4R4OA

Crystal structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamothioyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4oA00
1EQRA 2JA5G 3DM3A 3E0EA 2WFWA 3K8AA 4A3CH 1UE6A 2JA7G 2Q2IA 4KHPL 3MEFA 1LM0A 4L5TA 1X6OA 4BXXG 5ELOA 4POFA 3OTOQ 1PH4A 1XNQL 3NEMA 4GOPB 2LXKA 4A3FH 1HNWL 4DV7Q 1L1OC 3STBD 4HIKA 1AH9A 1NMFA 4YWKA 4IOCA 1VQGA 4JI5Q 2ZTDA 1Z9FA 2C35B 2EIFA 3UDFA 5HY6A 1FGUA 1HR0L 1HH2P 1K9MC 4JI6Q 2ASBA 4B3MQ 3HOWG 1VQKA 4LFBQ 2DGYA 1OXXK 2H5XA 1X56A 2UUBQ 3H15A 3CCUA 2UUCQ 3M4OH 4OXPA 3HOVG 2Z6KA 2OTLA 4LF4Q 3ULPA 2K5NA 4JI0Q 1U0LA 2OTJA 1HZAA 4AQYL 2CQOA 1VQNA 3KLWA 3AQQA 3J7A5 4YWLA 3WWVA 2UUAL 1HZCA 4JI1Q 1E1TA 3TQYA 3U50C 3EBEA 4DK3C 3J81i 4DV2Q 1IBKQ 4DR4Q 3GTJH 3ZJYC 4LF5L 4DR5L 1IBLL 2NVQH 4X65L 2D0PA 4DV3L 5C4XH 4A3CG 2R93H 2BA0A 4GOPC 3AEVA 4K0KL 1KC8C 1PH1A 4YHHQ 1KAWA 3PO3H 2PI2A 2VY3A 3PIOA 2N49A 4DR1L 1VQPA 1X3FA 4A3BH 3CQZH 4ME3A 3SGIA 3NENA 3S14H 4JYAQ 4A3FG 1PH7A 2UXDQ 4A3DH 2CKZB 1KHIA 1FJGQ 4GLAC 2WB1G 4LF7L 1PH9A 4LW1A 4A76A 4A3EH 3FKIH 3B6YA 2ZJRA 3FP9A 4X6AH 4KI0A 2HT1A 1KL9A 2BH2A 3F1ZA 3CD6A 2K5VA 1IBMQ 3GTQH 5JJIA 4GN4B 5LMNL 3RZOH 1WJJA 5LMUQ 2IHFA 1P16A 1YVCA 2Y0SE 3S24A 2KHJA 2QGQA 5IYBH 4IO9A 2Z0SA 4DV0L 1UWVA 1CKNA 4JV5L 4IPHA 5IWAQ 2MNAA 2HIVA 2RHQB 2V1CC 1LYLA 1I5FA 1VQ6A 4B3SQ 4QQBX 4B3TL 2JA9A 3VDYA 4WJ3M 1G51A 4OO1G 3PSIA 2UU9Q 1HR0W 1OXSC 2R93G 1U5KA 1NMGA 3PO3G 2R7DA 2Q2UA 4BBSH 3I56A 4LF8L 1FL0A 2A1AA 3LGJA 4A3BG 4A3DG 2JJQA 2BH8A 3T1HQ 3CCRA 4C3HH 1S3OA 2EXDA 2PQAA 3A0JA 3F8TA 3FKIG 2I5MX 3M9BA 4DR3L 5IYCH 3GTGH 4XIGS 4OWWB 2VS1A 3GTOH 4MNOA 4DR2Q 3I7FA 1Y14B 3CCMA 3Q8DA 2Q2HA 1C0AA 2CCZA 2K4KA 4KLKA 4PZ7A 4JI4L 2KHIA 1UE7A 2CWAA 5IYBG 3IRBA 4JI8L 1MIUA 4OX9Q 4X66L 5K36G 5AJ3Q 2WAQG 5EAYA 4GLXA 1J5EL 1TWFH 2CFMA 1VQ8A 3M3YH 1SR3A 4NXML 1Q86C 3ULJA 4P71A 4HJ9A 4QIWE 5M5YH 1WYDA 1HZBA 3RNUA 1VQMA 1EUJA 4P73A 3PUWA 4DV1L 3KFUA 3W1GA 4DV5L 3M7NA 3HFZB 1CSPA 4R4TA 4R4CA 2LXJA 1ASZA 1JJ2A 3S2DH 5M3FH 4DR6L 4BBSG 2AHOB 1VQHA 2QA4A 1N9WA 4A3GH 3HKZE 2JEAI 2EQSA 4DPGA 4PG3A 4LFAQ 3I55A 1Y1WH 4HIOA 3L0OA 2VQEQ 1Q7YC 5IE8A 3ULLA 1QVCA 1VQ4A 1QVGA 4LNQA 5IYCG 2KCMA 1CSQA 4OWTB 4DKAC 2NVXH 1PH6A 3KDFB 4UP8A 4LF6L 4TVAB 3KJPA 4YY3Q 1ASYA 3HOYH 3PIPA 2N78A 2HIXA 3M85A 2E5LQ 4Y7NH 4X62Q 1GKHA 4X64Q 3U58A 1MJCA 1MKHA 1OTCA 1N33Q 4GKJL 2A8VA 3EN2A 3PCOB 3CC2A 3RN2A 3E9IA 3PF5A 1L0WA 2B63H 2LSSA 1K8GA 4FDBA 1Y1VH 3S1QH 4JI2Q 1IYJB 5M3FG 1I94Q 3MXNB 3OTOL 1WCMG 2NZHA 2NN6I 4POGA 2K52A 2MFIA 4J15A 2K50A 3UDIA 3S1MH 3S16H 2YTVA 2XTIA 1XMOQ 1YEZA 2HQLA 4A3MG 4JI6L 2VW9A 1VQ9A 2NVTH 3U4VA 4AYBG 4B3ML 4BY1H 1N34L 2UUBL 2UUCL 5M5WH 4A3IH 4PMWA 2VQFQ 3TEHB 3HOYG 4GKKQ 2PQAB 3CC7A 3JAMc 3TREA 3GTPH 4R4QA 3CCEA 2R6GA 4L5QA 3UDGA 5M3MH 2JA6H 2E2JH 3TRZA 1SFOH 1KRTA 1KD1C 1J6QA 2RHSB 4RG1A 3F2CA 4UPAA 4JI1L 4HIMA 3KF8B 1EWIA 4KHZA 3RR5A 4DV2L 3GTLH 4DR4L 5C0XG 2NVYH 4MTNA 4JBJA 1K0RA 4YCWA 2I5LX 5H1SE 1AE2A 1VQLA 1Y1VG 1Q46A 4YHHL 4WJ4A 4IFDI 4Y52H 3S17H 4C2MH 1SN8A 2AKWB 3CCLA 1BVSA 4LF9L 2I5HA 4IPCA 4AIMA 2WB1E 4R1JA 1BBWA 3H0GH 2ZM6Q 1HR0Q 1L2FA 1OXTA 4JBWA 4QJFA 3KDFA 1R9TH 1XJVA 4JOIA 3G71A 4QL5A 4BY1G 1IBML 2JK8A 5FLXc 1JJGA 1N8RC 5IP9H 5LMUL 4A3IG 1EYGA 1D7QA 1X3EA 1NBWA 1Q1BA 2JA6G 5M3MG 2FXQA 1YI2A 3GDEA 4PZ8A 1PH5A 1H95A 4L5SA 2NN6G 5IWAL 3W5OA 1CKOA 4DUYL 4DR5Q 4DK6C 3TS0A 1VS0A 3KF6A 2F3IA 1X54A 4DV3Q 2F4VQ 2KCTA 3CPWA 3PO2H 1A62A 4EQ5A 2UU9L 2K5HA 1IXRA 4JI7Q 5C0XJ 3I2ZA 3KYHC 4DR1Q 1XNRQ 1X55A 5GAGC 4A3LH 5C4XG 3I4MH 4A4IA 1VQ7A 4UP9A 3CC4A 3S2HH 3T1HL 1TWAH 4O2DA 1E7ZA 3T1YQ 4IPGA 4O0AA 3HOXH 3H0GG 1JE5A 3K7AH 4OWXB 1WFQA 2HHHQ 4A3KH 3HOUH 3FHWA 2YYZA 4DV4L 1VQAA 1JMCA 2OQKA 5IP9G 4DUZQ 1K73C 4LUOA 1YNXA 4JG2A 4PZ6A 3RLNA 3K81C 1HNXQ 3PUXA 4OX9L 4YWMA 3H3VI 1XPUA 4XTCS 4P72A 5GADC 5AJ3L 1EIFA 2E8GA 2WAQE 1NJIC 2B29A 1Q1EA 1TWCH 5IP7H 4GN3B 1XPOA 1LUZA 4IPDA 1JJCB 1BKBA 3RN5A 1PH8A 3PO2G 3K80C 3K7UC 1C7YA 3J81j 1K83H 1D8LA 4OONA 4JI3Q 2F52A 1KQSA 1M1KC 3M4PA 1I3QH 4YCUA 2GVBA 3G4SA 1QZGA 1UEBA 4MZ9A 1Q81C 2E2IH 3I4MG 4A3LG 1CUKA 3PF4A 4C3IH 2ES2A 2PMZE 5GAHC 4DR7L 5LMNW 1X9NA 4LFAL 5GAEC 5C44H 1YHBA 3AYHB 2I0QA 1V43A 4QGUA 1GVPA 1E24A 2AWNA 1XTDA 3ERSX 3HOUG 4TQUS 2IX1A 3OYYA 4YY3L 4HJAA 3A5UA 2MO1A 4L5RC 1M90C 4NXNQ 2UXBQ 1KXLA 5IYDH 1G6PA 4A93H 4EX5A 2JA8H 3U4ZA 4X62L 5C3EH 2GN5A 3RZDH 1W2BA 1V9PA 3DLLA 1HNZL 1PYSB 1N32L 1HJPA 4HJ8A 1N33L 5IP7G 2CWPA 2K75A 4GS3A 4HJ5A 2KENA 5IT9c 3CCSA 1VQEA 3GO5A 4HIDA 1E22A 1GO3E 1N36Q 1QUQB 1FVIA 2JQOA 1I50H 2YV5A 2AWOA 2ALYB 4P75A 4JI2L 1I94L 2VUMH 4R4OA 4BXXH 2OWOA 3KF6B 3PV0A 1XMQQ 3CMEA 1WI5A 4IJHA 4AH6A 4UP7A 4RMFA 4APVA 2R7ZH 1VQIA 2YU9H 3S1NH 5J3BA 5C44G 4A3JH 4A3GG 1Q12A 1CKMA 4DV7L 1VQCA 4LFCQ 2PNHA 4AYBE 1G291 4DAMA 1Y1WG 4LFCL 4JI5L 4JOIC 4A75A 1PH3A 1EIYB 2UXCQ 5M5XH 4LFBL 5BR8Q 2BA1A 4GKKL 5DLQE 5IYDG 1EOVA 4A93G 3J80c 2JA8G 3PUZA 2YTYA 4BBRH 5ELNA 4C3JH 5C3EG 3CF5A 4LF4L 1VQFA 3CCVA 1XPRA 4JI0L 1PVOA 4JBMA 4DV6Q 2B3GA 4GN5A 3BU2A 3CP0A 1YHAA 3CCJA 4B3RQ 1PHJA 1IBKL 3BJUA 5JJKA 4QY7A 2XGTA 3W1BA 3OW2A 4BY7H 4KHPQ 2GVAA 1SROA 2VUMG 2ATWA 2B63G 1MJEA 1LTLA 1A8VA 3JC66 3J81c 1VQOA 1PYBA 1YJWA 3I4NH 1NY4A 3RLFA 1Q82C 3CXCA 3J80i 4NPSA 2QEXA 2YTXA 1XNQQ 2R7ZG 1HNWQ 5GQOA 3JAMi 2ZM6L 4GNXB 1NTGA 4A3JG 4JYAL 2Q2TA 4OO1I 2UXDL 1EFWA 1FJGL 1KIXA 1JT8A 3D0FA 1N34Q 1C9OA 1PFSA 4GKJQ 2IHEA 4P74A 3F2BA 3I4OA 4UY8C 3BZCA 2R92H 3E9HA 3HOZH 2IY5B 5GROA 3ICEA 3G6EA 1X3GA 1YJNA 4BBRG 1SRUA 2N8NA 2L15A 4AQYQ 5HGQA 1X65A 1O7IA 2UUAQ 3NBHB 1QVFA 2F4VL 1QUQA 1E3PA 1TWHH 2DUDA 2VZAA 2E2HH 4LF5Q 1IBLQ 1A0IA 3D31A 1RL2A 1NE3A 5FJ8H 4X65Q 4B3SL 4JI7L 1XNRL 4LWCA 1K8AC 4BY7G 1QZHA 2D62A 4K0KQ 3GD7A 3M4QA 4GNXC 5C4JH 3I4NG 1KRSA 1S72A 4LF9Q 1PV4A 3GTMH 3EIVA 3T1YL 1SLJA 1VQBA 1AE3A 3BZKA 1I6HH 1L1OA 1VQDA 4LF7Q 3F2DA 1YZ6A 1B70B 1B7YB 3L2PA 3GTKH 2ZJPA 2AMCB 2HHHL 4LUVA 1PA6A 2ID0A 2R92G 3HOZG 1EQQA 5LMNQ 4DUZL 1GM5A 1TWGH 4DR2L 2Y0SG 1OXUA 2OCEA 1HNXL 2ZJQA 1E1OA 4IJLA 4DAYB 3UE0A 4DV0Q 4ALPA 1TXYA 2JEBI 4DUYQ 1YBYA 4BA2I 2KBNA 4IFDG 3STBC 4JV5Q 4YCVA 1IL2A 3G48A 3S1RH 5E7NA 2MO0A 4H02A 4B3TQ 4JCVE 4JI3L 5FJ8G 4GOPA 4NB3A 3AFPA 2ZTCA 1HZ9A 1VQJA 1IZ6A 5JEAG 1BBUA 5JJLA 1K3RA 1VCIA 4GNXA 1T9HA 4LF8Q 1YHQA 3KOJA 2A19A 2RF4A 1SMXA 1SE8A 2IT1A 4LUZA 3H3VH 1UE1A 2OQ0A 4DV4Q 1W3SA 3ER0A 3HOXG 2VL6A 2VQEL 4DR3Q 1PH2A 3PGZA 2JE6I 4NXNL 2UXBL 4A3KG 2D0OA 3CW2C 4JI4Q 4JC0A 5FLMH 3NELA 4JBKA 1UE5A 4JI8Q 4BA1I 3TS2A 2E5LL 4X66Q 3CMAA 3A74A 1YIJA 1P8LA 1J5EQ 4X64L 5IY0A 4HJ7A 4A3EG 1OXVA 4NXMQ 4GLVB 3KJOA 2JA5H 2MQHA 1GD7A 3HKSA 4IFDJ 1N36L 4DV1Q 1DGSA 4DV5Q 3CCQA 2JA7H 1WCMH 1A63A 3PUYA 4DR6Q 4DNIA 4DR7Q 1XMQL 5C0XI 3CAMA 1RIPA 3HKZG 2ZTEA 5JEAJ 1Z47A 4A3MH 1S40A 4IOAA 2RCNA 1YJ9A 2NZOA 1XMOL 1VQ5A 3HOWH 2UXCL 3S15H 2K14A 1L1OB 5BR8L 3CPFA 4LF6Q 2Z6KC 1WOCA 1JB7A 3UDXA 3HOVH 3K0XA 4R4IA 2IX0A 1Q8KA 2WP8J 3UE1A 2PI2E 2VQFL 1HNZQ 5FLMG 1N32Q 2VNUD 2N3SA 3A5ZB 1B8AA 1YITA 2R7FA 1V1QA 4DV6L 1CKNB 3AFQA 3L7ZC 3J7ZC 4B3RL 3PUVA 3RLOA
chains in the Genus database with same CATH superfamily
5IGGA 5I9OA 3OW7A 3K8AA 1UE6A 3MEFA 1S5DD 4L5TA 1JOQA 1WD0A 5ELOA 3OTOQ 5C3XA 4DV7Q 1A2UA 1L1OC 4HIKA 1AH9A 1H9SB 1NUCA 1NMFA 2JSOA 1BCPC 2JA6B 4JI6Q 4H44C 4IUPA 4UDUC 1T5EA 2ASBA 4LFBQ 1SNQA 3GTLB 1C4QA 1QG7A 5D14A 4CJ1B 1XYIA 4HR7B 4OXPA 2RQXA 1U0LA 3SDZA 2NBFA 3VA5A 3KLWA 3J7A5 1O78A 4YWLA 1SYFA 2RDFA 3S17B 4XT3B 2D0PA 2K33A 1GXDC 3H0GB 2EYPA 2BA0A 2L55A 4YHHQ 1S5BD 1KTKA 4DR1L 3PIOA 2SOBA 3S14H 2UXDQ 1PH7A 2CKZB 1KHIA 1FJGQ 5EBDA 4IURA 4A76A 2KEEA 4ODGA 3FKIH 3B6YA 2ZJRA 3V2TA 1KL9A 3GTQH 1IBMQ 1ILPA 5JJIA 1SE4A 3BDCA 1WJJA 1EY9A 1P16A 1YVCA 2Y0SE 3S24A 2XRSD 2QGQA 4IO9A 4DXFA 5K36H 1RTOA 3X3NA 3RD4A 3PIP3 4IPHA 2MNAA 2RHQB 2EZVA 2BDOA 3VDYA 3VYTA 4OO1G 1OXSC 1STNA 2DY8A 1NMGA 2EY1A 4BBSH 3I56A 5JVG3 4LF8L 1VDZA 2WKCA 3TN2A 2BH8A 2R3ZA 5F2DA 2PQAA 1ILQA 3M9BA 1XWEA 3J80L 1TWCB 1Y69U 1RJTA 3I7FA 1KDCA 3JAML 1C0AA 2EY5A 1SBBB 2Q2HA 4R9WA 2CCZA 4PZ7A 2RKSA 2CWAA 3GV6A 3X3MA 5IYBG 1A3UA 2E74C 5AJ3Q 2WAQG 5CV5A 1F9SA 3IFDA 2M2LA 3M3YH 1SR3A 3FPPA 2D9UA 3RNUA 3M7GA 5I4DA 4DV1L 2QDLA 5C44B 4R4TA 1CSPA 4OGQC 2JN4A 1JJ2A 1F2YA 2QA4A 2E76C 1D1IA 1PFMA 4PG3A 4CDFC 2PZWA 3C1EA 3L0OA 1Q7YC 5IE8A 4LNQA 3EVQA 4QUCA 3NWSA 4DKAC 3C2PA 3QJYA 3KDFB 4TVAB 2HCCA 3PIPA 2HIXA 3M85A 4TKOB 4Y7NH 4X62Q 2IPKD 1PLFA 1SNMA 3U58A 1LTGD 4YIJA 5EPKA 3CC2A 1BBXC 1M8AA 1STGA 2B63H 3BVGA 3S1NB 4FDBA 1Y1VH 1A2TA 2LY7A 5M3FG 1WCMG 5M5XB 4J15A 2K50A 1UEAB 1XMOQ 4RCNA 2O5JC 3NSWA 2VW9A 1XXGA 3U4VA 4AYBG 1D2BA 3SEBA 3TZDA 2HQEA 4KKSA 2VQFQ 3WOEA 2WINB 5D3DA 2XRQD 2JA6H 2EYJA 3J80E 1D5MC 3EJIA 1KLUD 4RG1A 4XYOA 3JAME 2EJGC 3DEOA 3QOLA 4JI1L 4DR4L 1EWIA 3GTLH 3I4NB 4XYQA 4MTNA 4JBJA 1ZEQX 3NPPA 1K0RA 1TS5A 1Q46A 4IFDI 4Y52H 3S17H 3EA6A 5CV9A 4LF9L 5JAVA 4IPCA 2JXMB 3G7LA 3BYTB 3H0GH 1L2FA 1OXTA 4JBWA 4JOIA 3D4RA 1DOMA 1FNVA 4V190 5FLXc 1EYGA 1TVXA 1NBWA 1TWHB 5M3MG 1B53A 1YI2A 1LT4D 1O80A 1H95A 1QJOA 5IWAL 3TS0A 1Z6HA 4DN4M 1L0YB 5JEAH 2UU9L 2K5HA 5C0XJ 4DR1Q 4A3LH 5C4XG 4UP9A 3CC4A 4Z9CB 4FYDA 4QF4A 1RD9D 4OIJA 4O2DA 4IPGA 2CH4W 4ZKBB 1HA5A 5EKLA 3BYYB 4DV4L 1RODA 2DNEA 3D6CA 1K73C 5E3FA 3H3VI 5A2QE 4XTCS 5GADC 1K8MA 2WAQE 1CK1A 1TWCH 5L37A 5BN4A 4IUNA 2HCIA 3PO2G 3VR4A 4OONA 3M4PA 5CC4A 3IAYA 1PZKD 3J81L 2N55A 3I4MG 1PYWD 4C3IH 5GAHC 5ELDA 5LMNW 1IW7C 4HCSA 4E6IA 1JOOA 5C44H 3EROA 4DK0A 3HOUG 2AWNA 1XTDA 1ENAA 2PZTA 4YY3L 4HJAA 3C3LA 2MO1A 3NTIA 4NXNQ 5D3IB 2UXBQ 2K03A 2JA5B 3U4ZA 2GN5A 5C5MA 1V9PA 4UAIA 4HJ8A 1N33L 2CWPA 2K75A 1JQYD 5IT9c 1DONA 4A3MB 4FF1A 1QUQB 2L9HA 2JQOA 1I50H 4JI2L 1ESFA 1PMRA 4XT1B 1XX8A 2XSCA 3S15B 3CMEA 1VQIA 2F0QA 2CW0D 3S1NH 1B2TA 1CKMA 4KY5A 1GHJA 1VQCA 3OWFA 4AYBE 4JI5L 3SE0A 2UXCQ 5M5XH 5BR8Q 2BA1A 4GKKL 3J7AF 3Q24A 2OEOA 1SNOA 2JA8G 5KNBA 5IGCA 2O4XA 1VQFA 1XPRA 2ZXPA 1SNDA 3D8GA 2WB1B 4QY7A 1KLGD 2VUMG 4K8IA 1MJEA 3I4NH 1YJWA 1NY4A 3CXCA 3M4OB 2A68C 4GNXB 3J81E 4A3JG 1JT8A 2B8FA 4LAAA 4FXKC 1C9OA 1S5CD 3NQIA 4F88A 4P74A 4FVMA 1H9KA 3E9HA 5CORA 3GTJB 2PCFB 1ZYRC 3WOFA 2NVQB 1B3QA 5IGBA 2L15A 4MIUA 2R93B 4C1NK 5HGQA 2UUAQ 4JPBW 1QVFA 1V8QA 2A69D 3MAQA 3T13A 2F4VL 4A3BB 1E3PA 1TWHH 4OL7A 3D31A 2IWHA 4A3DB 4HEDA 4X65Q 1QZHA 2D62A 2D5DA 4K0KQ 2O5IC 4LF9Q 1PV4A 3EIVA 3ITPA 1JWSD 2EPBA 5FO9B 1YZ6A 2AQ1B 2B2WA 2AMCB 2HHHL 3K5MA 2EY2A 1KNAA 1PA6A 3K57A 3HOZG 4U673 5LMNQ 1QNKA 3J7YW 2ZJQA 1E1OA 5I6WA 2JEBI 1KDAA 2RBMA 4BA2I 4JV5Q 3ERQA 1G2TA 3NE5B 5KYIA 2I46A 4JI3L 5E1FA 5FJ8G 1ML0D 5A35A 2KA7A 4C3HB 1EFID 2FJ2A 1PTOC 3AU7A 4NMZA 1K3RA 1VCIA 4G7OC 4M8AA 2A19A 2G9HD 2RF4A 1BUVT 1SE8A 1SMXA 2G9DA 2IT1A 2K6AA 3H3VH 1UE1A 4DV4Q 2LMCB 4DU9A 1SMYD 4QMGA 5IIFA 3L3OC 5M5YB 3VYUA 4JI4Q 1RKNA 1CHPD 1BCPF 1U4RA 4JI8Q 3TS2A 5CR3A 4X66Q 1YIJA 1P8LA 1J5EQ 4X64L 4NXMQ 1OXVA 4GLVB 2JA5H 4F87A 1KABA 1N36L 2VB3X 3FPUB 4HMJA 2DN8A 5KRUA 5C0XI 5BN3A 3HKZG 5JEAJ 2A6ED 4XXEA 2B8GA 4A3MH 2ZXRA 1S40A 1CFMA 3HRZC 2L4NA 1O7YA 3EFXD 1B1ZA 1QB5D 3S15H 1II3A 1F2LA 4B9XA 4LF6Q 4M1UB 2Z6KC 1WOCA 5I9PA 4ZYSA 5HURA 5CBAE 2WP8J 5FLMG 2N3SA 1HFGA 2M00A 1V1QA 1B9NA 1CKNB 2F0KA 4HIOA 3J7ZC 4B3RL 3PUVA 2WKDA 5EKIA 1EQRA 3HG9A 2WFWA 4A3CH 2Q2IA 2X6GA 2F0SA 4BXXG 2IL8A 1V1PB 4GOPB 1XNQL 1HNWL 1FYCA 3MZ5A 3AB9A 4IOCA 1SE2A 1CM9A 1VQGA 2ZTDA 1Z9FA 4JI5Q 1FGUA 1HH2P 3A8JE 1ET6A 1OXXK 2H5XA 2UUCQ 1EZ8A 4CBVA 3M4OH 2AQ3B 2Z6KA 2OTLA 3NBIA 3N52A 2CQOA 3TQYA 3U50C 3GTJH 3PQIA 1CA6A 4DR5L 1CZWA 1IBLL 2NVQH 2AQ2B 2XWBB 2R93H 3AEVA 2IJ0A 1R9TB 2N49A 4K5XA 4A3BH 4ME3A 3SGIA 3NENA 4HMIA 4A3DH 4GLAC 4LF7L 1C8CA 3F2UA 4KI0A 4Q5VA 4GN4B 1IYUA 4PMCA 4DV0L 1UWVA 5IT9L 3BG3A 1BO0A 4HAEA 1LYLA 4QQBX 4UHVA 4B3TL 2QILA 3BS1A 4WJ3M 1G51A 3PSIA 3HOXB 1LT5D 1U5KA 1W6JA 4H7BA 2R7DA 1FL0A 3LGJA 4K6DA 1JE4A 4C3HH 2EXDA 3FKIG 2F0MA 3A0JA 4DR3L 4DNRB 4XIGS 2VS1A 1D1KA 2KHSA 2F0DA 1Y14B 1F9RA 3Q8DA 3M4YA 3CCMA 2ICIA 1DXMA 2RVLA 2DY7A 1MIUA 4OX9Q 5K36G 5CV4A 1I3QB 5EAYA 3TP7A 2E2IB 2Z8LA 4P71A 4HJ9A 4QIWE 4KY7A 1WYDA 1HZBA 4EQNA 5M5YH 1VQMA 1EUJA 3PUWA 3KFUA 3W1GA 1ASZA 4DR6L 4BBSG 3VYRA 1RHPA 2KJXA 4DXGA 1N9WA 2ZT9C 3HKZE 4A3GH 3N6RA 1JWMD 3I55A 1CA5A 2K01A 4DNTB 4Y7NB 1SAPA 4LJZC 4UP8A 1IKMA 5DM63 3HS0C 5FO8B 2G5DA 2L12A 4X64Q 2QCPX 1LV9A 1BOSA 1WVLA 1MJCA 1MKHA 2B63B 2A8VA 3EN2A 5IT9E 3Q0AA 3E9IA 2R7ZB 1DOLA 1L0WA 2F0UA 1K8GA 2Z1CA 1PFNA 1IYJB 1I94Q 3MXNB 3J7AV 1PRTC 1ICWA 2F0EA 2WIIB 2K52A 4X3UA 3S16H 2XTIA 4C3JB 1WTHA 4B3ML 1LTSD 1N34L 2RSOA 2UUBL 1STEA 3TEHB 3CC7A 3GTPH 4R4QA 2BE5C 2R6GA 4L5QA 5CV7A 3UDGA 3TRZA 2RHSB 2NN6H 1H9MA 3RUZA 3KF8B 4DV2L 4K2KA 3SK6A 4YCWA 1X3PA 1AE2A 1Y1VG 3TMEA 3T51B 1GUTA 4R1JA 1BBWA 2ZM6Q 4QJFA 4IUQA 1EEID 1BQQT 1R9TH 1AFPA 2L1BA 1HXYD 3G71A 2JP1A 2HUGA 5IP9H 5LMUL 2FMMA 1X3EA 1MGSA 1Q1BA 2Z9HA 2JA6G 3R2IA 4PZ8A 3E0JA 2EE1A 4DA2A 2EJFC 1CKOA 3A8KE 5C4JB 4DR5Q 1WTWA 1VS0A 1KNEA 3TZUA 4EQ5A 1I6HB 1TY2A 2KUMA 1IXRA 4JI7Q 2Q8RE 3KYHC 1K0SA 1G91A 1SYGA 4G7ZC 3T1HL 3T1YQ 1S5FD 5AFWA 4JK1C 3HOXH 3H0GG 1D5XC 1JE5A 1NR4A 4ZK9B 1SYDA 3DWPA 1EY6A 4A3KH 1VQAA 1JMCA 3S1RB 4PZ6A 5CGKA 3FRPB 1IKLA 1EIFA 2E8GA 1F2ZA 3DWAA 4RAUC 2F1MA 1PH8A 4CKCA 1NAPA 4C3IB 2WACA 1C7YA 3J81j 2F52A 1M1KC 1I3QH 1R4QB 2GVBA 3G4SA 4A3LG 2E2IH 2JYOA 3NUCA 3MHBA 4I7ZC 4LFAL 3CRKC 3KK7A 5KGUA 1EWHA 4C1NI 3AYHB 1V43A 4QGUA 1SYCA 2IX1A 3OYYA 2FINB 3I8ZA 1KXLA 5IYDH 1G6PA 4EX5A 2JA7B 4DF7A 1WCMB 1SJHD 1I50B 4GS3A 5BN5A 1UNSA 5EGTA 2RA4A 1GUOA 2YV5A 1T5XD 1ZXTA 2AWOA 1ENCA 1AZQA 3HOWB 1XMQQ 2BOSA 2Z6BA 4UP7A 2R7ZH 5ELCA 1ICFB 3HOVB 5C44G 1CQFA 3MVVA 1SYEA 1J8IA 1G291 1Y1WG 4JOIC 4A75A 1PH3A 5T1IA 5A2QL 1TQOA 5E4XA 4C3JH 4QUFA 4JI0L 2PO4A 5JPMC 1TS4A 5JOBA 5I6YA 4K5WA 2B3GA 5EJWA 1B9MA 1YHAA 3CCJA 4A3FB 3BJUA 1B4OA 5JJKA 5DM73 3OW2A 2GVAA 1SROA 4KKTA 2ATWA 1DD2A 1I4HA 3G6JB 1LTLA 1A8VA 2FMCA 1VQOA 3J80i 2YTXA 1K28A 5GQOA 3JAMi 1NTGA 4JYAL 3I3CA 1N34Q 4ID6A 1JB3A 2RDGA 1PTOF 2IHEA 3F2BA 5DAUA 3BZCA 1MBYA 2WV6D 1LTTD 3ZYYX 2N8NA 2DJGC 3L9AX 1IW7D 3PO3B 2L11A 3NBHB 3FMCA 4RGOS 4WFN3 1JCKB 2DUDA 3CQZB 1A0IA 1SNCA 4B3SL 1XNRL 1ONLA 4A3EB 5TSSA 2J7ZA 3HGBA 5C4JH 1HCZA 3I4NG 2C9OA 1S72A 3DWQA 1JWUD 1AE3A 3BZKA 1I6HH 3U9SA 2KCNA 1B70B 4KTAA 2ZJPA 1TIID 1OO9B 2EDGA 2XN9C 4LUVA 3DM1A 3MEHA 5ELFA 1WTPA 1AEXA 1FR3A 4DUZL 1EQQA 1OXUA 2OCEA 1HNXL 3K6OA 3UE0A 2F0NA 4ALPA 1TXYA 4IFDG 3STBC 4KJNA 2SDFA 3G48A 2PMZB 3S1RH 1EY0A 2MO0A 4JCVE 4ZKCB 1AN8A 1Q3LA 1STHA 1V1PA 5E4WC 5KNCA 4GOPA 1ET9A 1VQJA 3GTGB 5JJLA 3K59A 4PMBA 4LF8Q 1LACA 1YHQA 3KOJA 4LUZA 4IALA 2OQ0A 1QCBD 1W3SA 2VQEL 2JE6I 1TWFB 1H9JA 3CW2C 2VB2X 3PMFA 1WTQA 4JBKA 3NELA 4DAPA 2E5LL 4IUVA 3CMAA 3S2DB 1GUNA 2A68D 3E5SA 2F0JA 3OMGA 3Q23A 1GD7A 4DV1Q 2CHBD 3CCQA 2JA7H 1WCMH 1A63A 3QB3A 2IW3A 1ZYRD 2NVXB 1TS3A 2AUKA 1RIPA 3HOYB 4IOAA 1GUWA 1YJ9A 1VQ5A 3HOWH 2PYKA 2K14A 1L1OB 3CPFA 1BCPB 4DAYA 1WTRA 2ENBA 3K0XA 4R4IA 2IX0A 3HOVH 1JORA 3A56A 5I2YA 2R7FA 4DV6L 3L7ZC 2B2UA 3RLOA 1F9QA 4TRDA 2JA5G 3S1MB 1G2SA 3E0EA 4KHPL 4HTHA 4ZUIA 2NVTB 4BY1B 4POFA 1G8ZD 4A3IB 1YNNC 4A3FH 2LXKA 3KBGA 3LWUA 3V96A 2E2JB 2C35B 2EIFA 3UDFA 1HR0L 2B2WC 1TKWB 1VQKA 1U9RA 1UAPA 3H09A 1M4VA 4NW2A 3CCUA 4HSPA 2K5NA 1PTOD 4JI0Q 2OTJA 1HZAA 2A6HD 4AQYL 3AQQA 4RHRA 5FOBB 1KDBA 3WWVA 1HZCA 4JI1Q 3J81i 4DR4Q 4DK3C 3Q22A 4LF5L 1CT1D 3R93A 1GUGA 4DV3L 5C4XH 4A3CG 1DZ1A 1KC8C 1PH1A 3PO3H 1X3FA 3O13A 2K28A 3CQZH 4NKLA 4JYAQ 2WB1G 3WDNA 2IX3A 4LW1A 4A3EH 2CQAA 5JJZA 2HT1A 3F1ZA 2K5VA 1SEBD 3MFYA 3KLRA 3RZOH 2IHFA 4LK1C 2R61A 2NTTA 4B08A 4L8JA 1C48A 4G57A 5LL6X 5IWAQ 2V1CC 1I5FA 1VQ6A 4B3SQ 1Z7TA 3S2HB 1TWAB 2JA9A 3OOCA 2UU9Q 1HR0W 2R93G 4P2CB 4A3BG 1ESRA 4DAVA 1H9SA 4A3DG 1S3OA 3F8TA 1RF2D 1HTLD 3GTGH 3VR2A 3QWNA 5IYCH 4OWWB 1K8OA 1TR5A 1PRTF 4MNOA 3I90A 4XDXA 3TP8A 3SK8A 3T53B 1FNUA 1A3TA 4IQZA 3A7AB 3R8BA 4KD4A 4GLXA 1TWFH 1VQ8A 2OT2A 1Q86C 3ULJA 4OIKA 1I6VC 3GV3A 4P73A 2A73B 4DV5L 3M7NA 3HFZB 4A3GB 4R4CA 2F0LA 3S2DH 1MSGA 2F0OA 4RA8A 4WORA 5C4HA 1H9RA 4ZLTF 3GP7A 4A93B 5CMDA 5C3EB 2VQEQ 3RZDB 1QVCA 1VQ4A 1STYA 3NK9A 1I4PA 2KCMA 1CSQA 5FLXL 2NVXH 4KMUC 4YY3Q 1ASYA 3HOYH 1EZ6A 2N78A 4HCEA 2H1EA 2XIWA 2MP1A 2E5LQ 1JICA 1LLRD 4X3TA 3I4LA 5G3LF 3MA2B 1OTCA 1N33Q 4GKJL 3PCOB 1IL8A 2LSSA 2EYMA 4JI2Q 3S16B 1FD7D 2ICEC 1JOKA 3OTOL 2NZHA 5EKKA 2NN6I 1EYDA 3A7LA 3ONAB 2MFIA 1TU2B 3UDIA 2CH4A 1WTVA 1WD1A 4POGA 3S1MH 2K5QA 4BBRB 1YEZA 3P1HA 4JI6L 1VQ9A 3GTPB 2NVTH 3ND9A 4BY1H 5DEHA 4A3IH 1PDQA 5IODA 4GKKQ 2XWJB 3JAMc 2KECA 2E2JH 3MXGA 1SFOH 1EU3A 1KRTA 1J6QA 1BXTA 1KD1C 2B39A 4BY7B 4UPAA 1EY8A 4KHZA 3RR5A 3H91A 2K7VA 5C0XG 2MJ8A 1EYCA 1AZPA 3KLSA 2OF1A 3BVMA 4YHHL 3KUPA 3DUZA 1SN8A 5EPJA 3FVQA 2R92B 3CCLA 1BVSA 2MHVA 3CKIB 5ELBA 4AIMA 2WB1E 2Y0SB 3I70A 1HR0Q 1HRJA 5K5PA 3KDFA 5KIXA 5J1ZA 4QL5A 3V05A 1IBML 2JK8A 1JJGA 1N8RC 1D7QA 4MN3A 4JVZA 2E2HB 4KKUA 2FXQA 5FLXE 3GDEA 1EQTA 1PH5A 2E2DC 4IN3A 4L5SA 2NN6G 3W5OA 5C3WA 1Q8IA 4DUYL 1YNJC 1F9PA 1Y8NB 4DV3Q 2F3IA 1X54A 2F4VQ 3GTMB 2KCTA 3FEWX 3P20A 1A62A 1X55A 4OELB 1QNUA 3A55A 3S2HH 4WRDA 1TWAH 4A3KB 3NHHA 1MD2D 4CDDC 1SE3A 2HHHQ 2NUCA 2OQKA 5IP9G 2MPMA 5JPNC 1VMPA 4JG2A 3RLNA 3K81C 3PUXA 4YWMA 1PRTD 4P72A 5AJ3L 4N9TA 1NJIC 1E2ZA 2B29A 1Q1EA 5IP7H 3QIAA 4GN3B 4IPDA 3RN5A 2A5HA 2K5WA 3K7UC 5KEEA 1BCPD 4JI3Q 1CTMA 1KQSA 1LTBD 1A15A 4YCUA 1UEBA 2BCOA 3K5OA 3FDTA 1CUKA 2ES2A 2BE5D 1F77A 1X9NA 1YHBA 2QW7A 1WTXA 2I0QA 2B2TC 1R4PB 2RSNA 1E24A 1EY5A 2F4IA 3ERSX 1HFNA 4C56C 2EYOA 4L5RC 1M90C 4CJ0B 4A93H 4RH6A 5CV8A 4X62L 5C3EH 3RZDH 3S9WA 4IUTA 1HNZL 1PYSB 1N32L 1HJPA 3TDQA 1GUSA 1JC7A 2CVRA 2KVMA 4V0BA 2KENA 3CCSA 3H3VC 5CYUA 4HIDA 1E22A 1GO3E 1N36Q 1FVIA 1NNXA 3I72A 5LL6S 4G7HC 4NDXA 4BXXH 1CZGA 2PNRC 4EGVA 3KF6B 3PV0A 4AH6A 5J3BA 4FF4A 1Q12A 2KQ3A 2DNCA 2PNHA 4DAMA 2B2TA 4LFCL 3CRLC 1EIYB 3DEPA 4ME5A 5IYDG 4DK1A 3PUZA 4RGNA 4BBRH 5ELNA 1HQMC 3CF5A 4LF4L 2E75C 5HGTA 3CCVA 5J39A 1PVOA 2F03A 4GN5A 3BU2A 3CP0A 3QG1A 1HUNA 1X3QA 4B3RQ 4EVOA 1PHJA 1IBKL 1A6XA 2J4XA 2XGTA 4BY7H 2Q8IB 5FKAC 2QDBA 3KLSX 2B63G 3JC66 3J81c 1PYBA 3URYA 1EY7A 1Q82C 3RLFA 2NB0A 4KV6A 2QEXA 1XNQQ 2R7ZG 1HNWQ 4OO1I 1KIXA 2FHTA 3D0FA 1PFSA 2XVSA 3T16A 2EYLA 1PFBA 2R92H 3OHXC 3A8IE 2IY5B 5GROA 3T56B 3ICEA 3G6EA 2VXWA 2F0VA 1X3GA 3MWYW 4C3JG 1SRUA 2B2YA 1BR9A 1HPCA 2F0GA 3GQBA 1O7IA 1GJXA 1QUQA 2VZAA 2E2HH 4OHJA 3H6MA 1IBLQ 3UI2A 4FXDA 1RL2A 1NE3A 3RMHA 4LWCA 1K8AC 3GD7A 3LNNA 3M4QA 4GNXC 2PW5A 2K1BA 4L6TB 4RCOA 3GTMH 1SLJA 4N8FA 1L1OA 1LTAD 1PTOB 1KAAA 4LF7Q 1B7YB 3L2PA 2WAQB 2SEBD 1O7ZA 2ID0A 2KEDA 1F2MA 2DJFC 4DR2L 2EOTA 4DV0Q 4DUYQ 1YBYA 3MXPA 3OSOA 2KBNA 1DJRD 2HD3A 2TSSA 4MTKA 4YCVA 1RTNA 3IL8A 5E7NA 3KBXA 4F8MA 2X69A 4H02A 3IKJA 4B3TQ 1EY4A 5CBEE 1CQVA 2ZTCA 4PV1C 1HZ9A 3LWEA 5COYA 5JEAG 3GTOB 1A3VA 1MHWC 1T9HA 2V4DA 4GNXA 2F3VA 4IUUA 1W6KA 3MTSA 4CDEC 1PH2A 3BVZA 4ULLA 3ER0A 3OIQA 2VL6A 1K3BC 2HDLA 4DR3Q 3PGZA 3OIPA 4NXNL 3VYSA 2UXBL 1UE5A 2C5CA 5EBCA 1TT2A 4R8NA 4BA1I 4CJ2C 1SSOA 4XQJA 5M3FB 4ZAIA 3P75A 1O7LA 3KJOA 3C1FA 2MQHA 3HKSA 1DGSA 1U4MA 1Y1WB 4AYBB 4DR6Q 4DNIA 4HSVA 2H4OA 3NQTA 3CAMA 4CGYB 2ZTEA 1Z47A 4C3IG 4ABNA 2RCNA 2EJMA 2UXCL 1S5ED 5BR8L 1LABA 1JB7A 3UDXA 3UE1A 1HNZQ 1N32Q 1Q8KA 2VNUD 3NP8A 3A5ZB 1B8AA 1YITA 1EIHA 1U4LA 5C5LA 3S1QB 2M9VA 1DM0B 5ISRA 4LMQD 3DM3A 1WTOA 2JA7G 1LM0A 1X6OA 1PH4A 5M5WB 3NEMA 1LTRD 3STBD 3K5LA 4YWKA 5M3MB 4LFCQ 4O1NA 5HY6A 2F0IA 1NR2A 1SYBA 1K9MC 3HOWG 4B3MQ 2NTSA 3D3RA 2DGYA 4RHSA 2LKVA 1X56A 2UUBQ 3H15A 2NVYB 5CV6A 4RGTA 3HOVG 3OMCA 4LF4Q 3ULPA 2NYZD 1VQNA 4RGMA 3QO2A 2UUAL 5C4XB 1E1TA 4C2MB 3EBEA 4DV2Q 1IBKQ 3ZJYC 3HEJA 1STAA 2L0CA 1J9OA 4X65L 1EEFD 3A54A 4OO1H 2MUYA 1I4RA 4KD3A 4GOPC 4K0KL 1KAWA 2KCCA 2PI2A 2VY3A 1VQPA 2LS01 4A3FG 1PZID 1PH9A 3RZOB 5T1GA 4K5VA 4MHEA 3FP9A 4X6AH 1B3AA 1SJED 3BDOA 3CD6A 2BH2A 2MGSA 5LMNL 1XTCD 5LMUQ 1PTOH 3PO2B 2KHJA 5IYBH 5JVH3 2Z0SA 1CKNA 3DXJC 5DNFA 4JV5L 3I4MB 1G6ZA 2HIVA 2PPBC 4F7XA 2PZUA 4NP5A 2EVBA 3K7AB 3PO3G 2Q2UA 3HOUB 1MSHA 3SXHA 2A1AA 5D65A 4CHTB 2JJQA 3T1HQ 3CCRA 2EY6A 3D6WA 4A3EG 5EPLA 2J0TD 2I5MX 4K2LA 3GTOH 4B9WA 4DR2Q 3NWTA 1L0XB 1QWYA 2K4KA 3H94A 4KLKA 5IGEA 2KHIA 1UE7A 3DHQA 4JI4L 1D5ZC 1HA6A 1QE6A 3IRBA 4JI8L 1K83B 5KNDA 4X66L 2Z4HA 1YNND 2RDHA 1J5EL 2CFMA 2PW7A 2EYFA 3R2TA 4NXML 2F0HA 3NTKA 3SVMA 2B2UC 1B50A 3D4DA 2LXJA 3R3OA 5M3FH 1VQHA 2AHOB 2TMPA 2JEAI 2EQSA 4DPGA 4LFAQ 3MFGA 1Y1WH 3SHLA 1PXUA 2JA8B 1PRTB 4KY6A 2K05A 3ULLA 1QVGA 5IYCG 4OWTB 1PH6A 3K0YA 4LF6L 2PQEA 3KJPA 4QB4A 2P5ZX 3IFTA 4ILWA 5NUCA 1GKHA 3CHBD 5KYLA 2VUMB 4ZRZA 3VA7A 3RN2A 3PF5A 2YU9B 4A3JB 3LX0A 3S1QH 5M9OA 4XQQA 3NTHA 1BDOA 1STBA 2F0WA 1BF4A 2YTVA 1D6EC 2HQLA 4A3MG 3P7JA 4Q0FA 1SFOB 5M5WH 2UUCL 4PMWA 3HOYG 2SNMA 2PQAB 2QKIC 3TREA 3CCEA 1HUMA 5M3MH 1MI2A 5IOCA 1I4QA 4U68A 3F2CA 1EYAA 1VF7A 1GOZA 2D2CC 5C6AA 4G4KA 4HIMA 4X3SA 4X3KA 2NVYH 4H13C 4EQOA 3E3XA 2I5LX 5H1SE 1DYQA 1VQLA 4WJ4A 3E6ZX 3D4WA 4C2MH 1FGBD 4FF2A 2AKWB 4J6HA 3HOZB 4RKBA 1RCVD 1Y8PB 2I5HA 4TSSA 4R8IA 2Z4IA 1S4ZA 3QOJA 4BS9A 1XJVA 3Q6SA 4BY1G 4CKEA 3AMUA 1TS2A 1ZKOA 4A3IG 1E2VA 1Q90A 5C4ZA 4IFDH 3SK5A 1EL0A 2CW0C 4JW0A 1IYVA 4DK6C 2AUJD 1EQVA 3KF6A 1DCZA 3PO2H 3CPWA 3MXNA 3I2ZA 1XNRQ 3GTKB 3TBIB 2EXZA 5GAGC 1LT3D 3I4MH 2I07B 4A4IA 1VQ7A 1E7ZA 1TWGB 4O0AA 1EU4A 1TY0A 3DMUA 5ELEA 1EWCA 3K7AH 4OWXB 1WFQA 3OPOA 3HOUH 3FHWA 2YYZA 4FO2A 4EQPA 4DUZQ 4O42A 4QIWB 4LUOA 4KN4C 1YNXA 3K58A 1AP0A 1HNXQ 4ZCKA 4OX9L 3KF8A 1XPUA 1U4PA 3ND8A 4BWGB 2HDMA 5J22A 1XPOA 4PNYA 1LUZA 1JJCB 1BKBA 4FP5D 3HKZB 3K80C 1K83H 1D8LA 4I7AA 2OXPA 3SK4A 1QZGA 2A6HC 4MZ9A 1Q81C 3EQLC 3PF4A 2PMZE 4DR7L 1ENFA 5GAEC 2A69C 4KJOA 3CU7A 1HTPA 1IHZA 1GVPA 1LTID 4C3HG 4TQUS 4WJWA 1E2WA 1PZJD 3TSSA 4DGZA 3A5UA 2JA8H 4HN7A 1W2BA 3SR1A 3DLLA 3I73A 5IGFA 3HZXA 2F0TA 2F3WA 4KHVA 4IZ8A 5IP7G 4HJ5A 1CI3M 2RCFA 2X6LA 1VQEA 1LO5D 2FFKB 1RDPD 3GO5A 1QOHA 4I65A 3HP3A 4P75A 2ALYB 2VUMH 1I94L 4J1MA 4R4OA 2OWOA 4K8JA 1WI5A 4IJHA 4APVA 4RMFA 2YU9H 4A3JH 4A3GG 5FK9C 4DV7L 1YNJD 3MXUA 4LFBL 5DLQE 3QR8A 1EOVA 4A93G 3J80c 2YTYA 4L63B 5C3EG 4JBMA 1E0BA 2QF7A 4DV6Q 3TP5A 3I91A 1SNPA 1SMYC 1Y8OB 4DFAA 2QEJC 1AW7A 3W1BA 4KHPQ 3T4AC 4RWSC 4H0LC 5FO7B 4N8X1 2F0PA 2EYHA 2F0FA 4NPSA 2ZM6L 2UXDL 2Q2TA 1EIGA 5IGDA 3VR6A 1EFWA 1FJGL 1FNWA 3I4OA 4UY8C 3HOZH 1EOTA 1YJNA 4BBRG 2BDNA 2GA4B 3TP6A 3MC0B 2A6EC 2B2VC 4AQYQ 1NCVA 1X65A 2KOLA 3S14B 3W3AA 4LF5Q 2K32A 5FJ8H 4JI7L 2L5TA 4ZQ3A 4BY7G 3FKIB 1HQRD 3GTQB 1KRSA 3T1YL 1VQBA 4K6LA 1VQDA 4PQXA 3F2DA 3VR5A 5I2XA 4CDCC 3GTKH 1HHVA 2N88A 2R92G 4KK7A 1SXTA 4XQNA 3C46A 1GM5A 1GHKA 1TWGH 3BDLA 2Y0SG 1UUPA 1QILA 4IJLA 4CKBA 4DAYB 5LHY1 2B2VA 4FXGC 3U9OA 4BBSB 1IL2A 1LT6D 3K5NA 4NB3A 3AFPA 2SNSA 2K5DA 1IZ6A 1X32A 1BBUA 4ZUJA 1JR0D 2NZ1D 2NWGA 4N9PA 1V1OA 1I4GA 3VR3A 3NXWA 4KN7C 3HOXG 3M3YB 4QCLA 1VF5C 4A3KG 2D0OA 4JC0A 5FLMH 3OWEB 3BZDB 3NBHA 3A74A 3W2DA 1VMCA 2A74C 5IY0A 4HJ7A 4IFDJ 4FF3A 4GZYC 4RFBA 4DV5Q 5G3LD 3PUYA 4DR7Q 2O2LD 1XMQL 4RKLA 1DOKA 2LFNA 4K14A 1SDFA 5EQ0A 4J8QA 3PIO3 1BNZA 4FNFA 2NZOA 4S3SA 1XMOL 4OEMB 1CHQD 2ZXOA 1B44D 2VQFL 2PI2E 2XNAC 2Q8TA 2B2YC 1Y1VB 5C0XH 1I4XA 2K04A 3AFQA 4GKJQ 1NSNS
chains in the Genus database with same CATH topology
1EQRA 2JA5G 3DM3A 3E0EA 2WFWA 3K8AA 4A3CH 1UE6A 2JA7G 2Q2IA 4KHPL 3MEFA 1LM0A 4L5TA 1X6OA 4BXXG 5ELOA 4POFA 3OTOQ 1PH4A 1XNQL 3NEMA 4GOPB 2LXKA 4A3FH 1HNWL 4DV7Q 1L1OC 3STBD 4HIKA 1AH9A 1NMFA 4YWKA 4IOCA 1VQGA 4JI5Q 2ZTDA 1Z9FA 2C35B 2EIFA 3UDFA 5HY6A 1FGUA 1HR0L 1HH2P 1K9MC 4JI6Q 2ASBA 4B3MQ 3HOWG 1VQKA 4LFBQ 2DGYA 1OXXK 2H5XA 1X56A 2UUBQ 3H15A 3CCUA 2UUCQ 3M4OH 4OXPA 3HOVG 2Z6KA 2OTLA 4LF4Q 3ULPA 2K5NA 4JI0Q 1U0LA 2OTJA 1HZAA 4AQYL 2CQOA 1VQNA 3KLWA 3AQQA 3J7A5 4YWLA 3WWVA 2UUAL 1HZCA 4JI1Q 1E1TA 3TQYA 3U50C 3EBEA 4DK3C 3J81i 4DV2Q 1IBKQ 4DR4Q 3GTJH 3ZJYC 4LF5L 4DR5L 1IBLL 2NVQH 4X65L 2D0PA 4DV3L 5C4XH 4A3CG 2R93H 2BA0A 4GOPC 3AEVA 4K0KL 1KC8C 1PH1A 4YHHQ 1KAWA 3PO3H 2PI2A 2VY3A 3PIOA 2N49A 4DR1L 1VQPA 1X3FA 4A3BH 3CQZH 4ME3A 3SGIA 3NENA 3S14H 4JYAQ 4A3FG 1PH7A 2UXDQ 4A3DH 2CKZB 1KHIA 1FJGQ 4GLAC 2WB1G 4LF7L 1PH9A 4LW1A 4A76A 4A3EH 3FKIH 3B6YA 2ZJRA 3FP9A 4X6AH 4KI0A 2HT1A 1KL9A 2BH2A 3F1ZA 3CD6A 2K5VA 1IBMQ 3GTQH 5JJIA 4GN4B 5LMNL 3RZOH 1WJJA 5LMUQ 2IHFA 1P16A 1YVCA 2Y0SE 3S24A 2KHJA 2QGQA 5IYBH 4IO9A 2Z0SA 4DV0L 1UWVA 1CKNA 4JV5L 4IPHA 5IWAQ 2MNAA 2HIVA 2RHQB 2V1CC 1LYLA 1I5FA 1VQ6A 4B3SQ 4QQBX 4B3TL 2JA9A 3VDYA 4WJ3M 1G51A 4OO1G 3PSIA 2UU9Q 1HR0W 1OXSC 2R93G 1U5KA 1NMGA 3PO3G 2R7DA 2Q2UA 4BBSH 3I56A 4LF8L 1FL0A 2A1AA 3LGJA 4A3BG 4A3DG 2JJQA 2BH8A 3T1HQ 3CCRA 4C3HH 1S3OA 2EXDA 2PQAA 3A0JA 3F8TA 3FKIG 2I5MX 3M9BA 4DR3L 5IYCH 3GTGH 4XIGS 4OWWB 2VS1A 3GTOH 4MNOA 4DR2Q 3I7FA 1Y14B 3CCMA 3Q8DA 2Q2HA 1C0AA 2CCZA 2K4KA 4KLKA 4PZ7A 4JI4L 2KHIA 1UE7A 2CWAA 5IYBG 3IRBA 4JI8L 1MIUA 4OX9Q 4X66L 5K36G 5AJ3Q 2WAQG 5EAYA 4GLXA 1J5EL 1TWFH 2CFMA 1VQ8A 3M3YH 1SR3A 4NXML 1Q86C 3ULJA 4P71A 4HJ9A 4QIWE 5M5YH 1WYDA 1HZBA 3RNUA 1VQMA 1EUJA 4P73A 3PUWA 4DV1L 3KFUA 3W1GA 4DV5L 3M7NA 3HFZB 1CSPA 4R4TA 4R4CA 2LXJA 1ASZA 1JJ2A 3S2DH 5M3FH 4DR6L 4BBSG 2AHOB 1VQHA 2QA4A 1N9WA 4A3GH 3HKZE 2JEAI 2EQSA 4DPGA 4PG3A 4LFAQ 3I55A 1Y1WH 4HIOA 3L0OA 2VQEQ 1Q7YC 5IE8A 3ULLA 1QVCA 1VQ4A 1QVGA 4LNQA 5IYCG 2KCMA 1CSQA 4OWTB 4DKAC 2NVXH 1PH6A 3KDFB 4UP8A 4LF6L 4TVAB 3KJPA 4YY3Q 1ASYA 3HOYH 3PIPA 2N78A 2HIXA 3M85A 2E5LQ 4Y7NH 4X62Q 1GKHA 4X64Q 3U58A 1MJCA 1MKHA 1OTCA 1N33Q 4GKJL 2A8VA 3EN2A 3PCOB 3CC2A 3RN2A 3E9IA 3PF5A 1L0WA 2B63H 2LSSA 1K8GA 4FDBA 1Y1VH 3S1QH 4JI2Q 1IYJB 5M3FG 1I94Q 3MXNB 3OTOL 1WCMG 2NZHA 2NN6I 4POGA 2K52A 2MFIA 4J15A 2K50A 3UDIA 3S1MH 3S16H 2YTVA 2XTIA 1XMOQ 1YEZA 2HQLA 4A3MG 4JI6L 2VW9A 1VQ9A 2NVTH 3U4VA 4AYBG 4B3ML 4BY1H 1N34L 2UUBL 2UUCL 5M5WH 4A3IH 4PMWA 2VQFQ 3TEHB 3HOYG 4GKKQ 2PQAB 3CC7A 3JAMc 3TREA 3GTPH 4R4QA 3CCEA 2R6GA 4L5QA 3UDGA 5M3MH 2JA6H 2E2JH 3TRZA 1SFOH 1KRTA 1KD1C 1J6QA 2RHSB 4RG1A 3F2CA 4UPAA 4JI1L 4HIMA 3KF8B 1EWIA 4KHZA 3RR5A 4DV2L 3GTLH 4DR4L 5C0XG 2NVYH 4MTNA 4JBJA 1K0RA 4YCWA 2I5LX 5H1SE 1AE2A 1VQLA 1Y1VG 1Q46A 4YHHL 4WJ4A 4IFDI 4Y52H 3S17H 4C2MH 1SN8A 2AKWB 3CCLA 1BVSA 4LF9L 2I5HA 4IPCA 4AIMA 2WB1E 4R1JA 1BBWA 3H0GH 2ZM6Q 1HR0Q 1L2FA 1OXTA 4JBWA 4QJFA 3KDFA 1R9TH 1XJVA 4JOIA 3G71A 4QL5A 4BY1G 1IBML 2JK8A 5FLXc 1JJGA 1N8RC 5IP9H 5LMUL 4A3IG 1EYGA 1D7QA 1X3EA 1NBWA 1Q1BA 2JA6G 5M3MG 2FXQA 1YI2A 3GDEA 4PZ8A 1PH5A 1H95A 4L5SA 2NN6G 5IWAL 3W5OA 1CKOA 4DUYL 4DR5Q 4DK6C 3TS0A 1VS0A 3KF6A 2F3IA 1X54A 4DV3Q 2F4VQ 2KCTA 3CPWA 3PO2H 1A62A 4EQ5A 2UU9L 2K5HA 1IXRA 4JI7Q 5C0XJ 3I2ZA 3KYHC 4DR1Q 1XNRQ 1X55A 5GAGC 4A3LH 5C4XG 3I4MH 4A4IA 1VQ7A 4UP9A 3CC4A 3S2HH 3T1HL 1TWAH 4O2DA 1E7ZA 3T1YQ 4IPGA 4O0AA 3HOXH 3H0GG 1JE5A 3K7AH 4OWXB 1WFQA 2HHHQ 4A3KH 3HOUH 3FHWA 2YYZA 4DV4L 1VQAA 1JMCA 2OQKA 5IP9G 4DUZQ 1K73C 4LUOA 1YNXA 4JG2A 4PZ6A 3RLNA 3K81C 1HNXQ 3PUXA 4OX9L 4YWMA 3H3VI 1XPUA 4XTCS 4P72A 5GADC 5AJ3L 1EIFA 2E8GA 2WAQE 1NJIC 2B29A 1Q1EA 1TWCH 5IP7H 4GN3B 1XPOA 1LUZA 4IPDA 1JJCB 1BKBA 3RN5A 1PH8A 3PO2G 3K80C 3K7UC 1C7YA 3J81j 1K83H 1D8LA 4OONA 4JI3Q 2F52A 1KQSA 1M1KC 3M4PA 1I3QH 4YCUA 2GVBA 3G4SA 1QZGA 1UEBA 4MZ9A 1Q81C 2E2IH 3I4MG 4A3LG 1CUKA 3PF4A 4C3IH 2ES2A 2PMZE 5GAHC 4DR7L 5LMNW 1X9NA 4LFAL 5GAEC 5C44H 1YHBA 3AYHB 2I0QA 1V43A 4QGUA 1GVPA 1E24A 2AWNA 1XTDA 3ERSX 3HOUG 4TQUS 2IX1A 3OYYA 4YY3L 4HJAA 3A5UA 2MO1A 4L5RC 1M90C 4NXNQ 2UXBQ 1KXLA 5IYDH 1G6PA 4A93H 4EX5A 2JA8H 3U4ZA 4X62L 5C3EH 2GN5A 3RZDH 1W2BA 1V9PA 3DLLA 1HNZL 1PYSB 1N32L 1HJPA 4HJ8A 1N33L 5IP7G 2CWPA 2K75A 4GS3A 4HJ5A 2KENA 5IT9c 3CCSA 1VQEA 3GO5A 4HIDA 1E22A 1GO3E 1N36Q 1QUQB 1FVIA 2JQOA 1I50H 2YV5A 2AWOA 2ALYB 4P75A 4JI2L 1I94L 2VUMH 4R4OA 4BXXH 2OWOA 3KF6B 3PV0A 1XMQQ 3CMEA 1WI5A 4IJHA 4AH6A 4UP7A 4RMFA 4APVA 2R7ZH 1VQIA 2YU9H 3S1NH 5J3BA 5C44G 4A3JH 4A3GG 1Q12A 1CKMA 4DV7L 1VQCA 4LFCQ 2PNHA 4AYBE 1G291 4DAMA 1Y1WG 4LFCL 4JI5L 4JOIC 4A75A 1PH3A 1EIYB 2UXCQ 5M5XH 4LFBL 5BR8Q 2BA1A 4GKKL 5DLQE 5IYDG 1EOVA 4A93G 3J80c 2JA8G 3PUZA 2YTYA 4BBRH 5ELNA 4C3JH 5C3EG 3CF5A 4LF4L 1VQFA 3CCVA 1XPRA 4JI0L 1PVOA 4JBMA 4DV6Q 2B3GA 4GN5A 3BU2A 3CP0A 1YHAA 3CCJA 4B3RQ 1PHJA 1IBKL 3BJUA 5JJKA 4QY7A 2XGTA 3W1BA 3OW2A 4BY7H 4KHPQ 2GVAA 1SROA 2VUMG 2ATWA 2B63G 1MJEA 1LTLA 1A8VA 3JC66 3J81c 1VQOA 1PYBA 1YJWA 3I4NH 1NY4A 3RLFA 1Q82C 3CXCA 3J80i 4NPSA 2QEXA 2YTXA 1XNQQ 2R7ZG 1HNWQ 5GQOA 3JAMi 2ZM6L 4GNXB 1NTGA 4A3JG 4JYAL 2Q2TA 4OO1I 2UXDL 1EFWA 1FJGL 1KIXA 1JT8A 3D0FA 1N34Q 1C9OA 1PFSA 4GKJQ 2IHEA 4P74A 3F2BA 3I4OA 4UY8C 3BZCA 2R92H 3E9HA 3HOZH 2IY5B 5GROA 3ICEA 3G6EA 1X3GA 1YJNA 4BBRG 1SRUA 2N8NA 2L15A 4AQYQ 5HGQA 1X65A 1O7IA 2UUAQ 3NBHB 1QVFA 2F4VL 1QUQA 1E3PA 1TWHH 2DUDA 2VZAA 2E2HH 4LF5Q 1IBLQ 1A0IA 3D31A 1RL2A 1NE3A 5FJ8H 4X65Q 4B3SL 4JI7L 1XNRL 4LWCA 1K8AC 4BY7G 1QZHA 2D62A 4K0KQ 3GD7A 3M4QA 4GNXC 5C4JH 3I4NG 1KRSA 1S72A 4LF9Q 1PV4A 3GTMH 3EIVA 3T1YL 1SLJA 1VQBA 1AE3A 3BZKA 1I6HH 1L1OA 1VQDA 4LF7Q 3F2DA 1YZ6A 1B70B 1B7YB 3L2PA 3GTKH 2ZJPA 2AMCB 2HHHL 4LUVA 1PA6A 2ID0A 2R92G 3HOZG 1EQQA 5LMNQ 4DUZL 1GM5A 1TWGH 4DR2L 2Y0SG 1OXUA 2OCEA 1HNXL 2ZJQA 1E1OA 4IJLA 4DAYB 3UE0A 4DV0Q 4ALPA 1TXYA 2JEBI 4DUYQ 1YBYA 4BA2I 2KBNA 4IFDG 3STBC 4JV5Q 4YCVA 1IL2A 3G48A 3S1RH 5E7NA 2MO0A 4H02A 4B3TQ 4JCVE 4JI3L 5FJ8G 4GOPA 4NB3A 3AFPA 2ZTCA 1HZ9A 1VQJA 1IZ6A 5JEAG 1BBUA 5JJLA 1K3RA 1VCIA 4GNXA 1T9HA 4LF8Q 1YHQA 3KOJA 2A19A 2RF4A 1SMXA 1SE8A 2IT1A 4LUZA 3H3VH 1UE1A 2OQ0A 4DV4Q 1W3SA 3ER0A 3HOXG 2VL6A 2VQEL 4DR3Q 1PH2A 3PGZA 2JE6I 4NXNL 2UXBL 4A3KG 2D0OA 3CW2C 4JI4Q 4JC0A 5FLMH 3NELA 4JBKA 1UE5A 4JI8Q 4BA1I 3TS2A 2E5LL 4X66Q 3CMAA 3A74A 1YIJA 1P8LA 1J5EQ 4X64L 5IY0A 4HJ7A 4A3EG 1OXVA 4NXMQ 4GLVB 3KJOA 2JA5H 2MQHA 1GD7A 3HKSA 4IFDJ 1N36L 4DV1Q 1DGSA 4DV5Q 3CCQA 2JA7H 1WCMH 1A63A 3PUYA 4DR6Q 4DNIA 4DR7Q 1XMQL 5C0XI 3CAMA 1RIPA 3HKZG 2ZTEA 5JEAJ 1Z47A 4A3MH 1S40A 4IOAA 2RCNA 1YJ9A 2NZOA 1XMOL 1VQ5A 3HOWH 2UXCL 3S15H 2K14A 1L1OB 5BR8L 3CPFA 4LF6Q 2Z6KC 1WOCA 1JB7A 3UDXA 3HOVH 3K0XA 4R4IA 2IX0A 1Q8KA 2WP8J 3UE1A 2PI2E 2VQFL 1HNZQ 5FLMG 1N32Q 2VNUD 2N3SA 3A5ZB 1B8AA 1YITA 2R7FA 1V1QA 4DV6L 1CKNB 3AFQA 3L7ZC 3J7ZC 4B3RL 3PUVA 3RLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQR A;  2JA5 G;  3DM3 A;  3E0E A;  2WFW A;  3K8A A;  4A3C H;  1UE6 A;  2JA7 G;  2Q2I A;  4KHP L;  3MEF A;  1LM0 A;  4L5T A;  1X6O A;  4BXX G;  5ELO A;  4POF A;  3OTO Q;  1PH4 A;  1XNQ L;  3NEM A;  4GOP B;  2LXK A;  4A3F H;  1HNW L;  4DV7 Q;  1L1O C;  3STB D;  4HIK A;  1AH9 A;  1NMF A;  4YWK A;  4IOC A;  1VQG A;  4JI5 Q;  2ZTD A;  1Z9F A;  2C35 B;  2EIF A;  3UDF A;  5HY6 A;  1FGU A;  1HR0 L;  1HH2 P;  1K9M C;  4JI6 Q;  2ASB A;  4B3M Q;  3HOW G;  1VQK A;  4LFB Q;  2DGY A;  1OXX K;  2H5X A;  1X56 A;  2UUB Q;  3H15 A;  3CCU A;  2UUC Q;  3M4O H;  4OXP A;  3HOV G;  2Z6K A;  2OTL A;  4LF4 Q;  3ULP A;  2K5N A;  4JI0 Q;  1U0L A;  2OTJ A;  1HZA A;  4AQY L;  2CQO A;  1VQN A;  3KLW A;  3AQQ A;  3J7A 5;  4YWL A;  3WWV A;  2UUA L;  1HZC A;  4JI1 Q;  1E1T A;  3TQY A;  3U50 C;  3EBE A;  4DK3 C;  3J81 i;  4DV2 Q;  1IBK Q;  4DR4 Q;  3GTJ H;  3ZJY C;  4LF5 L;  4DR5 L;  1IBL L;  2NVQ H;  4X65 L;  2D0P A;  4DV3 L;  5C4X H;  4A3C G;  2R93 H;  2BA0 A;  4GOP C;  3AEV A;  4K0K L;  1KC8 C;  1PH1 A;  4YHH Q;  1KAW A;  3PO3 H;  2PI2 A;  2VY3 A;  3PIO A;  2N49 A;  4DR1 L;  1VQP A;  1X3F A;  4A3B H;  3CQZ H;  4ME3 A;  3SGI A;  3NEN A;  3S14 H;  4JYA Q;  4A3F G;  1PH7 A;  2UXD Q;  4A3D H;  2CKZ B;  1KHI A;  1FJG Q;  4GLA C;  2WB1 G;  4LF7 L;  1PH9 A;  4LW1 A;  4A76 A;  4A3E H;  3FKI H;  3B6Y A;  2ZJR A;  3FP9 A;  4X6A H;  4KI0 A;  2HT1 A;  1KL9 A;  2BH2 A;  3F1Z A;  3CD6 A;  2K5V A;  1IBM Q;  3GTQ H;  5JJI A;  4GN4 B;  5LMN L;  3RZO H;  1WJJ A;  5LMU Q;  2IHF A;  1P16 A;  1YVC A;  2Y0S E;  3S24 A;  2KHJ A;  2QGQ A;  5IYB H;  4IO9 A;  2Z0S A;  4DV0 L;  1UWV A;  1CKN A;  4JV5 L;  4IPH A;  5IWA Q;  2MNA A;  2HIV A;  2RHQ B;  2V1C C;  1LYL A;  1I5F A;  1VQ6 A;  4B3S Q;  4QQB X;  4B3T L;  2JA9 A;  3VDY A;  4WJ3 M;  1G51 A;  4OO1 G;  3PSI A;  2UU9 Q;  1HR0 W;  1OXS C;  2R93 G;  1U5K A;  1NMG A;  3PO3 G;  2R7D A;  2Q2U A;  4BBS H;  3I56 A;  4LF8 L;  1FL0 A;  2A1A A;  3LGJ A;  4A3B G;  4A3D G;  2JJQ A;  2BH8 A;  3T1H Q;  3CCR A;  4C3H H;  1S3O A;  2EXD A;  2PQA A;  3A0J A;  3F8T A;  3FKI G;  2I5M X;  3M9B A;  4DR3 L;  5IYC H;  3GTG H;  4XIG S;  4OWW B;  2VS1 A;  3GTO H;  4MNO A;  4DR2 Q;  3I7F A;  1Y14 B;  3CCM A;  3Q8D A;  2Q2H A;  1C0A A;  2CCZ A;  2K4K A;  4KLK A;  4PZ7 A;  4JI4 L;  2KHI A;  1UE7 A;  2CWA A;  5IYB G;  3IRB A;  4JI8 L;  1MIU A;  4OX9 Q;  4X66 L;  5K36 G;  5AJ3 Q;  2WAQ G;  5EAY A;  4GLX A;  1J5E L;  1TWF H;  2CFM A;  1VQ8 A;  3M3Y H;  1SR3 A;  4NXM L;  1Q86 C;  3ULJ A;  4P71 A;  4HJ9 A;  4QIW E;  5M5Y H;  1WYD A;  1HZB A;  3RNU A;  1VQM A;  1EUJ A;  4P73 A;  3PUW A;  4DV1 L;  3KFU A;  3W1G A;  4DV5 L;  3M7N A;  3HFZ B;  1CSP A;  4R4T A;  4R4C A;  2LXJ A;  1ASZ A;  1JJ2 A;  3S2D H;  5M3F H;  4DR6 L;  4BBS G;  2AHO B;  1VQH A;  2QA4 A;  1N9W A;  4A3G H;  3HKZ E;  2JEA I;  2EQS A;  4DPG A;  4PG3 A;  4LFA Q;  3I55 A;  1Y1W H;  4HIO A;  3L0O A;  2VQE Q;  1Q7Y C;  5IE8 A;  3ULL A;  1QVC A;  1VQ4 A;  1QVG A;  4LNQ A;  5IYC G;  2KCM A;  1CSQ A;  4OWT B;  4DKA C;  2NVX H;  1PH6 A;  3KDF B;  4UP8 A;  4LF6 L;  4TVA B;  3KJP A;  4YY3 Q;  1ASY A;  3HOY H;  3PIP A;  2N78 A;  2HIX A;  3M85 A;  2E5L Q;  4Y7N H;  4X62 Q;  1GKH A;  4X64 Q;  3U58 A;  1MJC A;  1MKH A;  1OTC A;  1N33 Q;  4GKJ L;  2A8V A;  3EN2 A;  3PCO B;  3CC2 A;  3RN2 A;  3E9I A;  3PF5 A;  1L0W A;  2B63 H;  2LSS A;  1K8G A;  4FDB A;  1Y1V H;  3S1Q H;  4JI2 Q;  1IYJ B;  5M3F G;  1I94 Q;  3MXN B;  3OTO L;  1WCM G;  2NZH A;  2NN6 I;  4POG A;  2K52 A;  2MFI A;  4J15 A;  2K50 A;  3UDI A;  3S1M H;  3S16 H;  2YTV A;  2XTI A;  1XMO Q;  1YEZ A;  2HQL A;  4A3M G;  4JI6 L;  2VW9 A;  1VQ9 A;  2NVT H;  3U4V A;  4AYB G;  4B3M L;  4BY1 H;  1N34 L;  2UUB L;  2UUC L;  5M5W H;  4A3I H;  4PMW A;  2VQF Q;  3TEH B;  3HOY G;  4GKK Q;  2PQA B;  3CC7 A;  3JAM c;  3TRE A;  3GTP H;  4R4Q A;  3CCE A;  2R6G A;  4L5Q A;  3UDG A;  5M3M H;  2JA6 H;  2E2J H;  3TRZ A;  1SFO H;  1KRT A;  1KD1 C;  1J6Q A;  2RHS B;  4RG1 A;  3F2C A;  4UPA A;  4JI1 L;  4HIM A;  3KF8 B;  1EWI A;  4KHZ A;  3RR5 A;  4DV2 L;  3GTL H;  4DR4 L;  5C0X G;  2NVY H;  4MTN A;  4JBJ A;  1K0R A;  4YCW A;  2I5L X;  5H1S E;  1AE2 A;  1VQL A;  1Y1V G;  1Q46 A;  4YHH L;  4WJ4 A;  4IFD I;  4Y52 H;  3S17 H;  4C2M H;  1SN8 A;  2AKW B;  3CCL A;  1BVS A;  4LF9 L;  2I5H A;  4IPC A;  4AIM A;  2WB1 E;  4R1J A;  1BBW A;  3H0G H;  2ZM6 Q;  1HR0 Q;  1L2F A;  1OXT A;  4JBW A;  4QJF A;  3KDF A;  1R9T H;  1XJV A;  4JOI A;  3G71 A;  4QL5 A;  4BY1 G;  1IBM L;  2JK8 A;  5FLX c;  1JJG A;  1N8R C;  5IP9 H;  5LMU L;  4A3I G;  1EYG A;  1D7Q A;  1X3E A;  1NBW A;  1Q1B A;  2JA6 G;  5M3M G;  2FXQ A;  1YI2 A;  3GDE A;  4PZ8 A;  1PH5 A;  1H95 A;  4L5S A;  2NN6 G;  5IWA L;  3W5O A;  1CKO A;  4DUY L;  4DR5 Q;  4DK6 C;  3TS0 A;  1VS0 A;  3KF6 A;  2F3I A;  1X54 A;  4DV3 Q;  2F4V Q;  2KCT A;  3CPW A;  3PO2 H;  1A62 A;  4EQ5 A;  2UU9 L;  2K5H A;  1IXR A;  4JI7 Q;  5C0X J;  3I2Z A;  3KYH C;  4DR1 Q;  1XNR Q;  1X55 A;  5GAG C;  4A3L H;  5C4X G;  3I4M H;  4A4I A;  1VQ7 A;  4UP9 A;  3CC4 A;  3S2H H;  3T1H L;  1TWA H;  4O2D A;  1E7Z A;  3T1Y Q;  4IPG A;  4O0A A;  3HOX H;  3H0G G;  1JE5 A;  3K7A H;  4OWX B;  1WFQ A;  2HHH Q;  4A3K H;  3HOU H;  3FHW A;  2YYZ A;  4DV4 L;  1VQA A;  1JMC A;  2OQK A;  5IP9 G;  4DUZ Q;  1K73 C;  4LUO A;  1YNX A;  4JG2 A;  4PZ6 A;  3RLN A;  3K81 C;  1HNX Q;  3PUX A;  4OX9 L;  4YWM A;  3H3V I;  1XPU A;  4XTC S;  4P72 A;  5GAD C;  5AJ3 L;  1EIF A;  2E8G A;  2WAQ E;  1NJI C;  2B29 A;  1Q1E A;  1TWC H;  5IP7 H;  4GN3 B;  1XPO A;  1LUZ A;  4IPD A;  1JJC B;  1BKB A;  3RN5 A;  1PH8 A;  3PO2 G;  3K80 C;  3K7U C;  1C7Y A;  3J81 j;  1K83 H;  1D8L A;  4OON A;  4JI3 Q;  2F52 A;  1KQS A;  1M1K C;  3M4P A;  1I3Q H;  4YCU A;  2GVB A;  3G4S A;  1QZG A;  1UEB A;  4MZ9 A;  1Q81 C;  2E2I H;  3I4M G;  4A3L G;  1CUK A;  3PF4 A;  4C3I H;  2ES2 A;  2PMZ E;  5GAH C;  4DR7 L;  5LMN W;  1X9N A;  4LFA L;  5GAE C;  5C44 H;  1YHB A;  3AYH B;  2I0Q A;  1V43 A;  4QGU A;  1GVP A;  1E24 A;  2AWN A;  1XTD A;  3ERS X;  3HOU G;  4TQU S;  2IX1 A;  3OYY A;  4YY3 L;  4HJA A;  3A5U A;  2MO1 A;  4L5R C;  1M90 C;  4NXN Q;  2UXB Q;  1KXL A;  5IYD H;  1G6P A;  4A93 H;  4EX5 A;  2JA8 H;  3U4Z A;  4X62 L;  5C3E H;  2GN5 A;  3RZD H;  1W2B A;  1V9P A;  3DLL A;  1HNZ L;  1PYS B;  1N32 L;  1HJP A;  4HJ8 A;  1N33 L;  5IP7 G;  2CWP A;  2K75 A;  4GS3 A;  4HJ5 A;  2KEN A;  5IT9 c;  3CCS A;  1VQE A;  3GO5 A;  4HID A;  1E22 A;  1GO3 E;  1N36 Q;  1QUQ B;  1FVI A;  2JQO A;  1I50 H;  2YV5 A;  2AWO A;  2ALY B;  4P75 A;  4JI2 L;  1I94 L;  2VUM H;  4R4O A;  4BXX H;  2OWO A;  3KF6 B;  3PV0 A;  1XMQ Q;  3CME A;  1WI5 A;  4IJH A;  4AH6 A;  4UP7 A;  4RMF A;  4APV A;  2R7Z H;  1VQI A;  2YU9 H;  3S1N H;  5J3B A;  5C44 G;  4A3J H;  4A3G G;  1Q12 A;  1CKM A;  4DV7 L;  1VQC A;  4LFC Q;  2PNH A;  4AYB E;  1G29 1;  4DAM A;  1Y1W G;  4LFC L;  4JI5 L;  4JOI C;  4A75 A;  1PH3 A;  1EIY B;  2UXC Q;  5M5X H;  4LFB L;  5BR8 Q;  2BA1 A;  4GKK L;  5DLQ E;  5IYD G;  1EOV A;  4A93 G;  3J80 c;  2JA8 G;  3PUZ A;  2YTY A;  4BBR H;  5ELN A;  4C3J H;  5C3E G;  3CF5 A;  4LF4 L;  1VQF A;  3CCV A;  1XPR A;  4JI0 L;  1PVO A;  4JBM A;  4DV6 Q;  2B3G A;  4GN5 A;  3BU2 A;  3CP0 A;  1YHA A;  3CCJ A;  4B3R Q;  1PHJ A;  1IBK L;  3BJU A;  5JJK A;  4QY7 A;  2XGT A;  3W1B A;  3OW2 A;  4BY7 H;  4KHP Q;  2GVA A;  1SRO A;  2VUM G;  2ATW A;  2B63 G;  1MJE A;  1LTL A;  1A8V A;  3JC6 6;  3J81 c;  1VQO A;  1PYB A;  1YJW A;  3I4N H;  1NY4 A;  3RLF A;  1Q82 C;  3CXC A;  3J80 i;  4NPS A;  2QEX A;  2YTX A;  1XNQ Q;  2R7Z G;  1HNW Q;  5GQO A;  3JAM i;  2ZM6 L;  4GNX B;  1NTG A;  4A3J G;  4JYA L;  2Q2T A;  4OO1 I;  2UXD L;  1EFW A;  1FJG L;  1KIX A;  1JT8 A;  3D0F A;  1N34 Q;  1C9O A;  1PFS A;  4GKJ Q;  2IHE A;  4P74 A;  3F2B A;  3I4O A;  4UY8 C;  3BZC A;  2R92 H;  3E9H A;  3HOZ H;  2IY5 B;  5GRO A;  3ICE A;  3G6E A;  1X3G A;  1YJN A;  4BBR G;  1SRU A;  2N8N A;  2L15 A;  4AQY Q;  5HGQ A;  1X65 A;  1O7I A;  2UUA Q;  3NBH B;  1QVF A;  2F4V L;  1QUQ A;  1E3P A;  1TWH H;  2DUD A;  2VZA A;  2E2H H;  4LF5 Q;  1IBL Q;  1A0I A;  3D31 A;  1RL2 A;  1NE3 A;  5FJ8 H;  4X65 Q;  4B3S L;  4JI7 L;  1XNR L;  4LWC A;  1K8A C;  4BY7 G;  1QZH A;  2D62 A;  4K0K Q;  3GD7 A;  3M4Q A;  4GNX C;  5C4J H;  3I4N G;  1KRS A;  1S72 A;  4LF9 Q;  1PV4 A;  3GTM H;  3EIV A;  3T1Y L;  1SLJ A;  1VQB A;  1AE3 A;  3BZK A;  1I6H H;  1L1O A;  1VQD A;  4LF7 Q;  3F2D A;  1YZ6 A;  1B70 B;  1B7Y B;  3L2P A;  3GTK H;  2ZJP A;  2AMC B;  2HHH L;  4LUV A;  1PA6 A;  2ID0 A;  2R92 G;  3HOZ G;  1EQQ A;  5LMN Q;  4DUZ L;  1GM5 A;  1TWG H;  4DR2 L;  2Y0S G;  1OXU A;  2OCE A;  1HNX L;  2ZJQ A;  1E1O A;  4IJL A;  4DAY B;  3UE0 A;  4DV0 Q;  4ALP A;  1TXY A;  2JEB I;  4DUY Q;  1YBY A;  4BA2 I;  2KBN A;  4IFD G;  3STB C;  4JV5 Q;  4YCV A;  1IL2 A;  3G48 A;  3S1R H;  5E7N A;  2MO0 A;  4H02 A;  4B3T Q;  4JCV E;  4JI3 L;  5FJ8 G;  4GOP A;  4NB3 A;  3AFP A;  2ZTC A;  1HZ9 A;  1VQJ A;  1IZ6 A;  5JEA G;  1BBU A;  5JJL A;  1K3R A;  1VCI A;  4GNX A;  1T9H A;  4LF8 Q;  1YHQ A;  3KOJ A;  2A19 A;  2RF4 A;  1SMX A;  1SE8 A;  2IT1 A;  4LUZ A;  3H3V H;  1UE1 A;  2OQ0 A;  4DV4 Q;  1W3S A;  3ER0 A;  3HOX G;  2VL6 A;  2VQE L;  4DR3 Q;  1PH2 A;  3PGZ A;  2JE6 I;  4NXN L;  2UXB L;  4A3K G;  2D0O A;  3CW2 C;  4JI4 Q;  4JC0 A;  5FLM H;  3NEL A;  4JBK A;  1UE5 A;  4JI8 Q;  4BA1 I;  3TS2 A;  2E5L L;  4X66 Q;  3CMA A;  3A74 A;  1YIJ A;  1P8L A;  1J5E Q;  4X64 L;  5IY0 A;  4HJ7 A;  4A3E G;  1OXV A;  4NXM Q;  4GLV B;  3KJO A;  2JA5 H;  2MQH A;  1GD7 A;  3HKS A;  4IFD J;  1N36 L;  4DV1 Q;  1DGS A;  4DV5 Q;  3CCQ A;  2JA7 H;  1WCM H;  1A63 A;  3PUY A;  4DR6 Q;  4DNI A;  4DR7 Q;  1XMQ L;  5C0X I;  3CAM A;  1RIP A;  3HKZ G;  2ZTE A;  5JEA J;  1Z47 A;  4A3M H;  1S40 A;  4IOA A;  2RCN A;  1YJ9 A;  2NZO A;  1XMO L;  1VQ5 A;  3HOW H;  2UXC L;  3S15 H;  2K14 A;  1L1O B;  5BR8 L;  3CPF A;  4LF6 Q;  2Z6K C;  1WOC A;  1JB7 A;  3UDX A;  3HOV H;  3K0X A;  4R4I A;  2IX0 A;  1Q8K A;  2WP8 J;  3UE1 A;  2PI2 E;  2VQF L;  1HNZ Q;  5FLM G;  1N32 Q;  2VNU D;  2N3S A;  3A5Z B;  1B8A A;  1YIT A;  2R7F A;  1V1Q A;  4DV6 L;  1CKN B;  3AFQ A;  3L7Z C;  3J7Z C;  4B3R L;  3PUV A;  3RLO A; 
#chains in the Genus database with same CATH topology
 5IGG A;  5I9O A;  3OW7 A;  3K8A A;  1UE6 A;  3MEF A;  1S5D D;  4L5T A;  1JOQ A;  1WD0 A;  5ELO A;  3OTO Q;  5C3X A;  4DV7 Q;  1A2U A;  1L1O C;  4HIK A;  1AH9 A;  1H9S B;  1NUC A;  1NMF A;  2JSO A;  1BCP C;  2JA6 B;  4JI6 Q;  4H44 C;  4IUP A;  4UDU C;  1T5E A;  2ASB A;  4LFB Q;  1SNQ A;  3GTL B;  1C4Q A;  1QG7 A;  5D14 A;  4CJ1 B;  1XYI A;  4HR7 B;  4OXP A;  2RQX A;  1U0L A;  3SDZ A;  2NBF A;  3VA5 A;  3KLW A;  3J7A 5;  1O78 A;  4YWL A;  1SYF A;  2RDF A;  3S17 B;  4XT3 B;  2D0P A;  2K33 A;  1GXD C;  3H0G B;  2EYP A;  2BA0 A;  2L55 A;  4YHH Q;  1S5B D;  1KTK A;  4DR1 L;  3PIO A;  2SOB A;  3S14 H;  2UXD Q;  1PH7 A;  2CKZ B;  1KHI A;  1FJG Q;  5EBD A;  4IUR A;  4A76 A;  2KEE A;  4ODG A;  3FKI H;  3B6Y A;  2ZJR A;  3V2T A;  1KL9 A;  3GTQ H;  1IBM Q;  1ILP A;  5JJI A;  1SE4 A;  3BDC A;  1WJJ A;  1EY9 A;  1P16 A;  1YVC A;  2Y0S E;  3S24 A;  2XRS D;  2QGQ A;  4IO9 A;  4DXF A;  5K36 H;  1RTO A;  3X3N A;  3RD4 A;  3PIP 3;  4IPH A;  2MNA A;  2RHQ B;  2EZV A;  2BDO A;  3VDY A;  3VYT A;  4OO1 G;  1OXS C;  1STN A;  2DY8 A;  1NMG A;  2EY1 A;  4BBS H;  3I56 A;  5JVG 3;  4LF8 L;  1VDZ A;  2WKC A;  3TN2 A;  2BH8 A;  2R3Z A;  5F2D A;  2PQA A;  1ILQ A;  3M9B A;  1XWE A;  3J80 L;  1TWC B;  1Y69 U;  1RJT A;  3I7F A;  1KDC A;  3JAM L;  1C0A A;  2EY5 A;  1SBB B;  2Q2H A;  4R9W A;  2CCZ A;  4PZ7 A;  2RKS A;  2CWA A;  3GV6 A;  3X3M A;  5IYB G;  1A3U A;  2E74 C;  5AJ3 Q;  2WAQ G;  5CV5 A;  1F9S A;  3IFD A;  2M2L A;  3M3Y H;  1SR3 A;  3FPP A;  2D9U A;  3RNU A;  3M7G A;  5I4D A;  4DV1 L;  2QDL A;  5C44 B;  4R4T A;  1CSP A;  4OGQ C;  2JN4 A;  1JJ2 A;  1F2Y A;  2QA4 A;  2E76 C;  1D1I A;  1PFM A;  4PG3 A;  4CDF C;  2PZW A;  3C1E A;  3L0O A;  1Q7Y C;  5IE8 A;  4LNQ A;  3EVQ A;  4QUC A;  3NWS A;  4DKA C;  3C2P A;  3QJY A;  3KDF B;  4TVA B;  2HCC A;  3PIP A;  2HIX A;  3M85 A;  4TKO B;  4Y7N H;  4X62 Q;  2IPK D;  1PLF A;  1SNM A;  3U58 A;  1LTG D;  4YIJ A;  5EPK A;  3CC2 A;  1BBX C;  1M8A A;  1STG A;  2B63 H;  3BVG A;  3S1N B;  4FDB A;  1Y1V H;  1A2T A;  2LY7 A;  5M3F G;  1WCM G;  5M5X B;  4J15 A;  2K50 A;  1UEA B;  1XMO Q;  4RCN A;  2O5J C;  3NSW A;  2VW9 A;  1XXG A;  3U4V A;  4AYB G;  1D2B A;  3SEB A;  3TZD A;  2HQE A;  4KKS A;  2VQF Q;  3WOE A;  2WIN B;  5D3D A;  2XRQ D;  2JA6 H;  2EYJ A;  3J80 E;  1D5M C;  3EJI A;  1KLU D;  4RG1 A;  4XYO A;  3JAM E;  2EJG C;  3DEO A;  3QOL A;  4JI1 L;  4DR4 L;  1EWI A;  3GTL H;  3I4N B;  4XYQ A;  4MTN A;  4JBJ A;  1ZEQ X;  3NPP A;  1K0R A;  1TS5 A;  1Q46 A;  4IFD I;  4Y52 H;  3S17 H;  3EA6 A;  5CV9 A;  4LF9 L;  5JAV A;  4IPC A;  2JXM B;  3G7L A;  3BYT B;  3H0G H;  1L2F A;  1OXT A;  4JBW A;  4JOI A;  3D4R A;  1DOM A;  1FNV A;  4V19 0;  5FLX c;  1EYG A;  1TVX A;  1NBW A;  1TWH B;  5M3M G;  1B53 A;  1YI2 A;  1LT4 D;  1O80 A;  1H95 A;  1QJO A;  5IWA L;  3TS0 A;  1Z6H A;  4DN4 M;  1L0Y B;  5JEA H;  2UU9 L;  2K5H A;  5C0X J;  4DR1 Q;  4A3L H;  5C4X G;  4UP9 A;  3CC4 A;  4Z9C B;  4FYD A;  4QF4 A;  1RD9 D;  4OIJ A;  4O2D A;  4IPG A;  2CH4 W;  4ZKB B;  1HA5 A;  5EKL A;  3BYY B;  4DV4 L;  1ROD A;  2DNE A;  3D6C A;  1K73 C;  5E3F A;  3H3V I;  5A2Q E;  4XTC S;  5GAD C;  1K8M A;  2WAQ E;  1CK1 A;  1TWC H;  5L37 A;  5BN4 A;  4IUN A;  2HCI A;  3PO2 G;  3VR4 A;  4OON A;  3M4P A;  5CC4 A;  3IAY A;  1PZK D;  3J81 L;  2N55 A;  3I4M G;  1PYW D;  4C3I H;  5GAH C;  5ELD A;  5LMN W;  1IW7 C;  4HCS A;  4E6I A;  1JOO A;  5C44 H;  3ERO A;  4DK0 A;  3HOU G;  2AWN A;  1XTD A;  1ENA A;  2PZT A;  4YY3 L;  4HJA A;  3C3L A;  2MO1 A;  3NTI A;  4NXN Q;  5D3I B;  2UXB Q;  2K03 A;  2JA5 B;  3U4Z A;  2GN5 A;  5C5M A;  1V9P A;  4UAI A;  4HJ8 A;  1N33 L;  2CWP A;  2K75 A;  1JQY D;  5IT9 c;  1DON A;  4A3M B;  4FF1 A;  1QUQ B;  2L9H A;  2JQO A;  1I50 H;  4JI2 L;  1ESF A;  1PMR A;  4XT1 B;  1XX8 A;  2XSC A;  3S15 B;  3CME A;  1VQI A;  2F0Q A;  2CW0 D;  3S1N H;  1B2T A;  1CKM A;  4KY5 A;  1GHJ A;  1VQC A;  3OWF A;  4AYB E;  4JI5 L;  3SE0 A;  2UXC Q;  5M5X H;  5BR8 Q;  2BA1 A;  4GKK L;  3J7A F;  3Q24 A;  2OEO A;  1SNO A;  2JA8 G;  5KNB A;  5IGC A;  2O4X A;  1VQF A;  1XPR A;  2ZXP A;  1SND A;  3D8G A;  2WB1 B;  4QY7 A;  1KLG D;  2VUM G;  4K8I A;  1MJE A;  3I4N H;  1YJW A;  1NY4 A;  3CXC A;  3M4O B;  2A68 C;  4GNX B;  3J81 E;  4A3J G;  1JT8 A;  2B8F A;  4LAA A;  4FXK C;  1C9O A;  1S5C D;  3NQI A;  4F88 A;  4P74 A;  4FVM A;  1H9K A;  3E9H A;  5COR A;  3GTJ B;  2PCF B;  1ZYR C;  3WOF A;  2NVQ B;  1B3Q A;  5IGB A;  2L15 A;  4MIU A;  2R93 B;  4C1N K;  5HGQ A;  2UUA Q;  4JPB W;  1QVF A;  1V8Q A;  2A69 D;  3MAQ A;  3T13 A;  2F4V L;  4A3B B;  1E3P A;  1TWH H;  4OL7 A;  3D31 A;  2IWH A;  4A3D B;  4HED A;  4X65 Q;  1QZH A;  2D62 A;  2D5D A;  4K0K Q;  2O5I C;  4LF9 Q;  1PV4 A;  3EIV A;  3ITP A;  1JWS D;  2EPB A;  5FO9 B;  1YZ6 A;  2AQ1 B;  2B2W A;  2AMC B;  2HHH L;  3K5M A;  2EY2 A;  1KNA A;  1PA6 A;  3K57 A;  3HOZ G;  4U67 3;  5LMN Q;  1QNK A;  3J7Y W;  2ZJQ A;  1E1O A;  5I6W A;  2JEB I;  1KDA A;  2RBM A;  4BA2 I;  4JV5 Q;  3ERQ A;  1G2T A;  3NE5 B;  5KYI A;  2I46 A;  4JI3 L;  5E1F A;  5FJ8 G;  1ML0 D;  5A35 A;  2KA7 A;  4C3H B;  1EFI D;  2FJ2 A;  1PTO C;  3AU7 A;  4NMZ A;  1K3R A;  1VCI A;  4G7O C;  4M8A A;  2A19 A;  2G9H D;  2RF4 A;  1BUV T;  1SE8 A;  1SMX A;  2G9D A;  2IT1 A;  2K6A A;  3H3V H;  1UE1 A;  4DV4 Q;  2LMC B;  4DU9 A;  1SMY D;  4QMG A;  5IIF A;  3L3O C;  5M5Y B;  3VYU A;  4JI4 Q;  1RKN A;  1CHP D;  1BCP F;  1U4R A;  4JI8 Q;  3TS2 A;  5CR3 A;  4X66 Q;  1YIJ A;  1P8L A;  1J5E Q;  4X64 L;  4NXM Q;  1OXV A;  4GLV B;  2JA5 H;  4F87 A;  1KAB A;  1N36 L;  2VB3 X;  3FPU B;  4HMJ A;  2DN8 A;  5KRU A;  5C0X I;  5BN3 A;  3HKZ G;  5JEA J;  2A6E D;  4XXE A;  2B8G A;  4A3M H;  2ZXR A;  1S40 A;  1CFM A;  3HRZ C;  2L4N A;  1O7Y A;  3EFX D;  1B1Z A;  1QB5 D;  3S15 H;  1II3 A;  1F2L A;  4B9X A;  4LF6 Q;  4M1U B;  2Z6K C;  1WOC A;  5I9P A;  4ZYS A;  5HUR A;  5CBA E;  2WP8 J;  5FLM G;  2N3S A;  1HFG A;  2M00 A;  1V1Q A;  1B9N A;  1CKN B;  2F0K A;  4HIO A;  3J7Z C;  4B3R L;  3PUV A;  2WKD A;  5EKI A;  1EQR A;  3HG9 A;  2WFW A;  4A3C H;  2Q2I A;  2X6G A;  2F0S A;  4BXX G;  2IL8 A;  1V1P B;  4GOP B;  1XNQ L;  1HNW L;  1FYC A;  3MZ5 A;  3AB9 A;  4IOC A;  1SE2 A;  1CM9 A;  1VQG A;  2ZTD A;  1Z9F A;  4JI5 Q;  1FGU A;  1HH2 P;  3A8J E;  1ET6 A;  1OXX K;  2H5X A;  2UUC Q;  1EZ8 A;  4CBV A;  3M4O H;  2AQ3 B;  2Z6K A;  2OTL A;  3NBI A;  3N52 A;  2CQO A;  3TQY A;  3U50 C;  3GTJ H;  3PQI A;  1CA6 A;  4DR5 L;  1CZW A;  1IBL L;  2NVQ H;  2AQ2 B;  2XWB B;  2R93 H;  3AEV A;  2IJ0 A;  1R9T B;  2N49 A;  4K5X A;  4A3B H;  4ME3 A;  3SGI A;  3NEN A;  4HMI A;  4A3D H;  4GLA C;  4LF7 L;  1C8C A;  3F2U A;  4KI0 A;  4Q5V A;  4GN4 B;  1IYU A;  4PMC A;  4DV0 L;  1UWV A;  5IT9 L;  3BG3 A;  1BO0 A;  4HAE A;  1LYL A;  4QQB X;  4UHV A;  4B3T L;  2QIL A;  3BS1 A;  4WJ3 M;  1G51 A;  3PSI A;  3HOX B;  1LT5 D;  1U5K A;  1W6J A;  4H7B A;  2R7D A;  1FL0 A;  3LGJ A;  4K6D A;  1JE4 A;  4C3H H;  2EXD A;  3FKI G;  2F0M A;  3A0J A;  4DR3 L;  4DNR B;  4XIG S;  2VS1 A;  1D1K A;  2KHS A;  2F0D A;  1Y14 B;  1F9R A;  3Q8D A;  3M4Y A;  3CCM A;  2ICI A;  1DXM A;  2RVL A;  2DY7 A;  1MIU A;  4OX9 Q;  5K36 G;  5CV4 A;  1I3Q B;  5EAY A;  3TP7 A;  2E2I B;  2Z8L A;  4P71 A;  4HJ9 A;  4QIW E;  4KY7 A;  1WYD A;  1HZB A;  4EQN A;  5M5Y H;  1VQM A;  1EUJ A;  3PUW A;  3KFU A;  3W1G A;  1ASZ A;  4DR6 L;  4BBS G;  3VYR A;  1RHP A;  2KJX A;  4DXG A;  1N9W A;  2ZT9 C;  3HKZ E;  4A3G H;  3N6R A;  1JWM D;  3I55 A;  1CA5 A;  2K01 A;  4DNT B;  4Y7N B;  1SAP A;  4LJZ C;  4UP8 A;  1IKM A;  5DM6 3;  3HS0 C;  5FO8 B;  2G5D A;  2L12 A;  4X64 Q;  2QCP X;  1LV9 A;  1BOS A;  1WVL A;  1MJC A;  1MKH A;  2B63 B;  2A8V A;  3EN2 A;  5IT9 E;  3Q0A A;  3E9I A;  2R7Z B;  1DOL A;  1L0W A;  2F0U A;  1K8G A;  2Z1C A;  1PFN A;  1IYJ B;  1I94 Q;  3MXN B;  3J7A V;  1PRT C;  1ICW A;  2F0E A;  2WII B;  2K52 A;  4X3U A;  3S16 H;  2XTI A;  4C3J B;  1WTH A;  4B3M L;  1LTS D;  1N34 L;  2RSO A;  2UUB L;  1STE A;  3TEH B;  3CC7 A;  3GTP H;  4R4Q A;  2BE5 C;  2R6G A;  4L5Q A;  5CV7 A;  3UDG A;  3TRZ A;  2RHS B;  2NN6 H;  1H9M A;  3RUZ A;  3KF8 B;  4DV2 L;  4K2K A;  3SK6 A;  4YCW A;  1X3P A;  1AE2 A;  1Y1V G;  3TME A;  3T51 B;  1GUT A;  4R1J A;  1BBW A;  2ZM6 Q;  4QJF A;  4IUQ A;  1EEI D;  1BQQ T;  1R9T H;  1AFP A;  2L1B A;  1HXY D;  3G71 A;  2JP1 A;  2HUG A;  5IP9 H;  5LMU L;  2FMM A;  1X3E A;  1MGS A;  1Q1B A;  2Z9H A;  2JA6 G;  3R2I A;  4PZ8 A;  3E0J A;  2EE1 A;  4DA2 A;  2EJF C;  1CKO A;  3A8K E;  5C4J B;  4DR5 Q;  1WTW A;  1VS0 A;  1KNE A;  3TZU A;  4EQ5 A;  1I6H B;  1TY2 A;  2KUM A;  1IXR A;  4JI7 Q;  2Q8R E;  3KYH C;  1K0S A;  1G91 A;  1SYG A;  4G7Z C;  3T1H L;  3T1Y Q;  1S5F D;  5AFW A;  4JK1 C;  3HOX H;  3H0G G;  1D5X C;  1JE5 A;  1NR4 A;  4ZK9 B;  1SYD A;  3DWP A;  1EY6 A;  4A3K H;  1VQA A;  1JMC A;  3S1R B;  4PZ6 A;  5CGK A;  3FRP B;  1IKL A;  1EIF A;  2E8G A;  1F2Z A;  3DWA A;  4RAU C;  2F1M A;  1PH8 A;  4CKC A;  1NAP A;  4C3I B;  2WAC A;  1C7Y A;  3J81 j;  2F52 A;  1M1K C;  1I3Q H;  1R4Q B;  2GVB A;  3G4S A;  4A3L G;  2E2I H;  2JYO A;  3NUC A;  3MHB A;  4I7Z C;  4LFA L;  3CRK C;  3KK7 A;  5KGU A;  1EWH A;  4C1N I;  3AYH B;  1V43 A;  4QGU A;  1SYC A;  2IX1 A;  3OYY A;  2FIN B;  3I8Z A;  1KXL A;  5IYD H;  1G6P A;  4EX5 A;  2JA7 B;  4DF7 A;  1WCM B;  1SJH D;  1I50 B;  4GS3 A;  5BN5 A;  1UNS A;  5EGT A;  2RA4 A;  1GUO A;  2YV5 A;  1T5X D;  1ZXT A;  2AWO A;  1ENC A;  1AZQ A;  3HOW B;  1XMQ Q;  2BOS A;  2Z6B A;  4UP7 A;  2R7Z H;  5ELC A;  1ICF B;  3HOV B;  5C44 G;  1CQF A;  3MVV A;  1SYE A;  1J8I A;  1G29 1;  1Y1W G;  4JOI C;  4A75 A;  1PH3 A;  5T1I A;  5A2Q L;  1TQO A;  5E4X A;  4C3J H;  4QUF A;  4JI0 L;  2PO4 A;  5JPM C;  1TS4 A;  5JOB A;  5I6Y A;  4K5W A;  2B3G A;  5EJW A;  1B9M A;  1YHA A;  3CCJ A;  4A3F B;  3BJU A;  1B4O A;  5JJK A;  5DM7 3;  3OW2 A;  2GVA A;  1SRO A;  4KKT A;  2ATW A;  1DD2 A;  1I4H A;  3G6J B;  1LTL A;  1A8V A;  2FMC A;  1VQO A;  3J80 i;  2YTX A;  1K28 A;  5GQO A;  3JAM i;  1NTG A;  4JYA L;  3I3C A;  1N34 Q;  4ID6 A;  1JB3 A;  2RDG A;  1PTO F;  2IHE A;  3F2B A;  5DAU A;  3BZC A;  1MBY A;  2WV6 D;  1LTT D;  3ZYY X;  2N8N A;  2DJG C;  3L9A X;  1IW7 D;  3PO3 B;  2L11 A;  3NBH B;  3FMC A;  4RGO S;  4WFN 3;  1JCK B;  2DUD A;  3CQZ B;  1A0I A;  1SNC A;  4B3S L;  1XNR L;  1ONL A;  4A3E B;  5TSS A;  2J7Z A;  3HGB A;  5C4J H;  1HCZ A;  3I4N G;  2C9O A;  1S72 A;  3DWQ A;  1JWU D;  1AE3 A;  3BZK A;  1I6H H;  3U9S A;  2KCN A;  1B70 B;  4KTA A;  2ZJP A;  1TII D;  1OO9 B;  2EDG A;  2XN9 C;  4LUV A;  3DM1 A;  3MEH A;  5ELF A;  1WTP A;  1AEX A;  1FR3 A;  4DUZ L;  1EQQ A;  1OXU A;  2OCE A;  1HNX L;  3K6O A;  3UE0 A;  2F0N A;  4ALP A;  1TXY A;  4IFD G;  3STB C;  4KJN A;  2SDF A;  3G48 A;  2PMZ B;  3S1R H;  1EY0 A;  2MO0 A;  4JCV E;  4ZKC B;  1AN8 A;  1Q3L A;  1STH A;  1V1P A;  5E4W C;  5KNC A;  4GOP A;  1ET9 A;  1VQJ A;  3GTG B;  5JJL A;  3K59 A;  4PMB A;  4LF8 Q;  1LAC A;  1YHQ A;  3KOJ A;  4LUZ A;  4IAL A;  2OQ0 A;  1QCB D;  1W3S A;  2VQE L;  2JE6 I;  1TWF B;  1H9J A;  3CW2 C;  2VB2 X;  3PMF A;  1WTQ A;  4JBK A;  3NEL A;  4DAP A;  2E5L L;  4IUV A;  3CMA A;  3S2D B;  1GUN A;  2A68 D;  3E5S A;  2F0J A;  3OMG A;  3Q23 A;  1GD7 A;  4DV1 Q;  2CHB D;  3CCQ A;  2JA7 H;  1WCM H;  1A63 A;  3QB3 A;  2IW3 A;  1ZYR D;  2NVX B;  1TS3 A;  2AUK A;  1RIP A;  3HOY B;  4IOA A;  1GUW A;  1YJ9 A;  1VQ5 A;  3HOW H;  2PYK A;  2K14 A;  1L1O B;  3CPF A;  1BCP B;  4DAY A;  1WTR A;  2ENB A;  3K0X A;  4R4I A;  2IX0 A;  3HOV H;  1JOR A;  3A56 A;  5I2Y A;  2R7F A;  4DV6 L;  3L7Z C;  2B2U A;  3RLO A;  1F9Q A;  4TRD A;  2JA5 G;  3S1M B;  1G2S A;  3E0E A;  4KHP L;  4HTH A;  4ZUI A;  2NVT B;  4BY1 B;  4POF A;  1G8Z D;  4A3I B;  1YNN C;  4A3F H;  2LXK A;  3KBG A;  3LWU A;  3V96 A;  2E2J B;  2C35 B;  2EIF A;  3UDF A;  1HR0 L;  2B2W C;  1TKW B;  1VQK A;  1U9R A;  1UAP A;  3H09 A;  1M4V A;  4NW2 A;  3CCU A;  4HSP A;  2K5N A;  1PTO D;  4JI0 Q;  2OTJ A;  1HZA A;  2A6H D;  4AQY L;  3AQQ A;  4RHR A;  5FOB B;  1KDB A;  3WWV A;  1HZC A;  4JI1 Q;  3J81 i;  4DR4 Q;  4DK3 C;  3Q22 A;  4LF5 L;  1CT1 D;  3R93 A;  1GUG A;  4DV3 L;  5C4X H;  4A3C G;  1DZ1 A;  1KC8 C;  1PH1 A;  3PO3 H;  1X3F A;  3O13 A;  2K28 A;  3CQZ H;  4NKL A;  4JYA Q;  2WB1 G;  3WDN A;  2IX3 A;  4LW1 A;  4A3E H;  2CQA A;  5JJZ A;  2HT1 A;  3F1Z A;  2K5V A;  1SEB D;  3MFY A;  3KLR A;  3RZO H;  2IHF A;  4LK1 C;  2R61 A;  2NTT A;  4B08 A;  4L8J A;  1C48 A;  4G57 A;  5LL6 X;  5IWA Q;  2V1C C;  1I5F A;  1VQ6 A;  4B3S Q;  1Z7T A;  3S2H B;  1TWA B;  2JA9 A;  3OOC A;  2UU9 Q;  1HR0 W;  2R93 G;  4P2C B;  4A3B G;  1ESR A;  4DAV A;  1H9S A;  4A3D G;  1S3O A;  3F8T A;  1RF2 D;  1HTL D;  3GTG H;  3VR2 A;  3QWN A;  5IYC H;  4OWW B;  1K8O A;  1TR5 A;  1PRT F;  4MNO A;  3I90 A;  4XDX A;  3TP8 A;  3SK8 A;  3T53 B;  1FNU A;  1A3T A;  4IQZ A;  3A7A B;  3R8B A;  4KD4 A;  4GLX A;  1TWF H;  1VQ8 A;  2OT2 A;  1Q86 C;  3ULJ A;  4OIK A;  1I6V C;  3GV3 A;  4P73 A;  2A73 B;  4DV5 L;  3M7N A;  3HFZ B;  4A3G B;  4R4C A;  2F0L A;  3S2D H;  1MSG A;  2F0O A;  4RA8 A;  4WOR A;  5C4H A;  1H9R A;  4ZLT F;  3GP7 A;  4A93 B;  5CMD A;  5C3E B;  2VQE Q;  3RZD B;  1QVC A;  1VQ4 A;  1STY A;  3NK9 A;  1I4P A;  2KCM A;  1CSQ A;  5FLX L;  2NVX H;  4KMU C;  4YY3 Q;  1ASY A;  3HOY H;  1EZ6 A;  2N78 A;  4HCE A;  2H1E A;  2XIW A;  2MP1 A;  2E5L Q;  1JIC A;  1LLR D;  4X3T A;  3I4L A;  5G3L F;  3MA2 B;  1OTC A;  1N33 Q;  4GKJ L;  3PCO B;  1IL8 A;  2LSS A;  2EYM A;  4JI2 Q;  3S16 B;  1FD7 D;  2ICE C;  1JOK A;  3OTO L;  2NZH A;  5EKK A;  2NN6 I;  1EYD A;  3A7L A;  3ONA B;  2MFI A;  1TU2 B;  3UDI A;  2CH4 A;  1WTV A;  1WD1 A;  4POG A;  3S1M H;  2K5Q A;  4BBR B;  1YEZ A;  3P1H A;  4JI6 L;  1VQ9 A;  3GTP B;  2NVT H;  3ND9 A;  4BY1 H;  5DEH A;  4A3I H;  1PDQ A;  5IOD A;  4GKK Q;  2XWJ B;  3JAM c;  2KEC A;  2E2J H;  3MXG A;  1SFO H;  1EU3 A;  1KRT A;  1J6Q A;  1BXT A;  1KD1 C;  2B39 A;  4BY7 B;  4UPA A;  1EY8 A;  4KHZ A;  3RR5 A;  3H91 A;  2K7V A;  5C0X G;  2MJ8 A;  1EYC A;  1AZP A;  3KLS A;  2OF1 A;  3BVM A;  4YHH L;  3KUP A;  3DUZ A;  1SN8 A;  5EPJ A;  3FVQ A;  2R92 B;  3CCL A;  1BVS A;  2MHV A;  3CKI B;  5ELB A;  4AIM A;  2WB1 E;  2Y0S B;  3I70 A;  1HR0 Q;  1HRJ A;  5K5P A;  3KDF A;  5KIX A;  5J1Z A;  4QL5 A;  3V05 A;  1IBM L;  2JK8 A;  1JJG A;  1N8R C;  1D7Q A;  4MN3 A;  4JVZ A;  2E2H B;  4KKU A;  2FXQ A;  5FLX E;  3GDE A;  1EQT A;  1PH5 A;  2E2D C;  4IN3 A;  4L5S A;  2NN6 G;  3W5O A;  5C3W A;  1Q8I A;  4DUY L;  1YNJ C;  1F9P A;  1Y8N B;  4DV3 Q;  2F3I A;  1X54 A;  2F4V Q;  3GTM B;  2KCT A;  3FEW X;  3P20 A;  1A62 A;  1X55 A;  4OEL B;  1QNU A;  3A55 A;  3S2H H;  4WRD A;  1TWA H;  4A3K B;  3NHH A;  1MD2 D;  4CDD C;  1SE3 A;  2HHH Q;  2NUC A;  2OQK A;  5IP9 G;  2MPM A;  5JPN C;  1VMP A;  4JG2 A;  3RLN A;  3K81 C;  3PUX A;  4YWM A;  1PRT D;  4P72 A;  5AJ3 L;  4N9T A;  1NJI C;  1E2Z A;  2B29 A;  1Q1E A;  5IP7 H;  3QIA A;  4GN3 B;  4IPD A;  3RN5 A;  2A5H A;  2K5W A;  3K7U C;  5KEE A;  1BCP D;  4JI3 Q;  1CTM A;  1KQS A;  1LTB D;  1A15 A;  4YCU A;  1UEB A;  2BCO A;  3K5O A;  3FDT A;  1CUK A;  2ES2 A;  2BE5 D;  1F77 A;  1X9N A;  1YHB A;  2QW7 A;  1WTX A;  2I0Q A;  2B2T C;  1R4P B;  2RSN A;  1E24 A;  1EY5 A;  2F4I A;  3ERS X;  1HFN A;  4C56 C;  2EYO A;  4L5R C;  1M90 C;  4CJ0 B;  4A93 H;  4RH6 A;  5CV8 A;  4X62 L;  5C3E H;  3RZD H;  3S9W A;  4IUT A;  1HNZ L;  1PYS B;  1N32 L;  1HJP A;  3TDQ A;  1GUS A;  1JC7 A;  2CVR A;  2KVM A;  4V0B A;  2KEN A;  3CCS A;  3H3V C;  5CYU A;  4HID A;  1E22 A;  1GO3 E;  1N36 Q;  1FVI A;  1NNX A;  3I72 A;  5LL6 S;  4G7H C;  4NDX A;  4BXX H;  1CZG A;  2PNR C;  4EGV A;  3KF6 B;  3PV0 A;  4AH6 A;  5J3B A;  4FF4 A;  1Q12 A;  2KQ3 A;  2DNC A;  2PNH A;  4DAM A;  2B2T A;  4LFC L;  3CRL C;  1EIY B;  3DEP A;  4ME5 A;  5IYD G;  4DK1 A;  3PUZ A;  4RGN A;  4BBR H;  5ELN A;  1HQM C;  3CF5 A;  4LF4 L;  2E75 C;  5HGT A;  3CCV A;  5J39 A;  1PVO A;  2F03 A;  4GN5 A;  3BU2 A;  3CP0 A;  3QG1 A;  1HUN A;  1X3Q A;  4B3R Q;  4EVO A;  1PHJ A;  1IBK L;  1A6X A;  2J4X A;  2XGT A;  4BY7 H;  2Q8I B;  5FKA C;  2QDB A;  3KLS X;  2B63 G;  3JC6 6;  3J81 c;  1PYB A;  3URY A;  1EY7 A;  1Q82 C;  3RLF A;  2NB0 A;  4KV6 A;  2QEX A;  1XNQ Q;  2R7Z G;  1HNW Q;  4OO1 I;  1KIX A;  2FHT A;  3D0F A;  1PFS A;  2XVS A;  3T16 A;  2EYL A;  1PFB A;  2R92 H;  3OHX C;  3A8I E;  2IY5 B;  5GRO A;  3T56 B;  3ICE A;  3G6E A;  2VXW A;  2F0V A;  1X3G A;  3MWY W;  4C3J G;  1SRU A;  2B2Y A;  1BR9 A;  1HPC A;  2F0G A;  3GQB A;  1O7I A;  1GJX A;  1QUQ A;  2VZA A;  2E2H H;  4OHJ A;  3H6M A;  1IBL Q;  3UI2 A;  4FXD A;  1RL2 A;  1NE3 A;  3RMH A;  4LWC A;  1K8A C;  3GD7 A;  3LNN A;  3M4Q A;  4GNX C;  2PW5 A;  2K1B A;  4L6T B;  4RCO A;  3GTM H;  1SLJ A;  4N8F A;  1L1O A;  1LTA D;  1PTO B;  1KAA A;  4LF7 Q;  1B7Y B;  3L2P A;  2WAQ B;  2SEB D;  1O7Z A;  2ID0 A;  2KED A;  1F2M A;  2DJF C;  4DR2 L;  2EOT A;  4DV0 Q;  4DUY Q;  1YBY A;  3MXP A;  3OSO A;  2KBN A;  1DJR D;  2HD3 A;  2TSS A;  4MTK A;  4YCV A;  1RTN A;  3IL8 A;  5E7N A;  3KBX A;  4F8M A;  2X69 A;  4H02 A;  3IKJ A;  4B3T Q;  1EY4 A;  5CBE E;  1CQV A;  2ZTC A;  4PV1 C;  1HZ9 A;  3LWE A;  5COY A;  5JEA G;  3GTO B;  1A3V A;  1MHW C;  1T9H A;  2V4D A;  4GNX A;  2F3V A;  4IUU A;  1W6K A;  3MTS A;  4CDE C;  1PH2 A;  3BVZ A;  4ULL A;  3ER0 A;  3OIQ A;  2VL6 A;  1K3B C;  2HDL A;  4DR3 Q;  3PGZ A;  3OIP A;  4NXN L;  3VYS A;  2UXB L;  1UE5 A;  2C5C A;  5EBC A;  1TT2 A;  4R8N A;  4BA1 I;  4CJ2 C;  1SSO A;  4XQJ A;  5M3F B;  4ZAI A;  3P75 A;  1O7L A;  3KJO A;  3C1F A;  2MQH A;  3HKS A;  1DGS A;  1U4M A;  1Y1W B;  4AYB B;  4DR6 Q;  4DNI A;  4HSV A;  2H4O A;  3NQT A;  3CAM A;  4CGY B;  2ZTE A;  1Z47 A;  4C3I G;  4ABN A;  2RCN A;  2EJM A;  2UXC L;  1S5E D;  5BR8 L;  1LAB A;  1JB7 A;  3UDX A;  3UE1 A;  1HNZ Q;  1N32 Q;  1Q8K A;  2VNU D;  3NP8 A;  3A5Z B;  1B8A A;  1YIT A;  1EIH A;  1U4L A;  5C5L A;  3S1Q B;  2M9V A;  1DM0 B;  5ISR A;  4LMQ D;  3DM3 A;  1WTO A;  2JA7 G;  1LM0 A;  1X6O A;  1PH4 A;  5M5W B;  3NEM A;  1LTR D;  3STB D;  3K5L A;  4YWK A;  5M3M B;  4LFC Q;  4O1N A;  5HY6 A;  2F0I A;  1NR2 A;  1SYB A;  1K9M C;  3HOW G;  4B3M Q;  2NTS A;  3D3R A;  2DGY A;  4RHS A;  2LKV A;  1X56 A;  2UUB Q;  3H15 A;  2NVY B;  5CV6 A;  4RGT A;  3HOV G;  3OMC A;  4LF4 Q;  3ULP A;  2NYZ D;  1VQN A;  4RGM A;  3QO2 A;  2UUA L;  5C4X B;  1E1T A;  4C2M B;  3EBE A;  4DV2 Q;  1IBK Q;  3ZJY C;  3HEJ A;  1STA A;  2L0C A;  1J9O A;  4X65 L;  1EEF D;  3A54 A;  4OO1 H;  2MUY A;  1I4R A;  4KD3 A;  4GOP C;  4K0K L;  1KAW A;  2KCC A;  2PI2 A;  2VY3 A;  1VQP A;  2LS0 1;  4A3F G;  1PZI D;  1PH9 A;  3RZO B;  5T1G A;  4K5V A;  4MHE A;  3FP9 A;  4X6A H;  1B3A A;  1SJE D;  3BDO A;  3CD6 A;  2BH2 A;  2MGS A;  5LMN L;  1XTC D;  5LMU Q;  1PTO H;  3PO2 B;  2KHJ A;  5IYB H;  5JVH 3;  2Z0S A;  1CKN A;  3DXJ C;  5DNF A;  4JV5 L;  3I4M B;  1G6Z A;  2HIV A;  2PPB C;  4F7X A;  2PZU A;  4NP5 A;  2EVB A;  3K7A B;  3PO3 G;  2Q2U A;  3HOU B;  1MSH A;  3SXH A;  2A1A A;  5D65 A;  4CHT B;  2JJQ A;  3T1H Q;  3CCR A;  2EY6 A;  3D6W A;  4A3E G;  5EPL A;  2J0T D;  2I5M X;  4K2L A;  3GTO H;  4B9W A;  4DR2 Q;  3NWT A;  1L0X B;  1QWY A;  2K4K A;  3H94 A;  4KLK A;  5IGE A;  2KHI A;  1UE7 A;  3DHQ A;  4JI4 L;  1D5Z C;  1HA6 A;  1QE6 A;  3IRB A;  4JI8 L;  1K83 B;  5KND A;  4X66 L;  2Z4H A;  1YNN D;  2RDH A;  1J5E L;  2CFM A;  2PW7 A;  2EYF A;  3R2T A;  4NXM L;  2F0H A;  3NTK A;  3SVM A;  2B2U C;  1B50 A;  3D4D A;  2LXJ A;  3R3O A;  5M3F H;  1VQH A;  2AHO B;  2TMP A;  2JEA I;  2EQS A;  4DPG A;  4LFA Q;  3MFG A;  1Y1W H;  3SHL A;  1PXU A;  2JA8 B;  1PRT B;  4KY6 A;  2K05 A;  3ULL A;  1QVG A;  5IYC G;  4OWT B;  1PH6 A;  3K0Y A;  4LF6 L;  2PQE A;  3KJP A;  4QB4 A;  2P5Z X;  3IFT A;  4ILW A;  5NUC A;  1GKH A;  3CHB D;  5KYL A;  2VUM B;  4ZRZ A;  3VA7 A;  3RN2 A;  3PF5 A;  2YU9 B;  4A3J B;  3LX0 A;  3S1Q H;  5M9O A;  4XQQ A;  3NTH A;  1BDO A;  1STB A;  2F0W A;  1BF4 A;  2YTV A;  1D6E C;  2HQL A;  4A3M G;  3P7J A;  4Q0F A;  1SFO B;  5M5W H;  2UUC L;  4PMW A;  3HOY G;  2SNM A;  2PQA B;  2QKI C;  3TRE A;  3CCE A;  1HUM A;  5M3M H;  1MI2 A;  5IOC A;  1I4Q A;  4U68 A;  3F2C A;  1EYA A;  1VF7 A;  1GOZ A;  2D2C C;  5C6A A;  4G4K A;  4HIM A;  4X3S A;  4X3K A;  2NVY H;  4H13 C;  4EQO A;  3E3X A;  2I5L X;  5H1S E;  1DYQ A;  1VQL A;  4WJ4 A;  3E6Z X;  3D4W A;  4C2M H;  1FGB D;  4FF2 A;  2AKW B;  4J6H A;  3HOZ B;  4RKB A;  1RCV D;  1Y8P B;  2I5H A;  4TSS A;  4R8I A;  2Z4I A;  1S4Z A;  3QOJ A;  4BS9 A;  1XJV A;  3Q6S A;  4BY1 G;  4CKE A;  3AMU A;  1TS2 A;  1ZKO A;  4A3I G;  1E2V A;  1Q90 A;  5C4Z A;  4IFD H;  3SK5 A;  1EL0 A;  2CW0 C;  4JW0 A;  1IYV A;  4DK6 C;  2AUJ D;  1EQV A;  3KF6 A;  1DCZ A;  3PO2 H;  3CPW A;  3MXN A;  3I2Z A;  1XNR Q;  3GTK B;  3TBI B;  2EXZ A;  5GAG C;  1LT3 D;  3I4M H;  2I07 B;  4A4I A;  1VQ7 A;  1E7Z A;  1TWG B;  4O0A A;  1EU4 A;  1TY0 A;  3DMU A;  5ELE A;  1EWC A;  3K7A H;  4OWX B;  1WFQ A;  3OPO A;  3HOU H;  3FHW A;  2YYZ A;  4FO2 A;  4EQP A;  4DUZ Q;  4O42 A;  4QIW B;  4LUO A;  4KN4 C;  1YNX A;  3K58 A;  1AP0 A;  1HNX Q;  4ZCK A;  4OX9 L;  3KF8 A;  1XPU A;  1U4P A;  3ND8 A;  4BWG B;  2HDM A;  5J22 A;  1XPO A;  4PNY A;  1LUZ A;  1JJC B;  1BKB A;  4FP5 D;  3HKZ B;  3K80 C;  1K83 H;  1D8L A;  4I7A A;  2OXP A;  3SK4 A;  1QZG A;  2A6H C;  4MZ9 A;  1Q81 C;  3EQL C;  3PF4 A;  2PMZ E;  4DR7 L;  1ENF A;  5GAE C;  2A69 C;  4KJO A;  3CU7 A;  1HTP A;  1IHZ A;  1GVP A;  1LTI D;  4C3H G;  4TQU S;  4WJW A;  1E2W A;  1PZJ D;  3TSS A;  4DGZ A;  3A5U A;  2JA8 H;  4HN7 A;  1W2B A;  3SR1 A;  3DLL A;  3I73 A;  5IGF A;  3HZX A;  2F0T A;  2F3W A;  4KHV A;  4IZ8 A;  5IP7 G;  4HJ5 A;  1CI3 M;  2RCF A;  2X6L A;  1VQE A;  1LO5 D;  2FFK B;  1RDP D;  3GO5 A;  1QOH A;  4I65 A;  3HP3 A;  4P75 A;  2ALY B;  2VUM H;  1I94 L;  4J1M A;  4R4O A;  2OWO A;  4K8J A;  1WI5 A;  4IJH A;  4APV A;  4RMF A;  2YU9 H;  4A3J H;  4A3G G;  5FK9 C;  4DV7 L;  1YNJ D;  3MXU A;  4LFB L;  5DLQ E;  3QR8 A;  1EOV A;  4A93 G;  3J80 c;  2YTY A;  4L63 B;  5C3E G;  4JBM A;  1E0B A;  2QF7 A;  4DV6 Q;  3TP5 A;  3I91 A;  1SNP A;  1SMY C;  1Y8O B;  4DFA A;  2QEJ C;  1AW7 A;  3W1B A;  4KHP Q;  3T4A C;  4RWS C;  4H0L C;  5FO7 B;  4N8X 1;  2F0P A;  2EYH A;  2F0F A;  4NPS A;  2ZM6 L;  2UXD L;  2Q2T A;  1EIG A;  5IGD A;  3VR6 A;  1EFW A;  1FJG L;  1FNW A;  3I4O A;  4UY8 C;  3HOZ H;  1EOT A;  1YJN A;  4BBR G;  2BDN A;  2GA4 B;  3TP6 A;  3MC0 B;  2A6E C;  2B2V C;  4AQY Q;  1NCV A;  1X65 A;  2KOL A;  3S14 B;  3W3A A;  4LF5 Q;  2K32 A;  5FJ8 H;  4JI7 L;  2L5T A;  4ZQ3 A;  4BY7 G;  3FKI B;  1HQR D;  3GTQ B;  1KRS A;  3T1Y L;  1VQB A;  4K6L A;  1VQD A;  4PQX A;  3F2D A;  3VR5 A;  5I2X A;  4CDC C;  3GTK H;  1HHV A;  2N88 A;  2R92 G;  4KK7 A;  1SXT A;  4XQN A;  3C46 A;  1GM5 A;  1GHK A;  1TWG H;  3BDL A;  2Y0S G;  1UUP A;  1QIL A;  4IJL A;  4CKB A;  4DAY B;  5LHY 1;  2B2V A;  4FXG C;  3U9O A;  4BBS B;  1IL2 A;  1LT6 D;  3K5N A;  4NB3 A;  3AFP A;  2SNS A;  2K5D A;  1IZ6 A;  1X32 A;  1BBU A;  4ZUJ A;  1JR0 D;  2NZ1 D;  2NWG A;  4N9P A;  1V1O A;  1I4G A;  3VR3 A;  3NXW A;  4KN7 C;  3HOX G;  3M3Y B;  4QCL A;  1VF5 C;  4A3K G;  2D0O A;  4JC0 A;  5FLM H;  3OWE B;  3BZD B;  3NBH A;  3A74 A;  3W2D A;  1VMC A;  2A74 C;  5IY0 A;  4HJ7 A;  4IFD J;  4FF3 A;  4GZY C;  4RFB A;  4DV5 Q;  5G3L D;  3PUY A;  4DR7 Q;  2O2L D;  1XMQ L;  4RKL A;  1DOK A;  2LFN A;  4K14 A;  1SDF A;  5EQ0 A;  4J8Q A;  3PIO 3;  1BNZ A;  4FNF A;  2NZO A;  4S3S A;  1XMO L;  4OEM B;  1CHQ D;  2ZXO A;  1B44 D;  2VQF L;  2PI2 E;  2XNA C;  2Q8T A;  2B2Y C;  1Y1V B;  5C0X H;  1I4X A;  2K04 A;  3AFQ A;  4GKJ Q;  1NSN S; 
#chains in the Genus database with same CATH homology
 1EQR A;  2JA5 G;  3DM3 A;  3E0E A;  2WFW A;  3K8A A;  4A3C H;  1UE6 A;  2JA7 G;  2Q2I A;  4KHP L;  3MEF A;  1LM0 A;  4L5T A;  1X6O A;  4BXX G;  5ELO A;  4POF A;  3OTO Q;  1PH4 A;  1XNQ L;  3NEM A;  4GOP B;  2LXK A;  4A3F H;  1HNW L;  4DV7 Q;  1L1O C;  3STB D;  4HIK A;  1AH9 A;  1NMF A;  4YWK A;  4IOC A;  1VQG A;  4JI5 Q;  2ZTD A;  1Z9F A;  2C35 B;  2EIF A;  3UDF A;  5HY6 A;  1FGU A;  1HR0 L;  1HH2 P;  1K9M C;  4JI6 Q;  2ASB A;  4B3M Q;  3HOW G;  1VQK A;  4LFB Q;  2DGY A;  1OXX K;  2H5X A;  1X56 A;  2UUB Q;  3H15 A;  3CCU A;  2UUC Q;  3M4O H;  4OXP A;  3HOV G;  2Z6K A;  2OTL A;  4LF4 Q;  3ULP A;  2K5N A;  4JI0 Q;  1U0L A;  2OTJ A;  1HZA A;  4AQY L;  2CQO A;  1VQN A;  3KLW A;  3AQQ A;  3J7A 5;  4YWL A;  3WWV A;  2UUA L;  1HZC A;  4JI1 Q;  1E1T A;  3TQY A;  3U50 C;  3EBE A;  4DK3 C;  3J81 i;  4DV2 Q;  1IBK Q;  4DR4 Q;  3GTJ H;  3ZJY C;  4LF5 L;  4DR5 L;  1IBL L;  2NVQ H;  4X65 L;  2D0P A;  4DV3 L;  5C4X H;  4A3C G;  2R93 H;  2BA0 A;  4GOP C;  3AEV A;  4K0K L;  1KC8 C;  1PH1 A;  4YHH Q;  1KAW A;  3PO3 H;  2PI2 A;  2VY3 A;  3PIO A;  2N49 A;  4DR1 L;  1VQP A;  1X3F A;  4A3B H;  3CQZ H;  4ME3 A;  3SGI A;  3NEN A;  3S14 H;  4JYA Q;  4A3F G;  1PH7 A;  2UXD Q;  4A3D H;  2CKZ B;  1KHI A;  1FJG Q;  4GLA C;  2WB1 G;  4LF7 L;  1PH9 A;  4LW1 A;  4A76 A;  4A3E H;  3FKI H;  3B6Y A;  2ZJR A;  3FP9 A;  4X6A H;  4KI0 A;  2HT1 A;  1KL9 A;  2BH2 A;  3F1Z A;  3CD6 A;  2K5V A;  1IBM Q;  3GTQ H;  5JJI A;  4GN4 B;  5LMN L;  3RZO H;  1WJJ A;  5LMU Q;  2IHF A;  1P16 A;  1YVC A;  2Y0S E;  3S24 A;  2KHJ A;  2QGQ A;  5IYB H;  4IO9 A;  2Z0S A;  4DV0 L;  1UWV A;  1CKN A;  4JV5 L;  4IPH A;  5IWA Q;  2MNA A;  2HIV A;  2RHQ B;  2V1C C;  1LYL A;  1I5F A;  1VQ6 A;  4B3S Q;  4QQB X;  4B3T L;  2JA9 A;  3VDY A;  4WJ3 M;  1G51 A;  4OO1 G;  3PSI A;  2UU9 Q;  1HR0 W;  1OXS C;  2R93 G;  1U5K A;  1NMG A;  3PO3 G;  2R7D A;  2Q2U A;  4BBS H;  3I56 A;  4LF8 L;  1FL0 A;  2A1A A;  3LGJ A;  4A3B G;  4A3D G;  2JJQ A;  2BH8 A;  3T1H Q;  3CCR A;  4C3H H;  1S3O A;  2EXD A;  2PQA A;  3A0J A;  3F8T A;  3FKI G;  2I5M X;  3M9B A;  4DR3 L;  5IYC H;  3GTG H;  4XIG S;  4OWW B;  2VS1 A;  3GTO H;  4MNO A;  4DR2 Q;  3I7F A;  1Y14 B;  3CCM A;  3Q8D A;  2Q2H A;  1C0A A;  2CCZ A;  2K4K A;  4KLK A;  4PZ7 A;  4JI4 L;  2KHI A;  1UE7 A;  2CWA A;  5IYB G;  3IRB A;  4JI8 L;  1MIU A;  4OX9 Q;  4X66 L;  5K36 G;  5AJ3 Q;  2WAQ G;  5EAY A;  4GLX A;  1J5E L;  1TWF H;  2CFM A;  1VQ8 A;  3M3Y H;  1SR3 A;  4NXM L;  1Q86 C;  3ULJ A;  4P71 A;  4HJ9 A;  4QIW E;  5M5Y H;  1WYD A;  1HZB A;  3RNU A;  1VQM A;  1EUJ A;  4P73 A;  3PUW A;  4DV1 L;  3KFU A;  3W1G A;  4DV5 L;  3M7N A;  3HFZ B;  1CSP A;  4R4T A;  4R4C A;  2LXJ A;  1ASZ A;  1JJ2 A;  3S2D H;  5M3F H;  4DR6 L;  4BBS G;  2AHO B;  1VQH A;  2QA4 A;  1N9W A;  4A3G H;  3HKZ E;  2JEA I;  2EQS A;  4DPG A;  4PG3 A;  4LFA Q;  3I55 A;  1Y1W H;  4HIO A;  3L0O A;  2VQE Q;  1Q7Y C;  5IE8 A;  3ULL A;  1QVC A;  1VQ4 A;  1QVG A;  4LNQ A;  5IYC G;  2KCM A;  1CSQ A;  4OWT B;  4DKA C;  2NVX H;  1PH6 A;  3KDF B;  4UP8 A;  4LF6 L;  4TVA B;  3KJP A;  4YY3 Q;  1ASY A;  3HOY H;  3PIP A;  2N78 A;  2HIX A;  3M85 A;  2E5L Q;  4Y7N H;  4X62 Q;  1GKH A;  4X64 Q;  3U58 A;  1MJC A;  1MKH A;  1OTC A;  1N33 Q;  4GKJ L;  2A8V A;  3EN2 A;  3PCO B;  3CC2 A;  3RN2 A;  3E9I A;  3PF5 A;  1L0W A;  2B63 H;  2LSS A;  1K8G A;  4FDB A;  1Y1V H;  3S1Q H;  4JI2 Q;  1IYJ B;  5M3F G;  1I94 Q;  3MXN B;  3OTO L;  1WCM G;  2NZH A;  2NN6 I;  4POG A;  2K52 A;  2MFI A;  4J15 A;  2K50 A;  3UDI A;  3S1M H;  3S16 H;  2YTV A;  2XTI A;  1XMO Q;  1YEZ A;  2HQL A;  4A3M G;  4JI6 L;  2VW9 A;  1VQ9 A;  2NVT H;  3U4V A;  4AYB G;  4B3M L;  4BY1 H;  1N34 L;  2UUB L;  2UUC L;  5M5W H;  4A3I H;  4PMW A;  2VQF Q;  3TEH B;  3HOY G;  4GKK Q;  2PQA B;  3CC7 A;  3JAM c;  3TRE A;  3GTP H;  4R4Q A;  3CCE A;  2R6G A;  4L5Q A;  3UDG A;  5M3M H;  2JA6 H;  2E2J H;  3TRZ A;  1SFO H;  1KRT A;  1KD1 C;  1J6Q A;  2RHS B;  4RG1 A;  3F2C A;  4UPA A;  4JI1 L;  4HIM A;  3KF8 B;  1EWI A;  4KHZ A;  3RR5 A;  4DV2 L;  3GTL H;  4DR4 L;  5C0X G;  2NVY H;  4MTN A;  4JBJ A;  1K0R A;  4YCW A;  2I5L X;  5H1S E;  1AE2 A;  1VQL A;  1Y1V G;  1Q46 A;  4YHH L;  4WJ4 A;  4IFD I;  4Y52 H;  3S17 H;  4C2M H;  1SN8 A;  2AKW B;  3CCL A;  1BVS A;  4LF9 L;  2I5H A;  4IPC A;  4AIM A;  2WB1 E;  4R1J A;  1BBW A;  3H0G H;  2ZM6 Q;  1HR0 Q;  1L2F A;  1OXT A;  4JBW A;  4QJF A;  3KDF A;  1R9T H;  1XJV A;  4JOI A;  3G71 A;  4QL5 A;  4BY1 G;  1IBM L;  2JK8 A;  5FLX c;  1JJG A;  1N8R C;  5IP9 H;  5LMU L;  4A3I G;  1EYG A;  1D7Q A;  1X3E A;  1NBW A;  1Q1B A;  2JA6 G;  5M3M G;  2FXQ A;  1YI2 A;  3GDE A;  4PZ8 A;  1PH5 A;  1H95 A;  4L5S A;  2NN6 G;  5IWA L;  3W5O A;  1CKO A;  4DUY L;  4DR5 Q;  4DK6 C;  3TS0 A;  1VS0 A;  3KF6 A;  2F3I A;  1X54 A;  4DV3 Q;  2F4V Q;  2KCT A;  3CPW A;  3PO2 H;  1A62 A;  4EQ5 A;  2UU9 L;  2K5H A;  1IXR A;  4JI7 Q;  5C0X J;  3I2Z A;  3KYH C;  4DR1 Q;  1XNR Q;  1X55 A;  5GAG C;  4A3L H;  5C4X G;  3I4M H;  4A4I A;  1VQ7 A;  4UP9 A;  3CC4 A;  3S2H H;  3T1H L;  1TWA H;  4O2D A;  1E7Z A;  3T1Y Q;  4IPG A;  4O0A A;  3HOX H;  3H0G G;  1JE5 A;  3K7A H;  4OWX B;  1WFQ A;  2HHH Q;  4A3K H;  3HOU H;  3FHW A;  2YYZ A;  4DV4 L;  1VQA A;  1JMC A;  2OQK A;  5IP9 G;  4DUZ Q;  1K73 C;  4LUO A;  1YNX A;  4JG2 A;  4PZ6 A;  3RLN A;  3K81 C;  1HNX Q;  3PUX A;  4OX9 L;  4YWM A;  3H3V I;  1XPU A;  4XTC S;  4P72 A;  5GAD C;  5AJ3 L;  1EIF A;  2E8G A;  2WAQ E;  1NJI C;  2B29 A;  1Q1E A;  1TWC H;  5IP7 H;  4GN3 B;  1XPO A;  1LUZ A;  4IPD A;  1JJC B;  1BKB A;  3RN5 A;  1PH8 A;  3PO2 G;  3K80 C;  3K7U C;  1C7Y A;  3J81 j;  1K83 H;  1D8L A;  4OON A;  4JI3 Q;  2F52 A;  1KQS A;  1M1K C;  3M4P A;  1I3Q H;  4YCU A;  2GVB A;  3G4S A;  1QZG A;  1UEB A;  4MZ9 A;  1Q81 C;  2E2I H;  3I4M G;  4A3L G;  1CUK A;  3PF4 A;  4C3I H;  2ES2 A;  2PMZ E;  5GAH C;  4DR7 L;  5LMN W;  1X9N A;  4LFA L;  5GAE C;  5C44 H;  1YHB A;  3AYH B;  2I0Q A;  1V43 A;  4QGU A;  1GVP A;  1E24 A;  2AWN A;  1XTD A;  3ERS X;  3HOU G;  4TQU S;  2IX1 A;  3OYY A;  4YY3 L;  4HJA A;  3A5U A;  2MO1 A;  4L5R C;  1M90 C;  4NXN Q;  2UXB Q;  1KXL A;  5IYD H;  1G6P A;  4A93 H;  4EX5 A;  2JA8 H;  3U4Z A;  4X62 L;  5C3E H;  2GN5 A;  3RZD H;  1W2B A;  1V9P A;  3DLL A;  1HNZ L;  1PYS B;  1N32 L;  1HJP A;  4HJ8 A;  1N33 L;  5IP7 G;  2CWP A;  2K75 A;  4GS3 A;  4HJ5 A;  2KEN A;  5IT9 c;  3CCS A;  1VQE A;  3GO5 A;  4HID A;  1E22 A;  1GO3 E;  1N36 Q;  1QUQ B;  1FVI A;  2JQO A;  1I50 H;  2YV5 A;  2AWO A;  2ALY B;  4P75 A;  4JI2 L;  1I94 L;  2VUM H;  4R4O A;  4BXX H;  2OWO A;  3KF6 B;  3PV0 A;  1XMQ Q;  3CME A;  1WI5 A;  4IJH A;  4AH6 A;  4UP7 A;  4RMF A;  4APV A;  2R7Z H;  1VQI A;  2YU9 H;  3S1N H;  5J3B A;  5C44 G;  4A3J H;  4A3G G;  1Q12 A;  1CKM A;  4DV7 L;  1VQC A;  4LFC Q;  2PNH A;  4AYB E;  1G29 1;  4DAM A;  1Y1W G;  4LFC L;  4JI5 L;  4JOI C;  4A75 A;  1PH3 A;  1EIY B;  2UXC Q;  5M5X H;  4LFB L;  5BR8 Q;  2BA1 A;  4GKK L;  5DLQ E;  5IYD G;  1EOV A;  4A93 G;  3J80 c;  2JA8 G;  3PUZ A;  2YTY A;  4BBR H;  5ELN A;  4C3J H;  5C3E G;  3CF5 A;  4LF4 L;  1VQF A;  3CCV A;  1XPR A;  4JI0 L;  1PVO A;  4JBM A;  4DV6 Q;  2B3G A;  4GN5 A;  3BU2 A;  3CP0 A;  1YHA A;  3CCJ A;  4B3R Q;  1PHJ A;  1IBK L;  3BJU A;  5JJK A;  4QY7 A;  2XGT A;  3W1B A;  3OW2 A;  4BY7 H;  4KHP Q;  2GVA A;  1SRO A;  2VUM G;  2ATW A;  2B63 G;  1MJE A;  1LTL A;  1A8V A;  3JC6 6;  3J81 c;  1VQO A;  1PYB A;  1YJW A;  3I4N H;  1NY4 A;  3RLF A;  1Q82 C;  3CXC A;  3J80 i;  4NPS A;  2QEX A;  2YTX A;  1XNQ Q;  2R7Z G;  1HNW Q;  5GQO A;  3JAM i;  2ZM6 L;  4GNX B;  1NTG A;  4A3J G;  4JYA L;  2Q2T A;  4OO1 I;  2UXD L;  1EFW A;  1FJG L;  1KIX A;  1JT8 A;  3D0F A;  1N34 Q;  1C9O A;  1PFS A;  4GKJ Q;  2IHE A;  4P74 A;  3F2B A;  3I4O A;  4UY8 C;  3BZC A;  2R92 H;  3E9H A;  3HOZ H;  2IY5 B;  5GRO A;  3ICE A;  3G6E A;  1X3G A;  1YJN A;  4BBR G;  1SRU A;  2N8N A;  2L15 A;  4AQY Q;  5HGQ A;  1X65 A;  1O7I A;  2UUA Q;  3NBH B;  1QVF A;  2F4V L;  1QUQ A;  1E3P A;  1TWH H;  2DUD A;  2VZA A;  2E2H H;  4LF5 Q;  1IBL Q;  1A0I A;  3D31 A;  1RL2 A;  1NE3 A;  5FJ8 H;  4X65 Q;  4B3S L;  4JI7 L;  1XNR L;  4LWC A;  1K8A C;  4BY7 G;  1QZH A;  2D62 A;  4K0K Q;  3GD7 A;  3M4Q A;  4GNX C;  5C4J H;  3I4N G;  1KRS A;  1S72 A;  4LF9 Q;  1PV4 A;  3GTM H;  3EIV A;  3T1Y L;  1SLJ A;  1VQB A;  1AE3 A;  3BZK A;  1I6H H;  1L1O A;  1VQD A;  4LF7 Q;  3F2D A;  1YZ6 A;  1B70 B;  1B7Y B;  3L2P A;  3GTK H;  2ZJP A;  2AMC B;  2HHH L;  4LUV A;  1PA6 A;  2ID0 A;  2R92 G;  3HOZ G;  1EQQ A;  5LMN Q;  4DUZ L;  1GM5 A;  1TWG H;  4DR2 L;  2Y0S G;  1OXU A;  2OCE A;  1HNX L;  2ZJQ A;  1E1O A;  4IJL A;  4DAY B;  3UE0 A;  4DV0 Q;  4ALP A;  1TXY A;  2JEB I;  4DUY Q;  1YBY A;  4BA2 I;  2KBN A;  4IFD G;  3STB C;  4JV5 Q;  4YCV A;  1IL2 A;  3G48 A;  3S1R H;  5E7N A;  2MO0 A;  4H02 A;  4B3T Q;  4JCV E;  4JI3 L;  5FJ8 G;  4GOP A;  4NB3 A;  3AFP A;  2ZTC A;  1HZ9 A;  1VQJ A;  1IZ6 A;  5JEA G;  1BBU A;  5JJL A;  1K3R A;  1VCI A;  4GNX A;  1T9H A;  4LF8 Q;  1YHQ A;  3KOJ A;  2A19 A;  2RF4 A;  1SMX A;  1SE8 A;  2IT1 A;  4LUZ A;  3H3V H;  1UE1 A;  2OQ0 A;  4DV4 Q;  1W3S A;  3ER0 A;  3HOX G;  2VL6 A;  2VQE L;  4DR3 Q;  1PH2 A;  3PGZ A;  2JE6 I;  4NXN L;  2UXB L;  4A3K G;  2D0O A;  3CW2 C;  4JI4 Q;  4JC0 A;  5FLM H;  3NEL A;  4JBK A;  1UE5 A;  4JI8 Q;  4BA1 I;  3TS2 A;  2E5L L;  4X66 Q;  3CMA A;  3A74 A;  1YIJ A;  1P8L A;  1J5E Q;  4X64 L;  5IY0 A;  4HJ7 A;  4A3E G;  1OXV A;  4NXM Q;  4GLV B;  3KJO A;  2JA5 H;  2MQH A;  1GD7 A;  3HKS A;  4IFD J;  1N36 L;  4DV1 Q;  1DGS A;  4DV5 Q;  3CCQ A;  2JA7 H;  1WCM H;  1A63 A;  3PUY A;  4DR6 Q;  4DNI A;  4DR7 Q;  1XMQ L;  5C0X I;  3CAM A;  1RIP A;  3HKZ G;  2ZTE A;  5JEA J;  1Z47 A;  4A3M H;  1S40 A;  4IOA A;  2RCN A;  1YJ9 A;  2NZO A;  1XMO L;  1VQ5 A;  3HOW H;  2UXC L;  3S15 H;  2K14 A;  1L1O B;  5BR8 L;  3CPF A;  4LF6 Q;  2Z6K C;  1WOC A;  1JB7 A;  3UDX A;  3HOV H;  3K0X A;  4R4I A;  2IX0 A;  1Q8K A;  2WP8 J;  3UE1 A;  2PI2 E;  2VQF L;  1HNZ Q;  5FLM G;  1N32 Q;  2VNU D;  2N3S A;  3A5Z B;  1B8A A;  1YIT A;  2R7F A;  1V1Q A;  4DV6 L;  1CKN B;  3AFQ A;  3L7Z C;  3J7Z C;  4B3R L;  3PUV A;  3RLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...