4R4OA

Crystal structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamothioyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4oA00
5FJ8H 1G291 2IT1A 4GLAC 4IPGA 4A3EG 1EQQA 1NJIC 4JI8Q 1C7YA 1KHIA 3HFZB 1GKHA 2VS1A 1HNXL 1Q1EA 3S1MH 1UWVA 4LUZA 3PO3H 4BA2I 3GTKH 4DAMA 1N9WA 1V9PA 4NB3A 3OW2A 1BBWA 4OO1G 2K75A 2R6GA 2K5VA 3ERSX 3TS2A 3LGJA 3KFUA 3HOZG 1S40A 1Y14B 1E24A 2E2JH 2R7FA 5M3FH 2YTYA 2WAQE 5HY6A 1IBKL 3PUVA 2BH8A 4A75A 4EX5A 3I2ZA 2ZTCA 1XNRQ 1MKHA 2JK8A 2XTIA 4DUZL 1CSQA 1VQGA 3S17H 3F2BA 4AH6A 4P75A 1I3QH 3HOVG 3CC2A 4BY7G 1A63A 4DAYB 3GTPH 1W3SA 3JC66 4A3KG 1OXSC 3I4NH 1U5KA 2L15A 4YWMA 4IPCA 3ULPA 2V1CC 3M9BA 3D31A 4A3BG 2Z6KC 4A93G 2UXDQ 3HOXH 3I4OA 1VQFA 2OCEA 5C3EG 1YJNA 4LF6L 4MZ9A 1K8GA 2B63G 2WB1E 4LUVA 5LMUQ 2OTJA 4IO9A 2QGQA 4A3DH 4JV5L 3J81c 4JG2A 5FLMG 2KHIA 3EBEA 4C3HH 4NXML 2JA8G 4R4CA 1PA6A 4L5RC 2E8GA 2UXBL 2AWNA 5GADC 2R93G 1MIUA 2OWOA 2WB1G 3KJOA 2RF4A 4JI8L 2B3GA 1SMXA 5IWAQ 1VQ4A 3S1QH 4IFDJ 3J7A5 3CPWA 3GDEA 1D8LA 3E9IA 2D0PA 3H15A 4PZ8A 1VQ9A 2HT1A 4JC0A 4TVAB 4UP7A 4QJFA 1XPRA 4A3IH 3KF6B 1LUZA 2EQSA 4B3TQ 4BBSG 1JMCA 1L1OC 3GD7A 3AYHB 3STBD 5FLXc 4OXPA 2RHQB 3UDXA 4HJ7A 1HJPA 1XNRL 4K0KQ 3U4ZA 4BBRG 3F1ZA 4LWCA 3JAMc 3E0EA 4C3JH 5IP7G 1CKOA 3UDIA 1Y1WH 4A76A 3HOYH 3ER0A 1SRUA 1P16A 1Q12A 3CMAA 1K83H 2WP8J 1JB7A 4IOCA 4HIKA 3I4MG 1H95A 3WWVA 2F4VQ 1X9NA 2UUCQ 3M3YH 5E7NA 4B3RQ 2UXDL 2RHSB 5C44H 3H3VH 3CCVA 3T1YQ 1AE2A 1L1OA 5LMUL 3A5ZB 2CFMA 2E2IH 3ULLA 2MNAA 5H1SE 1NMFA 5GAHC 1X56A 3S15H 1SFOH 4X66Q 1VQAA 1PHJA 1BBUA 3D0FA 5IWAL 3FKIG 4BA1I 1G6PA 2R92G 4OO1I 1E7ZA 2F3IA 2Y0SE 4DV5Q 2QA4A 4YHHQ 1VQJA 1HNXQ 4HJ9A 1X3EA 1Z9FA 4KI0A 1TWFH 2YTXA 4B3TL 1UEBA 2LXKA 3H0GH 4KHZA 4JI3Q 3S14H 4OWWB 2PMZE 2YYZA 3PF4A 3S16H 2VNUD 4AIMA 3A74A 1Q7YC 1JJGA 1UE7A 4L5TA 1VQ6A 4K0KL 3G71A 1VS0A 3A0JA 4IPHA 3GTGH 3L2PA 3PUYA 2OQ0A 1X54A 4A3LG 4BY1H 3CCJA 1YHAA 3UE0A 3PUXA 1QZGA 3TEHB 2UXCL 2FXQA 2F4VL 1Z47A 1PH1A 4IFDI 1GVPA 1NBWA 2UUCL 2VW9A 4DR3Q 3RLNA 3T1YL 4A3MG 1PFSA 2PNHA 3CMEA 1V1QA 4A3EH 4A3FG 4KHPQ 3J80i 1B7YB 1CKNB 4GN4B 3MEFA 4YCWA 4JI1Q 3IRBA 4X66L 4OWXB 1XJVA 1X65A 4NXMQ 2GVAA 4R1JA 2JA7G 3S1NH 1UE6A 1O7IA 2EIFA 2Q2IA 3AQQA 4FDBA 4X62L 5LMNQ 3UE1A 3CD6A 4GOPC 3TQYA 3KF6A 4DV5L 4A3GG 4YHHL 3K7UC 3EN2A 3UDFA 3KDFA 4Y7NH 4ALPA 4JOIC 4JI3L 3CCUA 3RN5A 2MO1A 2NZHA 3K0XA 4BY7H 3CCSA 3CCQA 1DGSA 3HOVH 1CUKA 1N33Q 4DV1Q 3AFQA 1WOCA 4A3KH 1VQOA 3OTOQ 1RL2A 3PCOB 3BU2A 2NVYH 2VUMG 1J5EQ 5BR8Q 4DV7L 2R7DA 4A3BH 4A93H 3U50C 1NMGA 1Q81C 1HR0Q 2OQKA 3FHWA 1KRTA 2K4KA 2K50A 5C3EH 3W1BA 1B70B 4YCVA 4A3JG 1GM5A 5DLQE 5C0XJ 4LF5Q 2MQHA 2PQAB 3PUWA 1CKMA 5FLMH 4JI7Q 4JYAQ 5JEAG 4TQUS 2JA8H 1A62A 4HIOA 4DR3L 3GTMH 2R93H 1KQSA 4JOIA 1KC8C 1I50H 1VQ8A 1X55A 4KHPL 1KXLA 1KD1C 5IYCG 4X64Q 4XTCS 3GTOH 4DKAC 4POGA 2CCZA 1VQHA 4KLKA 4P72A 3J81i 1AE3A 1N32Q 1A8VA 1UE1A 4JI1L 1U0LA 3CCMA 2OTLA 3H3VI 3T1HQ 4GLVB 5GROA 1WYDA 1WFQA 1JT8A 3CAMA 1PYSB 4UP9A 1IZ6A 4P71A 5LMNL 1K9MC 2KBNA 1E22A 5ELOA 4BBSH 4DV3Q 1AH9A 2ASBA 2N8NA 2YU9H 3BZCA 1HZ9A 2LXJA 5C0XI 1Q86C 1K73C 4JI0Q 1VQMA 2JEAI 1JE5A 4O2DA 4YWLA 5C4JH 4MTNA 4BBRH 2KCMA 1HNZQ 3W1GA 5IP7H 3M85A 1Y1VG 2Z6KA 1B8AA 1N33L 4DV1L 4RG1A 3I4MH 3BZKA 2MO0A 4DV2L 1YI2A 4LW1A 4OONA 3OTOL 3FP9A 1I6HH 4YWKA 2IY5B 1J5EL 5BR8L 2ZJPA 3KDFB 1LTLA 4UY8C 3KLWA 4JBJA 1E1TA 3J7ZC 1HR0L 3HKSA 3GTLH 4A4IA 2ID0A 1CSPA 1P8LA 2VL6A 4LF5L 2B29A 2ATWA 3VDYA 3PSIA 2CWAA 1VQ5A 4JI7L 2VZAA 4P74A 4JYAL 2VQFQ 2UXCQ 3CQZH 1VQ7A 3HOWG 4HIDA 1WCMG 1X3FA 1CKNA 3UDGA 1R9TH 3RZDH 4GOPB 1X6OA 2K5HA 3FKIH 1TWGH 4X64L 4A3CG 2JA5G 2Q2HA 2R92H 1M1KC 3PO2G 4IJHA 1N32L 1HZAA 1SR3A 4IJLA 2GVBA 3T1HL 5HGQA 2I5LX 4EQ5A 2YTVA 3I7FA 4R4OA 1IYJB 1SN8A 4QY7A 3KJPA 4DV3L 1VQPA 1HR0W 1J6QA 4X62Q 1VQLA 4JBWA 1S72A 3I56A 4JI0L 5ELNA 3EIVA 2HIXA 2AMCB 3DM3A 1NE3A 1QUQA 1HNZL 3HOUG 2NVQH 1I94Q 2HHHQ 4A3LH 3AFPA 1PH2A 3L0OA 5IYDG 4QQBX 1IXRA 4YCUA 2ZTDA 1VQCA 5GAGC 5GAEC 4QGUA 3S1RH 1EYGA 2PQAA 2KHJA 4POFA 1C9OA 1X3GA 3HKZE 4DV7Q 4A3MH 3CXCA 3RLFA 4DV0L 1XPUA 1QVCA 1YZ6A 1SLJA 4A3FH 2VQEQ 1HNWQ 1N36Q 2JA6G 3E9HA 2HIVA 4HIMA 2VQFL 3NBHB 3G6EA 1IL2A 2E2HH 4B3SL 3HKZG 1TWAH 4OWTB 1V43A 3I55A 3AEVA 5EAYA 2JA7H 3Q8DA 1L0WA 4PZ6A 4WJ4A 5AJ3Q 4LFAL 4DUYQ 1EUJA 2C35B 3M4QA 1OXTA 2XGTA 2EXDA 1M90C 3GO5A 4A3GH 2Z0SA 1EOVA 2N49A 1JJCB 4GN3B 4DK6C 1Q82C 4LFBQ 5C4XG 2F52A 4APVA 5M3MG 1YNXA 5J3BA 3PV0A 4PG3A 1OTCA 3SGIA 4LF9Q 3K8AA 5IYBG 1QVGA 4QL5A 3RN2A 2BA1A 4GKJQ 4JCVE 3F8TA 3HOZH 5JJIA 4PMWA 3TS0A 2LSSA 2ZJQA 1OXVA 4GS3A 3ULJA 2VUMH 1PH6A 4WJ3M 1I94L 1EIFA 2HHHL 3TREA 3MXNB 4LUOA 4YY3Q 1LM0A 4IFDG 2CWPA 4GNXB 1K3RA 4HJAA 2R7ZG 2WFWA 2UUBQ 1SE8A 2D62A 4UPAA 4DV4L 4A3JH 1YHBA 1XPOA 1YITA 1S3OA 1PH3A 1PH8A 4DR2L 4JI5Q 1D7QA 1QUQB 1C0AA 4DV2Q 1XNQQ 2UUAQ 3J80c 1HZCA 1KAWA 5M5WH 3M4OH 4UP8A 1IBMQ 1LYLA 5IP9G 3J81j 3G48A 4LF4Q 2VQEL 2VY3A 4LFCQ 1N36L 1HNWL 5IYCH 3CCRA 2NVXH 4GOPA 2B63H 2DGYA 2UU9Q 4BXXG 4R4IA 2IHFA 1YIJA 1XMOQ 4JBMA 2QEXA 4LF8Q 4LNQA 2ALYB 4GLXA 5AJ3L 2N78A 4DUYL 5JJLA 4HJ5A 1MJCA 5IT9c 3RNUA 3CC4A 2JA9A 2A19A 1BVSA 2NVTH 2NN6G 4J15A 4DV6Q 4LFBL 2K52A 1A0IA 5FJ8G 4DR5Q 3PIOA 4AQYQ 2GN5A 1IBLQ 4LF9L 2JJQA 3PO3G 1Y1VH 2AWOA 3CCEA 4JI6Q 3K81C 4GKJL 4X65Q 1PV4A 1GD7A 1FJGQ 2WAQG 1XMQL 1YEZA 3NELA 1HZBA 2HQLA 4JI2Q 2N3SA 3A5UA 3CC7A 4L5SA 5M3FG 4YY3L 2NZOA 1RIPA 1MJEA 3RZOH 1QVFA 1FVIA 2UUBL 1YBYA 5GQOA 3M7NA 1E1OA 4JI5L 2I5HA 3K80C 4MNOA 1E3PA 2E5LQ 4JBKA 1W2BA 2UUAL 4NXNQ 1XNQL 3HOWH 3S2DH 1WCMH 5M5XH 1IBML 4LF4L 3JAMi 3I4NG 1JJ2A 4RMFA 4LFCL 4O0AA 2JA5H 4L5QA 4DV0Q 3STBC 4GNXC 2UU9L 3PO2H 2ZJRA 3HOXG 2ZM6Q 3CF5A 1XMOL 2ZTEA 5LMNW 4LF8L 1ASYA 3S24A 3PGZA 4B3SQ 4GKKQ 2IX1A 4A3DG 1T9HA 1XTDA 2ES2A 4JI4Q 1TXYA 3DLLA 1PH4A 1PH7A 2YV5A 4DR7Q 4A3CH 1Q46A 1UE5A 4P73A 4LFAQ 4DV6L 3CPFA 2CQOA 1QZHA 2Q2TA 4DR5L 3ZJYC 3F2CA 3RR5A 4AQYL 1VQBA 1YJWA 2Q2UA 2DUDA 2K14A 1IBLL 3HOUH 4DR6Q 4B3MQ 1TWCH 4JI6L 1VQEA 1NY4A 2CKZB 2KENA 4X65L 1OXXK 2JEBI 1VQKA 1GO3E 2IHEA 1PH5A 4DR4Q 5JEAJ 3K7AH 1OXUA 1YVCA 3F2DA 1VCIA 4GNXA 1FJGL 4A3IG 4OX9Q 5IYDH 4QIWE 5JJKA 2MFIA 1N8RC 4R4TA 1ASZA 1EIYB 4JI2L 1BKBA 3CP0A 3KF8B 1FL0A 1VQDA 3B6YA 4DNIA 1KRSA 2IX0A 3BJUA 3ICEA 2A1AA 2JA6H 2AKWB 4LF7Q 2E5LL 1KL9A 1N34Q 4NXNL 4DV4Q 3GTQH 1Y1WG 2RCNA 1KIXA 3HOYG 4DR2Q 4PZ7A 4GN5A 2KCTA 3U4VA 4H02A 2I5MX 1YHQA 5IY0A 5M5YH 3M4PA 3KOJA 2PI2A 4DR1Q 2K5NA 2ZM6L 1WJJA 5C44G 2AHOB 5C4XH 3CCLA 5M3MH 4GKKL 4AYBE 4Y52H 3NENA 2NN6I 4DR7L 4JI4L 2H5XA 1VQIA 1PYBA 5IYBH 2I0QA 5C0XG 5K36G 2PI2E 1FGUA 3W5OA 3PUZA 2Y0SG 3U58A 4AYBG 4HJ8A 4DR6L 1NTGA 4B3ML 3OYYA 3L7ZC 1IBKQ 4C2MH 2R7ZH 4DR4L 1K8AC 1EFWA 1PVOA 1SROA 4OX9L 1HH2P 3H0GG 3NEMA 4DUZQ 1PH9A 3TRZA 1YJ9A 1EWIA 4XIGS 1XMQQ 1TWHH 1WI5A 4IPDA 1G51A 1Q8KA 5IP9H 1VQNA 3S2HH 4B3RL 2BH2A 4C3IH 2JE6I 1I5FA 2JQOA 4LF7L 3RLOA 4BXXH 1N34L 4BY1G 5IE8A 1EQRA 1K0RA 1Q1BA 3PF5A 4R4QA 3KYHC 4NPSA 4ME3A 4LF6Q 2A8VA 1L2FA 2D0OA 4X6AH 2BA0A 4JV5Q 3G4SA 4DR1L 3PIPA 4DK3C 4DPGA 3CW2C 3GTJH 1L1OB 2UXBQ 4IOAA
chains in the Genus database with same CATH superfamily
1G291 3N6RA 4A3EG 4JI8Q 2VS1A 5A35A 3CRLC 4LUZA 4BA2I 2F0KA 2M2LA 1LT5D 3E3XA 4KMUC 3OW2A 2PMZB 2NVQB 1ZXTA 2K75A 5E4XA 2K5VA 2PPBC 3LGJA 3QG1A 1CTMA 1PFMA 5ELFA 4ABNA 2R7FA 5M3FH 2YTYA 2MHVA 5HY6A 4DU9A 1RCVD 2OEOA 2ZTCA 2JK8A 3GTGB 1EQVA 1E2WA 1LTSD 3D6CA 1CSQA 1VQGA 2L0CA 4PQXA 4A3FB 4BY7G 3CC2A 3I4NH 2PZTA 1TS2A 2V1CC 2JA7B 1GXDC 3HOXH 4C1NK 1PZID 4LF6L 4MZ9A 3R2TA 4JV5L 4NXML 2JA8G 1ET6A 2AWNA 4LMQD 4N9PA 2OWOA 2WB1G 1VQ4A 3S1QH 1XYIA 1SMXA 3HOZB 3J7A5 3I8ZA 3H15A 4PZ8A 4JC0A 1IKMA 3E0JA 1R4QB 1WTOA 2Z8LA 1XPRA 3FRPB 3E5SA 4PNYA 4HEDA 3T13A 5C3XA 5FLXc 2RHQB 1O80A 3JAMc 2LY7A 3HOYH 2B63B 3C1EA 3T16A 2FHTA 4G7OC 1VMPA 4ZUJA 3H3VH 2R93B 3T1YQ 2K05A 1STYA 2NVTB 2K01A 5FO7B 2KCNA 5JOBA 4XYQA 2E2IH 2MNAA 3V2TA 5C0XH 5GAHC 5K36H 3NWTA 1RJTA 1BBUA 1NNXA 3D0FA 2A68C 3LWUA 3AB9A 4DV5Q 1UUPA 4KV6A 1BCPF 4HJ9A 1D5MC 1SMYD 5DM63 2EYJA 4B3TL 2KHSA 4KHZA 3S14H 4JI3Q 3KLSX 4OWWB 1ENCA 5IGFA 1C4QA 1VQ6A 4RCNA 3S2DB 1JOOA 4TRDA 3GTGH 5M5XB 3L2PA 3AMUA 2OQ0A 3F2UA 1Z6HA 1DJRD 1HUMA 1AP0A 3NK9A 2UXCL 1STEA 5FLXL 4KD3A 2F4VL 2F03A 4NMZA 2L1BA 1LABA 3JAML 4K2KA 3FEWX 3RLNA 1PFSA 2PNHA 5HGTA 4A3FG 4KHPQ 2Q8IB 3RD4A 2AQ1B 4GN4B 1BQQT 3I73A 4OWXB 4X66L 2JA7G 2F3VA 3S1NH 3MXGA 1O7IA 2EIFA 5LMNQ 1FYCA 4IUTA 1G6ZA 1SYBA 1BCPB 3K5OA 4ZCKA 1JE4A 5IGBA 5CORA 2HQEA 5A2QL 1B53A 3K0YA 4IUNA 1X32A 2MO1A 3CCSA 3HOVH 1CUKA 3AFQA 1J9OA 4A3KH 2NVYH 1J5EQ 4A93H 1NMGA 1DOMA 1FNVA 2OQKA 4RGTA 2K4KA 2K50A 2EYPA 2XWBB 5C0XJ 2F0DA 5C4XB 1JORA 1D2BA 1JWMD 3GTMH 2R93H 1VQ8A 3VR6A 1X3QA 1QNKA 3GTOH 1N32Q 1UE1A 1U0LA 1MD2D 1E2ZA 3H3VI 1WFQA 3CAMA 1EY9A 1PYSB 4UP9A 1JWUD 5CV8A 1PTOD 5C0XI 1Q86C 3GQBA 3MWYW 1AZQA 1JE5A 3HEJA 4L8JA 3W1GA 5I9PA 4BWGB 3S2HB 2D2CC 4C3IB 3BZKA 2MO0A 4LAAA 2IY5B 4K8JA 4YWKA 3KDFB 3WDNA 1LTLA 1XXGA 4UY8C 3J7ZC 1E1TA 3HKSA 4E6IA 1JOKA 2VL6A 2ATWA 4LF5L 2KQ3A 2ZXOA 3C2PA 1ET9A 2JP1A 2CWAA 4JI7L 4OIKA 2L12A 4P74A 5C5MA 2VQFQ 3S1MB 4HIDA 1X3FA 2EYFA 3UDGA 4U673 1Y69U 1A3TA 4I65A 4KD4A 4GOPB 2K5HA 3I72A 4X64L 3EA6A 2Q2HA 2R92H 4IJHA 1SXTA 4IJLA 5HGQA 4KY6A 2I5LX 5IT9L 2DY8A 3I7FA 4R4OA 1B3QA 1SN8A 4QY7A 3EROA 5FO8B 1VQPA 4A3CG 4FYDA 1S72A 3I56A 1RODA 5ELNA 4H44C 3QOLA 3S17B 1KAAA 3BZDB 4JK1C 4A3LH 4KN4C 4RGOS 1LACA 1QILA 5TSSA 5GAEC 5GAGC 5HURA 4QGUA 3FVQA 2KHJA 1VF5C 1PFBA 5LL6S 3TBIB 4C3HB 3RLFA 2VB3X 1CK1A 3E9HA 1BBXC 3A55A 1YNJC 2E2HH 1Y8NB 5ELBA 4OWTB 3AEVA 5EAYA 1D5XC 3HGBA 3G7LA 1H9MA 1OXTA 4DNRB 2EPBA 4GN3B 1Q82C 3KK7A 5C4XG 4WRDA 3NWSA 4LF9Q 1DOKA 3K8AA 4IN3A 5ELDA 2XVSA 2QKIC 4PMWA 2ZJQA 5CV5A 1Y1WB 3KLSA 2K7VA 1I94L 2HHHL 3MXNB 4LUOA 1LM0A 1CQFA 1S5ED 2R7ZG 4P2CB 5C44B 4XT1B 3PMFA 1C0AA 3J80c 1HZCA 5M5WH 1HXYD 3L3OC 4QUFA 2J7ZA 3J81j 4C3IG 3CCRA 1STGA 4GOPA 1CM9A 2SNSA 4X3TA 1ZEQX 4S3SA 2ALYB 2CH4W 5L37A 4DUYL 4DN4M 4RHRA 2RSOA 4G57A 2A19A 3H0GB 4DR5Q 3S16B 3N52A 2OF1A 1B44D 1O7ZA 4AQYQ 2JJQA 1F2ZA 3NXWA 4BS9A 1T5EA 2AWOA 1QWYA 3K81C 2I46A 4GKJL 5CMDA 2RVLA 4X65Q 2O4XA 3MA2B 5AFWA 1GD7A 3NELA 1SNQA 2N3SA 1HFNA 4YY3L 3G6JB 3MAQA 1FVIA 1YBYA 4CJ0B 3A7LA 3K80C 3IAYA 1E3PA 1XNQL 1H9KA 1ZKOA 1SYDA 4L6TB 1B9MA 4JW0A 4ME5A 4RMFA 4LFCL 1SAPA 1KLUD 1S5CD 2N88A 2F0UA 4EQNA 5EBDA 2PYKA 4LF8L 2ENBA 1ASYA 3J80L 1Q8IA 3S24A 3PGZA 1PLFA 1XTDA 2MP1A 4JI4Q 3H94A 4C3HG 1PH4A 4DR7Q 2FMCA 4Y7NB 2Q2TA 1IKLA 3F2CA 4L63B 3RR5A 1CZGA 2QCPX 4B3MQ 1TWCH 2HUGA 3K5MA 1NY4A 2WINB 1VQKA 1OXXK 1GO3E 3MXNA 1YVCA 4FF2A 4KJNA 3SK5A 4DNIA 5CV9A 2Z6BA 2A1AA 4FF3A 3LNNA 4LF7Q 2EJGC 2NTSA 3GTQH 1Y1WG 1SMYC 2EY2A 4DR2Q 1YHQA 2FMMA 1IYUA 4DR1Q 1MHWC 2K5NA 2F1MA 1DCZA 5C44G 4G7ZC 2LKVA 1F9QA 4GKKL 2R61A 3J81L 1K8OA 4Y52H 1VQIA 1PYBA 2I0QA 2CVRA 4BBRB 1QJOA 3W5OA 3I70A 3U58A 1W6KA 4HJ8A 3BDLA 3SHLA 1T5XD 2B2VA 1ESFA 3L7ZC 4DR4L 5E1FA 3H0GG 1YJ9A 4QB4A 1EWIA 1WD0A 1PXUA 2RQXA 1TWHH 1WI5A 5IP9H 3CQZB 4B3RL 5G3LF 2JE6I 3RLOA 1K0RA 1Q1BA 4R4QA 4NPSA 2EYLA 4LF6Q 2F0FA 4X6AH 2F0PA 2BA0A 4JV5Q 4J8QA 3G4SA 1K3BC 3CW2C 1G2SA 4FO2A 2IT1A 1SYFA 1C7YA 4HAEA 2NWGA 1KHIA 1HNXL 2SEBD 1TY0A 3GTKH 1G8ZD 1N9WA 4FF4A 1NAPA 4ILWA 4NB3A 4OO1G 2BE5C 2R6GA 3ERSX 4QUCA 2A74C 5JJZA 1WTRA 2E2JH 2B2TC 2WAQE 4MTKA 5FLXE 3S1RB 3I2ZA 2A73B 1MKHA 2XTIA 4DUZL 3JAME 4RKLA 2PCFB 5EPLA 1W3SA 2CH4A 2L15A 3CRKC 5T1GA 1VDZA 3D31A 3Q0AA 2Z6KC 2RA4A 3I4OA 1VQFA 2E75C 1DOLA 2B2TA 4KY5A 5FLMG 3EBEA 4UDUC 1RTNA 2O2LD 2RKSA 2E8GA 3C46A 4LK1C 2J4XA 1MIUA 4RH6A 3K59A 2R3ZA 2D0PA 4UP7A 2F0OA 4A3IH 4B3TQ 1V8QA 3QOJA 1BF4A 4XQJA 1JB3A 4BBRG 3F1ZA 3M4OB 4LWCA 5CV4A 1HRJA 1O78A 1EY0A 1CKOA 4H0LC 2NUCA 1CFMA 3UDIA 1JB7A 1SRUA 1P16A 1H95A 2WP8J 2F0VA 3WWVA 1B50A 2F4VQ 3CKIB 1AFPA 5E7NA 2UXDL 2GA4B 2RHSB 4DF7A 1HCZA 3MHBA 3A5ZB 4TKOB 5KNBA 4NKLA 1NMFA 1SFOH 5EGTA 1BR9A 4X66Q 2SOBA 1PHJA 1MGSA 4FP5D 1G6PA 1NUCA 1SEBD 4OO1I 2EZVA 1YNNC 1EY5A 1D5ZC 1B1ZA 1X3EA 4IQZA 2YTXA 1XTCD 2M9VA 2L4NA 1Q7YC 1UE7A 4L5TA 2KOLA 4K0KL 1WCMB 5JAVA 5KYIA 3PUYA 1TY2A 3VR2A 1YHAA 2K5QA 3PUXA 2JA5B 3V05A 4KKSA 4C1NI 2AQ2B 2L55A 5IGDA 1PH1A 1O7LA 1NBWA 3VA5A 1A15A 4B9XA 1EU4A 1NSNS 4R8IA 1V1QA 4HSPA 4A3EH 2IW3A 2ZXPA 4IUUA 1B7YB 4ZYSA 3ITPA 2B2WA 5C4ZA 2BCOA 3K5NA 2KJXA 3HOUB 4YCWA 3WOFA 5C6AA 1X65A 5LL6X 4R1JA 4ZKBB 3OMGA 3CD6A 5I2XA 1K28A 1KDBA 4DFAA 3K7AB 3TQYA 1JWSD 3BS1A 3UDFA 4K5WA 4ALPA 1CT1D 4CJ1B 3RN5A 2SNMA 4BY7H 2JA6B 1EQTA 1VQOA 1U4LA 4CKBA 2VUMG 1Q81C 5M5YB 3FHWA 1PRTD 4LF5Q 2PQAB 4J6HA 5I6WA 1IYVA 4JI7Q 3T51B 2JA8H 5M3MB 3D3RA 1I50H 1TIID 5JPMC 1KXLA 3DM1A 4X64Q 3R3OA 4POGA 1VQHA 2F0QA 1AE3A 1C48A 4JI1L 4PV1C 1DYQA 3SK4A 4DGZA 1RTOA 1IZ6A 4P71A 4C2MB 5ELOA 5IIFA 4KTAA 2LMCB 2YU9H 2LXJA 1K73C 5IOCA 4HN7A 2KECA 3SEBA 1SJHD 1EFID 1B8AA 1N33L 4DV1L 4RG1A 1YI2A 3FP9A 2ZJPA 1BUVT 3NBHA 4JBJA 1DM0B 1EOTA 4A4IA 1CSPA 1P8LA 2B29A 3GTJB 3PSIA 3DEOA 4JYAL 3H3VC 2WKCA 5EQ0A 1WCMG 5KNDA 3URYA 4RCOA 3PO3B 5I6YA 1V1PB 3RZDH 3I90A 3W2DA 2JA5G 1M1KC 1IW7C 4WFN3 1L0XB 1HZAA 1CQVA 2XNAC 4EQ5A 1D1KA 5BN3A 4Q0FA 3DHQA 3KJPA 4X62Q 4JI0L 1M8AA 2K5WA 5COYA 1I3QB 1NE3A 1QUQA 1HNZL 3HOUG 2NVQH 3GTPB 1I94Q 2MUYA 2HHHQ 1Z7TA 3AFPA 1ZYRD 5I9OA 5IYDG 1UEAB 4ZK9B 1IXRA 2ZTDA 1VQCA 2PQAA 1C9OA 3HKZE 3J80E 4A3DB 4DV7Q 3TDQA 3CXCA 4DV0L 4A3FH 2JA6G 4KJOA 2OT2A 1IL2A 4B3SL 1SE4A 3I55A 2WV6D 3Q8DA 2JA7H 4PZ6A 4WJ4A 4DUYQ 1EUJA 4ZKCB 4OELB 2EXDA 4LJZC 3GO5A 1EOVA 3D4WA 1F9SA 3P20A 3OIPA 1EY8A 1EIHA 1L0YB 4APVA 5M3MG 5J3BA 1OTCA 3SGIA 4CGYB 5IYBG 4GKJQ 3PIO3 5CC4A 4MIUA 3HOZH 5EBCA 4C3JB 1Q90A 2NTTA 2LSSA 2HDMA 1C8CA 1AZPA 1DXMA 1PH6A 1K83B 4IFDG 4EVOA 4YY3Q 1F2LA 2WFWA 4R8NA 3M3YB 2D62A 4OIJA 1MI2A 1YHBA 3MFYA 1PH3A 1PH8A 1KTKA 1NCVA 4DV2Q 1XNQQ 1I4GA 4UP8A 2VY3A 1B3AA 4LFCQ 3S15B 1V1PA 2G5DA 4X3SA 4BXXG 2B63H 4AYBB 4JBMA 4CDEC 2SDFA 4LF8Q 2KVMA 3ND9A 3R8BA 5AJ3L 5JJLA 4HJ5A 2F0MA 5IT9c 1KNEA 2JA9A 4CDCC 2NVTH 4J15A 4LFBL 4B08A 2QILA 2KEDA 1PZJD 2K52A 5FJ8G 2GN5A 2EOTA 3PO3G 1TS5A 2R7ZB 1PV4A 4BY1B 2TSSA 2NZ1D 2WAQG 4CDDC 1YEZA 1SNCA 3U9SA 2NZOA 1QVFA 2UUBL 2QW7A 3H91A 1E1OA 3NBIA 4JI5L 3IFTA 2UUAL 3S2DH 4O42A 4G7HC 5M5XH 4IUPA 3D6WA 4OGQC 1GUSA 3JAMi 4LF4L 1JJ2A 4IZ8A 3P75A 2WACA 4O0AA 2AQ3B 2UU9L 5I2YA 2ZJRA 1XMOL 2NBFA 5LMNW 1WTXA 2FJ2A 3QJYA 1HHVA 1B4OA 4GKKQ 3BVZA 2IX1A 4A3DG 4A3CH 1Q46A 4LFAQ 4P73A 4DV6L 3CPFA 3OIQA 2CW0D 1HPCA 1IBLL 3TP7A 3WOEA 3T53B 2CKZB 4Q5VA 4DR4Q 4A3BB 1OXUA 4QIWE 2A6HC 2MFIA 5C3EB 1N8RC 1ASZA 4JI2L 1BKBA 1EEID 1VQDA 1EEFD 2IX0A 1WTPA 1Y8OB 4C3JG 4NXNL 4DV4Q 5D65A 1NR4A 4PZ7A 3T4AC 2KCTA 3U4VA 1JOQA 2K03A 2BOSA 3KOJA 4PMBA 3DWQA 3TZUA 1EWHA 2PW7A 5FKAC 5KIXA 2ZM6L 5C4XH 1MBYA 3SDZA 3NENA 1WVLA 2K04A 2FINB 5CV7A 5C4JB 3QB3A 3QR8A 1VMCA 2PI2E 1FGUA 2N55A 3U9OA 3PUZA 4AYBG 3I4MB 3OW7A 4F7XA 3EFXD 3KBGA 1D6EC 3L9AX 4DAYA 1ICFB 2DJFC 2R7ZH 1QOHA 4EGVA 1EFWA 2QEJC 1SROA 1HFGA 3OOCA 3NEMA 4MHEA 4DUZQ 3GTLB 3TRZA 5FO9B 1F2MA 5JVG3 3X3MA 1XMQQ 4ID6A 2EY5A 1G51A 3TP5A 3S2HH 5KYLA 4HR7B 1R4PB 4C3IH 1K0SA 5CBEE 1R9TB 3HP3A 2Z4IA 1N34L 4BY1G 5IE8A 3FKIB 1II3A 1TWGB 3QO2A 2HCCA 3KYHC 2K28A 3HZXA 4ME3A 2D0OA 1FR3A 3D8GA 1MSHA 4OL7A 2NYZD 3PIPA 4DPGA 2J0TD 1L1OB 3A8KE 4K8IA 5F2DA 4IPGA 1NJIC 1EQQA 3S1MH 3HFZB 1UWVA 5EPJA 1LT6D 4DAMA 1V9PA 3TS2A 1TWFB 1SBBB 3KFUA 1I4XA 1Y14B 3SE0A 1S5BD 1HTLD 1IBKL 3PUVA 2BH8A 4IUQA 2BDOA 1JQYD 1U4PA 4A3MB 3S17H 4AH6A 2RDGA 1A63A 4KK7A 1U5KA 2A6ED 1TWAB 4IPCA 3ULPA 1SE2A 3FPUB 1HQMC 4A3BG 2UXDQ 5C3EG 5ELEA 4CDFC 4A3GB 2WB1E 4LUVA 3J81c 4JG2A 4C3HH 3TN2A 4R4CA 4KKTA 4L5RC 1V1OA 5GADC 3K5LA 3MEHA 3VYSA 2B3GA 3OPOA 3GDEA 1VQ9A 2HT1A 4TVAB 1Q3LA 2JSOA 2RBMA 4QJFA 4BBSG 1L1OC 4A3JB 1TQOA 3DEPA 3GD7A 3STBD 3VYUA 3SVMA 4OXPA 4HJ7A 1GJXA 1XNRL 4K0KQ 3E0EA 2XRSD 1RDPD 5IP7G 1D1IA 1Y1WH 4A76A 3CMAA 3I4MG 1Y8PB 2NVXB 3X3NA 1KDCA 4DXGA 4HMIA 3A7AB 1X9NA 2X6GA 1A3VA 5C44H 3CCVA 2F0IA 3IFDA 1KNAA 1L1OA 5LMUL 1TS4A 2CFMA 3ULLA 5H1SE 1ZYRC 1Y1VB 5IWAL 5DAUA 3FKIG 2Z9HA 1ONLA 1E7ZA 1G91A 2QA4A 1PFNA 1GOZA 3C1FA 4KKUA 1Z9FA 4KI0A 1TWFH 4K14A 1UEBA 2LXKA 3H0GH 2B2YC 3S16H 2PMZE 2PQEA 2YYZA 2VNUD 2EY6A 4X3KA 4AIMA 3A74A 3M4YA 4Z9CB 3HOWB 1PTOB 5ELCA 3A0JA 1I4RA 1HA5A 4IALA 3CCJA 3FDTA 5D3IB 1QZGA 5KNCA 3TEHB 3PO2B 2EY1A 1U9RA 4X3UA 2FXQA 1LTGD 3LX0A 2E2DC 3BVMA 5EJWA 2UUCL 3SK6A 4R9WA 2VW9A 1SJED 4A3MG 4RFBA 3SXHA 3CMEA 3PQIA 3OWEB 3J80i 1CKNB 4JI1Q 3IRBA 4OO1H 1DONA 4NXMQ 1GUNA 1UE6A 4FDBA 3VR3A 2Q2IA 4CBVA 3UE1A 3J7YW 5C3WA 4A3GG 4YHHL 2EYMA 3EVQA 2MPMA 1ENAA 4C56C 3P7JA 1S5FD 2XIWA 4Y7NH 4JOIC 3CCUA 1A2TA 2H1EA 4UAIA 2E76C 3CCQA 1DGSA 1N33Q 4DV1Q 3CU7A 1RL2A 3PCOB 3BU2A 2LS01 3MVVA 1QNUA 2R7DA 3VYTA 5ISRA 2TMPA 4DAVA 4YCVA 4A3JG 5DLQE 3PUWA 1CKMA 4DK1A 5FLMH 4JYAQ 1GHKA 5JEAG 1GHJA 1EY6A 1A62A 4DR3L 2L11A 2HD3A 4JOIA 1PTOC 4RA8A 1KC8C 4B9WA 1KD1C 1B2TA 1STBA 5IYCG 2D9UA 4DKAC 1ML0D 4P72A 3J81i 3HRZC 3CCMA 1JT8A 2OTLA 4GLVB 1JR0D 5IGEA 1I6VC 2P5ZX 1K9MC 5CGKA 5A2QE 1AH9A 3BZCA 1HZ9A 2KUMA 2K5DA 4JI0Q 1VQMA 3MXPA 4YWLA 2JEAI 4F8MA 1PDQA 4FXKC 4BBRH 2VUMB 1HNZQ 1Y1VG 2PW5A 2Z6KA 3OTOL 4OONA 5BR8L 4H13C 1HR0L 1GUTA 2VXWA 3Q22A 2CW0C 2ID0A 4F87A 3BYTB 4G4KA 2H4OA 2VZAA 3QWNA 4ZRZA 3CQZH 1VQ7A 2UXCQ 3HOWG 1CKNA 1EZ8A 3MXUA 5J22A 3GV6A 1BCPD 1X6OA 3QIAA 3S9WA 3PO2G 1SR3A 3T1HL 4XT3B 2DNCA 4XYOA 5FK9C 1O7YA 1IYJB 4DV3L 1VQLA 1OO9B 2AMCB 3MTSA 1QE6A 1SNPA 1PH2A 2L9HA 4N8FA 4QQBX 3HOXB 1LTBD 1MSGA 2F0SA 3NP8A 3S1RH 1LTAD 4RGNA 5CR3A 4POFA 1X3GA 3E6ZX 1A2UA 1XPUA 1QVCA 1YZ6A 3R93A 1SE3A 2HIVA 3NBHB 1ICWA 3S1QB 3PIP3 1V43A 3M7GA 3IKJA 5AJ3Q 1H9RA 3H09A 3M4QA 3R2IA 5IT9E 3ONAB 2XGTA 2IJ0A 2N49A 1JJCB 4LFBQ 1F77A 1PYWD 3NTHA 2F52A 2DN8A 1YNXA 4M1UB 1RD9D 1QVGA 2BA1A 2KA7A 4JCVE 5D3DA 3TS0A 3A8JE 4U68A 4V190 1OXVA 3HOYB 3NTKA 2VUMH 2CHBD 4WJ3M 1JC7A 2IL8A 4CJ2C 4GNXB 1K3RA 2UUBQ 4DXFA 1SE8A 2A69D 3A56A 1XPOA 4JI5Q 4H7BA 4DR2L 1D7QA 4FXDA 1QUQB 4HMJA 5I4DA 2WIIB 2UUAQ 5EKKA 3M4OH 2E2IB 1LYLA 3G48A 2EJMA 4LF4Q 4UHVA 2VQEL 2F0EA 1I4QA 1N36L 1HNWL 3GP7A 2DGYA 1STAA 1EU3A 5E4WC 2UU9Q 1XMOQ 2K32A 2N78A 3MC0B 3T56B 3RNUA 2EYOA 4OEMB 1BVSA 2NN6G 4DV6Q 3S14B 2A6EC 2EVBA 4XXEA 5K5PA 1E0BA 5JPNC 1IBLQ 2JXMB 3CCEA 4FF1A 3BG3A 1X3PA 3MFGA 1HZBA 1LV9A 3ND8A 4RWSC 4JI2Q 3CC7A 4L5SA 1SYCA 5M3FG 2F0HA 1BNZA 1M4VA 5GQOA 3M7NA 3K58A 1PZKD 3A54A 4JBKA 4NXNQ 1WCMH 1IBML 2Z4HA 3I4NG 2JA5H 3STBC 4GNXC 3V96A 3S1NB 3HOXG 2ZM6Q 3CF5A 2ZTEA 2D5DA 1KABA 1GUOA 2ZXRA 3UI2A 1WTQA 3J7AV 1T9HA 2ES2A 1TXYA 3RUZA 3OMCA 1QZHA 1HQRD 2WAQB 1YJWA 3HOVB 3KBXA 2DUDA 3HOUH 3DMUA 4A3KB 4K6DA 4JI6L 2NVYB 2KENA 1SYGA 2IHEA 1PH5A 3NQIA 4A93B 3K7AH 2KEEA 1FJGL 4GNXA 5IYDH 2PNRC 4FVMA 5JJKA 4R4TA 1EIGA 3KF8B 1FL0A 3B6YA 2Q8TA 3ICEA 3GTMB 2JA6H 3LWEA 2AKWB 2Q8RE 2EDGA 2E5LL 1N34Q 3W3AA 2RCNA 4ODGA 1KIXA 3HOYG 3GTOB 4GN5A 4H02A 2I5MX 5IY0A 5M5YH 3I3CA 3M4PA 4NW2A 1SNMA 2AHOB 3CCLA 5M3MH 2NN6I 2H5XA 1EY7A 1TR5A 5IYBH 5C0XG 1BOSA 5K36G 1WTVA 4DR6L 1NTGA 4EQPA 4IFDH 3FMCA 1IBKQ 4C2MH 1EYAA 1K8AC 1IL8A 4OX9L 1HH2P 1PH9A 5EKIA 2FFKB 4XIGS 1J8IA 3K6OA 4IPDA 1Q8KA 3P1HA 3J7AF 4MN3A 2XRQD 2JQOA 4BXXH 1LT3D 2K33A 1EQRA 3PF5A 2R92B 2A8VA 1EZ6A 3KUPA 4RAUC 3J81E 1GUGA 3GTJH 2O5IC 4IOAA 5FJ8H 4GLAC 2L5TA 1EYDA 1GKHA 1B9NA 1Q1EA 1LTTD 2QF7A 3PO3H 1FNUA 3OSOA 2RCFA 1BBWA 2DJGC 3BYYB 5LHY1 1EYCA 4XQNA 1SNOA 1S40A 3HOZG 1E24A 2K1BA 4A75A 1CA6A 4EX5A 3KF8A 3NQTA 5M9OA 1XNRQ 1I4PA 2VB2X 1BO0A 2HDLA 2WKDA 3F2BA 4P75A 1I3QH 2RDHA 2BE5D 2QDLA 3HOVG 4DAYB 3GTPH 3JC66 4A3KG 1OXSC 2E2HB 4YWMA 3NTIA 3M9BA 4A93G 2OCEA 1YJNA 1XWEA 1K8GA 2B63G 5LMUQ 1F9PA 2OTJA 4IO9A 2QGQA 4A3DH 2KHIA 3EJIA 1WTWA 1PA6A 1PRTF 5T1IA 2UXBL 4GZYC 2R93G 3KJOA 2RF4A 4JI8L 5IWAQ 4IFDJ 3GV3A 5EKLA 4CKEA 3CPWA 1D8LA 3E9IA 2EYHA 4ZLTF 5CBAE 1AEXA 2CQAA 1RF2D 2B39A 1LUZA 2EQSA 3KF6B 2IWHA 1JMCA 1BCPC 3AYHB 5IGGA 3NUCA 3UDXA 1HJPA 4O1NA 3U4ZA 5M5WB 4C3JH 1STNA 5DEHA 4QMGA 3EQLC 4XQQA 3ER0A 4IFDI 1Q12A 1K83H 3Q6SA 4IOCA 4HIKA 3O13A 2UUCQ 4ZQ3A 3M3YH 4B3RQ 1TT2A 4FNFA 3TSSA 3VR4A 1AE2A 1PRTB 4PMCA 4HCSA 3OWFA 1X56A 3S15H 4QF4A 1AN8A 1VQAA 2F3WA 2MJ8A 4BA1I 4BBSB 2DNEA 2R92G 2F3IA 2Y0SE 5IGCA 1TKWB 4YHHQ 2O5JC 1VQJA 1HNXQ 3ERQA 4K5XA 2IX3A 5NUCA 4K2LA 2AUJD 3D4RA 5G3LD 3PF4A 2JYOA 3TZDA 2IPKD 3VR5A 1JJGA 1I6HB 4HTHA 3G71A 1VS0A 4IPHA 1SNDA 1XX8A 1X54A 4A3LG 4CKCA 1YNND 4BY1H 4N8X1 2F0LA 3UE0A 2F0WA 1Z47A 1GVPA 1EY4A 3HG9A 4DR3Q 2EJFC 3T1YL 1ESRA 2A69C 3MEFA 2F0TA 1XJVA 1TWCB 4NDXA 2GVAA 2I07B 1ILQA 4X62L 3AQQA 2DY7A 4GOPC 1A6XA 3KF6A 1PMRA 4DV5L 1QCBD 3K7UC 1TVXA 4CHTB 1H9JA 2LFNA 2E74C 3EN2A 1PRTC 4JPBW 4DAPA 3KDFA 4OHJA 2ZT9C 4JI3L 1STHA 2NZHA 3K0XA 1WOCA 1E2VA 3OTOQ 3GTQB 3HKZB 5BR8Q 4DV7L 1FGBD 1KDAA 3FPPA 4HCEA 4KN7C 3U50C 1WD1A 4N9TA 2XWJB 1HR0Q 4A3BH 2Z1CA 1KRTA 2X69A 5C3EH 3W1BA 1B70B 1GM5A 2MQHA 5KEEA 4TQUS 3TP6A 1LTID 3BDCA 4ULLA 4HIOA 2EE1A 1KQSA 1X55A 4KHPL 2MGSA 5C5LA 4XTCS 2CCZA 4KLKA 1A8VA 5IODA 3DWPA 3T1HQ 5GROA 1WYDA 5CV6A 3HS0C 1RHPA 1S4ZA 5LMNL 2KBNA 1E22A 4BBSH 1LT4D 4DV3Q 4K5VA 2ASBA 2N8NA 2F0GA 4O2DA 5C4JH 4MTNA 4IUVA 1TWHB 2KCMA 5EPKA 5IP7H 3D4DA 3M85A 2C9OA 2BDNA 1VF7A 3KLRA 1LLRD 2PZWA 3NSWA 3I4MH 4DV2L 4LW1A 1I6HH 1S5DD 1BXTA 1J5EL 3KLWA 4F88A 2OXPA 3IL8A 5BN5A 2ICIA 3GTLH 1PTOF 1LTRD 3VDYA 3SR1A 1QG7A 1VQ5A 1HTPA 1FNWA 2G9HD 1CA5A 1R9TH 3GTKB 3NE5B 3FKIH 1TWGH 1UAPA 1K8MA 1N32L 2GVBA 2E2JB 2YTVA 2F0JA 3C3LA 2PO4A 4IURA 1HR0W 2RDFA 1J6QA 2HCIA 4JBWA 3EIVA 2HIXA 3I4LA 3DM3A 5E3FA 1IW7D 1GUWA 5J39A 5DNFA 3RZOB 1W6JA 3L0OA 5DM73 1A3UA 4YCUA 1NR2A 1EYGA 1DD2A 2A68D 2B2VC 2B2UC 5FOBB 4A3MH 1LO5D 2A5HA 1SLJA 2VQEQ 1HNWQ 1N36Q 4HIMA 2VQFL 3G6EA 3HKZG 1TWAH 4JVZA 1L0WA 4LFAL 1JICA 2C35B 2B2YA 2F4IA 1M90C 1CHPD 4A3GH 2Z0SA 4A3IB 4DK6C 2B2UA 3PV0A 4PG3A 3NHHA 4K6LA 4QL5A 3SK8A 3RN2A 4QIWB 5JJIA 3F8TA 4GS3A 3ULJA 2PZUA 1EIFA 1SSOA 3TREA 2CWPA 4HJAA 2ICEC 4XDXA 4A3JH 4UPAA 4DV4L 3DWAA 2XN9C 4J1MA 1S3OA 5KRUA 1YITA 5JEAH 1KAWA 2B8GA 1CHQD 1IBMQ 5JVH3 5IP9G 1SFOB 5IYCH 1EWCA 2NVXH 2Y0SB 4R4IA 2IHFA 1YIJA 2F0NA 4RKBA 2QEXA 4LNQA 1WTHA 4GLXA 4FXGC 1MJCA 3CC4A 3RMHA 4WORA 1A0IA 1U4RA 3PIOA 1BDOA 4YIJA 4LF9L 1Y1VH 3VYRA 4JI6Q 1F9RA 3Q24A 1G2TA 1HA6A 1FJGQ 1XMQL 5J1ZA 4RGMA 2HQLA 1CZWA 3A5UA 5C4HA 1RIPA 3DXJC 1MJEA 3H6MA 1QB5D 3RZOH 4EQOA 3ZYYX 1H9SB 2B8FA 2I5HA 4DA2A 4MNOA 1F2YA 2E5LQ 4V0BA 4A3EB 1W2BA 5KGUA 3HOWH 1PTOH 2KCCA 5CYUA 1EL0A 1JCKB 1TS3A 4L5QA 4RHSA 4DV0Q 2QDBA 3PO2H 3DUZA 1KLGD 3A8IE 4B3SQ 2NB0A 3OHXC 3Q23A 3DLLA 1PH7A 2YV5A 1UE5A 5BN4A 1ILPA 2CQOA 4DR5L 3ZJYC 1ENFA 4AQYL 1VQBA 2Q2UA 3AU7A 4BY7B 2K14A 4DR6Q 3TP8A 5M3FB 3K57A 1VQEA 4X65L 2JEBI 5JEAJ 3F2DA 2RSNA 2C5CA 1VCIA 4QCLA 4A3IG 3NPPA 1AW7A 4OX9Q 1SDFA 1EIYB 3CP0A 1KRSA 4DNTB 3BJUA 2JA8B 3I4NB 1CI3M 2AUKA 1I50B 1KL9A 2WB1B 4KHVA 2K6AA 1U4MA 3CHBD 4M8AA 4I7AA 2A6HD 2PI2A 3MZ5A 2XSCA 1WJJA 1IHZA 4WJWA 3BDOA 1SYEA 2V4DA 2YU9B 4AYBE 4DR7L 4JI4L 3BVGA 1RKNA 2Y0SG 4B3ML 2JN4A 4TSSA 2B2WC 3OYYA 1UNSA 2X6LA 1YNJD 1PVOA 1H9SA 4HSVA 1FD7D 1I4HA 2EXZA 1TU2B 4I7ZC 5D14A 3TMEA 1VQNA 4DK0A 2M00A 2BH2A 2G9DA 3VA7A 1I5FA 4LF7L 3RZDB 4ZUIA 4ZAIA 3I91A 1DZ1A 1L2FA 1HUNA 4DR1L 4KY7A 4DK3C 2NN6H 2UXBQ 4NP5A
chains in the Genus database with same CATH topology
5FJ8H 1G291 2IT1A 4GLAC 4IPGA 4A3EG 1EQQA 1NJIC 4JI8Q 1C7YA 1KHIA 3HFZB 1GKHA 2VS1A 1HNXL 1Q1EA 3S1MH 1UWVA 4LUZA 3PO3H 4BA2I 3GTKH 4DAMA 1N9WA 1V9PA 4NB3A 3OW2A 1BBWA 4OO1G 2K75A 2R6GA 2K5VA 3ERSX 3TS2A 3LGJA 3KFUA 3HOZG 1S40A 1Y14B 1E24A 2E2JH 2R7FA 5M3FH 2YTYA 2WAQE 5HY6A 1IBKL 3PUVA 2BH8A 4A75A 4EX5A 3I2ZA 2ZTCA 1XNRQ 1MKHA 2JK8A 2XTIA 4DUZL 1CSQA 1VQGA 3S17H 3F2BA 4AH6A 4P75A 1I3QH 3HOVG 3CC2A 4BY7G 1A63A 4DAYB 3GTPH 1W3SA 3JC66 4A3KG 1OXSC 3I4NH 1U5KA 2L15A 4YWMA 4IPCA 3ULPA 2V1CC 3M9BA 3D31A 4A3BG 2Z6KC 4A93G 2UXDQ 3HOXH 3I4OA 1VQFA 2OCEA 5C3EG 1YJNA 4LF6L 4MZ9A 1K8GA 2B63G 2WB1E 4LUVA 5LMUQ 2OTJA 4IO9A 2QGQA 4A3DH 4JV5L 3J81c 4JG2A 5FLMG 2KHIA 3EBEA 4C3HH 4NXML 2JA8G 4R4CA 1PA6A 4L5RC 2E8GA 2UXBL 2AWNA 5GADC 2R93G 1MIUA 2OWOA 2WB1G 3KJOA 2RF4A 4JI8L 2B3GA 1SMXA 5IWAQ 1VQ4A 3S1QH 4IFDJ 3J7A5 3CPWA 3GDEA 1D8LA 3E9IA 2D0PA 3H15A 4PZ8A 1VQ9A 2HT1A 4JC0A 4TVAB 4UP7A 4QJFA 1XPRA 4A3IH 3KF6B 1LUZA 2EQSA 4B3TQ 4BBSG 1JMCA 1L1OC 3GD7A 3AYHB 3STBD 5FLXc 4OXPA 2RHQB 3UDXA 4HJ7A 1HJPA 1XNRL 4K0KQ 3U4ZA 4BBRG 3F1ZA 4LWCA 3JAMc 3E0EA 4C3JH 5IP7G 1CKOA 3UDIA 1Y1WH 4A76A 3HOYH 3ER0A 1SRUA 1P16A 1Q12A 3CMAA 1K83H 2WP8J 1JB7A 4IOCA 4HIKA 3I4MG 1H95A 3WWVA 2F4VQ 1X9NA 2UUCQ 3M3YH 5E7NA 4B3RQ 2UXDL 2RHSB 5C44H 3H3VH 3CCVA 3T1YQ 1AE2A 1L1OA 5LMUL 3A5ZB 2CFMA 2E2IH 3ULLA 2MNAA 5H1SE 1NMFA 5GAHC 1X56A 3S15H 1SFOH 4X66Q 1VQAA 1PHJA 1BBUA 3D0FA 5IWAL 3FKIG 4BA1I 1G6PA 2R92G 4OO1I 1E7ZA 2F3IA 2Y0SE 4DV5Q 2QA4A 4YHHQ 1VQJA 1HNXQ 4HJ9A 1X3EA 1Z9FA 4KI0A 1TWFH 2YTXA 4B3TL 1UEBA 2LXKA 3H0GH 4KHZA 4JI3Q 3S14H 4OWWB 2PMZE 2YYZA 3PF4A 3S16H 2VNUD 4AIMA 3A74A 1Q7YC 1JJGA 1UE7A 4L5TA 1VQ6A 4K0KL 3G71A 1VS0A 3A0JA 4IPHA 3GTGH 3L2PA 3PUYA 2OQ0A 1X54A 4A3LG 4BY1H 3CCJA 1YHAA 3UE0A 3PUXA 1QZGA 3TEHB 2UXCL 2FXQA 2F4VL 1Z47A 1PH1A 4IFDI 1GVPA 1NBWA 2UUCL 2VW9A 4DR3Q 3RLNA 3T1YL 4A3MG 1PFSA 2PNHA 3CMEA 1V1QA 4A3EH 4A3FG 4KHPQ 3J80i 1B7YB 1CKNB 4GN4B 3MEFA 4YCWA 4JI1Q 3IRBA 4X66L 4OWXB 1XJVA 1X65A 4NXMQ 2GVAA 4R1JA 2JA7G 3S1NH 1UE6A 1O7IA 2EIFA 2Q2IA 3AQQA 4FDBA 4X62L 5LMNQ 3UE1A 3CD6A 4GOPC 3TQYA 3KF6A 4DV5L 4A3GG 4YHHL 3K7UC 3EN2A 3UDFA 3KDFA 4Y7NH 4ALPA 4JOIC 4JI3L 3CCUA 3RN5A 2MO1A 2NZHA 3K0XA 4BY7H 3CCSA 3CCQA 1DGSA 3HOVH 1CUKA 1N33Q 4DV1Q 3AFQA 1WOCA 4A3KH 1VQOA 3OTOQ 1RL2A 3PCOB 3BU2A 2NVYH 2VUMG 1J5EQ 5BR8Q 4DV7L 2R7DA 4A3BH 4A93H 3U50C 1NMGA 1Q81C 1HR0Q 2OQKA 3FHWA 1KRTA 2K4KA 2K50A 5C3EH 3W1BA 1B70B 4YCVA 4A3JG 1GM5A 5DLQE 5C0XJ 4LF5Q 2MQHA 2PQAB 3PUWA 1CKMA 5FLMH 4JI7Q 4JYAQ 5JEAG 4TQUS 2JA8H 1A62A 4HIOA 4DR3L 3GTMH 2R93H 1KQSA 4JOIA 1KC8C 1I50H 1VQ8A 1X55A 4KHPL 1KXLA 1KD1C 5IYCG 4X64Q 4XTCS 3GTOH 4DKAC 4POGA 2CCZA 1VQHA 4KLKA 4P72A 3J81i 1AE3A 1N32Q 1A8VA 1UE1A 4JI1L 1U0LA 3CCMA 2OTLA 3H3VI 3T1HQ 4GLVB 5GROA 1WYDA 1WFQA 1JT8A 3CAMA 1PYSB 4UP9A 1IZ6A 4P71A 5LMNL 1K9MC 2KBNA 1E22A 5ELOA 4BBSH 4DV3Q 1AH9A 2ASBA 2N8NA 2YU9H 3BZCA 1HZ9A 2LXJA 5C0XI 1Q86C 1K73C 4JI0Q 1VQMA 2JEAI 1JE5A 4O2DA 4YWLA 5C4JH 4MTNA 4BBRH 2KCMA 1HNZQ 3W1GA 5IP7H 3M85A 1Y1VG 2Z6KA 1B8AA 1N33L 4DV1L 4RG1A 3I4MH 3BZKA 2MO0A 4DV2L 1YI2A 4LW1A 4OONA 3OTOL 3FP9A 1I6HH 4YWKA 2IY5B 1J5EL 5BR8L 2ZJPA 3KDFB 1LTLA 4UY8C 3KLWA 4JBJA 1E1TA 3J7ZC 1HR0L 3HKSA 3GTLH 4A4IA 2ID0A 1CSPA 1P8LA 2VL6A 4LF5L 2B29A 2ATWA 3VDYA 3PSIA 2CWAA 1VQ5A 4JI7L 2VZAA 4P74A 4JYAL 2VQFQ 2UXCQ 3CQZH 1VQ7A 3HOWG 4HIDA 1WCMG 1X3FA 1CKNA 3UDGA 1R9TH 3RZDH 4GOPB 1X6OA 2K5HA 3FKIH 1TWGH 4X64L 4A3CG 2JA5G 2Q2HA 2R92H 1M1KC 3PO2G 4IJHA 1N32L 1HZAA 1SR3A 4IJLA 2GVBA 3T1HL 5HGQA 2I5LX 4EQ5A 2YTVA 3I7FA 4R4OA 1IYJB 1SN8A 4QY7A 3KJPA 4DV3L 1VQPA 1HR0W 1J6QA 4X62Q 1VQLA 4JBWA 1S72A 3I56A 4JI0L 5ELNA 3EIVA 2HIXA 2AMCB 3DM3A 1NE3A 1QUQA 1HNZL 3HOUG 2NVQH 1I94Q 2HHHQ 4A3LH 3AFPA 1PH2A 3L0OA 5IYDG 4QQBX 1IXRA 4YCUA 2ZTDA 1VQCA 5GAGC 5GAEC 4QGUA 3S1RH 1EYGA 2PQAA 2KHJA 4POFA 1C9OA 1X3GA 3HKZE 4DV7Q 4A3MH 3CXCA 3RLFA 4DV0L 1XPUA 1QVCA 1YZ6A 1SLJA 4A3FH 2VQEQ 1HNWQ 1N36Q 2JA6G 3E9HA 2HIVA 4HIMA 2VQFL 3NBHB 3G6EA 1IL2A 2E2HH 4B3SL 3HKZG 1TWAH 4OWTB 1V43A 3I55A 3AEVA 5EAYA 2JA7H 3Q8DA 1L0WA 4PZ6A 4WJ4A 5AJ3Q 4LFAL 4DUYQ 1EUJA 2C35B 3M4QA 1OXTA 2XGTA 2EXDA 1M90C 3GO5A 4A3GH 2Z0SA 1EOVA 2N49A 1JJCB 4GN3B 4DK6C 1Q82C 4LFBQ 5C4XG 2F52A 4APVA 5M3MG 1YNXA 5J3BA 3PV0A 4PG3A 1OTCA 3SGIA 4LF9Q 3K8AA 5IYBG 1QVGA 4QL5A 3RN2A 2BA1A 4GKJQ 4JCVE 3F8TA 3HOZH 5JJIA 4PMWA 3TS0A 2LSSA 2ZJQA 1OXVA 4GS3A 3ULJA 2VUMH 1PH6A 4WJ3M 1I94L 1EIFA 2HHHL 3TREA 3MXNB 4LUOA 4YY3Q 1LM0A 4IFDG 2CWPA 4GNXB 1K3RA 4HJAA 2R7ZG 2WFWA 2UUBQ 1SE8A 2D62A 4UPAA 4DV4L 4A3JH 1YHBA 1XPOA 1YITA 1S3OA 1PH3A 1PH8A 4DR2L 4JI5Q 1D7QA 1QUQB 1C0AA 4DV2Q 1XNQQ 2UUAQ 3J80c 1HZCA 1KAWA 5M5WH 3M4OH 4UP8A 1IBMQ 1LYLA 5IP9G 3J81j 3G48A 4LF4Q 2VQEL 2VY3A 4LFCQ 1N36L 1HNWL 5IYCH 3CCRA 2NVXH 4GOPA 2B63H 2DGYA 2UU9Q 4BXXG 4R4IA 2IHFA 1YIJA 1XMOQ 4JBMA 2QEXA 4LF8Q 4LNQA 2ALYB 4GLXA 5AJ3L 2N78A 4DUYL 5JJLA 4HJ5A 1MJCA 5IT9c 3RNUA 3CC4A 2JA9A 2A19A 1BVSA 2NVTH 2NN6G 4J15A 4DV6Q 4LFBL 2K52A 1A0IA 5FJ8G 4DR5Q 3PIOA 4AQYQ 2GN5A 1IBLQ 4LF9L 2JJQA 3PO3G 1Y1VH 2AWOA 3CCEA 4JI6Q 3K81C 4GKJL 4X65Q 1PV4A 1GD7A 1FJGQ 2WAQG 1XMQL 1YEZA 3NELA 1HZBA 2HQLA 4JI2Q 2N3SA 3A5UA 3CC7A 4L5SA 5M3FG 4YY3L 2NZOA 1RIPA 1MJEA 3RZOH 1QVFA 1FVIA 2UUBL 1YBYA 5GQOA 3M7NA 1E1OA 4JI5L 2I5HA 3K80C 4MNOA 1E3PA 2E5LQ 4JBKA 1W2BA 2UUAL 4NXNQ 1XNQL 3HOWH 3S2DH 1WCMH 5M5XH 1IBML 4LF4L 3JAMi 3I4NG 1JJ2A 4RMFA 4LFCL 4O0AA 2JA5H 4L5QA 4DV0Q 3STBC 4GNXC 2UU9L 3PO2H 2ZJRA 3HOXG 2ZM6Q 3CF5A 1XMOL 2ZTEA 5LMNW 4LF8L 1ASYA 3S24A 3PGZA 4B3SQ 4GKKQ 2IX1A 4A3DG 1T9HA 1XTDA 2ES2A 4JI4Q 1TXYA 3DLLA 1PH4A 1PH7A 2YV5A 4DR7Q 4A3CH 1Q46A 1UE5A 4P73A 4LFAQ 4DV6L 3CPFA 2CQOA 1QZHA 2Q2TA 4DR5L 3ZJYC 3F2CA 3RR5A 4AQYL 1VQBA 1YJWA 2Q2UA 2DUDA 2K14A 1IBLL 3HOUH 4DR6Q 4B3MQ 1TWCH 4JI6L 1VQEA 1NY4A 2CKZB 2KENA 4X65L 1OXXK 2JEBI 1VQKA 1GO3E 2IHEA 1PH5A 4DR4Q 5JEAJ 3K7AH 1OXUA 1YVCA 3F2DA 1VCIA 4GNXA 1FJGL 4A3IG 4OX9Q 5IYDH 4QIWE 5JJKA 2MFIA 1N8RC 4R4TA 1ASZA 1EIYB 4JI2L 1BKBA 3CP0A 3KF8B 1FL0A 1VQDA 3B6YA 4DNIA 1KRSA 2IX0A 3BJUA 3ICEA 2A1AA 2JA6H 2AKWB 4LF7Q 2E5LL 1KL9A 1N34Q 4NXNL 4DV4Q 3GTQH 1Y1WG 2RCNA 1KIXA 3HOYG 4DR2Q 4PZ7A 4GN5A 2KCTA 3U4VA 4H02A 2I5MX 1YHQA 5IY0A 5M5YH 3M4PA 3KOJA 2PI2A 4DR1Q 2K5NA 2ZM6L 1WJJA 5C44G 2AHOB 5C4XH 3CCLA 5M3MH 4GKKL 4AYBE 4Y52H 3NENA 2NN6I 4DR7L 4JI4L 2H5XA 1VQIA 1PYBA 5IYBH 2I0QA 5C0XG 5K36G 2PI2E 1FGUA 3W5OA 3PUZA 2Y0SG 3U58A 4AYBG 4HJ8A 4DR6L 1NTGA 4B3ML 3OYYA 3L7ZC 1IBKQ 4C2MH 2R7ZH 4DR4L 1K8AC 1EFWA 1PVOA 1SROA 4OX9L 1HH2P 3H0GG 3NEMA 4DUZQ 1PH9A 3TRZA 1YJ9A 1EWIA 4XIGS 1XMQQ 1TWHH 1WI5A 4IPDA 1G51A 1Q8KA 5IP9H 1VQNA 3S2HH 4B3RL 2BH2A 4C3IH 2JE6I 1I5FA 2JQOA 4LF7L 3RLOA 4BXXH 1N34L 4BY1G 5IE8A 1EQRA 1K0RA 1Q1BA 3PF5A 4R4QA 3KYHC 4NPSA 4ME3A 4LF6Q 2A8VA 1L2FA 2D0OA 4X6AH 2BA0A 4JV5Q 3G4SA 4DR1L 3PIPA 4DK3C 4DPGA 3CW2C 3GTJH 1L1OB 2UXBQ 4IOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 H;  1G29 1;  2IT1 A;  4GLA C;  4IPG A;  4A3E G;  1EQQ A;  1NJI C;  4JI8 Q;  1C7Y A;  1KHI A;  3HFZ B;  1GKH A;  2VS1 A;  1HNX L;  1Q1E A;  3S1M H;  1UWV A;  4LUZ A;  3PO3 H;  4BA2 I;  3GTK H;  4DAM A;  1N9W A;  1V9P A;  4NB3 A;  3OW2 A;  1BBW A;  4OO1 G;  2K75 A;  2R6G A;  2K5V A;  3ERS X;  3TS2 A;  3LGJ A;  3KFU A;  3HOZ G;  1S40 A;  1Y14 B;  1E24 A;  2E2J H;  2R7F A;  5M3F H;  2YTY A;  2WAQ E;  5HY6 A;  1IBK L;  3PUV A;  2BH8 A;  4A75 A;  4EX5 A;  3I2Z A;  2ZTC A;  1XNR Q;  1MKH A;  2JK8 A;  2XTI A;  4DUZ L;  1CSQ A;  1VQG A;  3S17 H;  3F2B A;  4AH6 A;  4P75 A;  1I3Q H;  3HOV G;  3CC2 A;  4BY7 G;  1A63 A;  4DAY B;  3GTP H;  1W3S A;  3JC6 6;  4A3K G;  1OXS C;  3I4N H;  1U5K A;  2L15 A;  4YWM A;  4IPC A;  3ULP A;  2V1C C;  3M9B A;  3D31 A;  4A3B G;  2Z6K C;  4A93 G;  2UXD Q;  3HOX H;  3I4O A;  1VQF A;  2OCE A;  5C3E G;  1YJN A;  4LF6 L;  4MZ9 A;  1K8G A;  2B63 G;  2WB1 E;  4LUV A;  5LMU Q;  2OTJ A;  4IO9 A;  2QGQ A;  4A3D H;  4JV5 L;  3J81 c;  4JG2 A;  5FLM G;  2KHI A;  3EBE A;  4C3H H;  4NXM L;  2JA8 G;  4R4C A;  1PA6 A;  4L5R C;  2E8G A;  2UXB L;  2AWN A;  5GAD C;  2R93 G;  1MIU A;  2OWO A;  2WB1 G;  3KJO A;  2RF4 A;  4JI8 L;  2B3G A;  1SMX A;  5IWA Q;  1VQ4 A;  3S1Q H;  4IFD J;  3J7A 5;  3CPW A;  3GDE A;  1D8L A;  3E9I A;  2D0P A;  3H15 A;  4PZ8 A;  1VQ9 A;  2HT1 A;  4JC0 A;  4TVA B;  4UP7 A;  4QJF A;  1XPR A;  4A3I H;  3KF6 B;  1LUZ A;  2EQS A;  4B3T Q;  4BBS G;  1JMC A;  1L1O C;  3GD7 A;  3AYH B;  3STB D;  5FLX c;  4OXP A;  2RHQ B;  3UDX A;  4HJ7 A;  1HJP A;  1XNR L;  4K0K Q;  3U4Z A;  4BBR G;  3F1Z A;  4LWC A;  3JAM c;  3E0E A;  4C3J H;  5IP7 G;  1CKO A;  3UDI A;  1Y1W H;  4A76 A;  3HOY H;  3ER0 A;  1SRU A;  1P16 A;  1Q12 A;  3CMA A;  1K83 H;  2WP8 J;  1JB7 A;  4IOC A;  4HIK A;  3I4M G;  1H95 A;  3WWV A;  2F4V Q;  1X9N A;  2UUC Q;  3M3Y H;  5E7N A;  4B3R Q;  2UXD L;  2RHS B;  5C44 H;  3H3V H;  3CCV A;  3T1Y Q;  1AE2 A;  1L1O A;  5LMU L;  3A5Z B;  2CFM A;  2E2I H;  3ULL A;  2MNA A;  5H1S E;  1NMF A;  5GAH C;  1X56 A;  3S15 H;  1SFO H;  4X66 Q;  1VQA A;  1PHJ A;  1BBU A;  3D0F A;  5IWA L;  3FKI G;  4BA1 I;  1G6P A;  2R92 G;  4OO1 I;  1E7Z A;  2F3I A;  2Y0S E;  4DV5 Q;  2QA4 A;  4YHH Q;  1VQJ A;  1HNX Q;  4HJ9 A;  1X3E A;  1Z9F A;  4KI0 A;  1TWF H;  2YTX A;  4B3T L;  1UEB A;  2LXK A;  3H0G H;  4KHZ A;  4JI3 Q;  3S14 H;  4OWW B;  2PMZ E;  2YYZ A;  3PF4 A;  3S16 H;  2VNU D;  4AIM A;  3A74 A;  1Q7Y C;  1JJG A;  1UE7 A;  4L5T A;  1VQ6 A;  4K0K L;  3G71 A;  1VS0 A;  3A0J A;  4IPH A;  3GTG H;  3L2P A;  3PUY A;  2OQ0 A;  1X54 A;  4A3L G;  4BY1 H;  3CCJ A;  1YHA A;  3UE0 A;  3PUX A;  1QZG A;  3TEH B;  2UXC L;  2FXQ A;  2F4V L;  1Z47 A;  1PH1 A;  4IFD I;  1GVP A;  1NBW A;  2UUC L;  2VW9 A;  4DR3 Q;  3RLN A;  3T1Y L;  4A3M G;  1PFS A;  2PNH A;  3CME A;  1V1Q A;  4A3E H;  4A3F G;  4KHP Q;  3J80 i;  1B7Y B;  1CKN B;  4GN4 B;  3MEF A;  4YCW A;  4JI1 Q;  3IRB A;  4X66 L;  4OWX B;  1XJV A;  1X65 A;  4NXM Q;  2GVA A;  4R1J A;  2JA7 G;  3S1N H;  1UE6 A;  1O7I A;  2EIF A;  2Q2I A;  3AQQ A;  4FDB A;  4X62 L;  5LMN Q;  3UE1 A;  3CD6 A;  4GOP C;  3TQY A;  3KF6 A;  4DV5 L;  4A3G G;  4YHH L;  3K7U C;  3EN2 A;  3UDF A;  3KDF A;  4Y7N H;  4ALP A;  4JOI C;  4JI3 L;  3CCU A;  3RN5 A;  2MO1 A;  2NZH A;  3K0X A;  4BY7 H;  3CCS A;  3CCQ A;  1DGS A;  3HOV H;  1CUK A;  1N33 Q;  4DV1 Q;  3AFQ A;  1WOC A;  4A3K H;  1VQO A;  3OTO Q;  1RL2 A;  3PCO B;  3BU2 A;  2NVY H;  2VUM G;  1J5E Q;  5BR8 Q;  4DV7 L;  2R7D A;  4A3B H;  4A93 H;  3U50 C;  1NMG A;  1Q81 C;  1HR0 Q;  2OQK A;  3FHW A;  1KRT A;  2K4K A;  2K50 A;  5C3E H;  3W1B A;  1B70 B;  4YCV A;  4A3J G;  1GM5 A;  5DLQ E;  5C0X J;  4LF5 Q;  2MQH A;  2PQA B;  3PUW A;  1CKM A;  5FLM H;  4JI7 Q;  4JYA Q;  5JEA G;  4TQU S;  2JA8 H;  1A62 A;  4HIO A;  4DR3 L;  3GTM H;  2R93 H;  1KQS A;  4JOI A;  1KC8 C;  1I50 H;  1VQ8 A;  1X55 A;  4KHP L;  1KXL A;  1KD1 C;  5IYC G;  4X64 Q;  4XTC S;  3GTO H;  4DKA C;  4POG A;  2CCZ A;  1VQH A;  4KLK A;  4P72 A;  3J81 i;  1AE3 A;  1N32 Q;  1A8V A;  1UE1 A;  4JI1 L;  1U0L A;  3CCM A;  2OTL A;  3H3V I;  3T1H Q;  4GLV B;  5GRO A;  1WYD A;  1WFQ A;  1JT8 A;  3CAM A;  1PYS B;  4UP9 A;  1IZ6 A;  4P71 A;  5LMN L;  1K9M C;  2KBN A;  1E22 A;  5ELO A;  4BBS H;  4DV3 Q;  1AH9 A;  2ASB A;  2N8N A;  2YU9 H;  3BZC A;  1HZ9 A;  2LXJ A;  5C0X I;  1Q86 C;  1K73 C;  4JI0 Q;  1VQM A;  2JEA I;  1JE5 A;  4O2D A;  4YWL A;  5C4J H;  4MTN A;  4BBR H;  2KCM A;  1HNZ Q;  3W1G A;  5IP7 H;  3M85 A;  1Y1V G;  2Z6K A;  1B8A A;  1N33 L;  4DV1 L;  4RG1 A;  3I4M H;  3BZK A;  2MO0 A;  4DV2 L;  1YI2 A;  4LW1 A;  4OON A;  3OTO L;  3FP9 A;  1I6H H;  4YWK A;  2IY5 B;  1J5E L;  5BR8 L;  2ZJP A;  3KDF B;  1LTL A;  4UY8 C;  3KLW A;  4JBJ A;  1E1T A;  3J7Z C;  1HR0 L;  3HKS A;  3GTL H;  4A4I A;  2ID0 A;  1CSP A;  1P8L A;  2VL6 A;  4LF5 L;  2B29 A;  2ATW A;  3VDY A;  3PSI A;  2CWA A;  1VQ5 A;  4JI7 L;  2VZA A;  4P74 A;  4JYA L;  2VQF Q;  2UXC Q;  3CQZ H;  1VQ7 A;  3HOW G;  4HID A;  1WCM G;  1X3F A;  1CKN A;  3UDG A;  1R9T H;  3RZD H;  4GOP B;  1X6O A;  2K5H A;  3FKI H;  1TWG H;  4X64 L;  4A3C G;  2JA5 G;  2Q2H A;  2R92 H;  1M1K C;  3PO2 G;  4IJH A;  1N32 L;  1HZA A;  1SR3 A;  4IJL A;  2GVB A;  3T1H L;  5HGQ A;  2I5L X;  4EQ5 A;  2YTV A;  3I7F A;  4R4O A;  1IYJ B;  1SN8 A;  4QY7 A;  3KJP A;  4DV3 L;  1VQP A;  1HR0 W;  1J6Q A;  4X62 Q;  1VQL A;  4JBW A;  1S72 A;  3I56 A;  4JI0 L;  5ELN A;  3EIV A;  2HIX A;  2AMC B;  3DM3 A;  1NE3 A;  1QUQ A;  1HNZ L;  3HOU G;  2NVQ H;  1I94 Q;  2HHH Q;  4A3L H;  3AFP A;  1PH2 A;  3L0O A;  5IYD G;  4QQB X;  1IXR A;  4YCU A;  2ZTD A;  1VQC A;  5GAG C;  5GAE C;  4QGU A;  3S1R H;  1EYG A;  2PQA A;  2KHJ A;  4POF A;  1C9O A;  1X3G A;  3HKZ E;  4DV7 Q;  4A3M H;  3CXC A;  3RLF A;  4DV0 L;  1XPU A;  1QVC A;  1YZ6 A;  1SLJ A;  4A3F H;  2VQE Q;  1HNW Q;  1N36 Q;  2JA6 G;  3E9H A;  2HIV A;  4HIM A;  2VQF L;  3NBH B;  3G6E A;  1IL2 A;  2E2H H;  4B3S L;  3HKZ G;  1TWA H;  4OWT B;  1V43 A;  3I55 A;  3AEV A;  5EAY A;  2JA7 H;  3Q8D A;  1L0W A;  4PZ6 A;  4WJ4 A;  5AJ3 Q;  4LFA L;  4DUY Q;  1EUJ A;  2C35 B;  3M4Q A;  1OXT A;  2XGT A;  2EXD A;  1M90 C;  3GO5 A;  4A3G H;  2Z0S A;  1EOV A;  2N49 A;  1JJC B;  4GN3 B;  4DK6 C;  1Q82 C;  4LFB Q;  5C4X G;  2F52 A;  4APV A;  5M3M G;  1YNX A;  5J3B A;  3PV0 A;  4PG3 A;  1OTC A;  3SGI A;  4LF9 Q;  3K8A A;  5IYB G;  1QVG A;  4QL5 A;  3RN2 A;  2BA1 A;  4GKJ Q;  4JCV E;  3F8T A;  3HOZ H;  5JJI A;  4PMW A;  3TS0 A;  2LSS A;  2ZJQ A;  1OXV A;  4GS3 A;  3ULJ A;  2VUM H;  1PH6 A;  4WJ3 M;  1I94 L;  1EIF A;  2HHH L;  3TRE A;  3MXN B;  4LUO A;  4YY3 Q;  1LM0 A;  4IFD G;  2CWP A;  4GNX B;  1K3R A;  4HJA A;  2R7Z G;  2WFW A;  2UUB Q;  1SE8 A;  2D62 A;  4UPA A;  4DV4 L;  4A3J H;  1YHB A;  1XPO A;  1YIT A;  1S3O A;  1PH3 A;  1PH8 A;  4DR2 L;  4JI5 Q;  1D7Q A;  1QUQ B;  1C0A A;  4DV2 Q;  1XNQ Q;  2UUA Q;  3J80 c;  1HZC A;  1KAW A;  5M5W H;  3M4O H;  4UP8 A;  1IBM Q;  1LYL A;  5IP9 G;  3J81 j;  3G48 A;  4LF4 Q;  2VQE L;  2VY3 A;  4LFC Q;  1N36 L;  1HNW L;  5IYC H;  3CCR A;  2NVX H;  4GOP A;  2B63 H;  2DGY A;  2UU9 Q;  4BXX G;  4R4I A;  2IHF A;  1YIJ A;  1XMO Q;  4JBM A;  2QEX A;  4LF8 Q;  4LNQ A;  2ALY B;  4GLX A;  5AJ3 L;  2N78 A;  4DUY L;  5JJL A;  4HJ5 A;  1MJC A;  5IT9 c;  3RNU A;  3CC4 A;  2JA9 A;  2A19 A;  1BVS A;  2NVT H;  2NN6 G;  4J15 A;  4DV6 Q;  4LFB L;  2K52 A;  1A0I A;  5FJ8 G;  4DR5 Q;  3PIO A;  4AQY Q;  2GN5 A;  1IBL Q;  4LF9 L;  2JJQ A;  3PO3 G;  1Y1V H;  2AWO A;  3CCE A;  4JI6 Q;  3K81 C;  4GKJ L;  4X65 Q;  1PV4 A;  1GD7 A;  1FJG Q;  2WAQ G;  1XMQ L;  1YEZ A;  3NEL A;  1HZB A;  2HQL A;  4JI2 Q;  2N3S A;  3A5U A;  3CC7 A;  4L5S A;  5M3F G;  4YY3 L;  2NZO A;  1RIP A;  1MJE A;  3RZO H;  1QVF A;  1FVI A;  2UUB L;  1YBY A;  5GQO A;  3M7N A;  1E1O A;  4JI5 L;  2I5H A;  3K80 C;  4MNO A;  1E3P A;  2E5L Q;  4JBK A;  1W2B A;  2UUA L;  4NXN Q;  1XNQ L;  3HOW H;  3S2D H;  1WCM H;  5M5X H;  1IBM L;  4LF4 L;  3JAM i;  3I4N G;  1JJ2 A;  4RMF A;  4LFC L;  4O0A A;  2JA5 H;  4L5Q A;  4DV0 Q;  3STB C;  4GNX C;  2UU9 L;  3PO2 H;  2ZJR A;  3HOX G;  2ZM6 Q;  3CF5 A;  1XMO L;  2ZTE A;  5LMN W;  4LF8 L;  1ASY A;  3S24 A;  3PGZ A;  4B3S Q;  4GKK Q;  2IX1 A;  4A3D G;  1T9H A;  1XTD A;  2ES2 A;  4JI4 Q;  1TXY A;  3DLL A;  1PH4 A;  1PH7 A;  2YV5 A;  4DR7 Q;  4A3C H;  1Q46 A;  1UE5 A;  4P73 A;  4LFA Q;  4DV6 L;  3CPF A;  2CQO A;  1QZH A;  2Q2T A;  4DR5 L;  3ZJY C;  3F2C A;  3RR5 A;  4AQY L;  1VQB A;  1YJW A;  2Q2U A;  2DUD A;  2K14 A;  1IBL L;  3HOU H;  4DR6 Q;  4B3M Q;  1TWC H;  4JI6 L;  1VQE A;  1NY4 A;  2CKZ B;  2KEN A;  4X65 L;  1OXX K;  2JEB I;  1VQK A;  1GO3 E;  2IHE A;  1PH5 A;  4DR4 Q;  5JEA J;  3K7A H;  1OXU A;  1YVC A;  3F2D A;  1VCI A;  4GNX A;  1FJG L;  4A3I G;  4OX9 Q;  5IYD H;  4QIW E;  5JJK A;  2MFI A;  1N8R C;  4R4T A;  1ASZ A;  1EIY B;  4JI2 L;  1BKB A;  3CP0 A;  3KF8 B;  1FL0 A;  1VQD A;  3B6Y A;  4DNI A;  1KRS A;  2IX0 A;  3BJU A;  3ICE A;  2A1A A;  2JA6 H;  2AKW B;  4LF7 Q;  2E5L L;  1KL9 A;  1N34 Q;  4NXN L;  4DV4 Q;  3GTQ H;  1Y1W G;  2RCN A;  1KIX A;  3HOY G;  4DR2 Q;  4PZ7 A;  4GN5 A;  2KCT A;  3U4V A;  4H02 A;  2I5M X;  1YHQ A;  5IY0 A;  5M5Y H;  3M4P A;  3KOJ A;  2PI2 A;  4DR1 Q;  2K5N A;  2ZM6 L;  1WJJ A;  5C44 G;  2AHO B;  5C4X H;  3CCL A;  5M3M H;  4GKK L;  4AYB E;  4Y52 H;  3NEN A;  2NN6 I;  4DR7 L;  4JI4 L;  2H5X A;  1VQI A;  1PYB A;  5IYB H;  2I0Q A;  5C0X G;  5K36 G;  2PI2 E;  1FGU A;  3W5O A;  3PUZ A;  2Y0S G;  3U58 A;  4AYB G;  4HJ8 A;  4DR6 L;  1NTG A;  4B3M L;  3OYY A;  3L7Z C;  1IBK Q;  4C2M H;  2R7Z H;  4DR4 L;  1K8A C;  1EFW A;  1PVO A;  1SRO A;  4OX9 L;  1HH2 P;  3H0G G;  3NEM A;  4DUZ Q;  1PH9 A;  3TRZ A;  1YJ9 A;  1EWI A;  4XIG S;  1XMQ Q;  1TWH H;  1WI5 A;  4IPD A;  1G51 A;  1Q8K A;  5IP9 H;  1VQN A;  3S2H H;  4B3R L;  2BH2 A;  4C3I H;  2JE6 I;  1I5F A;  2JQO A;  4LF7 L;  3RLO A;  4BXX H;  1N34 L;  4BY1 G;  5IE8 A;  1EQR A;  1K0R A;  1Q1B A;  3PF5 A;  4R4Q A;  3KYH C;  4NPS A;  4ME3 A;  4LF6 Q;  2A8V A;  1L2F A;  2D0O A;  4X6A H;  2BA0 A;  4JV5 Q;  3G4S A;  4DR1 L;  3PIP A;  4DK3 C;  4DPG A;  3CW2 C;  3GTJ H;  1L1O B;  2UXB Q;  4IOA A; 
#chains in the Genus database with same CATH topology
 1G29 1;  3N6R A;  4A3E G;  4JI8 Q;  2VS1 A;  5A35 A;  3CRL C;  4LUZ A;  4BA2 I;  2F0K A;  2M2L A;  1LT5 D;  3E3X A;  4KMU C;  3OW2 A;  2PMZ B;  2NVQ B;  1ZXT A;  2K75 A;  5E4X A;  2K5V A;  2PPB C;  3LGJ A;  3QG1 A;  1CTM A;  1PFM A;  5ELF A;  4ABN A;  2R7F A;  5M3F H;  2YTY A;  2MHV A;  5HY6 A;  4DU9 A;  1RCV D;  2OEO A;  2ZTC A;  2JK8 A;  3GTG B;  1EQV A;  1E2W A;  1LTS D;  3D6C A;  1CSQ A;  1VQG A;  2L0C A;  4PQX A;  4A3F B;  4BY7 G;  3CC2 A;  3I4N H;  2PZT A;  1TS2 A;  2V1C C;  2JA7 B;  1GXD C;  3HOX H;  4C1N K;  1PZI D;  4LF6 L;  4MZ9 A;  3R2T A;  4JV5 L;  4NXM L;  2JA8 G;  1ET6 A;  2AWN A;  4LMQ D;  4N9P A;  2OWO A;  2WB1 G;  1VQ4 A;  3S1Q H;  1XYI A;  1SMX A;  3HOZ B;  3J7A 5;  3I8Z A;  3H15 A;  4PZ8 A;  4JC0 A;  1IKM A;  3E0J A;  1R4Q B;  1WTO A;  2Z8L A;  1XPR A;  3FRP B;  3E5S A;  4PNY A;  4HED A;  3T13 A;  5C3X A;  5FLX c;  2RHQ B;  1O80 A;  3JAM c;  2LY7 A;  3HOY H;  2B63 B;  3C1E A;  3T16 A;  2FHT A;  4G7O C;  1VMP A;  4ZUJ A;  3H3V H;  2R93 B;  3T1Y Q;  2K05 A;  1STY A;  2NVT B;  2K01 A;  5FO7 B;  2KCN A;  5JOB A;  4XYQ A;  2E2I H;  2MNA A;  3V2T A;  5C0X H;  5GAH C;  5K36 H;  3NWT A;  1RJT A;  1BBU A;  1NNX A;  3D0F A;  2A68 C;  3LWU A;  3AB9 A;  4DV5 Q;  1UUP A;  4KV6 A;  1BCP F;  4HJ9 A;  1D5M C;  1SMY D;  5DM6 3;  2EYJ A;  4B3T L;  2KHS A;  4KHZ A;  3S14 H;  4JI3 Q;  3KLS X;  4OWW B;  1ENC A;  5IGF A;  1C4Q A;  1VQ6 A;  4RCN A;  3S2D B;  1JOO A;  4TRD A;  3GTG H;  5M5X B;  3L2P A;  3AMU A;  2OQ0 A;  3F2U A;  1Z6H A;  1DJR D;  1HUM A;  1AP0 A;  3NK9 A;  2UXC L;  1STE A;  5FLX L;  4KD3 A;  2F4V L;  2F03 A;  4NMZ A;  2L1B A;  1LAB A;  3JAM L;  4K2K A;  3FEW X;  3RLN A;  1PFS A;  2PNH A;  5HGT A;  4A3F G;  4KHP Q;  2Q8I B;  3RD4 A;  2AQ1 B;  4GN4 B;  1BQQ T;  3I73 A;  4OWX B;  4X66 L;  2JA7 G;  2F3V A;  3S1N H;  3MXG A;  1O7I A;  2EIF A;  5LMN Q;  1FYC A;  4IUT A;  1G6Z A;  1SYB A;  1BCP B;  3K5O A;  4ZCK A;  1JE4 A;  5IGB A;  5COR A;  2HQE A;  5A2Q L;  1B53 A;  3K0Y A;  4IUN A;  1X32 A;  2MO1 A;  3CCS A;  3HOV H;  1CUK A;  3AFQ A;  1J9O A;  4A3K H;  2NVY H;  1J5E Q;  4A93 H;  1NMG A;  1DOM A;  1FNV A;  2OQK A;  4RGT A;  2K4K A;  2K50 A;  2EYP A;  2XWB B;  5C0X J;  2F0D A;  5C4X B;  1JOR A;  1D2B A;  1JWM D;  3GTM H;  2R93 H;  1VQ8 A;  3VR6 A;  1X3Q A;  1QNK A;  3GTO H;  1N32 Q;  1UE1 A;  1U0L A;  1MD2 D;  1E2Z A;  3H3V I;  1WFQ A;  3CAM A;  1EY9 A;  1PYS B;  4UP9 A;  1JWU D;  5CV8 A;  1PTO D;  5C0X I;  1Q86 C;  3GQB A;  3MWY W;  1AZQ A;  1JE5 A;  3HEJ A;  4L8J A;  3W1G A;  5I9P A;  4BWG B;  3S2H B;  2D2C C;  4C3I B;  3BZK A;  2MO0 A;  4LAA A;  2IY5 B;  4K8J A;  4YWK A;  3KDF B;  3WDN A;  1LTL A;  1XXG A;  4UY8 C;  3J7Z C;  1E1T A;  3HKS A;  4E6I A;  1JOK A;  2VL6 A;  2ATW A;  4LF5 L;  2KQ3 A;  2ZXO A;  3C2P A;  1ET9 A;  2JP1 A;  2CWA A;  4JI7 L;  4OIK A;  2L12 A;  4P74 A;  5C5M A;  2VQF Q;  3S1M B;  4HID A;  1X3F A;  2EYF A;  3UDG A;  4U67 3;  1Y69 U;  1A3T A;  4I65 A;  4KD4 A;  4GOP B;  2K5H A;  3I72 A;  4X64 L;  3EA6 A;  2Q2H A;  2R92 H;  4IJH A;  1SXT A;  4IJL A;  5HGQ A;  4KY6 A;  2I5L X;  5IT9 L;  2DY8 A;  3I7F A;  4R4O A;  1B3Q A;  1SN8 A;  4QY7 A;  3ERO A;  5FO8 B;  1VQP A;  4A3C G;  4FYD A;  1S72 A;  3I56 A;  1ROD A;  5ELN A;  4H44 C;  3QOL A;  3S17 B;  1KAA A;  3BZD B;  4JK1 C;  4A3L H;  4KN4 C;  4RGO S;  1LAC A;  1QIL A;  5TSS A;  5GAE C;  5GAG C;  5HUR A;  4QGU A;  3FVQ A;  2KHJ A;  1VF5 C;  1PFB A;  5LL6 S;  3TBI B;  4C3H B;  3RLF A;  2VB3 X;  1CK1 A;  3E9H A;  1BBX C;  3A55 A;  1YNJ C;  2E2H H;  1Y8N B;  5ELB A;  4OWT B;  3AEV A;  5EAY A;  1D5X C;  3HGB A;  3G7L A;  1H9M A;  1OXT A;  4DNR B;  2EPB A;  4GN3 B;  1Q82 C;  3KK7 A;  5C4X G;  4WRD A;  3NWS A;  4LF9 Q;  1DOK A;  3K8A A;  4IN3 A;  5ELD A;  2XVS A;  2QKI C;  4PMW A;  2ZJQ A;  5CV5 A;  1Y1W B;  3KLS A;  2K7V A;  1I94 L;  2HHH L;  3MXN B;  4LUO A;  1LM0 A;  1CQF A;  1S5E D;  2R7Z G;  4P2C B;  5C44 B;  4XT1 B;  3PMF A;  1C0A A;  3J80 c;  1HZC A;  5M5W H;  1HXY D;  3L3O C;  4QUF A;  2J7Z A;  3J81 j;  4C3I G;  3CCR A;  1STG A;  4GOP A;  1CM9 A;  2SNS A;  4X3T A;  1ZEQ X;  4S3S A;  2ALY B;  2CH4 W;  5L37 A;  4DUY L;  4DN4 M;  4RHR A;  2RSO A;  4G57 A;  2A19 A;  3H0G B;  4DR5 Q;  3S16 B;  3N52 A;  2OF1 A;  1B44 D;  1O7Z A;  4AQY Q;  2JJQ A;  1F2Z A;  3NXW A;  4BS9 A;  1T5E A;  2AWO A;  1QWY A;  3K81 C;  2I46 A;  4GKJ L;  5CMD A;  2RVL A;  4X65 Q;  2O4X A;  3MA2 B;  5AFW A;  1GD7 A;  3NEL A;  1SNQ A;  2N3S A;  1HFN A;  4YY3 L;  3G6J B;  3MAQ A;  1FVI A;  1YBY A;  4CJ0 B;  3A7L A;  3K80 C;  3IAY A;  1E3P A;  1XNQ L;  1H9K A;  1ZKO A;  1SYD A;  4L6T B;  1B9M A;  4JW0 A;  4ME5 A;  4RMF A;  4LFC L;  1SAP A;  1KLU D;  1S5C D;  2N88 A;  2F0U A;  4EQN A;  5EBD A;  2PYK A;  4LF8 L;  2ENB A;  1ASY A;  3J80 L;  1Q8I A;  3S24 A;  3PGZ A;  1PLF A;  1XTD A;  2MP1 A;  4JI4 Q;  3H94 A;  4C3H G;  1PH4 A;  4DR7 Q;  2FMC A;  4Y7N B;  2Q2T A;  1IKL A;  3F2C A;  4L63 B;  3RR5 A;  1CZG A;  2QCP X;  4B3M Q;  1TWC H;  2HUG A;  3K5M A;  1NY4 A;  2WIN B;  1VQK A;  1OXX K;  1GO3 E;  3MXN A;  1YVC A;  4FF2 A;  4KJN A;  3SK5 A;  4DNI A;  5CV9 A;  2Z6B A;  2A1A A;  4FF3 A;  3LNN A;  4LF7 Q;  2EJG C;  2NTS A;  3GTQ H;  1Y1W G;  1SMY C;  2EY2 A;  4DR2 Q;  1YHQ A;  2FMM A;  1IYU A;  4DR1 Q;  1MHW C;  2K5N A;  2F1M A;  1DCZ A;  5C44 G;  4G7Z C;  2LKV A;  1F9Q A;  4GKK L;  2R61 A;  3J81 L;  1K8O A;  4Y52 H;  1VQI A;  1PYB A;  2I0Q A;  2CVR A;  4BBR B;  1QJO A;  3W5O A;  3I70 A;  3U58 A;  1W6K A;  4HJ8 A;  3BDL A;  3SHL A;  1T5X D;  2B2V A;  1ESF A;  3L7Z C;  4DR4 L;  5E1F A;  3H0G G;  1YJ9 A;  4QB4 A;  1EWI A;  1WD0 A;  1PXU A;  2RQX A;  1TWH H;  1WI5 A;  5IP9 H;  3CQZ B;  4B3R L;  5G3L F;  2JE6 I;  3RLO A;  1K0R A;  1Q1B A;  4R4Q A;  4NPS A;  2EYL A;  4LF6 Q;  2F0F A;  4X6A H;  2F0P A;  2BA0 A;  4JV5 Q;  4J8Q A;  3G4S A;  1K3B C;  3CW2 C;  1G2S A;  4FO2 A;  2IT1 A;  1SYF A;  1C7Y A;  4HAE A;  2NWG A;  1KHI A;  1HNX L;  2SEB D;  1TY0 A;  3GTK H;  1G8Z D;  1N9W A;  4FF4 A;  1NAP A;  4ILW A;  4NB3 A;  4OO1 G;  2BE5 C;  2R6G A;  3ERS X;  4QUC A;  2A74 C;  5JJZ A;  1WTR A;  2E2J H;  2B2T C;  2WAQ E;  4MTK A;  5FLX E;  3S1R B;  3I2Z A;  2A73 B;  1MKH A;  2XTI A;  4DUZ L;  3JAM E;  4RKL A;  2PCF B;  5EPL A;  1W3S A;  2CH4 A;  2L15 A;  3CRK C;  5T1G A;  1VDZ A;  3D31 A;  3Q0A A;  2Z6K C;  2RA4 A;  3I4O A;  1VQF A;  2E75 C;  1DOL A;  2B2T A;  4KY5 A;  5FLM G;  3EBE A;  4UDU C;  1RTN A;  2O2L D;  2RKS A;  2E8G A;  3C46 A;  4LK1 C;  2J4X A;  1MIU A;  4RH6 A;  3K59 A;  2R3Z A;  2D0P A;  4UP7 A;  2F0O A;  4A3I H;  4B3T Q;  1V8Q A;  3QOJ A;  1BF4 A;  4XQJ A;  1JB3 A;  4BBR G;  3F1Z A;  3M4O B;  4LWC A;  5CV4 A;  1HRJ A;  1O78 A;  1EY0 A;  1CKO A;  4H0L C;  2NUC A;  1CFM A;  3UDI A;  1JB7 A;  1SRU A;  1P16 A;  1H95 A;  2WP8 J;  2F0V A;  3WWV A;  1B50 A;  2F4V Q;  3CKI B;  1AFP A;  5E7N A;  2UXD L;  2GA4 B;  2RHS B;  4DF7 A;  1HCZ A;  3MHB A;  3A5Z B;  4TKO B;  5KNB A;  4NKL A;  1NMF A;  1SFO H;  5EGT A;  1BR9 A;  4X66 Q;  2SOB A;  1PHJ A;  1MGS A;  4FP5 D;  1G6P A;  1NUC A;  1SEB D;  4OO1 I;  2EZV A;  1YNN C;  1EY5 A;  1D5Z C;  1B1Z A;  1X3E A;  4IQZ A;  2YTX A;  1XTC D;  2M9V A;  2L4N A;  1Q7Y C;  1UE7 A;  4L5T A;  2KOL A;  4K0K L;  1WCM B;  5JAV A;  5KYI A;  3PUY A;  1TY2 A;  3VR2 A;  1YHA A;  2K5Q A;  3PUX A;  2JA5 B;  3V05 A;  4KKS A;  4C1N I;  2AQ2 B;  2L55 A;  5IGD A;  1PH1 A;  1O7L A;  1NBW A;  3VA5 A;  1A15 A;  4B9X A;  1EU4 A;  1NSN S;  4R8I A;  1V1Q A;  4HSP A;  4A3E H;  2IW3 A;  2ZXP A;  4IUU A;  1B7Y B;  4ZYS A;  3ITP A;  2B2W A;  5C4Z A;  2BCO A;  3K5N A;  2KJX A;  3HOU B;  4YCW A;  3WOF A;  5C6A A;  1X65 A;  5LL6 X;  4R1J A;  4ZKB B;  3OMG A;  3CD6 A;  5I2X A;  1K28 A;  1KDB A;  4DFA A;  3K7A B;  3TQY A;  1JWS D;  3BS1 A;  3UDF A;  4K5W A;  4ALP A;  1CT1 D;  4CJ1 B;  3RN5 A;  2SNM A;  4BY7 H;  2JA6 B;  1EQT A;  1VQO A;  1U4L A;  4CKB A;  2VUM G;  1Q81 C;  5M5Y B;  3FHW A;  1PRT D;  4LF5 Q;  2PQA B;  4J6H A;  5I6W A;  1IYV A;  4JI7 Q;  3T51 B;  2JA8 H;  5M3M B;  3D3R A;  1I50 H;  1TII D;  5JPM C;  1KXL A;  3DM1 A;  4X64 Q;  3R3O A;  4POG A;  1VQH A;  2F0Q A;  1AE3 A;  1C48 A;  4JI1 L;  4PV1 C;  1DYQ A;  3SK4 A;  4DGZ A;  1RTO A;  1IZ6 A;  4P71 A;  4C2M B;  5ELO A;  5IIF A;  4KTA A;  2LMC B;  2YU9 H;  2LXJ A;  1K73 C;  5IOC A;  4HN7 A;  2KEC A;  3SEB A;  1SJH D;  1EFI D;  1B8A A;  1N33 L;  4DV1 L;  4RG1 A;  1YI2 A;  3FP9 A;  2ZJP A;  1BUV T;  3NBH A;  4JBJ A;  1DM0 B;  1EOT A;  4A4I A;  1CSP A;  1P8L A;  2B29 A;  3GTJ B;  3PSI A;  3DEO A;  4JYA L;  3H3V C;  2WKC A;  5EQ0 A;  1WCM G;  5KND A;  3URY A;  4RCO A;  3PO3 B;  5I6Y A;  1V1P B;  3RZD H;  3I90 A;  3W2D A;  2JA5 G;  1M1K C;  1IW7 C;  4WFN 3;  1L0X B;  1HZA A;  1CQV A;  2XNA C;  4EQ5 A;  1D1K A;  5BN3 A;  4Q0F A;  3DHQ A;  3KJP A;  4X62 Q;  4JI0 L;  1M8A A;  2K5W A;  5COY A;  1I3Q B;  1NE3 A;  1QUQ A;  1HNZ L;  3HOU G;  2NVQ H;  3GTP B;  1I94 Q;  2MUY A;  2HHH Q;  1Z7T A;  3AFP A;  1ZYR D;  5I9O A;  5IYD G;  1UEA B;  4ZK9 B;  1IXR A;  2ZTD A;  1VQC A;  2PQA A;  1C9O A;  3HKZ E;  3J80 E;  4A3D B;  4DV7 Q;  3TDQ A;  3CXC A;  4DV0 L;  4A3F H;  2JA6 G;  4KJO A;  2OT2 A;  1IL2 A;  4B3S L;  1SE4 A;  3I55 A;  2WV6 D;  3Q8D A;  2JA7 H;  4PZ6 A;  4WJ4 A;  4DUY Q;  1EUJ A;  4ZKC B;  4OEL B;  2EXD A;  4LJZ C;  3GO5 A;  1EOV A;  3D4W A;  1F9S A;  3P20 A;  3OIP A;  1EY8 A;  1EIH A;  1L0Y B;  4APV A;  5M3M G;  5J3B A;  1OTC A;  3SGI A;  4CGY B;  5IYB G;  4GKJ Q;  3PIO 3;  5CC4 A;  4MIU A;  3HOZ H;  5EBC A;  4C3J B;  1Q90 A;  2NTT A;  2LSS A;  2HDM A;  1C8C A;  1AZP A;  1DXM A;  1PH6 A;  1K83 B;  4IFD G;  4EVO A;  4YY3 Q;  1F2L A;  2WFW A;  4R8N A;  3M3Y B;  2D62 A;  4OIJ A;  1MI2 A;  1YHB A;  3MFY A;  1PH3 A;  1PH8 A;  1KTK A;  1NCV A;  4DV2 Q;  1XNQ Q;  1I4G A;  4UP8 A;  2VY3 A;  1B3A A;  4LFC Q;  3S15 B;  1V1P A;  2G5D A;  4X3S A;  4BXX G;  2B63 H;  4AYB B;  4JBM A;  4CDE C;  2SDF A;  4LF8 Q;  2KVM A;  3ND9 A;  3R8B A;  5AJ3 L;  5JJL A;  4HJ5 A;  2F0M A;  5IT9 c;  1KNE A;  2JA9 A;  4CDC C;  2NVT H;  4J15 A;  4LFB L;  4B08 A;  2QIL A;  2KED A;  1PZJ D;  2K52 A;  5FJ8 G;  2GN5 A;  2EOT A;  3PO3 G;  1TS5 A;  2R7Z B;  1PV4 A;  4BY1 B;  2TSS A;  2NZ1 D;  2WAQ G;  4CDD C;  1YEZ A;  1SNC A;  3U9S A;  2NZO A;  1QVF A;  2UUB L;  2QW7 A;  3H91 A;  1E1O A;  3NBI A;  4JI5 L;  3IFT A;  2UUA L;  3S2D H;  4O42 A;  4G7H C;  5M5X H;  4IUP A;  3D6W A;  4OGQ C;  1GUS A;  3JAM i;  4LF4 L;  1JJ2 A;  4IZ8 A;  3P75 A;  2WAC A;  4O0A A;  2AQ3 B;  2UU9 L;  5I2Y A;  2ZJR A;  1XMO L;  2NBF A;  5LMN W;  1WTX A;  2FJ2 A;  3QJY A;  1HHV A;  1B4O A;  4GKK Q;  3BVZ A;  2IX1 A;  4A3D G;  4A3C H;  1Q46 A;  4LFA Q;  4P73 A;  4DV6 L;  3CPF A;  3OIQ A;  2CW0 D;  1HPC A;  1IBL L;  3TP7 A;  3WOE A;  3T53 B;  2CKZ B;  4Q5V A;  4DR4 Q;  4A3B B;  1OXU A;  4QIW E;  2A6H C;  2MFI A;  5C3E B;  1N8R C;  1ASZ A;  4JI2 L;  1BKB A;  1EEI D;  1VQD A;  1EEF D;  2IX0 A;  1WTP A;  1Y8O B;  4C3J G;  4NXN L;  4DV4 Q;  5D65 A;  1NR4 A;  4PZ7 A;  3T4A C;  2KCT A;  3U4V A;  1JOQ A;  2K03 A;  2BOS A;  3KOJ A;  4PMB A;  3DWQ A;  3TZU A;  1EWH A;  2PW7 A;  5FKA C;  5KIX A;  2ZM6 L;  5C4X H;  1MBY A;  3SDZ A;  3NEN A;  1WVL A;  2K04 A;  2FIN B;  5CV7 A;  5C4J B;  3QB3 A;  3QR8 A;  1VMC A;  2PI2 E;  1FGU A;  2N55 A;  3U9O A;  3PUZ A;  4AYB G;  3I4M B;  3OW7 A;  4F7X A;  3EFX D;  3KBG A;  1D6E C;  3L9A X;  4DAY A;  1ICF B;  2DJF C;  2R7Z H;  1QOH A;  4EGV A;  1EFW A;  2QEJ C;  1SRO A;  1HFG A;  3OOC A;  3NEM A;  4MHE A;  4DUZ Q;  3GTL B;  3TRZ A;  5FO9 B;  1F2M A;  5JVG 3;  3X3M A;  1XMQ Q;  4ID6 A;  2EY5 A;  1G51 A;  3TP5 A;  3S2H H;  5KYL A;  4HR7 B;  1R4P B;  4C3I H;  1K0S A;  5CBE E;  1R9T B;  3HP3 A;  2Z4I A;  1N34 L;  4BY1 G;  5IE8 A;  3FKI B;  1II3 A;  1TWG B;  3QO2 A;  2HCC A;  3KYH C;  2K28 A;  3HZX A;  4ME3 A;  2D0O A;  1FR3 A;  3D8G A;  1MSH A;  4OL7 A;  2NYZ D;  3PIP A;  4DPG A;  2J0T D;  1L1O B;  3A8K E;  4K8I A;  5F2D A;  4IPG A;  1NJI C;  1EQQ A;  3S1M H;  3HFZ B;  1UWV A;  5EPJ A;  1LT6 D;  4DAM A;  1V9P A;  3TS2 A;  1TWF B;  1SBB B;  3KFU A;  1I4X A;  1Y14 B;  3SE0 A;  1S5B D;  1HTL D;  1IBK L;  3PUV A;  2BH8 A;  4IUQ A;  2BDO A;  1JQY D;  1U4P A;  4A3M B;  3S17 H;  4AH6 A;  2RDG A;  1A63 A;  4KK7 A;  1U5K A;  2A6E D;  1TWA B;  4IPC A;  3ULP A;  1SE2 A;  3FPU B;  1HQM C;  4A3B G;  2UXD Q;  5C3E G;  5ELE A;  4CDF C;  4A3G B;  2WB1 E;  4LUV A;  3J81 c;  4JG2 A;  4C3H H;  3TN2 A;  4R4C A;  4KKT A;  4L5R C;  1V1O A;  5GAD C;  3K5L A;  3MEH A;  3VYS A;  2B3G A;  3OPO A;  3GDE A;  1VQ9 A;  2HT1 A;  4TVA B;  1Q3L A;  2JSO A;  2RBM A;  4QJF A;  4BBS G;  1L1O C;  4A3J B;  1TQO A;  3DEP A;  3GD7 A;  3STB D;  3VYU A;  3SVM A;  4OXP A;  4HJ7 A;  1GJX A;  1XNR L;  4K0K Q;  3E0E A;  2XRS D;  1RDP D;  5IP7 G;  1D1I A;  1Y1W H;  4A76 A;  3CMA A;  3I4M G;  1Y8P B;  2NVX B;  3X3N A;  1KDC A;  4DXG A;  4HMI A;  3A7A B;  1X9N A;  2X6G A;  1A3V A;  5C44 H;  3CCV A;  2F0I A;  3IFD A;  1KNA A;  1L1O A;  5LMU L;  1TS4 A;  2CFM A;  3ULL A;  5H1S E;  1ZYR C;  1Y1V B;  5IWA L;  5DAU A;  3FKI G;  2Z9H A;  1ONL A;  1E7Z A;  1G91 A;  2QA4 A;  1PFN A;  1GOZ A;  3C1F A;  4KKU A;  1Z9F A;  4KI0 A;  1TWF H;  4K14 A;  1UEB A;  2LXK A;  3H0G H;  2B2Y C;  3S16 H;  2PMZ E;  2PQE A;  2YYZ A;  2VNU D;  2EY6 A;  4X3K A;  4AIM A;  3A74 A;  3M4Y A;  4Z9C B;  3HOW B;  1PTO B;  5ELC A;  3A0J A;  1I4R A;  1HA5 A;  4IAL A;  3CCJ A;  3FDT A;  5D3I B;  1QZG A;  5KNC A;  3TEH B;  3PO2 B;  2EY1 A;  1U9R A;  4X3U A;  2FXQ A;  1LTG D;  3LX0 A;  2E2D C;  3BVM A;  5EJW A;  2UUC L;  3SK6 A;  4R9W A;  2VW9 A;  1SJE D;  4A3M G;  4RFB A;  3SXH A;  3CME A;  3PQI A;  3OWE B;  3J80 i;  1CKN B;  4JI1 Q;  3IRB A;  4OO1 H;  1DON A;  4NXM Q;  1GUN A;  1UE6 A;  4FDB A;  3VR3 A;  2Q2I A;  4CBV A;  3UE1 A;  3J7Y W;  5C3W A;  4A3G G;  4YHH L;  2EYM A;  3EVQ A;  2MPM A;  1ENA A;  4C56 C;  3P7J A;  1S5F D;  2XIW A;  4Y7N H;  4JOI C;  3CCU A;  1A2T A;  2H1E A;  4UAI A;  2E76 C;  3CCQ A;  1DGS A;  1N33 Q;  4DV1 Q;  3CU7 A;  1RL2 A;  3PCO B;  3BU2 A;  2LS0 1;  3MVV A;  1QNU A;  2R7D A;  3VYT A;  5ISR A;  2TMP A;  4DAV A;  4YCV A;  4A3J G;  5DLQ E;  3PUW A;  1CKM A;  4DK1 A;  5FLM H;  4JYA Q;  1GHK A;  5JEA G;  1GHJ A;  1EY6 A;  1A62 A;  4DR3 L;  2L11 A;  2HD3 A;  4JOI A;  1PTO C;  4RA8 A;  1KC8 C;  4B9W A;  1KD1 C;  1B2T A;  1STB A;  5IYC G;  2D9U A;  4DKA C;  1ML0 D;  4P72 A;  3J81 i;  3HRZ C;  3CCM A;  1JT8 A;  2OTL A;  4GLV B;  1JR0 D;  5IGE A;  1I6V C;  2P5Z X;  1K9M C;  5CGK A;  5A2Q E;  1AH9 A;  3BZC A;  1HZ9 A;  2KUM A;  2K5D A;  4JI0 Q;  1VQM A;  3MXP A;  4YWL A;  2JEA I;  4F8M A;  1PDQ A;  4FXK C;  4BBR H;  2VUM B;  1HNZ Q;  1Y1V G;  2PW5 A;  2Z6K A;  3OTO L;  4OON A;  5BR8 L;  4H13 C;  1HR0 L;  1GUT A;  2VXW A;  3Q22 A;  2CW0 C;  2ID0 A;  4F87 A;  3BYT B;  4G4K A;  2H4O A;  2VZA A;  3QWN A;  4ZRZ A;  3CQZ H;  1VQ7 A;  2UXC Q;  3HOW G;  1CKN A;  1EZ8 A;  3MXU A;  5J22 A;  3GV6 A;  1BCP D;  1X6O A;  3QIA A;  3S9W A;  3PO2 G;  1SR3 A;  3T1H L;  4XT3 B;  2DNC A;  4XYO A;  5FK9 C;  1O7Y A;  1IYJ B;  4DV3 L;  1VQL A;  1OO9 B;  2AMC B;  3MTS A;  1QE6 A;  1SNP A;  1PH2 A;  2L9H A;  4N8F A;  4QQB X;  3HOX B;  1LTB D;  1MSG A;  2F0S A;  3NP8 A;  3S1R H;  1LTA D;  4RGN A;  5CR3 A;  4POF A;  1X3G A;  3E6Z X;  1A2U A;  1XPU A;  1QVC A;  1YZ6 A;  3R93 A;  1SE3 A;  2HIV A;  3NBH B;  1ICW A;  3S1Q B;  3PIP 3;  1V43 A;  3M7G A;  3IKJ A;  5AJ3 Q;  1H9R A;  3H09 A;  3M4Q A;  3R2I A;  5IT9 E;  3ONA B;  2XGT A;  2IJ0 A;  2N49 A;  1JJC B;  4LFB Q;  1F77 A;  1PYW D;  3NTH A;  2F52 A;  2DN8 A;  1YNX A;  4M1U B;  1RD9 D;  1QVG A;  2BA1 A;  2KA7 A;  4JCV E;  5D3D A;  3TS0 A;  3A8J E;  4U68 A;  4V19 0;  1OXV A;  3HOY B;  3NTK A;  2VUM H;  2CHB D;  4WJ3 M;  1JC7 A;  2IL8 A;  4CJ2 C;  4GNX B;  1K3R A;  2UUB Q;  4DXF A;  1SE8 A;  2A69 D;  3A56 A;  1XPO A;  4JI5 Q;  4H7B A;  4DR2 L;  1D7Q A;  4FXD A;  1QUQ B;  4HMJ A;  5I4D A;  2WII B;  2UUA Q;  5EKK A;  3M4O H;  2E2I B;  1LYL A;  3G48 A;  2EJM A;  4LF4 Q;  4UHV A;  2VQE L;  2F0E A;  1I4Q A;  1N36 L;  1HNW L;  3GP7 A;  2DGY A;  1STA A;  1EU3 A;  5E4W C;  2UU9 Q;  1XMO Q;  2K32 A;  2N78 A;  3MC0 B;  3T56 B;  3RNU A;  2EYO A;  4OEM B;  1BVS A;  2NN6 G;  4DV6 Q;  3S14 B;  2A6E C;  2EVB A;  4XXE A;  5K5P A;  1E0B A;  5JPN C;  1IBL Q;  2JXM B;  3CCE A;  4FF1 A;  3BG3 A;  1X3P A;  3MFG A;  1HZB A;  1LV9 A;  3ND8 A;  4RWS C;  4JI2 Q;  3CC7 A;  4L5S A;  1SYC A;  5M3F G;  2F0H A;  1BNZ A;  1M4V A;  5GQO A;  3M7N A;  3K58 A;  1PZK D;  3A54 A;  4JBK A;  4NXN Q;  1WCM H;  1IBM L;  2Z4H A;  3I4N G;  2JA5 H;  3STB C;  4GNX C;  3V96 A;  3S1N B;  3HOX G;  2ZM6 Q;  3CF5 A;  2ZTE A;  2D5D A;  1KAB A;  1GUO A;  2ZXR A;  3UI2 A;  1WTQ A;  3J7A V;  1T9H A;  2ES2 A;  1TXY A;  3RUZ A;  3OMC A;  1QZH A;  1HQR D;  2WAQ B;  1YJW A;  3HOV B;  3KBX A;  2DUD A;  3HOU H;  3DMU A;  4A3K B;  4K6D A;  4JI6 L;  2NVY B;  2KEN A;  1SYG A;  2IHE A;  1PH5 A;  3NQI A;  4A93 B;  3K7A H;  2KEE A;  1FJG L;  4GNX A;  5IYD H;  2PNR C;  4FVM A;  5JJK A;  4R4T A;  1EIG A;  3KF8 B;  1FL0 A;  3B6Y A;  2Q8T A;  3ICE A;  3GTM B;  2JA6 H;  3LWE A;  2AKW B;  2Q8R E;  2EDG A;  2E5L L;  1N34 Q;  3W3A A;  2RCN A;  4ODG A;  1KIX A;  3HOY G;  3GTO B;  4GN5 A;  4H02 A;  2I5M X;  5IY0 A;  5M5Y H;  3I3C A;  3M4P A;  4NW2 A;  1SNM A;  2AHO B;  3CCL A;  5M3M H;  2NN6 I;  2H5X A;  1EY7 A;  1TR5 A;  5IYB H;  5C0X G;  1BOS A;  5K36 G;  1WTV A;  4DR6 L;  1NTG A;  4EQP A;  4IFD H;  3FMC A;  1IBK Q;  4C2M H;  1EYA A;  1K8A C;  1IL8 A;  4OX9 L;  1HH2 P;  1PH9 A;  5EKI A;  2FFK B;  4XIG S;  1J8I A;  3K6O A;  4IPD A;  1Q8K A;  3P1H A;  3J7A F;  4MN3 A;  2XRQ D;  2JQO A;  4BXX H;  1LT3 D;  2K33 A;  1EQR A;  3PF5 A;  2R92 B;  2A8V A;  1EZ6 A;  3KUP A;  4RAU C;  3J81 E;  1GUG A;  3GTJ H;  2O5I C;  4IOA A;  5FJ8 H;  4GLA C;  2L5T A;  1EYD A;  1GKH A;  1B9N A;  1Q1E A;  1LTT D;  2QF7 A;  3PO3 H;  1FNU A;  3OSO A;  2RCF A;  1BBW A;  2DJG C;  3BYY B;  5LHY 1;  1EYC A;  4XQN A;  1SNO A;  1S40 A;  3HOZ G;  1E24 A;  2K1B A;  4A75 A;  1CA6 A;  4EX5 A;  3KF8 A;  3NQT A;  5M9O A;  1XNR Q;  1I4P A;  2VB2 X;  1BO0 A;  2HDL A;  2WKD A;  3F2B A;  4P75 A;  1I3Q H;  2RDH A;  2BE5 D;  2QDL A;  3HOV G;  4DAY B;  3GTP H;  3JC6 6;  4A3K G;  1OXS C;  2E2H B;  4YWM A;  3NTI A;  3M9B A;  4A93 G;  2OCE A;  1YJN A;  1XWE A;  1K8G A;  2B63 G;  5LMU Q;  1F9P A;  2OTJ A;  4IO9 A;  2QGQ A;  4A3D H;  2KHI A;  3EJI A;  1WTW A;  1PA6 A;  1PRT F;  5T1I A;  2UXB L;  4GZY C;  2R93 G;  3KJO A;  2RF4 A;  4JI8 L;  5IWA Q;  4IFD J;  3GV3 A;  5EKL A;  4CKE A;  3CPW A;  1D8L A;  3E9I A;  2EYH A;  4ZLT F;  5CBA E;  1AEX A;  2CQA A;  1RF2 D;  2B39 A;  1LUZ A;  2EQS A;  3KF6 B;  2IWH A;  1JMC A;  1BCP C;  3AYH B;  5IGG A;  3NUC A;  3UDX A;  1HJP A;  4O1N A;  3U4Z A;  5M5W B;  4C3J H;  1STN A;  5DEH A;  4QMG A;  3EQL C;  4XQQ A;  3ER0 A;  4IFD I;  1Q12 A;  1K83 H;  3Q6S A;  4IOC A;  4HIK A;  3O13 A;  2UUC Q;  4ZQ3 A;  3M3Y H;  4B3R Q;  1TT2 A;  4FNF A;  3TSS A;  3VR4 A;  1AE2 A;  1PRT B;  4PMC A;  4HCS A;  3OWF A;  1X56 A;  3S15 H;  4QF4 A;  1AN8 A;  1VQA A;  2F3W A;  2MJ8 A;  4BA1 I;  4BBS B;  2DNE A;  2R92 G;  2F3I A;  2Y0S E;  5IGC A;  1TKW B;  4YHH Q;  2O5J C;  1VQJ A;  1HNX Q;  3ERQ A;  4K5X A;  2IX3 A;  5NUC A;  4K2L A;  2AUJ D;  3D4R A;  5G3L D;  3PF4 A;  2JYO A;  3TZD A;  2IPK D;  3VR5 A;  1JJG A;  1I6H B;  4HTH A;  3G71 A;  1VS0 A;  4IPH A;  1SND A;  1XX8 A;  1X54 A;  4A3L G;  4CKC A;  1YNN D;  4BY1 H;  4N8X 1;  2F0L A;  3UE0 A;  2F0W A;  1Z47 A;  1GVP A;  1EY4 A;  3HG9 A;  4DR3 Q;  2EJF C;  3T1Y L;  1ESR A;  2A69 C;  3MEF A;  2F0T A;  1XJV A;  1TWC B;  4NDX A;  2GVA A;  2I07 B;  1ILQ A;  4X62 L;  3AQQ A;  2DY7 A;  4GOP C;  1A6X A;  3KF6 A;  1PMR A;  4DV5 L;  1QCB D;  3K7U C;  1TVX A;  4CHT B;  1H9J A;  2LFN A;  2E74 C;  3EN2 A;  1PRT C;  4JPB W;  4DAP A;  3KDF A;  4OHJ A;  2ZT9 C;  4JI3 L;  1STH A;  2NZH A;  3K0X A;  1WOC A;  1E2V A;  3OTO Q;  3GTQ B;  3HKZ B;  5BR8 Q;  4DV7 L;  1FGB D;  1KDA A;  3FPP A;  4HCE A;  4KN7 C;  3U50 C;  1WD1 A;  4N9T A;  2XWJ B;  1HR0 Q;  4A3B H;  2Z1C A;  1KRT A;  2X69 A;  5C3E H;  3W1B A;  1B70 B;  1GM5 A;  2MQH A;  5KEE A;  4TQU S;  3TP6 A;  1LTI D;  3BDC A;  4ULL A;  4HIO A;  2EE1 A;  1KQS A;  1X55 A;  4KHP L;  2MGS A;  5C5L A;  4XTC S;  2CCZ A;  4KLK A;  1A8V A;  5IOD A;  3DWP A;  3T1H Q;  5GRO A;  1WYD A;  5CV6 A;  3HS0 C;  1RHP A;  1S4Z A;  5LMN L;  2KBN A;  1E22 A;  4BBS H;  1LT4 D;  4DV3 Q;  4K5V A;  2ASB A;  2N8N A;  2F0G A;  4O2D A;  5C4J H;  4MTN A;  4IUV A;  1TWH B;  2KCM A;  5EPK A;  5IP7 H;  3D4D A;  3M85 A;  2C9O A;  2BDN A;  1VF7 A;  3KLR A;  1LLR D;  2PZW A;  3NSW A;  3I4M H;  4DV2 L;  4LW1 A;  1I6H H;  1S5D D;  1BXT A;  1J5E L;  3KLW A;  4F88 A;  2OXP A;  3IL8 A;  5BN5 A;  2ICI A;  3GTL H;  1PTO F;  1LTR D;  3VDY A;  3SR1 A;  1QG7 A;  1VQ5 A;  1HTP A;  1FNW A;  2G9H D;  1CA5 A;  1R9T H;  3GTK B;  3NE5 B;  3FKI H;  1TWG H;  1UAP A;  1K8M A;  1N32 L;  2GVB A;  2E2J B;  2YTV A;  2F0J A;  3C3L A;  2PO4 A;  4IUR A;  1HR0 W;  2RDF A;  1J6Q A;  2HCI A;  4JBW A;  3EIV A;  2HIX A;  3I4L A;  3DM3 A;  5E3F A;  1IW7 D;  1GUW A;  5J39 A;  5DNF A;  3RZO B;  1W6J A;  3L0O A;  5DM7 3;  1A3U A;  4YCU A;  1NR2 A;  1EYG A;  1DD2 A;  2A68 D;  2B2V C;  2B2U C;  5FOB B;  4A3M H;  1LO5 D;  2A5H A;  1SLJ A;  2VQE Q;  1HNW Q;  1N36 Q;  4HIM A;  2VQF L;  3G6E A;  3HKZ G;  1TWA H;  4JVZ A;  1L0W A;  4LFA L;  1JIC A;  2C35 B;  2B2Y A;  2F4I A;  1M90 C;  1CHP D;  4A3G H;  2Z0S A;  4A3I B;  4DK6 C;  2B2U A;  3PV0 A;  4PG3 A;  3NHH A;  4K6L A;  4QL5 A;  3SK8 A;  3RN2 A;  4QIW B;  5JJI A;  3F8T A;  4GS3 A;  3ULJ A;  2PZU A;  1EIF A;  1SSO A;  3TRE A;  2CWP A;  4HJA A;  2ICE C;  4XDX A;  4A3J H;  4UPA A;  4DV4 L;  3DWA A;  2XN9 C;  4J1M A;  1S3O A;  5KRU A;  1YIT A;  5JEA H;  1KAW A;  2B8G A;  1CHQ D;  1IBM Q;  5JVH 3;  5IP9 G;  1SFO B;  5IYC H;  1EWC A;  2NVX H;  2Y0S B;  4R4I A;  2IHF A;  1YIJ A;  2F0N A;  4RKB A;  2QEX A;  4LNQ A;  1WTH A;  4GLX A;  4FXG C;  1MJC A;  3CC4 A;  3RMH A;  4WOR A;  1A0I A;  1U4R A;  3PIO A;  1BDO A;  4YIJ A;  4LF9 L;  1Y1V H;  3VYR A;  4JI6 Q;  1F9R A;  3Q24 A;  1G2T A;  1HA6 A;  1FJG Q;  1XMQ L;  5J1Z A;  4RGM A;  2HQL A;  1CZW A;  3A5U A;  5C4H A;  1RIP A;  3DXJ C;  1MJE A;  3H6M A;  1QB5 D;  3RZO H;  4EQO A;  3ZYY X;  1H9S B;  2B8F A;  2I5H A;  4DA2 A;  4MNO A;  1F2Y A;  2E5L Q;  4V0B A;  4A3E B;  1W2B A;  5KGU A;  3HOW H;  1PTO H;  2KCC A;  5CYU A;  1EL0 A;  1JCK B;  1TS3 A;  4L5Q A;  4RHS A;  4DV0 Q;  2QDB A;  3PO2 H;  3DUZ A;  1KLG D;  3A8I E;  4B3S Q;  2NB0 A;  3OHX C;  3Q23 A;  3DLL A;  1PH7 A;  2YV5 A;  1UE5 A;  5BN4 A;  1ILP A;  2CQO A;  4DR5 L;  3ZJY C;  1ENF A;  4AQY L;  1VQB A;  2Q2U A;  3AU7 A;  4BY7 B;  2K14 A;  4DR6 Q;  3TP8 A;  5M3F B;  3K57 A;  1VQE A;  4X65 L;  2JEB I;  5JEA J;  3F2D A;  2RSN A;  2C5C A;  1VCI A;  4QCL A;  4A3I G;  3NPP A;  1AW7 A;  4OX9 Q;  1SDF A;  1EIY B;  3CP0 A;  1KRS A;  4DNT B;  3BJU A;  2JA8 B;  3I4N B;  1CI3 M;  2AUK A;  1I50 B;  1KL9 A;  2WB1 B;  4KHV A;  2K6A A;  1U4M A;  3CHB D;  4M8A A;  4I7A A;  2A6H D;  2PI2 A;  3MZ5 A;  2XSC A;  1WJJ A;  1IHZ A;  4WJW A;  3BDO A;  1SYE A;  2V4D A;  2YU9 B;  4AYB E;  4DR7 L;  4JI4 L;  3BVG A;  1RKN A;  2Y0S G;  4B3M L;  2JN4 A;  4TSS A;  2B2W C;  3OYY A;  1UNS A;  2X6L A;  1YNJ D;  1PVO A;  1H9S A;  4HSV A;  1FD7 D;  1I4H A;  2EXZ A;  1TU2 B;  4I7Z C;  5D14 A;  3TME A;  1VQN A;  4DK0 A;  2M00 A;  2BH2 A;  2G9D A;  3VA7 A;  1I5F A;  4LF7 L;  3RZD B;  4ZUI A;  4ZAI A;  3I91 A;  1DZ1 A;  1L2F A;  1HUN A;  4DR1 L;  4KY7 A;  4DK3 C;  2NN6 H;  2UXB Q;  4NP5 A; 
#chains in the Genus database with same CATH homology
 5FJ8 H;  1G29 1;  2IT1 A;  4GLA C;  4IPG A;  4A3E G;  1EQQ A;  1NJI C;  4JI8 Q;  1C7Y A;  1KHI A;  3HFZ B;  1GKH A;  2VS1 A;  1HNX L;  1Q1E A;  3S1M H;  1UWV A;  4LUZ A;  3PO3 H;  4BA2 I;  3GTK H;  4DAM A;  1N9W A;  1V9P A;  4NB3 A;  3OW2 A;  1BBW A;  4OO1 G;  2K75 A;  2R6G A;  2K5V A;  3ERS X;  3TS2 A;  3LGJ A;  3KFU A;  3HOZ G;  1S40 A;  1Y14 B;  1E24 A;  2E2J H;  2R7F A;  5M3F H;  2YTY A;  2WAQ E;  5HY6 A;  1IBK L;  3PUV A;  2BH8 A;  4A75 A;  4EX5 A;  3I2Z A;  2ZTC A;  1XNR Q;  1MKH A;  2JK8 A;  2XTI A;  4DUZ L;  1CSQ A;  1VQG A;  3S17 H;  3F2B A;  4AH6 A;  4P75 A;  1I3Q H;  3HOV G;  3CC2 A;  4BY7 G;  1A63 A;  4DAY B;  3GTP H;  1W3S A;  3JC6 6;  4A3K G;  1OXS C;  3I4N H;  1U5K A;  2L15 A;  4YWM A;  4IPC A;  3ULP A;  2V1C C;  3M9B A;  3D31 A;  4A3B G;  2Z6K C;  4A93 G;  2UXD Q;  3HOX H;  3I4O A;  1VQF A;  2OCE A;  5C3E G;  1YJN A;  4LF6 L;  4MZ9 A;  1K8G A;  2B63 G;  2WB1 E;  4LUV A;  5LMU Q;  2OTJ A;  4IO9 A;  2QGQ A;  4A3D H;  4JV5 L;  3J81 c;  4JG2 A;  5FLM G;  2KHI A;  3EBE A;  4C3H H;  4NXM L;  2JA8 G;  4R4C A;  1PA6 A;  4L5R C;  2E8G A;  2UXB L;  2AWN A;  5GAD C;  2R93 G;  1MIU A;  2OWO A;  2WB1 G;  3KJO A;  2RF4 A;  4JI8 L;  2B3G A;  1SMX A;  5IWA Q;  1VQ4 A;  3S1Q H;  4IFD J;  3J7A 5;  3CPW A;  3GDE A;  1D8L A;  3E9I A;  2D0P A;  3H15 A;  4PZ8 A;  1VQ9 A;  2HT1 A;  4JC0 A;  4TVA B;  4UP7 A;  4QJF A;  1XPR A;  4A3I H;  3KF6 B;  1LUZ A;  2EQS A;  4B3T Q;  4BBS G;  1JMC A;  1L1O C;  3GD7 A;  3AYH B;  3STB D;  5FLX c;  4OXP A;  2RHQ B;  3UDX A;  4HJ7 A;  1HJP A;  1XNR L;  4K0K Q;  3U4Z A;  4BBR G;  3F1Z A;  4LWC A;  3JAM c;  3E0E A;  4C3J H;  5IP7 G;  1CKO A;  3UDI A;  1Y1W H;  4A76 A;  3HOY H;  3ER0 A;  1SRU A;  1P16 A;  1Q12 A;  3CMA A;  1K83 H;  2WP8 J;  1JB7 A;  4IOC A;  4HIK A;  3I4M G;  1H95 A;  3WWV A;  2F4V Q;  1X9N A;  2UUC Q;  3M3Y H;  5E7N A;  4B3R Q;  2UXD L;  2RHS B;  5C44 H;  3H3V H;  3CCV A;  3T1Y Q;  1AE2 A;  1L1O A;  5LMU L;  3A5Z B;  2CFM A;  2E2I H;  3ULL A;  2MNA A;  5H1S E;  1NMF A;  5GAH C;  1X56 A;  3S15 H;  1SFO H;  4X66 Q;  1VQA A;  1PHJ A;  1BBU A;  3D0F A;  5IWA L;  3FKI G;  4BA1 I;  1G6P A;  2R92 G;  4OO1 I;  1E7Z A;  2F3I A;  2Y0S E;  4DV5 Q;  2QA4 A;  4YHH Q;  1VQJ A;  1HNX Q;  4HJ9 A;  1X3E A;  1Z9F A;  4KI0 A;  1TWF H;  2YTX A;  4B3T L;  1UEB A;  2LXK A;  3H0G H;  4KHZ A;  4JI3 Q;  3S14 H;  4OWW B;  2PMZ E;  2YYZ A;  3PF4 A;  3S16 H;  2VNU D;  4AIM A;  3A74 A;  1Q7Y C;  1JJG A;  1UE7 A;  4L5T A;  1VQ6 A;  4K0K L;  3G71 A;  1VS0 A;  3A0J A;  4IPH A;  3GTG H;  3L2P A;  3PUY A;  2OQ0 A;  1X54 A;  4A3L G;  4BY1 H;  3CCJ A;  1YHA A;  3UE0 A;  3PUX A;  1QZG A;  3TEH B;  2UXC L;  2FXQ A;  2F4V L;  1Z47 A;  1PH1 A;  4IFD I;  1GVP A;  1NBW A;  2UUC L;  2VW9 A;  4DR3 Q;  3RLN A;  3T1Y L;  4A3M G;  1PFS A;  2PNH A;  3CME A;  1V1Q A;  4A3E H;  4A3F G;  4KHP Q;  3J80 i;  1B7Y B;  1CKN B;  4GN4 B;  3MEF A;  4YCW A;  4JI1 Q;  3IRB A;  4X66 L;  4OWX B;  1XJV A;  1X65 A;  4NXM Q;  2GVA A;  4R1J A;  2JA7 G;  3S1N H;  1UE6 A;  1O7I A;  2EIF A;  2Q2I A;  3AQQ A;  4FDB A;  4X62 L;  5LMN Q;  3UE1 A;  3CD6 A;  4GOP C;  3TQY A;  3KF6 A;  4DV5 L;  4A3G G;  4YHH L;  3K7U C;  3EN2 A;  3UDF A;  3KDF A;  4Y7N H;  4ALP A;  4JOI C;  4JI3 L;  3CCU A;  3RN5 A;  2MO1 A;  2NZH A;  3K0X A;  4BY7 H;  3CCS A;  3CCQ A;  1DGS A;  3HOV H;  1CUK A;  1N33 Q;  4DV1 Q;  3AFQ A;  1WOC A;  4A3K H;  1VQO A;  3OTO Q;  1RL2 A;  3PCO B;  3BU2 A;  2NVY H;  2VUM G;  1J5E Q;  5BR8 Q;  4DV7 L;  2R7D A;  4A3B H;  4A93 H;  3U50 C;  1NMG A;  1Q81 C;  1HR0 Q;  2OQK A;  3FHW A;  1KRT A;  2K4K A;  2K50 A;  5C3E H;  3W1B A;  1B70 B;  4YCV A;  4A3J G;  1GM5 A;  5DLQ E;  5C0X J;  4LF5 Q;  2MQH A;  2PQA B;  3PUW A;  1CKM A;  5FLM H;  4JI7 Q;  4JYA Q;  5JEA G;  4TQU S;  2JA8 H;  1A62 A;  4HIO A;  4DR3 L;  3GTM H;  2R93 H;  1KQS A;  4JOI A;  1KC8 C;  1I50 H;  1VQ8 A;  1X55 A;  4KHP L;  1KXL A;  1KD1 C;  5IYC G;  4X64 Q;  4XTC S;  3GTO H;  4DKA C;  4POG A;  2CCZ A;  1VQH A;  4KLK A;  4P72 A;  3J81 i;  1AE3 A;  1N32 Q;  1A8V A;  1UE1 A;  4JI1 L;  1U0L A;  3CCM A;  2OTL A;  3H3V I;  3T1H Q;  4GLV B;  5GRO A;  1WYD A;  1WFQ A;  1JT8 A;  3CAM A;  1PYS B;  4UP9 A;  1IZ6 A;  4P71 A;  5LMN L;  1K9M C;  2KBN A;  1E22 A;  5ELO A;  4BBS H;  4DV3 Q;  1AH9 A;  2ASB A;  2N8N A;  2YU9 H;  3BZC A;  1HZ9 A;  2LXJ A;  5C0X I;  1Q86 C;  1K73 C;  4JI0 Q;  1VQM A;  2JEA I;  1JE5 A;  4O2D A;  4YWL A;  5C4J H;  4MTN A;  4BBR H;  2KCM A;  1HNZ Q;  3W1G A;  5IP7 H;  3M85 A;  1Y1V G;  2Z6K A;  1B8A A;  1N33 L;  4DV1 L;  4RG1 A;  3I4M H;  3BZK A;  2MO0 A;  4DV2 L;  1YI2 A;  4LW1 A;  4OON A;  3OTO L;  3FP9 A;  1I6H H;  4YWK A;  2IY5 B;  1J5E L;  5BR8 L;  2ZJP A;  3KDF B;  1LTL A;  4UY8 C;  3KLW A;  4JBJ A;  1E1T A;  3J7Z C;  1HR0 L;  3HKS A;  3GTL H;  4A4I A;  2ID0 A;  1CSP A;  1P8L A;  2VL6 A;  4LF5 L;  2B29 A;  2ATW A;  3VDY A;  3PSI A;  2CWA A;  1VQ5 A;  4JI7 L;  2VZA A;  4P74 A;  4JYA L;  2VQF Q;  2UXC Q;  3CQZ H;  1VQ7 A;  3HOW G;  4HID A;  1WCM G;  1X3F A;  1CKN A;  3UDG A;  1R9T H;  3RZD H;  4GOP B;  1X6O A;  2K5H A;  3FKI H;  1TWG H;  4X64 L;  4A3C G;  2JA5 G;  2Q2H A;  2R92 H;  1M1K C;  3PO2 G;  4IJH A;  1N32 L;  1HZA A;  1SR3 A;  4IJL A;  2GVB A;  3T1H L;  5HGQ A;  2I5L X;  4EQ5 A;  2YTV A;  3I7F A;  4R4O A;  1IYJ B;  1SN8 A;  4QY7 A;  3KJP A;  4DV3 L;  1VQP A;  1HR0 W;  1J6Q A;  4X62 Q;  1VQL A;  4JBW A;  1S72 A;  3I56 A;  4JI0 L;  5ELN A;  3EIV A;  2HIX A;  2AMC B;  3DM3 A;  1NE3 A;  1QUQ A;  1HNZ L;  3HOU G;  2NVQ H;  1I94 Q;  2HHH Q;  4A3L H;  3AFP A;  1PH2 A;  3L0O A;  5IYD G;  4QQB X;  1IXR A;  4YCU A;  2ZTD A;  1VQC A;  5GAG C;  5GAE C;  4QGU A;  3S1R H;  1EYG A;  2PQA A;  2KHJ A;  4POF A;  1C9O A;  1X3G A;  3HKZ E;  4DV7 Q;  4A3M H;  3CXC A;  3RLF A;  4DV0 L;  1XPU A;  1QVC A;  1YZ6 A;  1SLJ A;  4A3F H;  2VQE Q;  1HNW Q;  1N36 Q;  2JA6 G;  3E9H A;  2HIV A;  4HIM A;  2VQF L;  3NBH B;  3G6E A;  1IL2 A;  2E2H H;  4B3S L;  3HKZ G;  1TWA H;  4OWT B;  1V43 A;  3I55 A;  3AEV A;  5EAY A;  2JA7 H;  3Q8D A;  1L0W A;  4PZ6 A;  4WJ4 A;  5AJ3 Q;  4LFA L;  4DUY Q;  1EUJ A;  2C35 B;  3M4Q A;  1OXT A;  2XGT A;  2EXD A;  1M90 C;  3GO5 A;  4A3G H;  2Z0S A;  1EOV A;  2N49 A;  1JJC B;  4GN3 B;  4DK6 C;  1Q82 C;  4LFB Q;  5C4X G;  2F52 A;  4APV A;  5M3M G;  1YNX A;  5J3B A;  3PV0 A;  4PG3 A;  1OTC A;  3SGI A;  4LF9 Q;  3K8A A;  5IYB G;  1QVG A;  4QL5 A;  3RN2 A;  2BA1 A;  4GKJ Q;  4JCV E;  3F8T A;  3HOZ H;  5JJI A;  4PMW A;  3TS0 A;  2LSS A;  2ZJQ A;  1OXV A;  4GS3 A;  3ULJ A;  2VUM H;  1PH6 A;  4WJ3 M;  1I94 L;  1EIF A;  2HHH L;  3TRE A;  3MXN B;  4LUO A;  4YY3 Q;  1LM0 A;  4IFD G;  2CWP A;  4GNX B;  1K3R A;  4HJA A;  2R7Z G;  2WFW A;  2UUB Q;  1SE8 A;  2D62 A;  4UPA A;  4DV4 L;  4A3J H;  1YHB A;  1XPO A;  1YIT A;  1S3O A;  1PH3 A;  1PH8 A;  4DR2 L;  4JI5 Q;  1D7Q A;  1QUQ B;  1C0A A;  4DV2 Q;  1XNQ Q;  2UUA Q;  3J80 c;  1HZC A;  1KAW A;  5M5W H;  3M4O H;  4UP8 A;  1IBM Q;  1LYL A;  5IP9 G;  3J81 j;  3G48 A;  4LF4 Q;  2VQE L;  2VY3 A;  4LFC Q;  1N36 L;  1HNW L;  5IYC H;  3CCR A;  2NVX H;  4GOP A;  2B63 H;  2DGY A;  2UU9 Q;  4BXX G;  4R4I A;  2IHF A;  1YIJ A;  1XMO Q;  4JBM A;  2QEX A;  4LF8 Q;  4LNQ A;  2ALY B;  4GLX A;  5AJ3 L;  2N78 A;  4DUY L;  5JJL A;  4HJ5 A;  1MJC A;  5IT9 c;  3RNU A;  3CC4 A;  2JA9 A;  2A19 A;  1BVS A;  2NVT H;  2NN6 G;  4J15 A;  4DV6 Q;  4LFB L;  2K52 A;  1A0I A;  5FJ8 G;  4DR5 Q;  3PIO A;  4AQY Q;  2GN5 A;  1IBL Q;  4LF9 L;  2JJQ A;  3PO3 G;  1Y1V H;  2AWO A;  3CCE A;  4JI6 Q;  3K81 C;  4GKJ L;  4X65 Q;  1PV4 A;  1GD7 A;  1FJG Q;  2WAQ G;  1XMQ L;  1YEZ A;  3NEL A;  1HZB A;  2HQL A;  4JI2 Q;  2N3S A;  3A5U A;  3CC7 A;  4L5S A;  5M3F G;  4YY3 L;  2NZO A;  1RIP A;  1MJE A;  3RZO H;  1QVF A;  1FVI A;  2UUB L;  1YBY A;  5GQO A;  3M7N A;  1E1O A;  4JI5 L;  2I5H A;  3K80 C;  4MNO A;  1E3P A;  2E5L Q;  4JBK A;  1W2B A;  2UUA L;  4NXN Q;  1XNQ L;  3HOW H;  3S2D H;  1WCM H;  5M5X H;  1IBM L;  4LF4 L;  3JAM i;  3I4N G;  1JJ2 A;  4RMF A;  4LFC L;  4O0A A;  2JA5 H;  4L5Q A;  4DV0 Q;  3STB C;  4GNX C;  2UU9 L;  3PO2 H;  2ZJR A;  3HOX G;  2ZM6 Q;  3CF5 A;  1XMO L;  2ZTE A;  5LMN W;  4LF8 L;  1ASY A;  3S24 A;  3PGZ A;  4B3S Q;  4GKK Q;  2IX1 A;  4A3D G;  1T9H A;  1XTD A;  2ES2 A;  4JI4 Q;  1TXY A;  3DLL A;  1PH4 A;  1PH7 A;  2YV5 A;  4DR7 Q;  4A3C H;  1Q46 A;  1UE5 A;  4P73 A;  4LFA Q;  4DV6 L;  3CPF A;  2CQO A;  1QZH A;  2Q2T A;  4DR5 L;  3ZJY C;  3F2C A;  3RR5 A;  4AQY L;  1VQB A;  1YJW A;  2Q2U A;  2DUD A;  2K14 A;  1IBL L;  3HOU H;  4DR6 Q;  4B3M Q;  1TWC H;  4JI6 L;  1VQE A;  1NY4 A;  2CKZ B;  2KEN A;  4X65 L;  1OXX K;  2JEB I;  1VQK A;  1GO3 E;  2IHE A;  1PH5 A;  4DR4 Q;  5JEA J;  3K7A H;  1OXU A;  1YVC A;  3F2D A;  1VCI A;  4GNX A;  1FJG L;  4A3I G;  4OX9 Q;  5IYD H;  4QIW E;  5JJK A;  2MFI A;  1N8R C;  4R4T A;  1ASZ A;  1EIY B;  4JI2 L;  1BKB A;  3CP0 A;  3KF8 B;  1FL0 A;  1VQD A;  3B6Y A;  4DNI A;  1KRS A;  2IX0 A;  3BJU A;  3ICE A;  2A1A A;  2JA6 H;  2AKW B;  4LF7 Q;  2E5L L;  1KL9 A;  1N34 Q;  4NXN L;  4DV4 Q;  3GTQ H;  1Y1W G;  2RCN A;  1KIX A;  3HOY G;  4DR2 Q;  4PZ7 A;  4GN5 A;  2KCT A;  3U4V A;  4H02 A;  2I5M X;  1YHQ A;  5IY0 A;  5M5Y H;  3M4P A;  3KOJ A;  2PI2 A;  4DR1 Q;  2K5N A;  2ZM6 L;  1WJJ A;  5C44 G;  2AHO B;  5C4X H;  3CCL A;  5M3M H;  4GKK L;  4AYB E;  4Y52 H;  3NEN A;  2NN6 I;  4DR7 L;  4JI4 L;  2H5X A;  1VQI A;  1PYB A;  5IYB H;  2I0Q A;  5C0X G;  5K36 G;  2PI2 E;  1FGU A;  3W5O A;  3PUZ A;  2Y0S G;  3U58 A;  4AYB G;  4HJ8 A;  4DR6 L;  1NTG A;  4B3M L;  3OYY A;  3L7Z C;  1IBK Q;  4C2M H;  2R7Z H;  4DR4 L;  1K8A C;  1EFW A;  1PVO A;  1SRO A;  4OX9 L;  1HH2 P;  3H0G G;  3NEM A;  4DUZ Q;  1PH9 A;  3TRZ A;  1YJ9 A;  1EWI A;  4XIG S;  1XMQ Q;  1TWH H;  1WI5 A;  4IPD A;  1G51 A;  1Q8K A;  5IP9 H;  1VQN A;  3S2H H;  4B3R L;  2BH2 A;  4C3I H;  2JE6 I;  1I5F A;  2JQO A;  4LF7 L;  3RLO A;  4BXX H;  1N34 L;  4BY1 G;  5IE8 A;  1EQR A;  1K0R A;  1Q1B A;  3PF5 A;  4R4Q A;  3KYH C;  4NPS A;  4ME3 A;  4LF6 Q;  2A8V A;  1L2F A;  2D0O A;  4X6A H;  2BA0 A;  4JV5 Q;  3G4S A;  4DR1 L;  3PIP A;  4DK3 C;  4DPG A;  3CW2 C;  3GTJ H;  1L1O B;  2UXB Q;  4IOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...