3T56 B;  4POG A;  4K5W A;  4RCN A;  4WJ4 A;  2PQA B;  2JA9 A;  1X3Q A;  4NMZ A;  1ENF A;  5HGT A;  1EY6 A;  3A8K E;  1PH8 A;  1RDP D;  2CH4 W;  5E1F A;  3S1R B;  3J81 L;  5C44 H;  4BY1 H;  4NW2 A;  4YCU A;  2MQH A;  2DN8 A;  3NHH A;  3K5O A;  4A3B B;  1JB7 A;  4A93 H;  4K0K Q;  1SFO H;  1STH A;  5I9O A;  4LF5 Q;  1E0B A;  4OON A;  2Y0S B;  4ZAI A;  4XYQ A;  4K0K L;  5C0X I;  2ATW A;  1HZ9 A;  1MKH A;  2LS0 1;  2E2H H;  3A8J E;  2PI2 A;  1WI5 A;  3DXJ C;  1XWE A;  2JA7 B;  3A55 A;  1SYD A;  3K7U C;  1LTI D;  2K04 A;  2CQO A;  5IGF A;  5LMN Q;  4QQB X;  1NR4 A;  5LMN L;  4G7H C;  1N33 L;  1V1P B;  1DZ1 A;  3MXN A;  1QZH A;  3CQZ B;  3IRB A;  3KF6 B;  3JAM c;  2R93 H;  4ALP A;  3QWN A;  4GKJ Q;  4DV7 L;  1CA6 A;  4A3D H;  3PUV A;  1DOK A;  5GAG C;  4DXF A;  2EYF A;  3K58 A;  4RKL A;  2RCN A;  4KJO A;  3NWT A;  5JJK A;  3MTS A;  1LTT D;  1OXS C;  2QDB A;  3IAY A;  1UE6 A;  1SE4 A;  2EDG A;  1K8O A;  5DAU A;  4EQP A;  4IZ8 A;  1AE2 A;  1E7Z A;  4IUT A;  1YNJ D;  1PTO B;  2XRQ D;  4A3J G;  3EFX D;  4C1N I;  2X6L A;  5C3W A;  4DAV A;  1H9R A;  3HEJ A;  3S1N H;  1EWI A;  3S15 B;  5IY0 A;  1KDC A;  1UEB A;  2EVB A;  3OW2 A;  4K2K A;  4DF7 A;  2SNM A;  1EYA A;  1SYE A;  1PFN A;  2RCF A;  2PZU A;  3TRZ A;  1I3Q H;  4YCW A;  3TRE A;  1T5X D;  3B6Y A;  4R8N A;  1G2S A;  2CHB D;  4C3J H;  2K6A A;  1WCM B;  2XVS A;  5EQ0 A;  3GTG H;  3DM1 A;  1KAB A;  2DGY A;  2UUB Q;  2A6E D;  2F0S A;  1TVX A;  2HUG A;  3E6Z X;  5IWA Q;  3I56 A;  1WTV A;  4QCL A;  5NUC A;  3SR1 A;  1JB3 A;  1NAP A;  2I46 A;  3UDG A;  1E2V A;  4O0A A;  1ESF A;  5IWA L;  2QKI C;  1CQF A;  3TSS A;  4DR2 Q;  3C1E A;  4ME5 A;  2F0F A;  1Q1E A;  3E9I A;  1VQN A;  1RF2 D;  2NWG A;  1TWC B;  1KAA A;  2H4O A;  5M5X B;  4JI7 Q;  1A62 A;  1BBX C;  2F3I A;  3GP7 A;  2RQX A;  4KJN A;  1XJV A;  4V19 0;  5BN4 A;  1XTC D;  4N8X 1;  5C4Z A;  2EYJ A;  1Q3L A;  1NJI C;  4JI7 L;  1IW7 D;  1HXY D;  5CV9 A;  1JE4 A;  2RVL A;  1PH9 A;  3I4N H;  3BYT B;  1PTO C;  2IW3 A;  1S4Z A;  3SEB A;  4PQX A;  3S1Q B;  1YNN C;  4HR7 B;  1EIY B;  2BH2 A;  2EYL A;  2ZM6 Q;  4IUQ A;  3S16 H;  4HIK A;  2A6H C;  1VQP A;  2WKD A;  4EX5 A;  4JI1 Q;  1Y1W H;  1X32 A;  5FLX L;  4M8A A;  2R3Z A;  4JI1 L;  1MI2 A;  3SE0 A;  1OO9 B;  1JOQ A;  1IXR A;  3BVM A;  4LMQ D;  1HFG A;  2NZ1 D;  5IP7 G;  4RMF A;  5JOB A;  4IUR A;  1ILP A;  4JI2 L;  3QOJ A;  1B9M A;  1EQQ A;  2DNC A;  5A35 A;  3P20 A;  5KEE A;  2HHH Q;  4ZQ3 A;  1CKO A;  1EY5 A;  1X3P A;  1RJT A;  3CU7 A;  3I4O A;  2HHH L;  1EY7 A;  2RSN A;  1PA6 A;  5ELF A;  3GTJ B;  2D0P A;  4A3E G;  5ELN A;  5COR A;  3CCQ A;  2EYM A;  1X54 A;  2DY7 A;  1J6Q A;  1OXX K;  3J81 i;  1OTC A;  1VF7 A;  2ASB A;  2VNU D;  1HH2 P;  4A3L H;  2EE1 A;  3VYU A;  1K8G A;  2EY5 A;  4BBS B;  1SXT A;  3QG1 A;  1AFP A;  2F3W A;  4A3M G;  3W2D A;  2IHE A;  1LAC A;  3ULP A;  4N8F A;  1SBB B;  1TWA B;  2LXK A;  5FO8 B;  4KHZ A;  3H0G G;  3VR5 A;  4IFD I;  1VQ8 A;  4F88 A;  1TWG H;  1SRU A;  4LNQ A;  3WOE A;  4G7Z C;  2P5Z X;  5IGG A;  1Q86 C;  1NE3 A;  1Z9F A;  4QUC A;  1SE8 A;  2WAQ G;  1WTQ A;  4IOA A;  1YVC A;  5D3I B;  2K4K A;  5IIF A;  2ICI A;  3A5U A;  1Y8P B;  5M5Y H;  1HR0 W;  4QIW E;  4ID6 A;  4A76 A;  1O7I A;  2QCP X;  4Y52 H;  3HKZ G;  1EIF A;  5GAH C;  5IYD G;  4J15 A;  1M8A A;  2CW0 D;  4CJ2 C;  1L0W A;  3KJO A;  4DAY A;  4Y7N H;  3H15 A;  4IUP A;  1PTO F;  4HID A;  2K14 A;  2A74 C;  1ONL A;  4UPA A;  1TWH H;  4DAM A;  2WFW A;  2F3V A;  4LFC Q;  2J7Z A;  1WVL A;  4PZ8 A;  2PMZ B;  1I4P A;  3I4M G;  2JA5 H;  2N3S A;  5E4X A;  1J8I A;  1A8V A;  1LTA D;  3QR8 A;  3MC0 B;  5E3F A;  2B2Y C;  3PCO B;  3ITP A;  3KFU A;  4MIU A;  4PMC A;  1OXU A;  1KTK A;  3NPP A;  1BF4 A;  1ZYR D;  5TSS A;  3S14 B;  5M3M H;  1X6O A;  2FIN B;  5G3L D;  4PMB A;  5KNB A;  1PH1 A;  1EL0 A;  4NDX A;  4DV6 L;  4C3I G;  3SDZ A;  1Y14 B;  1I4R A;  2B2U A;  2OXP A;  3SVM A;  1I4X A;  4OXP A;  4O42 A;  4P71 A;  3CC7 A;  3NUC A;  1TS2 A;  2SEB D;  3EA6 A;  2EJM A;  2WIN B;  2JXM B;  1SYG A;  2X6G A;  1KL9 A;  1YHA A;  3CCU A;  1V1Q A;  1JCK B;  5C3E B;  1K0S A;  1E1T A;  4NKL A;  2IT1 A;  2A69 C;  1IYV A;  3KDF A;  2JA6 G;  4B3M Q;  2JQO A;  3GDE A;  4BBR B;  2F0I A;  4ULL A;  5IYB H;  2QDL A;  4A3G H;  1HZB A;  4RGN A;  1I94 Q;  1A2U A;  2O2L D;  1VQA A;  3JAM L;  4FO2 A;  2F0J A;  4KLK A;  4V0B A;  1I94 L;  1TKW B;  2BE5 C;  4H0L C;  3RR5 A;  1SSO A;  1K28 A;  1YEZ A;  3CC2 A;  2MPM A;  2HCC A;  4A3M B;  3I72 A;  3K80 C;  2L4N A;  1GUT A;  3K6O A;  4JBM A;  4FP5 D;  2Z4I A;  1SJE D;  3Q8D A;  3HOW G;  1PFB A;  1ENA A;  2VUM H;  1YZ6 A;  3H0G B;  2F0V A;  2D9U A;  2N55 A;  2HD3 A;  3T53 B;  2R92 B;  3GTQ B;  3H09 A;  1DON A;  1BR9 A;  2KEC A;  4AYB G;  4A3D G;  1FVI A;  4IPH A;  4IAL A;  2WAQ B;  1H9M A;  4JI0 Q;  3A5Z B;  4JOI C;  3S2D H;  5I6W A;  4FVM A;  3DHQ A;  4B9X A;  1DD2 A;  1JJC B;  2ICE C;  4DUZ Q;  4OIK A;  3S1M B;  5C4X G;  1ZXT A;  3PO3 B;  3RLO A;  1YHB A;  3J7Y W;  2EIF A;  3Q6S A;  4DUZ L;  3PF4 A;  2LSS A;  1STG A;  1PH4 A;  2IX3 A;  3M3Y H;  2WB1 B;  4G57 A;  2WII B;  2PYK A;  1TWF H;  3H91 A;  5KIX A;  2B63 H;  1S5B D;  5FO7 B;  2F0H A;  1R9T H;  3IL8 A;  2YU9 H;  1K0R A;  1XTD A;  1KRT A;  3HOZ G;  1BVS A;  1PYS B;  2Q8R E;  3S24 A;  2JA8 H;  3I4M B;  1B2T A;  4P73 A;  2HIV A;  4LUV A;  2VXW A;  1STY A;  4M1U B;  3PUW A;  2ZJQ A;  1BKB A;  2AHO B;  4ZUI A;  3D3R A;  3PGZ A;  5KND A;  1EYC A;  1P8L A;  2BOS A;  3M9B A;  4GZY C;  3S17 B;  1QG7 A;  2A5H A;  1XPU A;  4MTK A;  3MEF A;  3FRP B;  4H13 C;  4BWG B;  4NXM Q;  1M4V A;  3OWE B;  3DMU A;  4C3I B;  4KD3 A;  2QEX A;  2AQ2 B;  4X64 Q;  4QF4 A;  4BY7 H;  2GVB A;  4P72 A;  5GRO A;  4JI6 L;  5C44 B;  3HKS A;  4X64 L;  4DV2 Q;  4BY1 B;  1TXY A;  1EY0 A;  2MNA A;  4KI0 A;  3HKZ E;  2NVX H;  4S3S A;  1IBL Q;  3AU7 A;  3HOU H;  1CKM A;  1SFO B;  1IBL L;  4JC0 A;  4DUY Q;  2K05 A;  3P7J A;  1W3S A;  4ZLT F;  2E2H B;  3M85 A;  2FMC A;  4J8Q A;  1NSN S;  3FDT A;  4LFB Q;  3HOY H;  3CMA A;  4B3T Q;  2IHF A;  4PZ7 A;  3D6W A;  4U68 A;  2PO4 A;  4LFB L;  3L7Z C;  1A3U A;  4AH6 A;  4J6H A;  3ERQ A;  1YIJ A;  3FKI G;  3OTO Q;  4A3I H;  2CVR A;  5E7N A;  3MFG A;  1SRO A;  1PZI D;  2GVA A;  3OMC A;  1BCP D;  1HHV A;  3OIP A;  1RL2 A;  5EPK A;  3OTO L;  2O5J C;  4A3B G;  1L0X B;  4B08 A;  2MFI A;  1SNC A;  2R93 B;  3BDL A;  4A3D B;  1G91 A;  2Y0S G;  3OWF A;  2QEJ C;  3C46 A;  2I5H A;  2RHS B;  2IJ0 A;  5C5L A;  4TSS A;  3C3L A;  4LUO A;  2RDH A;  3CHB D;  1G29 1;  1XPO A;  1JWU D;  2BDO A;  5JJZ A;  2JA7 G;  2F4I A;  4DAP A;  1U4M A;  4YHH Q;  4HED A;  4C2M H;  4KKS A;  1DXM A;  3HOV H;  1C4Q A;  1DYQ A;  2F0P A;  2Z9H A;  3I91 A;  3F2B A;  1Y8O B;  1F2M A;  2SDF A;  3JAM i;  4DR5 Q;  4JG2 A;  1EY4 A;  3M4Q A;  1VDZ A;  1VS0 A;  1G51 A;  3FVQ A;  1N36 L;  4DR5 L;  3NBH A;  3KLW A;  1UWV A;  4JW0 A;  1I4Q A;  4K8I A;  4RKB A;  5C0X J;  2CCZ A;  4CKE A;  3SK5 A;  5CV8 A;  4C3J B;  2OWO A;  2PQE A;  2EXD A;  3CME A;  3GTG B;  3BYY B;  1VQ5 A;  1A0I A;  3DWP A;  1TS4 A;  3PF5 A;  3R3O A;  1EOT A;  4H7B A;  1XNQ L;  4BA2 I;  4UP9 A;  1NTG A;  3CCE A;  3PIP A;  3PO2 H;  3K7A H;  3NWS A;  2NN6 H;  2OTL A;  5ELC A;  2E75 C;  3URY A;  5LMN W;  5M3F H;  3TZD A;  4A3F H;  4FDB A;  1MGS A;  3PUY A;  4AYB E;  1EZ8 A;  4FYD A;  1VQE A;  3S2H H;  2F0T A;  2B39 A;  1BQQ T;  4KHP Q;  1J5E Q;  2L1B A;  4DNR B;  3CXC A;  4ZUJ A;  3I4N B;  3BDC A;  1WCM G;  1D6E C;  1HNZ Q;  1NUC A;  1RKN A;  1J5E L;  1HNW L;  1TS5 A;  2L0C A;  2ZTC A;  3GTM H;  4A75 A;  3NEM A;  3RUZ A;  5I2X A;  4G4K A;  4K14 A;  1HTL D;  2GA4 B;  3S16 B;  3H6M A;  1Y1W B;  1DGS A;  1E1O A;  2O4X A;  3G6J B;  4DU9 A;  2KCT A;  4DV4 Q;  3L3O C;  3PQI A;  4FNF A;  3VR4 A;  2DY8 A;  1RHP A;  1YBY A;  3TME A;  4X66 Q;  3U50 C;  2EYH A;  3E9H A;  1AEX A;  5FLM G;  2A73 B;  1CFM A;  3SGI A;  1LYL A;  3CCJ A;  3SXH A;  1A63 A;  3FKI B;  4O1N A;  5IYC H;  1HPC A;  2K5H A;  5IP9 H;  1U4P A;  3AEV A;  2F0O A;  1DJR D;  2M00 A;  4GKK Q;  4H44 C;  4JI8 Q;  4HAE A;  5JEA J;  3MAQ A;  2A68 C;  1ROD A;  2VY3 A;  3M7G A;  1HZC A;  4RGM A;  4CDE C;  4JI8 L;  2R6G A;  1LT6 D;  3R2T A;  3MXN B;  3BZK A;  4LF5 L;  4HJ9 A;  1U4R A;  1QIL A;  2JEB I;  1H9J A;  1OXT A;  1MHW C;  5M9O A;  3G6E A;  1E22 A;  1H9K A;  2E2J H;  2OQK A;  3G7L A;  2F03 A;  3J81 j;  1EWH A;  3FMC A;  4YCV A;  4KD4 A;  1B4O A;  1HA5 A;  1RCV D;  4JI5 Q;  3NK9 A;  4JCV E;  1UE1 A;  1TWG B;  2XRS D;  2NVQ H;  4JI5 L;  1L2F A;  2PZW A;  4J1M A;  4APV A;  2EPB A;  2ZJR A;  4X3T A;  4OWW B;  1D5Z C;  3IFT A;  1Q12 A;  2FJ2 A;  1P16 A;  2KQ3 A;  4GKJ L;  3MFY A;  3J80 E;  3MZ5 A;  1O7L A;  1H9S A;  4WOR A;  4EVO A;  4BBS G;  5M5Y B;  4R4Q A;  4B3R Q;  1CTM A;  2HIX A;  2EYO A;  1D1K A;  1JOR A;  3K8A A;  1L0Y B;  2V4D A;  1I5F A;  2LY7 A;  1NBW A;  2PNR C;  3IFD A;  3J7A 5;  1A15 A;  4Y7N B;  1Q7Y C;  1PYW D;  1KDA A;  4RCO A;  5KRU A;  2EJG C;  4JI4 Q;  1EFI D;  2TSS A;  1TWH B;  1PHJ A;  1STA A;  2E8G A;  1IW7 C;  4JI4 L;  3HGB A;  1XX8 A;  2Y0S E;  3EVQ A;  4DK1 A;  3CKI B;  5C0X G;  3M4O H;  3RZO H;  2HDL A;  4EQ5 A;  4KMU C;  5IGB A;  2ZXP A;  1D8L A;  2QA4 A;  1SNP A;  2Q2U A;  1BBU A;  1ICW A;  4OEL B;  4OIJ A;  1CSP A;  1UEA B;  1NMG A;  2UUB L;  1SNM A;  1Y1V H;  3VYS A;  1PRT F;  5M3M B;  5EKL A;  1YNX A;  3GTK H;  1QJO A;  4CDD C;  4IFD J;  1UE5 A;  2IY5 B;  5JJI A;  3MXG A;  1STN A;  2D5D A;  4DR2 L;  1JJ2 A;  4IPG A;  2NVT H;  2MP1 A;  2B8G A;  5C4J H;  1Q46 A;  4K2L A;  4PZ6 A;  2H5X A;  5K5P A;  2Q8T A;  2E2I H;  1FNV A;  4HSP A;  5EAY A;  3WOF A;  3V2T A;  5H1S E;  5IE8 A;  1IL2 A;  4KY5 A;  4BXX G;  3EQL C;  2Z6B A;  3BS1 A;  3D6C A;  2UU9 Q;  1SAP A;  4XXE A;  4YWL A;  4CDF C;  4A3G B;  1PFM A;  1EWC A;  2ZM6 L;  1SE2 A;  4AIM A;  4YIJ A;  1EYG A;  1JJG A;  2FMM A;  4NP5 A;  4B3S Q;  1FL0 A;  1K9M C;  3HFZ B;  4OO1 H;  4B3S L;  4UHV A;  1XNR Q;  1LTL A;  5LL6 S;  1G2T A;  4FF3 A;  4L5S A;  1XNR L;  4C3H H;  2C5C A;  3TP8 A;  2F0L A;  3VA7 A;  1GUS A;  5C3E G;  3BZC A;  1KRS A;  2NN6 I;  2R7D A;  3NXW A;  3HOX H;  4HSV A;  1CHP D;  2DJG C;  4QUF A;  4BS9 A;  2VUM B;  4JI3 Q;  4BBR G;  3LGJ A;  4GLX A;  1C7Y A;  2EJF C;  3VR6 A;  4JI3 L;  2KA7 A;  1SNO A;  2OEO A;  3BU2 A;  3I4L A;  2K5W A;  4ZCK A;  3KUP A;  5JEA G;  2R61 A;  4RA8 A;  5DLQ E;  1O80 A;  1I6H H;  3S2D B;  1JQY D;  3S1R H;  1VQG A;  5CV4 A;  4I7Z C;  1PTO D;  4IJH A;  3SHL A;  3NEN A;  2HT1 A;  3HOV G;  3LWE A;  1YNN D;  2CW0 C;  4JPB W;  1LUZ A;  2MGS A;  2SOB A;  1MD2 D;  4KKU A;  5HGQ A;  4OEM B;  2A6H D;  3M3Y B;  4PNY A;  3T1Y Q;  4HIO A;  1LAB A;  1TWF B;  4GS3 A;  2B63 B;  2R92 G;  5IGE A;  1XYI A;  3K81 C;  3M4Y A;  5C5M A;  3BZD B;  3T16 A;  4KY6 A;  3T1Y L;  1R9T B;  2YU9 B;  3K5M A;  1BXT A;  4DAY B;  3GTO B;  2E5L Q;  2LXJ A;  3RLN A;  4L5Q A;  2JA8 B;  2DNE A;  1SJH D;  4DPG A;  1S72 A;  2A8V A;  4H02 A;  1L1O A;  1ZYR C;  3STB D;  3PO3 G;  4HCS A;  2Z6K A;  4IPD A;  5A2Q L;  4MNO A;  5FO9 B;  2Z4H A;  2G9H D;  1HZA A;  2JN4 A;  1G6Z A;  2WB1 G;  4UY8 C;  2A19 A;  2KHS A;  4LAA A;  3I55 A;  2BA1 A;  2KHI A;  4DXG A;  3U4V A;  1C9O A;  3C1F A;  2BCO A;  2K01 A;  1UUP A;  1WFQ A;  4BY7 B;  1UE7 A;  1ML0 D;  1TS3 A;  2E2D C;  1D5M C;  3GV3 A;  3KJP A;  2OF1 A;  4LFC L;  1PTO H;  1PV4 A;  2UUA Q;  5D14 A;  1QVC A;  3RN5 A;  4OL7 A;  2Z8L A;  1OXV A;  4KHV A;  4FF4 A;  1VQK A;  2UUA L;  3GQB A;  1BBW A;  2F0Q A;  3HOU B;  3DEO A;  3QIA A;  2MJ8 A;  4IFD G;  2QF7 A;  3KDF B;  3CF5 A;  4FXG C;  1NY4 A;  4UDU C;  3CCV A;  1HQM C;  2N78 A;  4JK1 C;  4R9W A;  3GTL H;  1WJJ A;  1XXG A;  2M9V A;  2WKC A;  4N9P A;  4ILW A;  1HJP A;  3J81 E;  3HOY B;  1BNZ A;  4OX9 Q;  1RIP A;  4IUU A;  5C44 G;  4BY1 G;  4OWX B;  2JEA I;  3NQT A;  4A3I B;  5IP9 G;  1R4Q B;  4OX9 L;  2UUC Q;  2VQE Q;  1QVF A;  1FGB D;  2B2T A;  1FNU A;  3F1Z A;  1GHK A;  2L15 A;  2UUC L;  2VQE L;  4A93 G;  2N49 A;  2R7Z H;  2B29 A;  1O78 A;  4IPC A;  1F2Z A;  1WYD A;  4B3M L;  3KBG A;  3TP6 A;  1Q8K A;  4DR7 Q;  2J0T D;  2WV6 D;  1LT5 D;  2F52 A;  3I3C A;  1TY2 A;  2B2V A;  3N6R A;  2NVY H;  2I0Q A;  1N32 Q;  4DR7 L;  2B2U C;  3UDF A;  2PMZ E;  4RWS C;  2ZJP A;  3FHW A;  1X65 A;  1N32 L;  3MVV A;  5J39 A;  4C2M B;  4GOP A;  3HOV B;  5CC4 A;  2NZO A;  2FFK B;  1HA6 A;  4GLV B;  5I2Y A;  5C3X A;  5FKA C;  1RD9 D;  4LUZ A;  1GHJ A;  1NCV A;  2R93 G;  3HG9 A;  2F0K A;  2FHT A;  2AQ1 B;  2VW9 A;  1HR0 Q;  3D0F A;  5IT9 E;  1AE3 A;  1CUK A;  3CAM A;  4JVZ A;  1GUO A; 
#chains in the Genus database with same CATH homology
 1N33 L;  4C2M H;  1S3O A;  3HOV H;  1QZH A;  3AQQ A;  3IRB A;  3KF6 B;  1HNX Q;  1X56 A;  4GN4 B;  3JAM c;  3F2B A;  4ALP A;  4JI0 L;  3H3V I;  2R93 H;  4GKJ Q;  4DV7 L;  2KCM A;  3JAM i;  1XMO Q;  4DR5 Q;  4JG2 A;  2VQF Q;  3PUV A;  5GAG C;  1HNX L;  1YJN A;  4A3D H;  3M4Q A;  3T1H Q;  4TVA B;  2RCN A;  1VS0 A;  2JA7 H;  5JJK A;  2ZTE A;  1G51 A;  1XMO L;  1N36 L;  4DR5 L;  1OXS C;  2VQF L;  2E5L L;  1UE6 A;  4X62 Q;  2OCE A;  4X65 Q;  1VQD A;  3KLW A;  3T1H L;  1UWV A;  3TS0 A;  1AE2 A;  3PO2 G;  1E7Z A;  5C0X J;  2CCZ A;  1EUJ A;  3A0J A;  2VS1 A;  2OWO A;  4X62 L;  2NN6 G;  4X65 L;  2EXD A;  3CME A;  4A3J G;  3DM3 A;  4HJ5 A;  4OO1 I;  2Z0S A;  3TEH B;  5M3F G;  1A0I A;  1KIX A;  3CQZ H;  1VQ5 A;  1CKN B;  4A3F G;  3PF5 A;  1XNQ L;  4BA2 I;  4A3K H;  1KXL A;  4UP9 A;  1NTG A;  3S1N H;  1C0A A;  3CCE A;  1EWI A;  5IY0 A;  3PIP A;  4GNX A;  3PO2 H;  1UEB A;  3K7A H;  4XTC S;  3OW2 A;  1IBM Q;  1SMX A;  4A3J H;  2OTL A;  5LMN W;  4GN3 B;  1PVO A;  4POF A;  5M3F H;  3TRZ A;  1MIU A;  1I3Q H;  2A1A A;  4YCW A;  4A3F H;  3TRE A;  4DR6 Q;  2AMC B;  4NB3 A;  3B6Y A;  4FDB A;  1YHQ A;  2IX1 A;  5FJ8 H;  4C3J H;  5JJL A;  1H95 A;  3PUY A;  4AYB E;  4DR6 L;  2K52 A;  3GTG H;  1VQE A;  1VQH A;  3GO5 A;  3S2H H;  2DGY A;  2UUB Q;  4KHP Q;  1CKN A;  3E0E A;  1J5E Q;  4DR4 Q;  3CXC A;  4L5R C;  5IWA Q;  4LF9 Q;  3I56 A;  1L1O C;  1WCM G;  1HNZ Q;  1KHI A;  1VCI A;  2Z6K C;  3UDG A;  3S15 H;  1J5E L;  1HNW L;  4DR4 L;  4O0A A;  3KOJ A;  2ZTC A;  4O2D A;  5IWA L;  2I5L X;  3GTM H;  1QUQ A;  2MO1 A;  3NEM A;  4A75 A;  1IZ6 A;  2WAQ E;  4DR2 Q;  4NXM L;  1X3E A;  3I4N G;  2EQS A;  1Q1E A;  3E9I A;  4DR3 Q;  1VQN A;  3ULJ A;  4BA1 I;  4A3C H;  1WCM H;  1U5K A;  4JI7 Q;  1K3R A;  1A62 A;  4DV5 Q;  2F3I A;  2CFM A;  1W2B A;  1XJV A;  1DGS A;  1E1O A;  2YTX A;  4IJL A;  4QJF A;  3W5O A;  1NJI C;  4JI7 L;  4DV2 L;  3AFP A;  1KQS A;  1PH9 A;  3I4N H;  2CKZ B;  2KCT A;  4DV4 Q;  2GN5 A;  1Y1W G;  1I50 H;  5IYC G;  1GD7 A;  1M90 C;  2WB1 E;  3VDY A;  1YBY A;  4DV6 Q;  2ES2 A;  1KAW A;  1EIY B;  4X66 Q;  3U50 C;  2BH2 A;  3ERS X;  3E9H A;  5FLM G;  4GOP B;  3OYY A;  2ZM6 Q;  1VQ4 A;  3S16 H;  3SGI A;  1LYL A;  2I5M X;  2CWP A;  3CCJ A;  4DUY L;  1TWC H;  4HIK A;  1VQP A;  5M5X H;  3EN2 A;  5LMU Q;  4EX5 A;  4JI1 Q;  1Y1W H;  1A63 A;  5IYC H;  5IP9 H;  2K5H A;  2UXB Q;  4PG3 A;  3AEV A;  5LMU L;  1KC8 C;  4JI1 L;  3HOX G;  1V9P A;  4MTN A;  5FLM H;  4GKK Q;  4B3T L;  2UXB L;  5J3B A;  4JI8 Q;  1YI2 A;  5JEA J;  1IXR A;  3S1Q H;  1XPR A;  3I2Z A;  5IP7 G;  4LF7 Q;  1Q82 C;  2VY3 A;  3NEL A;  4RMF A;  1HZC A;  1K73 C;  4JI8 L;  2NZH A;  5BR8 Q;  2R6G A;  4JI2 L;  5ELO A;  3MXN B;  4DV0 Q;  1EQQ A;  3BZK A;  4LF5 L;  2D62 A;  4QL5 A;  4HJ9 A;  2HHH Q;  5BR8 L;  4LWC A;  1CKO A;  2JEB I;  1QVG A;  1OXT A;  4DV0 L;  4HJ7 A;  1Q81 C;  3I4O A;  4LF6 Q;  5HY6 A;  3G6E A;  1PH3 A;  4JBK A;  2HHH L;  5IP7 H;  1E22 A;  2E2J H;  2OQK A;  4JOI A;  3PUX A;  1PA6 A;  3J81 j;  4A3L G;  4YCV A;  2D0P A;  4A3E G;  4LF6 L;  3NBH B;  5ELN A;  5GQO A;  3CCQ A;  1EFW A;  1VQL A;  3FP9 A;  1X54 A;  4JI5 Q;  4JCV E;  1UE1 A;  3J81 c;  1HR0 L;  2NVQ H;  1J6Q A;  1OXX K;  4JBJ A;  3J81 i;  4JI5 L;  1L2F A;  2CWA A;  1OTC A;  1X55 A;  2ASB A;  2VNU D;  1HH2 P;  3DLL A;  2VZA A;  4APV A;  4A3L H;  4YHH L;  1Q1B A;  4GLA C;  2ZJR A;  1PH6 A;  4A3E H;  1K8G A;  1FGU A;  3J7Z C;  1PH7 A;  3AYH B;  4GOP C;  2VL6 A;  4GNX B;  4OWW B;  4A3M G;  3UE1 A;  1Q12 A;  1FJG Q;  1P16 A;  3D31 A;  2OQ0 A;  4GKJ L;  2IHE A;  3ULP A;  3GTJ H;  4BBS G;  2LXK A;  1JE5 A;  4R4Q A;  1MJC A;  1VQ9 A;  1FJG L;  4B3R Q;  4KHZ A;  2FXQ A;  1D7Q A;  3H0G G;  4LW1 A;  1VQ7 A;  2HIX A;  4IFD I;  3K8A A;  4JV5 Q;  1VQ8 A;  1E24 A;  1I5F A;  1SRU A;  1TWG H;  4LNQ A;  1NBW A;  4A3M H;  3J7A 5;  1Q86 C;  4JV5 L;  1Q7Y C;  1NE3 A;  1Z9F A;  1SE8 A;  2WAQ G;  4BBS H;  4IOA A;  1NMF A;  4JI4 Q;  3H0G H;  1YVC A;  3TQY A;  2K4K A;  2N8N A;  1PHJ A;  4L5T A;  2E8G A;  1QUQ B;  4A4I A;  4JI4 L;  3A5U A;  2Y0S E;  5M5Y H;  1B7Y B;  1HR0 W;  1TWA H;  1IBM L;  4QIW E;  1M1K C;  2Q2H A;  4A76 A;  1O7I A;  1Y1V G;  5C0X G;  3M4O H;  3CCR A;  4Y52 H;  3HKZ G;  1CSQ A;  1EIF A;  4PMW A;  5IYD G;  4J15 A;  5GAH C;  3RZO H;  4R1J A;  2UXD Q;  4EQ5 A;  1L0W A;  2K5V A;  1D8L A;  3KJO A;  2QA4 A;  4Y7N H;  4YWK A;  2Q2U A;  1BBU A;  3EBE A;  2HQL A;  1CSP A;  3H15 A;  2JA5 G;  4DR1 Q;  3GTO H;  2RF4 A;  1NMG A;  1ASY A;  4HID A;  1U0L A;  2K14 A;  3W1G A;  4AQY Q;  1Y1V H;  2UUB L;  4KHP L;  4UPA A;  1TWH H;  2JJQ A;  4DAM A;  5IT9 c;  2B3G A;  1YIT A;  3CCL A;  4LF9 L;  1YNX A;  2WFW A;  1VQ6 A;  3GTK H;  4DR1 L;  4IFD J;  1HNZ L;  5IYD H;  3G4S A;  4ME3 A;  4AQY L;  3RZD H;  1UE5 A;  5M5W H;  4HJA A;  4PZ8 A;  1PFS A;  4LFC Q;  3CCM A;  2IY5 B;  1PH5 A;  2OTJ A;  4GNX C;  5JJI A;  5M3M G;  4DR2 L;  1JJ2 A;  3I4M G;  4IPG A;  2JA5 H;  2NVT H;  2N3S A;  5C4J H;  1EOV A;  1A8V A;  1Q46 A;  4DR3 L;  4PZ6 A;  3UE0 A;  2H5X A;  2E2I H;  4DV5 L;  1SLJ A;  1IBK Q;  3PCO B;  5EAY A;  3KFU A;  1OXU A;  2AWN A;  5H1S E;  2YYZ A;  1E3P A;  5IE8 A;  5M3M H;  1IL2 A;  1IBK L;  1X6O A;  4BXX G;  3H3V H;  1VQM A;  4DV4 L;  4JI6 Q;  3A74 A;  2XTI A;  3PIO A;  1PH1 A;  2WP8 J;  4OO1 G;  3G48 A;  4DV6 L;  2UU9 Q;  4X66 L;  4QGU A;  1Y14 B;  4YWL A;  4OXP A;  1VQO A;  2PNH A;  1N34 Q;  1B70 B;  2ZM6 L;  1VQF A;  2IX0 A;  4P71 A;  4AIM A;  3CC7 A;  1EYG A;  1JJG A;  4B3S Q;  4BXX H;  4JYA Q;  2ALY B;  4IOC A;  1FL0 A;  3RNU A;  1IYJ B;  5IYB G;  1N34 L;  2R7Z G;  1KL9 A;  1VQJ A;  1XMQ Q;  1YHA A;  3CCU A;  1V1Q A;  3HFZ B;  1K9M C;  4A3G G;  4B3S L;  1XNR Q;  5LMN L;  3CPF A;  4JYA L;  5GAE C;  4C3I H;  4HJ8 A;  3S14 H;  1LTL A;  1E1T A;  2IT1 A;  1XMQ L;  4DV3 Q;  3KDF A;  4GKK L;  1LM0 A;  4L5S A;  4C3H H;  1XNR L;  4UP7 A;  2JA6 G;  4B3M Q;  2JQO A;  3PV0 A;  3GDE A;  5C3E G;  5AJ3 Q;  1SN8 A;  1KRS A;  2NN6 I;  2R7D A;  3BZC A;  5IYB H;  4DV3 L;  4LF7 L;  3HOX H;  4LF4 Q;  4A3G H;  1HZB A;  4HIM A;  3ICE A;  5AJ3 L;  1WOC A;  1I94 Q;  3UDX A;  4JI3 Q;  1VQA A;  4BBR G;  4LF4 L;  3GTP H;  3LGJ A;  4GLX A;  1C7Y A;  4KLK A;  2JA6 H;  1I94 L;  2F4V Q;  4P74 A;  4LFA Q;  4JI3 L;  5C3E H;  3GD7 A;  3RR5 A;  4TQU S;  2VUM G;  3BU2 A;  1YEZ A;  5JEA G;  3RLF A;  3W1B A;  3CC2 A;  2F4V L;  1VQC A;  4LFA L;  2PQA A;  4XIG S;  5DLQ E;  1N9W A;  1I6H H;  4BBR H;  3K80 C;  5FLX c;  3S1R H;  1VQG A;  4JBM A;  4IO9 A;  3Q8D A;  4IJH A;  3HOW G;  2JE6 I;  3NEN A;  2HT1 A;  4NXN Q;  1JMC A;  2VUM H;  3HOV G;  1YZ6 A;  1PYB A;  3JC6 6;  1GKH A;  1ASZ A;  1X3G A;  1LUZ A;  4RG1 A;  2KHJ A;  3G71 A;  4NXN L;  2BH8 A;  3EIV A;  4AYB G;  1N33 Q;  4A3D G;  5HGQ A;  1FVI A;  4IPH A;  3HOW H;  3T1Y Q;  4HIO A;  4JI0 Q;  4GS3 A;  2R92 G;  3CD6 A;  2UXC Q;  3A5Z B;  2PI2 E;  3K81 C;  4JOI C;  4DV7 Q;  2ID0 A;  3S2D H;  4B3R L;  1YJW A;  1S40 A;  2MO0 A;  3T1Y L;  2UXC L;  2Q2I A;  4P75 A;  4DAY B;  3U58 A;  1N36 Q;  1JJC B;  4DKA C;  2E5L Q;  2B63 G;  1AH9 A;  2LXJ A;  3RLN A;  4JBW A;  4L5Q A;  2AWO A;  4DUZ Q;  3F2D A;  3M7N A;  5C4X G;  1PH2 A;  4R4T A;  2R92 H;  3RLO A;  3GTQ H;  1YHB A;  2EIF A;  4DPG A;  4A3K G;  4DUZ L;  1SR3 A;  3PF4 A;  2LSS A;  1S72 A;  1PH4 A;  2A8V A;  1K83 H;  4H02 A;  4QY7 A;  4R4O A;  1L1O A;  3M3Y H;  3STB D;  3PO3 G;  2Z6K A;  4IPD A;  2JA8 G;  1TWF H;  2B63 H;  4MNO A;  1XNQ Q;  2DUD A;  3KF6 A;  5C4X H;  4DNI A;  3CPW A;  3WWV A;  1HZA A;  1B8A A;  2YV5 A;  3F2C A;  3U4Z A;  1KD1 C;  1R9T H;  1VQI A;  2KBN A;  2WB1 G;  1Z47 A;  2A19 A;  3AFQ A;  2YU9 H;  2C35 B;  5FJ8 G;  4UY8 C;  3I55 A;  2UXD L;  2BA1 A;  2KHI A;  1K0R A;  1K8A C;  2K5N A;  3U4V A;  1XTD A;  1KRT A;  1C9O A;  2JK8 A;  4NPS A;  4GN5 A;  3HOZ G;  1BVS A;  5GAD C;  3S1M H;  1PYS B;  3L2P A;  3PO3 H;  3S24 A;  2JA8 H;  4DK3 C;  4P73 A;  2HIV A;  1WFQ A;  2D0O A;  3PSI A;  2Q2T A;  4LUV A;  3BJU A;  4MZ9 A;  1UE7 A;  1VQB A;  3M4P A;  3PUW A;  3CCS A;  3KJP A;  2ZJQ A;  1BKB A;  2K75 A;  2AHO B;  4LFC L;  1V43 A;  3PGZ A;  4WJ3 M;  3HOZ H;  1PV4 A;  2UUA Q;  1T9H A;  1P8L A;  4BY7 G;  1QVC A;  3M9B A;  3RN5 A;  1HNW Q;  4UP8 A;  3J80 c;  1OXV A;  1XPU A;  2YTV A;  4A3C G;  5K36 G;  3MEF A;  1VQK A;  3J80 i;  2UUA L;  4LF8 Q;  1BBW A;  3F8T A;  3UDI A;  3CC4 A;  4NXM Q;  3L0O A;  2KEN A;  3ER0 A;  2ZTD A;  1EQR A;  1GVP A;  4DK6 C;  3I4M H;  2QEX A;  4LF8 L;  2V1C C;  4IFD G;  3KDF B;  3CF5 A;  1N8R C;  4YWM A;  1NY4 A;  4X64 Q;  4BY7 H;  3CCV A;  2N78 A;  1X3F A;  3HOU G;  2GVB A;  3PUZ A;  1WJJ A;  4P72 A;  3GTL H;  3I7F A;  1GO3 E;  5GRO A;  1QZG A;  3HKS A;  4X64 L;  4YY3 Q;  4DV2 Q;  2XGT A;  4JI6 L;  3CP0 A;  3TS2 A;  1TXY A;  4DV1 Q;  1YJ9 A;  1HJP A;  4KI0 A;  2R7F A;  2YTY A;  2MNA A;  2UU9 L;  3K0X A;  3S17 H;  3HKZ E;  3ZJY C;  2NVX H;  4YY3 L;  1G6P A;  4OX9 Q;  3KYH C;  1RIP A;  4DV1 L;  1IBL Q;  5C44 G;  4BY1 G;  4OWX B;  2JEA I;  3HOU H;  5IP9 G;  3CW2 C;  1CKM A;  4R4I A;  3HOY G;  4POG A;  4OX9 L;  2UUC Q;  2VQE Q;  1IBL L;  4JC0 A;  1QVF A;  3RN2 A;  4DUY Q;  4WJ4 A;  3F1Z A;  2PQA B;  2JA9 A;  2L15 A;  1W3S A;  1PH8 A;  3KF8 B;  2VQE L;  2UUC L;  4A3I G;  3M85 A;  4A93 G;  2N49 A;  2R7Z H;  2B29 A;  5C44 H;  1MJE A;  4IPC A;  4BY1 H;  1WYD A;  4YCU A;  4B3M L;  2MQH A;  1Q8K A;  4DR7 Q;  3HOY H;  4LFB Q;  3CMA A;  4B3T Q;  2IHF A;  4PZ7 A;  2F52 A;  2I0Q A;  2K50 A;  2NVY H;  1N32 Q;  4DR7 L;  3L7Z C;  4AH6 A;  4LFB L;  3ULL A;  1YIJ A;  3FKI G;  3UDF A;  2PMZ E;  3OTO Q;  2ZJP A;  4JI2 Q;  3FHW A;  5E7N A;  4A3I H;  1SFO H;  1JB7 A;  1X65 A;  2AKW B;  4A93 H;  4K0K Q;  1SRO A;  1N32 L;  2GVA A;  4X6A H;  4LF5 Q;  4OON A;  4GOP A;  3OTO L;  1RL2 A;  4K0K L;  5C0X I;  4A3B G;  1GM5 A;  2ATW A;  2NZO A;  1HZ9 A;  1MKH A;  4R4C A;  2E2H H;  2MFI A;  3STB C;  2PI2 A;  1WI5 A;  4GLV B;  3FKI H;  4OWT B;  2Y0S G;  4LUZ A;  2I5H A;  2RHS B;  2BA0 A;  3K7U C;  1JT8 A;  2QGQ A;  2CQO A;  4LUO A;  2R93 G;  4A3B H;  5LMN Q;  4QQB X;  1G29 1;  2VW9 A;  1XPO A;  1HR0 Q;  3D0F A;  1X9N A;  1AE3 A;  1CUK A;  1L1O B;  2JA7 G;  3CAM A;  2RHQ B;  4YHH Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...