4R4TA

Crystal structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)phenylthioamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
SHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4tA00
1I94Q 3FHWA 1UE5A 4C3JH 1Q8KA 4DKAC 5M3FH 4DUZL 4BY7G 2B3GA 4ME3A 4NXNQ 3S2DH 1Y1VH 4GNXB 2E2JH 2AMCB 4A75A 4DK3C 4B3RL 5C4XG 2ZJQA 3GTMH 1VQ4A 4NPSA 3ICEA 2WB1G 3ERSX 4X66L 2HHHQ 1HZCA 1JJCB 3FP9A 4DR5Q 3U50C 4IFDG 1DGSA 1N36L 4KHPL 1VQ5A 4A3LH 1EQRA 4YY3Q 2JA7H 2ASBA 2Z0SA 1VQJA 1IL2A 4LFBL 4DV4Q 2PMZE 4C3HH 2GVBA 4B3MQ 5IWAQ 4DNIA 3F1ZA 3GTJH 1WYDA 1CKNA 4LF9Q 3KFUA 1KD1C 5ELNA 4DR4Q 3GDEA 2ZM6Q 4LUVA 1X6OA 2UUAL 4LF7L 2AWOA 3H15A 1VQKA 2UUBQ 3E9HA 4P72A 5C3EG 2E8GA 2Q2HA 4HIMA 1N33L 1QVFA 4JOIA 4A3IH 4BY1G 3J80c 2ZTDA 4BA1I 4BY7H 1E1TA 1JT8A 4B3SQ 5C0XI 2KCTA 2VQFQ 1M90C 3HOYG 1BBWA 4A3KG 3PUYA 2OWOA 4L5TA 3GO5A 1K8GA 1PH3A 3S17H 4OWTB 3CAMA 1IBKL 4BBRG 1Z47A 4JYAL 1E24A 2K5HA 1MJCA 1GM5A 2B29A 1L1OC 1PH9A 3MEFA 1HH2P 1IBMQ 1SFOH 3ULPA 1CKMA 3PUZA 2HT1A 1Q1BA 2E2IH 5M5WH 3J7ZC 5HY6A 3EN2A 3KF6B 3CMEA 1NMGA 4IO9A 1N32Q 1FL0A 4GOPA 3H0GG 4DV3Q 4DR6L 1JJGA 3I55A 4NXML 1P16A 4P73A 4DUYQ 2IY5B 2VUMH 1RIPA 2C35B 1KXLA 1XPOA 1E3PA 3NEMA 3U4VA 1QZGA 4JI4L 4FDBA 3BU2A 5IYBG 4WJ3M 3KDFB 4R4TA 2UUCL 5M5XH 2MO1A 4BY1H 1B7YB 2JE6I 1Q7YC 4JI7Q 4DK6C 1K9MC 4A3EH 1HZ9A 4AIMA 3CCRA 1VQCA 3HOYH 1I94L 3PF4A 2VY3A 4QQBX 2EQSA 3VDYA 3PO3G 4MNOA 3HOVG 3L7ZC 4KLKA 4NXNL 2R92H 3F8TA 4KI0A 3D0FA 1HZAA 3PCOB 3CCQA 3EBEA 2PI2A 3I4MG 3RN2A 1CSPA 4BBRH 4DR1Q 1JMCA 1Y14B 1TWGH 4R4QA 3RLOA 4QL5A 1JB7A 4A76A 1PA6A 1PH8A 2HHHL 4DR5L 2CKZB 2JJQA 3FKIH 4APVA 1XNQQ 1BVSA 5ELOA 5GROA 2N8NA 2R6GA 2QEXA 4A3DG 4HJ9A 4JI2Q 4YY3L 5JJLA 3GTLH 5IP7H 4DV4L 3KLWA 2DGYA 4JI1Q 1CKOA 4B3ML 2VNUD 4GNXA 3EIVA 5IWAL 3S14H 4LUZA 4A93G 1SR3A 4P74A 4YCUA 1L2FA 3CP0A 1OXVA 1D8LA 1MIUA 1A8VA 2AWNA 5IYBH 4LF9L 5IP9H 1AE2A 2R7FA 2ES2A 4DR4L 3NBHB 2ZM6L 4OO1I 1CSQA 2JEBI 2K52A 1Y1VG 4O0AA 3SGIA 1I5FA 2RHSB 2UUBL 2NVTH 5GADC 5C4JH 2ALYB 5GAGC 2HIXA 2LSSA 1GVPA 3E9IA 3HOVH 4B3SL 1EIFA 4L5RC 3ZJYC 2YTYA 4GS3A 2VQFL 4HJAA 3I4NH 3MXNB 4JG2A 4LF4Q 1IZ6A 2A1AA 3CXCA 5IT9c 1HZBA 4WJ4A 4UPAA 1U5KA 1XTDA 4A3GH 3UDFA 4YCWA 1HNZQ 2JA7G 4A3LG 3K81C 4OWXB 1L0WA 1Q81C 2UU9Q 3STBC 1YITA 2BH2A 2VW9A 4UP8A 1KL9A 2UXDQ 2D0OA 2KHIA 1XJVA 4IOAA 1TWHH 1IBML 1X65A 1OXSC 4IPGA 2WAQE 4DAYB 4Y52H 4A93H 3A5ZB 4QIWE 4K0KQ 1N32L 2N49A 1PH7A 3CCLA 4DV3L 2YU9H 1OXUA 4A3IG 1LYLA 1NY4A 1QVCA 4YWLA 4DUYL 4B3TQ 4X6AH 1I6HH 5C0XJ 2YYZA 1WCMG 5BR8Q 1EYGA 1VQIA 1D7QA 1VCIA 3A5UA 3G6EA 2PQAB 1QVGA 4JI7L 4L5QA 4GKKQ 2ZJRA 3OW2A 3T1YQ 2DUDA 2HQLA 1NBWA 2K5NA 3KF6A 4PZ6A 5M3MG 1C9OA 1KIXA 1V43A 1SN8A 1X3EA 4XTCS 1FJGL 1JE5A 3G4SA 3J7A5 2JA9A 3U4ZA 1VQOA 1GD7A 4DR1L 4BA2I 1S3OA 1K0RA 4X62Q 4POFA 5GAHC 2NN6G 4AQYQ 3KJPA 1QZHA 1X3GA 3AFPA 3KDFA 1U0LA 1PH2A 3UDIA 1G291 1XNQL 2K5VA 4LUOA 1C7YA 2CFMA 1FGUA 1VQMA 1LUZA 1VQ9A 2GN5A 3IRBA 4JI2L 2VUMG 1HR0W 3TQYA 3TS0A 1H95A 4JI1L 1IXRA 3KOJA 1W3SA 4LF5Q 1N9WA 4AYBG 3I2ZA 4LFAQ 4A3MH 1VQAA 4A3EG 3DM3A 4EQ5A 1XMOQ 5FJ8H 2IX0A 1WCMH 4TVAB 3L2PA 1MJEA 4JI5Q 4XIGS 2F4VQ 2CWPA 2R92G 2ZTCA 4DV1Q 2RF4A 1TWCH 3J81c 2B63G 5FLXc 1XPRA 5M3MH 4DV6Q 3S16H 1L1OB 1K3RA 1K73C 2V1CC 5FLMH 4LF4L 3FKIG 1OXTA 1SRUA 4JI8Q 4LWCA 3I56A 4J15A 1YHBA 1Z9FA 3HKZE 3BZCA 4GN5A 4YHHQ 2F52A 2MNAA 1HNZL 5LMNQ 2JK8A 4PMWA 3TRZA 4DR7Q 2JEAI 5IP7G 1VQ7A 1Q12A 3JAMi 2UU9L 2R93H 1OXXK 1WOCA 2Z6KC 4NB3A 3GTKH 2UXDL 2JA5H 4QGUA 3RLNA 5M5YH 3CMAA 3CCSA 1YIJA 4YWKA 1B70B 2UXCQ 3I4OA 3BZKA 5IP9G 4RMFA 2WB1E 3CCUA 3D31A 2ZJPA 4A4IA 2EXDA 1PH1A 2VS1A 4X65Q 4ALPA 1KQSA 4LFCQ 3AYHB 1E7ZA 1NTGA 3I7FA 3CPWA 3HOUG 5K36G 3HOZG 4OONA 4C3IH 2N3SA 4B3TL 1TXYA 3CQZH 4IFDI 3K0XA 3PGZA 4TQUS 3I4NG 5BR8L 2B63H 1XPUA 1PV4A 3AEVA 4JCVE 4QJFA 1YJWA 1LM0A 4A3JH 1K8AC 2E5LQ 4A3GG 3A0JA 1HNXQ 5LMUQ 4GKKL 2R7DA 4R4OA 1K83H 1PYBA 1EQQA 3T1YL 4GKJQ 3RLFA 3S24A 4IJLA 4LF8Q 5DLQE 3F2DA 3CC7A 1NJIC 4YCVA 4A3FH 2L15A 5JJKA 1AE3A 1VQBA 2Y0SG 3W1BA 1PH6A 3M4PA 2BA0A 4KHZA 1E1OA 4AYBE 4JBWA 2K14A 3M9BA 3CD6A 4X62L 4AQYL 4JV5Q 3OYYA 3PV0A 1BKBA 3ULLA 2IT1A 2KENA 2VQEQ 2PQAA 3PO2G 2OQ0A 1Q46A 1VQ6A 4JOIC 3GTGH 4GLVB 4IPHA 1N34Q 3UDGA 2ATWA 3HOUH 3HOXH 2IX1A 5EAYA 3HOZH 4LF5L 3E0EA 3CF5A 4LFAL 1EOVA 4HIDA 1XMQQ 4DV0Q 2R7ZG 1HR0Q 5LMNW 2JQOA 1G51A 2NVXH 1I50H 3T1HQ 4JI5L 3K7AH 1E22A 1UE7A 3OTOQ 2F4VL 4DV1L 4BXXH 1VQEA 1X56A 3A74A 3GTQH 4PG3A 2I5HA 3CW2C 3CC2A 3K7UC 3AQQA 4DV6L 3PSIA 2E2HH 2Q2TA 2NVQH 3Q8DA 3JC66 4GOPC 4DR2Q 4JI8L 4GN4B 4YHHL 2RHQB 5C0XG 5LMNL 4DR7L 4DV2Q 5IYCH 1YEZA 1HNWQ 3PO2H 1J5EQ 3M4OH 2MQHA 4A3MG 2OTJA 4LF6Q 4GN3B 5C44H 3U58A 2UXCL 2OQKA 4DPGA 4OXPA 5FJ8G 4JI3Q 4JI6Q 1V9PA 1TWAH 1L1OA 2IHEA 1OTCA 2Q2IA 1NE3A 2K50A 1PH5A 4X65L 1JJ2A 2R7ZH 4LFCL 3HFZB 3RR5A 4HJ7A 5IYDH 4MTNA 3F2CA 5IE8A 4IOCA 1X55A 2Y0SE 3DLLA 3S1QH 1YI2A 4JI0Q 4PZ7A 1PVOA 1SMXA 1Q82C 2LXKA 3W5OA 1ASYA 3UE1A 5FLMG 2GVAA 2A19A 3K8AA 5H1SE 1YJ9A 2Q2UA 4DAMA 3HOWH 4LW1A 1VQDA 2XTIA 2E5LL 1LTLA 3CCEA 5LMUL 3F2BA 3GD7A 1GKHA 1HNXL 1AH9A 1IYJB 1S72A 2CQOA 1N8RC 5JEAJ 3RZDH 2I0QA 4GKJL 2R93G 4LF8L 2WP8J 1WJJA 2JA5G 4GNXC 3H3VI 4UP7A 3CCVA 1EUJA 4O2DA 3G71A 4DR3Q 2PNHA 1IBLQ 4HIOA 4A3BH 4A3CH 4JV5L 4EX5A 1MKHA 4LNQA 2MFIA 4OX9Q 4DV5Q 2VQEL 1P8LA 1VQHA 2F3IA 1I3QH 3S2HH 3RZOH 4K0KL 1N34L 4R4CA 2MO0A 1RL2A 1Q86C 1PH4A 4IFDJ 1WFQA 1A0IA 1YNXA 1V1QA 3M4QA 4BBSG 3CPFA 2HIVA 2I5MX 2NZOA 4A3JG 2YTXA 4POGA 3RN5A 1XMQL 4DV0L 1ASZA 1HR0L 2JA8G 1XNRQ 4R4IA 2KCMA 3T1HL 2UXBQ 3KF8B 3OTOL 3HKSA 1QUQB 3PUXA 4RG1A 3M3YH 4OWWB 4A3FG 2AKWB 3CCMA 2A8VA 2VL6A 1X54A 1EFWA 1PYSB 5GAEC 4PZ8A 2XGTA 1KC8C 4OO1G 1SLJA 1YBYA 5C4XH 1EWIA 2QGQA 3AFQA 2YV5A 4DR2L 1HJPA 2H5XA 4P71A 1C0AA 4X64Q 3TS2A 1FVIA 3S15H 1BBUA 5AJ3Q 1PFSA 4DV2L 1HNWL 3HOXG 3S1MH 1KRTA 1J5EL 2FXQA 4HIKA 2CWAA 3GTPH 3S1RH 1TWFH 1VQNA 3UE0A 4LF6L 2K75A 3STBD 2IHFA 5J3BA 1VQGA 2NVYH 4JI3L 4JI6L 1Y1WG 4BBSH 3UDXA 4DV7Q 2JA8H 4BXXG 3RNUA 4QY7A 5IY0A 3CC4A 1KAWA 1T9HA 4R1JA 4DUZQ 1VQ8A 2NN6I 1EIYB 1NMFA 5C3EH 4JI0L 4B3RQ 1G6PA 4P75A 2WAQG 1CKNB 3TEHB 4X66Q 3M7NA 1M1KC 1W2BA 2YTVA 4HJ8A 1VQLA 1S40A 4GLAC 4A3KH 1WI5A 3ULJA 2OTLA 1N36Q 5IYCG 4UP9A 1FJGQ 3K80C 2JA6G 1A62A 4IPDA 1J6QA 3M85A 1R9TH 4KHPQ 4JBJA 4LFBQ 4IPCA 3J81j 5C44G 2PI2E 5E7NA 3KYHC 2EIFA 1YHQA 4DR3L 1IBLL 2AHOB 3PIOA 2VZAA 1X9NA 1KHIA 4OX9L 3PUWA 1KRSA 5GQOA 2CCZA 1PHJA 3TREA 4UY8C 1XMOL 3BJUA 5IYDG 4DV5L 4MZ9A 4L5SA 1YHAA 2UUAQ 4GLXA 1Y1WH 2BA1A 4LF7Q 1SE8A 4Y7NH 1Q1EA 3S1NH 4H02A 2RCNA 3H0GH 3J80i 1B8AA 2QA4A 1N33Q 2I5LX 1O7IA 2KHJA 1VQFA 2ZTEA 2K4KA 3HOWG 2D0PA 1YVCA 1XNRL 5M3FG 4GOPB 2UXBL 3J81i 4C2MH 5JJIA 1CUKA 2LXJA 2BH8A 1IBKQ 3PO3H 4JBKA 3LGJA 3PIPA 4JYAQ 3GTOH 4HJ5A 1YJNA 1A63A 4AH6A 2JA6H 4JC0A 4A3BG 2D62A 3B6YA 4A3CG 1UE6A 5HGQA 3JAMc 1VS0A 2ID0A 3WWVA 3I4MH 4IJHA 3L0OA 3KJOA 2N78A 4X64L 4DR6Q 5AJ3L 1QUQA 4NXMQ 1X3FA 2NZHA 2OCEA 4A3DH 3G48A 3W1GA 1SROA 3NENA 3CCJA 4JI4Q 3PUVA 2Z6KA 1UEBA 3NELA 1YZ6A 5JEAG 2UUCQ 2WFWA 1VQPA 1UE1A 1UWVA 2KBNA 3HKZG 3PF5A 4YWMA 3ER0A 4JBMA 1GO3E 4DV7L 3H3VH
chains in the Genus database with same CATH superfamily
2XWJB 4XDXA 1WTXA 1XYIA 4DUZL 4BY7G 2PW7A 2AQ3B 2E2JH 2X6LA 4DK3C 3VYUA 4X3SA 3HZXA 4OIKA 4NPSA 2HHHQ 1M8AA 4F88A 1JOKA 4DR5Q 2H4OA 4XT1B 4XYQA 3HOUB 3HOXB 1EQRA 3V2TA 2ASBA 4C3HH 2H1EA 3C46A 3F1ZA 3MTSA 1KD1C 5ELNA 3KFUA 3GDEA 2ZM6Q 4LUVA 1TY0A 2AWOA 1VQKA 2EXZA 1N33L 2B8FA 1EY6A 3TP5A 4B3SQ 1TS2A 4QCLA 1LLRD 4RKBA 5C3WA 2VQFQ 4MTKA 3HOYG 1BBWA 1NSNS 3BVGA 5CV5A 2JA6B 2VB2X 2K04A 4H44C 4OWTB 1PH3A 2NBFA 3FDTA 3A55A 1E24A 4KD4A 5CV4A 1MJCA 1L1OC 3SEBA 3P75A 1HH2P 1SFOH 3CKIB 3PUZA 2HT1A 3J81L 1EOTA 2E2IH 5M5WH 5HY6A 4Q0FA 1GHJA 4IO9A 4FYDA 1SYBA 5IGCA 4DR6L 1MI2A 1JJGA 3TP7A 1IW7C 4DUYQ 1RIPA 2C35B 4P2CB 1KXLA 1QNKA 4FDBA 3KDFB 4R4TA 4Z9CB 5M3FB 4CGYB 2Z4HA 5FKAC 5KNCA 1ZYRC 4A3EH 3Q24A 2VY3A 4QQBX 5CMDA 4FP5D 4EQOA 2K03A 1H9MA 1QE6A 3DXJC 3EBEA 3CCQA 3I4MG 1CSPA 1Y8OB 3C1FA 1AP0A 3RLOA 2HHHL 3S2HB 1H9SA 4A76A 4DR5L 2JJQA 3FKIH 3VR3A 4APVA 1JE4A 3QWNA 2CH4A 2N8NA 5JJZA 4JI2Q 3P1HA 1STBA 5IP7H 1WTRA 5ELDA 3KLWA 3SDZA 4A93G 1TU2B 4LUZA 4P74A 4XT3B 2WKDA 2AWNA 2ES2A 1AE2A 2BE5C 3NBHB 2ZM6L 4RGTA 1Y1VG 5E3FA 4K5WA 2WIIB 3HOVH 4B3SL 2G9HD 1CHQD 3OSOA 2VQFL 4JG2A 4WJ4A 1EEFD 4DFAA 4BWGB 1XTDA 4N8FA 3CRLC 3S1RB 2KA7A 2UU9Q 2NVYB 1FD7D 1UAPA 4BBSB 4IOAA 2DY8A 2I07B 1X65A 3TZUA 4Y52H 5C4HA 1SYDA 1U4RA 3CCLA 2A6EC 4DUYL 1I6HH 1V8QA 1DCZA 1ILQA 5BR8Q 2CVRA 4DXFA 4L5QA 4GKKQ 4J1MA 2XRSD 1GUNA 1STHA 2EYJA 2DUDA 1KIXA 1JB3A 1ML0D 2KEDA 2RVLA 1V43A 1C48A 4DA2A 3J7A5 2JA9A 2B2VC 1GD7A 2EYMA 4AQYQ 2NN6G 1YNJD 3KJPA 3GTLB 2PZUA 3S1NB 1STYA 1G291 3KLRA 4PMCA 3I4LA 4ULLA 1VQMA 1VQ9A 4JI2L 2VUMG 3TS0A 4C56C 3I2ZA 4BS9A 4C2MB 1ENFA 2NVTB 1XMOQ 5KRUA 2IX0A 1WCMH 4TVAB 3T16A 2R92G 1LTAD 2L1BA 3I4MB 5CV8A 1XPRA 3S16H 4FXKC 4F8MA 2O5IC 1K3RA 3VR2A 4LWCA 3I56A 3HKZE 1B44D 4C1NK 3JAMi 2WKCA 2UU9L 4ZRZA 3CCSA 1YIJA 2UXCQ 3MHBA 3BZKA 1G91A 2ZJPA 4A4IA 1Y1VB 1KQSA 2KUMA 2B2TC 2VS1A 4X65Q 1CFMA 5K36G 4CJ0B 4C3IH 2L9HA 2LKVA 5LL6X 2EYPA 5JPNC 4OELB 3TBIB 4RGNA 5BR8L 4QJFA 2F0HA 2IWHA 4A3GG 4GKKL 2K01A 4FNFA 5CORA 5C3XA 1PFNA 4G7HC 3I73A 4R4OA 1PYBA 2AUJD 4LF8Q 1DOKA 4A3FH 2L15A 5JJKA 1AE3A 2DY7A 4C1NI 4KHZA 5F2DA 4JBWA 4B9XA 4AQYL 1F9PA 1HTLD 3OYYA 5M9OA 3HKZB 3BVZA 1RF2D 2PQAA 3PO2G 3ND9A 1PZID 3GTGH 5D3IB 4IPHA 3UDGA 1RDPD 1F2ZA 1GUWA 4G7ZC 1H9RA 3CF5A 1ENCA 4HIDA 4HSVA 4DV0Q 1AZQA 1G51A 1I50H 3T1HQ 2OEOA 1SNMA 2A68C 5L37A 1VQEA 3GTQH 1BOSA 3R8BA 1SNPA 2I5HA 3K7UC 2A74C 3AQQA 3EJIA 1D5MC 4GOPC 4DR2Q 2R61A 5M5YB 1JOOA 2VUMB 2RHQB 1UUPA 3X3MA 1HQMC 1CQVA 5M5XB 1J5EQ 2UXCL 4DPGA 1HA5A 1V9PA 2R92B 1M4VA 2Q2IA 2ZXRA 1PH5A 4X65L 4RFBA 2R7ZH 5FOBB 1JQYD 3RR5A 4HJ7A 5IE8A 1PRTB 4KHVA 3DLLA 2BDOA 3S1QH 4K2LA 1Q82C 2CH4W 2Q8IB 1DD2A 5FLMG 2A73B 1IW7D 3HOWH 1NUCA 1VQDA 1LTLA 1EFID 3RZDH 2I0QA 2R93G 4LF8L 1WJJA 3EQLC 2JA5G 1VDZA 3NK9A 4UP7A 2Z8LA 5C0XH 4O2DA 3SK4A 3G71A 2FJ2A 4A3BH 4A3CH 2MFIA 4OX9Q 5C4JB 1VQHA 1BCPB 3IL8A 5COYA 1HPCA 1S5ED 4R4CA 2MO0A 1A2UA 1A0IA 5DAUA 2NZOA 2JA8G 4POGA 4A3GB 3RN5A 4DV0L 1CHPD 4HCEA 1E2VA 1XNRQ 4RA8A 4XYOA 3T1HL 2K33A 3KF8B 1NNXA 2NVQB 3CCMA 4ZKCB 3VA7A 1YNND 2BE5D 1PYSB 2KVMA 3SXHA 4F87A 1G6ZA 1KC8C 3KK7A 2RDGA 2QGQA 4DR2L 3J80L 1A2TA 2H5XA 1I4HA 1F2LA 4IFDH 1SNDA 2EY6A 3S1MH 3OPOA 1J5EL 2FXQA 4MIUA 2SNSA 3UE0A 4PQXA 2MPMA 3EROA 4ZKBB 2XSCA 4R9WA 1HCZA 4HN7A 4HMJA 5BN5A 2NN6I 3ND8A 1NMFA 3NTHA 1KAAA 5C3EH 2A6ED 2LS01 4P75A 3E0JA 2HCCA 4X66Q 4E6IA 3Q0AA 2X6GA 4HJ8A 1VQLA 4NP5A 5EPKA 4A3KH 2KECA 4UP9A 1A62A 1VMCA 3VR5A 4HR7B 1BBXC 4EQNA 3KYHC 2EIFA 1YHQA 2AHOB 1CI3M 3RZOB 3D4DA 1DJRD 1X9NA 4OX9L 4CKBA 1PHJA 2ZXOA 5IYDG 4MZ9A 1YHAA 1B2TA 1SE8A 4Y7NH 1Q1EA 3RUZA 1O7IA 2KHJA 5LL6S 1VQFA 4IUPA 1YVCA 3E5SA 1XNRL 2R93B 3J81i 1D5XC 1CUKA 2JA5B 1G2SA 4JYAQ 1B4OA 1EY8A 1AEXA 1A6XA 1NAPA 2AUKA 2F0GA 4ZLTF 3WWVA 1MSGA 4IJHA 1BXTA 3J80E 5IGGA 1X3FA 2OCEA 2JA8B 1SROA 4JI4Q 1JORA 3PUVA 5E4WC 1K83B 1HTPA 4JBMA 3H3VH 3ER0A 2PO4A 2EJGC 1UE5A 4C3JH 4DKAC 2B2WA 4NXNQ 3HP3A 2MJ8A 3S2DH 2KCNA 2AMCB 4A75A 2N88A 1ZXTA 2ZJQA 2FFKB 2WB1G 3ERSX 4X66L 3OMGA 3CHBD 1JJCB 2M9VA 3DUZA 1DGSA 5TSSA 4A3LH 4YY3Q 1DOLA 2JA7H 1GOZA 4DV4Q 2WV6D 2XWBB 4B3MQ 4DNIA 3GTJH 2Z6BA 1CKNA 4XQQA 3H15A 2E2HB 1QVFA 2E8GA 1B9NA 1ESFA 4JOIA 4K5VA 4A3IH 2KCTA 1ET6A 3OOCA 1EU3A 1F77A 5D65A 4L5TA 4FXGC 1FNUA 1SEBD 1K28A 4JYAL 1TKWB 2A68D 2K5HA 3W2DA 2B29A 1PH9A 2BCOA 3MEFA 4EVOA 5FK9C 2A5HA 2QW7A 1WTPA 3J7ZC 2B2YA 3CMEA 2LFNA 5J39A 1B50A 1FL0A 1LACA 3H0GG 1T5EA 5D3DA 3H3VC 3R93A 1E3PA 3U4VA 4JI4L 1D1KA 1X3PA 3OHXC 3QOLA 4BY1H 4JI7Q 3PO3G 3VDYA 4DK0A 4M1UB 3HOVG 2HDMA 3L7ZC 4NXNL 3F8TA 4IUQA 4KI0A 4PMBA 2TSSA 3PCOB 2EJFC 4DXGA 3C2PA 3NTKA 4I65A 1CK1A 2QILA 4DR1Q 1VMPA 4R4QA 1I3QB 1XNQQ 3PQIA 2QEXA 3T51B 2QF7A 4YY3L 4DV4L 3G7LA 4O1NA 1RTOA 4B3ML 1AW7A 4GNXA 2A6HC 3S14H 2VNUD 1L2FA 3CP0A 3P20A 1D8LA 1MIUA 5IYBH 3I70A 1B53A 4LAAA 4O0AA 2K52A 4ID6A 2RHSB 2E76C 1I6VC 1PTOC 5KYIA 2ALYB 5GAGC 3BS1A 3RD4A 1GVPA 2YTYA 3I4NH 4LF4Q 1IZ6A 3QR8A 4ILWA 5IT9c 3CXCA 3VYSA 4UPAA 4U68A 3UDFA 3K57A 3GTPB 1L0WA 4UDUC 3I90A 2VW9A 2E2IB 2UXDQ 5KNBA 4HMIA 5EBDA 4IPGA 5HGTA 4QIWE 2N49A 3BDLA 3QG1A 3KLSA 1OXUA 1LYLA 1NY4A 2J4XA 5EPJA 5I6WA 2YYZA 1WCMG 5IGBA 1A15A 3BVMA 1D7QA 4JI7L 2PQAB 1R9TB 1LTSD 3SK6A 1EWCA 2EYHA 1TY2A 2EVBA 3KF6A 4PZ6A 3T1YQ 1FJGL 5NUCA 3PIO3 1JE5A 4DR1L 4BA2I 4X62Q 4POFA 1Y1WB 1X3GA 3H0GB 4MN3A 1XNQL 1STGA 2GN5A 3IRBA 1H95A 4CKEA 2BOSA 4XQNA 3KOJA 1BNZA 1W3SA 4AYBG 4LFAQ 4A3MH 1J9OA 4QIWB 2AQ1B 5CC4A 4R8NA 5FJ8H 3PO3B 4C3IG 3FRPB 1DOMA 4XIGS 2F0UA 3HOVB 2QDBA 2ZTCA 4DV1Q 1KTKA 2Q8TA 1SNOA 3KBGA 5FLXc 3URYA 2ENBA 4DV6Q 4MHEA 4I7AA 4Q5VA 4LF4L 1OXTA 1H9JA 2NWGA 2OXPA 4JI8Q 4J15A 1YHBA 3BZCA 4NKLA 2MNAA 2F52A 4WJWA 2JK8A 1QOHA 1Q12A 1OXXK 2Z6KC 3GTKH 2UXDL 3RLNA 1KABA 4YWKA 3LNNA 3I4OA 1XX8A 4RH6A 5IP9G 1SNQA 1PH1A 3AYHB 4IUUA 3NSWA 3GTMB 1GUTA 1NR4A 4ODGA 3NBIA 3CQZH 3K0XA 3PGZA 3OWFA 1LM0A 1E0BA 4A3JH 1K8AC 2PQEA 2R7DA 4DAYA 1EQQA 2L55A 2RQXA 3T1YL 4GKJQ 3S24A 1EYDA 3F2DA 5BN3A 4KN7C 3V96A 1PTOF 1QB5D 1VQBA 3DM1A 5A2QL 4AYBE 1R4QB 4X62L 2KEEA 4PV1C 3ULLA 2VQEQ 4FXDA 2OQ0A 1VQ6A 3T4AC 1YNNC 4BY7B 2PPBC 4QB4A 3HOUH 1WCMB 3HOXH 3E0EA 5A35A 2L0CA 4LFAL 1EOVA 2SOBA 2R7ZG 2K1BA 1AN8A 2F0FA 2JP1A 4DV1L 4BXXH 3MXPA 3A74A 3D3RA 1WTWA 3CW2C 3CC2A 4DV6L 2JYOA 3F2UA 3W3AA 3JC66 3K59A 4JI8L 1CZWA 4GN4B 5C0XG 2Z4IA 5CV9A 2HDLA 4AYBB 3M4OH 2OTJA 4FF4A 4LF6Q 3HOYB 3V05A 4OXPA 4C3IB 4JI3Q 4JI6Q 4J6HA 1TWAH 1L1OA 5CBAE 2WACA 4HCSA 4N8X1 1JJ2A 1D6EC 3NPPA 1VF7A 1RCVD 4L8JA 4MTNA 3TP6A 5C5MA 1CZGA 5I2XA 1TWGB 3A8IE 1YI2A 4PZ7A 2HD3A 1SMXA 1PVOA 2LXKA 4KJNA 3W5OA 3UE1A 1YJ9A 3C1EA 5CYUA 1KLUD 2XTIA 3GD7A 1N8RC 3GP7A 4GKJL 2B2UC 2HUGA 3IKJA 4ZUJA 2ZXPA 2P5ZX 1TVXA 4QF4A 4HIOA 1MKHA 2B39A 5A2QE 4KTAA 2VQEL 1J8IA 2F3IA 3S2HH 1FYCA 1V1PA 3M4QA 3CPFA 2HIVA 3GTQB 4HSPA 1ASZA 2EY2A 2A6HD 3HKSA 3PUXA 2F0PA 2AKWB 1X54A 4JW0A 4PZ8A 4N9TA 1ENAA 2F0EA 4OO1G 3G6JB 4A93B 1A3VA 1HXYD 1EWIA 1PTOD 1Z7TA 1HJPA 2YU9B 1BBUA 5AJ3Q 1PFSA 3L3OC 1KRTA 4HIKA 3S1RH 4ZAIA 2R7ZB 4LF6L 1BQQT 2IHFA 1VQGA 2NVYH 3GQBA 3I8ZA 4JI3L 5C6AA 4JI6L 4BBSH 3TP8A 3T53B 1T5XD 1HUNA 1U9RA 3RNUA 5IY0A 3CC4A 1T9HA 3L9AX 5EJWA 5CV6A 4RKLA 4B3RQ 3AU7A 4RWSC 3RZDB 3NWTA 2DJGC 2WAQG 4RGMA 1CKNB 4HTHA 1EZ8A 5K5PA 3P7JA 1S40A 2M2LA 3ULJA 2OTLA 1EYCA 5IYCG 1N36Q 4KHPQ 3K80C 5IIFA 2GA4B 4IPCA 3J81j 4KK7A 1PXUA 5C44G 3SR1A 2B2VA 2VZAA 3DWPA 4UY8C 1KRSA 5GQOA 2CCZA 1TWCB 1XMOL 3BJUA 2F03A 4L5SA 3S1NH 2BA1A 4LF7Q 4H02A 2I5LX 5FO7B 2CW0C 1ESRA 1CA5A 1X3QA 2ZTEA 2K4KA 1ICWA 1PZKD 2D9UA 4C2MH 5EPLA 2F0NA 2LXJA 1IBKQ 1A3TA 3LGJA 3QOJA 5EKLA 4HJ5A 1PFMA 4AH6A 3VA5A 2D62A 3JAMc 5FO9B 5AFWA 3I4MH 3O13A 5CR3A 5AJ3L 2X69A 3N52A 2NZHA 2DN8A 4DAVA 3NELA 5JEAG 4HAEA 5CV7A 2LY7A 2RSNA 2UUCQ 2Q8RE 4FF1A 1VQPA 1UE1A 2KBNA 3PF5A 1GO3E 1O7LA 1I94Q 3FHWA 3VR6A 5G3LF 2K5DA 5DM63 1Q8KA 2KHSA 5I4DA 3J7AF 3Q22A 2B3GA 4ME3A 2B2TA 1Y1VH 5I9PA 4GNXB 4B3RL 3A8KE 5C4XG 3KUPA 3ICEA 2WINB 1PLFA 5EBCA 1N36L 4KHPL 3GV3A 2XNAC 1A3UA 1UNSA 1IL2A 1VQJA 4LJZC 5T1IA 3D6CA 2GVBA 2NVXB 5IWAQ 5HURA 4Y7NB 2PW5A 4LF9Q 4DR4Q 1X6OA 4LF7L 2UUBQ 4WRDA 1FGBD 4P72A 4KD3A 4BY1G 2ZTDA 4BA1I 3M4YA 1E1TA 1EWHA 5DEHA 1EY9A 1JR0D 3VYRA 5C0XI 1HHVA 3OMCA 2OWOA 3PO2B 1K8GA 3S17H 3TSSA 1IBKL 5C44B 1Z47A 1RD9D 4ZYSA 2L5TA 1GM5A 3DEOA 1IBMQ 3ULPA 1TS4A 4WORA 2NN6H 3KF6B 4KV6A 1NMGA 1N32Q 4B08A 4GOPA 3I55A 4P73A 2IY5B 2IPKD 2VUMH 2F0VA 1SBBB 2F0LA 5IYBG 2F0QA 4WJ3M 3I3CA 1I4XA 1ZEQX 5M5XH 2UUCL 2MO1A 2JE6I 3K58A 2F0WA 1K9MC 4AIMA 3CCRA 1VQCA 1I94L 1EEID 2EQSA 4MNOA 1F9SA 4KLKA 2R92H 2PNRC 1HZAA 4G57A 4BBRH 1KNEA 1JMCA 1JB7A 4QL5A 4NDXA 2CKZB 4KJOA 1S5FD 1BVSA 2F0SA 5GROA 2PZTA 2R6GA 3OIPA 4A3DG 4HJ9A 2JXMB 3T56B 1K8MA 1Q90A 3K5MA 4JI1Q 1LTTD 3FVQA 3EIVA 5IWAL 1SR3A 2E74C 4YCUA 1OXVA 3M3YB 1A8VA 3K5NA 4LF9L 4DR4L 1STNA 2NB0A 4OO1I 1CSQA 5EKKA 2UUBL 3SGIA 1I5FA 5K36H 5C4XB 5GADC 5C4JH 3D4WA 2LSSA 4R8IA 3E9IA 1QCBD 4L5RC 3ZJYC 4GS3A 3S15B 1GUOA 1JICA 1HZBA 1U4MA 5IODA 1U5KA 4A3GH 1SE4A 4YCWA 1HNZQ 2SDFA 4OWXB 1TWFB 3T13A 1JWSD 2BH2A 4C3HG 3NWSA 4UP8A 2SEBD 2D0OA 3OIQA 4JVZA 2KHIA 4ABNA 1TWHH 1IBML 4DAYB 1JC7A 4DU9A 2FMCA 3RMHA 4K0KQ 1N32L 1PH7A 1OO9B 5IGEA 4RHSA 1QVCA 4B3TQ 4X6AH 3ITPA 5C0XJ 1IYVA 3I91A 2RDHA 4OL7A 1EYGA 1VCIA 1QVGA 1I4GA 1E2WA 3OW2A 1NBWA 4ZK9B 2DNCA 1HFNA 1SN8A 1PRTC 1VQOA 1K0RA 1QZHA 4KMUC 2G9DA 4CBVA 5JAVA 5GAHC 1KDBA 1CT1D 1SE3A 3NTIA 1PH2A 3UDIA 1BO0A 2K5VA 1DYQA 1C7YA 1FGUA 1LUZA 1HR0W 3TQYA 1GHKA 4JI1L 1IXRA 1TR5A 4LF5Q 2XVSA 1VQAA 3PIP3 4A3EG 4RGOS 1PTOH 1BCPC 3L2PA 1MJEA 3GTOB 1FNVA 5EGTA 2RF4A 3J81c 2EE1A 4DK1A 5M3MH 1TS3A 2PCFB 1L1OB 1K73C 2CW0D 5FLMH 3FKIG 1AZPA 4V0BA 1XWEA 4A3DB 4YHHQ 1HNZL 3TRZA 1EQVA 4DR7Q 5IP7G 1VQ7A 2R93H 2JSOA 2JA5H 3A56A 4QGUA 4J8QA 1HUMA 2J7ZA 1B70B 1BUVT 1LV9A 2Z9HA 3AMUA 4RMFA 1FR3A 2EYFA 2WB1E 3CCUA 3D31A 3MXNA 5IOCA 3DEPA 2F1MA 4K0KL 4ALPA 2E2JB 4X3KA 1NTGA 3CPWA 4K2KA 3HOUG 1G2TA 4CDCC 4OONA 2NTSA 4B3TL 1IKLA 3MXUA 5ELEA 1WTQA 4ME5A 1O78A 1CA6A 1PV4A 2B63H 4JCVE 3AEVA 1LT5D 3A0JA 5LMUQ 2QKIC 1K83H 1V1PB 4C3HB 2SNMA 4IJLA 1RODA 4IN3A 3CC7A 1PMRA 3EA6A 2Y0SG 3W1BA 3M4PA 1E1OA 2K14A 3M9BA 3CD6A 2IW3A 1BKBA 1DM0B 2IT1A 2RBMA 1RJTA 1UEAB 4IZ8A 4GLVB 1LT4D 1SYEA 4X3TA 5CBEE 2IX1A 1II3A 2F0KA 3HOZH 4LF5L 2WB1B 1B3AA 1XMQQ 2JQOA 3MWYW 3K7AH 1E22A 1UE7A 1O80A 1F2YA 1TS5A 1X56A 5EQ0A 1WTHA 1SFOB 5M5WB 3PSIA 2E2HH 2Q2TA 3Q6SA 3A54A 2EJMA 3Q8DA 3GTKB 1MHWC 4XXEA 4YHHL 3TDQA 2K28A 4DR7L 2VB3X 1YEZA 1WTOA 1EL0A 1PRTF 3IFTA 3MEHA 4TRDA 1RHPA 3ERQA 2MQHA 4KY7A 4A3EB 3U58A 1GUGA 3HRZC 2IHEA 1OTCA 1NE3A 3CQZB 4H7BA 3HFZB 5IYDH 3F2CA 1QWYA 3K0YA 1X55A 2Y0SE 2F4IA 1ASYA 4WFN3 3FKIB 5I2YA 3K8AA 2Q2UA 3BDCA 4LW1A 2BDNA 5LMUL 1AH9A 1GKHA 3WOFA 5LHY1 1BCPF 2CQOA 1S72A 2CQAA 5JEAJ 3E6ZX 3FPUB 3R2TA 3MFYA 1EUJA 1AFPA 2PNHA 1SE2A 2E75C 3H09A 4G4KA 1HA6A 4DV5Q 1I3QH 5I6YA 3MAQA 4FO2A 3MXGA 4G7OC 1SSOA 1MD2D 4BBSG 1BF4A 5C5LA 2C5CA 2YTXA 1XMQL 3MFGA 1GXDC 1CTMA 2UXBQ 3DWAA 4FVMA 4OWWB 4A3FG 1K8OA 2Y0SB 4IUTA 1D2BA 2A8VA 2VL6A 1KNAA 4K6DA 4OIJA 5GAEC 3FEWX 5KIXA 2XGTA 1SLJA 1YBYA 3NHHA 2YV5A 4KN4C 3M4OB 3CU7A 4K5XA 4X64Q 4UAIA 5CGKA 1I6HB 4IUNA 2EDGA 1TWAB 5ISRA 4NMZA 1IYUA 3GTPH 5J1ZA 5E4XA 2ICIA 3QIAA 5J3BA 3M7GA 1KDCA 1Y8PB 3S9WA 1L0YB 1Q3LA 4QY7A 1EIYB 1BR9A 1G6PA 3VYTA 3NUCA 1I4QA 3TEHB 3M7NA 1W2BA 2YTVA 3QJYA 2K7VA 4FF3A 2QEJC 1J6QA 4IPDA 1R9TH 3DHQA 4LFBQ 1ICFB 2F0DA 5E7NA 3EFXD 1F2MA 1SNCA 1PRTD 1SJED 3PIOA 1EU4A 2O4XA 4DV5L 1Y69U 4EGVA 1SXTA 4LMQD 2UUAQ 1Y1WH 2MGSA 4U673 3S16B 2RCNA 3H0GH 1EZ6A 1B8AA 3J80i 2QA4A 4N9PA 3HOWG 2D0PA 3A8JE 3K5LA 2HCIA 4GOPB 2UXBL 5JJIA 4RCOA 3DMUA 1GUSA 4K8IA 4JBKA 3PO3H 4ZQ3A 1BCPD 1YJNA 2JA6H 1IL8A 4A3BG 3SVMA 2EYLA 4A3CG 1S5BD 4YIJA 4NW2A 1JWMD 2ID0A 2MHVA 4IUVA 5BN4A 1FNWA 3L0OA 2N78A 4X64L 3R3OA 1WTVA 3H94A 1X32A 1QUQA 2XRQD 4NXMQ 1JCKB 5IT9L 1F9QA 1SAPA 1Y8NB 3G48A 3NENA 4F7XA 2Z6KA 3NQTA 1UWVA 3HKZG 3J81E 4YWMA 1W6JA 4A3FB 1SJHD 2C9OA 5M3FH 3KLSX 1EY0A 4ZCKA 3GTMH 1VQ4A 2A69C 1HZCA 3GTGB 3FP9A 3U50C 1V1OA 4IFDG 1VQ5A 4LFBL 2Z0SA 2PMZE 3U9SA 3TZDA 5KNDA 1I50B 3R2IA 5J22A 1CQFA 1S5CD 1WYDA 3VR4A 2UUAL 4CDDC 2E2DC 2O2LD 1Z6HA 3HS0C 3E9HA 5C3EG 4HIMA 2Q2HA 3DWQA 2G5DA 3J80c 1ILPA 1JT8A 2RDFA 2K6AA 2MP1A 4BY7H 1DZ1A 2N55A 2FHTA 3BZDB 3WOEA 1M90C 1G8ZD 2O5JC 1HQRD 4A3KG 3PUYA 3GO5A 4H0LC 3CAMA 4BBRG 4CJ2C 1EY5A 2L12A 1U4PA 1CKMA 1PYWD 1Q1BA 5FLXL 3EN2A 4KKTA 3S1QB 4DV3Q 2EPBA 2RCFA 2PMZB 4NXML 1P16A 3QB3A 3HOWB 1XPOA 1LTRD 3NEMA 2EYOA 5IT9E 2EY5A 1QZGA 3BU2A 5JPMC 2F3VA 1B7YB 4HEDA 4OGQC 1Q7YC 2VXWA 4KKSA 4DK6C 1HZ9A 3HOYH 3PF4A 4K14A 1NCVA 1K0SA 4A3BB 3D0FA 2PI2A 2FMMA 3RN2A 4KY6A 1Y14B 1TWGH 4PNYA 3U9OA 3MA2B 2D5DA 1PA6A 1PH8A 4B9WA 4DGZA 5ELOA 1WD0A 1C8CA 5KEEA 3IFDA 5JJLA 2OT2A 3GTLH 2B2UA 2DGYA 1CKOA 3NE5B 3OWEB 5JVG3 1EY7A 3K5OA 1MBYA 4CDEC 5KGUA 5IP9H 2RA4A 2R7FA 4C3JG 5C4ZA 4L63B 2V4DA 2JEBI 2KJXA 2NVTH 1LTID 2HIXA 3S17B 1EIFA 2I46A 4JK1C 4HJAA 3MXNB 2A1AA 4DAPA 3S1MB 1PDQA 4RCNA 4A3LG 2JA7G 3K81C 1EY4A 1Q8IA 1Q81C 3STBC 1YITA 4IQZA 1KL9A 1XJVA 1OXSC 2D2CC 2WAQE 3GV6A 4A93H 2CHBD 1E2ZA 3A5ZB 2M00A 5FLXE 5C3EB 4DV3L 4KKUA 1GJXA 2YU9H 4A3IG 4YWLA 3QO2A 1XXGA 3CRKC 4A3KB 1VQIA 3A5UA 3G6EA 1I4PA 2F0TA 2ZJRA 3LWUA 4BBRB 2HQLA 2K5NA 5M3MG 1C9OA 4XTCS 1X3EA 4I7ZC 3G4SA 3U4ZA 1LO5D 1PZJD 1S3OA 3HGBA 1O7YA 4DN4M 5DM73 2ZT9C 1SMYC 3AFPA 3KDFA 3ONAB 1U0LA 1VF5C 5JVH3 1W6KA 1ZYRD 4LUOA 2CFMA 3PMFA 2AQ2B 1N9WA 2WAQB 2TMPA 2QDLA 3DM3A 4EQ5A 1ONLA 5FO8B 4JI5Q 2PYKA 3HEJA 2F4VQ 2CWPA 1BDOA 1TWCH 2MUYA 2KCCA 3H6MA 3SK8A 1R4PB 2B63G 2JN4A 5T1GA 3AB9A 4EQPA 2V1CC 3HG9A 1SRUA 3LWEA 2DJFC 1Z9FA 4GN5A 4FF2A 3TMEA 1TWHB 5LMNQ 4PMWA 1C4QA 3NBHA 2JEAI 1WOCA 4NB3A 2IX3A 3CMAA 5M5YH 4OEMB 1D1IA 1DXMA 4C3JB 1F9RA 1ET9A 3S2DB 1QNUA 1JOQA 2EXDA 2B2WC 4LFCQ 1E7ZA 3I7FA 4L6TB 5ELCA 3HOZG 2N3SA 4M8AA 1TXYA 4IFDI 4TQUS 3I4NG 5ELFA 1XPUA 1YJWA 2E5LQ 2JA7B 1HNXQ 1O7ZA 5DNFA 1LTGD 2OF1A 2LMCB 3TN2A 3RLFA 1MGSA 1IHZA 2NUCA 5DLQE 3BDOA 4QUFA 3A7LA 4YCVA 1NJIC 3GTJB 1PH6A 4IURA 2BA0A 4O42A 4OO1H 4JV5Q 3PV0A 4QUCA 1STEA 2KENA 2XN9C 1KLGD 4V190 1Q46A 4A3IB 2A69D 4JOIC 3BYTB 1EIHA 1QJOA 1N34Q 3MC0B 3N6RA 1PTOB 2ATWA 2K05A 3LX0A 5E1FA 5EAYA 5IGDA 5G3LD 3KBXA 2NZ1D 1MSHA 1PFBA 2R3ZA 1S4ZA 5LMNW 1HR0Q 2F0IA 1DONA 2NVXH 2J0TD 4JI5L 5D14A 4LK1C 5M3MB 3OTOQ 2F4VL 1WD1A 2FINB 1WVLA 1B3QA 4PG3A 3A7AB 2DNEA 4RHRA 1RTNA 2NVQH 2B2YC 1D5ZC 3NQIA 2EOTA 5LMNL 4DV2Q 5IYCH 1HNWQ 1LABA 3PO2H 2HQEA 2F0MA 4QMGA 4BY1B 4A3MG 4GN3B 5C44H 3NXWA 1L0XB 2OQKA 5FJ8G 2K5QA 1SYFA 3J7AV 2K50A 3JAML 4LFCL 2B63B 4XQJA 1TIID 1LT3D 4IOCA 3UI2A 3K6OA 2NTTA 3E3XA 4JI0Q 1H9SB 3D8GA 1JWUD 2GVAA 2A19A 1U4LA 5H1SE 4DAMA 2PZWA 2E5LL 3CCEA 1HNXL 2F3WA 3F2BA 1IYJB 5ELBA 4H13C 1NR2A 1K3BC 3S14B 1XTCD 2WP8J 3H3VI 4GNXC 3CCVA 1S5DD 4DR3Q 1IBLQ 4ZUIA 4JV5L 4EX5A 4DNRB 5I9OA 4KY5A 4LNQA 2K32A 3HOZB 1P8LA 3RZOH 2XIWA 4K6LA 4CJ1B 3D4RA 1N34L 1RL2A 1Q86C 1PH4A 3I4NB 1RKNA 2KQ3A 1WFQA 1YNXA 4IFDJ 3K7AB 1V1QA 2F0JA 2I5MX 4CDFC 4A3JG 1HR0L 5JEAH 4R4IA 1QG7A 2KCMA 5KYLA 2QCPX 3C3LA 4CHTB 2RSOA 3OTOL 1QUQB 4RG1A 3M3YH 3EVQA 4TSSA 1STAA 1EFWA 4IALA 4UHVA 4CKCA 4JPBW 2B8GA 5C4XH 3AFQA 1CM9A 4DF7A 1IKMA 4P71A 1C0AA 2IL8A 3TS2A 1FVIA 3S15H 3IAYA 3WDNA 4DV2L 4GZYC 1HNWL 1EYAA 3FMCA 3HOXG 4S3SA 2CWAA 1TWFH 3MVVA 3J7YW 1VQNA 2K75A 2EY1A 3STBD 1I4RA 1Y1WG 3FPPA 3UDXA 3BYYB 4DV7Q 2JA8H 4BXXG 2L11A 1KAWA 4R1JA 4DUZQ 1VQ8A 3JAME 1YNJC 4JI0L 2IJ0A 2L4NA 4DNTB 3H91A 1QILA 2EZVA 1B1ZA 1M1KC 2NYZD 2K5WA 5EKIA 4GLAC 1FJGQ 1WI5A 2JA6G 1HRJA 3Q23A 3M85A 1SDFA 4JBJA 4A3MB 5IGFA 2ICEC 3OW7A 2PI2E 4DR3L 1IBLL 1HFGA 1H9KA 1LTBD 1KHIA 4K8JA 3PUWA 1ZKOA 3TREA 1B9MA 2KOLA 5JOBA 4GLXA 2RKSA 1SMYD 1N33Q 1SYGA 1TQOA 3BG3A 3X3NA 5M3FG 3NP8A 4TKOB 1KDAA 3ZYYX 2BH8A 3I72A 3D6WA 3PIPA 4X3UA 3GTOH 1TT2A 1A63A 4JC0A 3B6YA 3SE0A 1UE6A 5HGQA 1VS0A 3SHLA 3SK5A 4OHJA 3KJOA 4DR6Q 3KF8A 1LT6D 3MZ5A 4A3DH 2Z1CA 2F0OA 3W1GA 4A3JB 3CCJA 1UEBA 1EIGA 1YZ6A 2WFWA 1SYCA 1EQTA 4RAUC 4DV7L
chains in the Genus database with same CATH topology
1I94Q 3FHWA 1UE5A 4C3JH 1Q8KA 4DKAC 5M3FH 4DUZL 4BY7G 2B3GA 4ME3A 4NXNQ 3S2DH 1Y1VH 4GNXB 2E2JH 2AMCB 4A75A 4DK3C 4B3RL 5C4XG 2ZJQA 3GTMH 1VQ4A 4NPSA 3ICEA 2WB1G 3ERSX 4X66L 2HHHQ 1HZCA 1JJCB 3FP9A 4DR5Q 3U50C 4IFDG 1DGSA 1N36L 4KHPL 1VQ5A 4A3LH 1EQRA 4YY3Q 2JA7H 2ASBA 2Z0SA 1VQJA 1IL2A 4LFBL 4DV4Q 2PMZE 4C3HH 2GVBA 4B3MQ 5IWAQ 4DNIA 3F1ZA 3GTJH 1WYDA 1CKNA 4LF9Q 3KFUA 1KD1C 5ELNA 4DR4Q 3GDEA 2ZM6Q 4LUVA 1X6OA 2UUAL 4LF7L 2AWOA 3H15A 1VQKA 2UUBQ 3E9HA 4P72A 5C3EG 2E8GA 2Q2HA 4HIMA 1N33L 1QVFA 4JOIA 4A3IH 4BY1G 3J80c 2ZTDA 4BA1I 4BY7H 1E1TA 1JT8A 4B3SQ 5C0XI 2KCTA 2VQFQ 1M90C 3HOYG 1BBWA 4A3KG 3PUYA 2OWOA 4L5TA 3GO5A 1K8GA 1PH3A 3S17H 4OWTB 3CAMA 1IBKL 4BBRG 1Z47A 4JYAL 1E24A 2K5HA 1MJCA 1GM5A 2B29A 1L1OC 1PH9A 3MEFA 1HH2P 1IBMQ 1SFOH 3ULPA 1CKMA 3PUZA 2HT1A 1Q1BA 2E2IH 5M5WH 3J7ZC 5HY6A 3EN2A 3KF6B 3CMEA 1NMGA 4IO9A 1N32Q 1FL0A 4GOPA 3H0GG 4DV3Q 4DR6L 1JJGA 3I55A 4NXML 1P16A 4P73A 4DUYQ 2IY5B 2VUMH 1RIPA 2C35B 1KXLA 1XPOA 1E3PA 3NEMA 3U4VA 1QZGA 4JI4L 4FDBA 3BU2A 5IYBG 4WJ3M 3KDFB 4R4TA 2UUCL 5M5XH 2MO1A 4BY1H 1B7YB 2JE6I 1Q7YC 4JI7Q 4DK6C 1K9MC 4A3EH 1HZ9A 4AIMA 3CCRA 1VQCA 3HOYH 1I94L 3PF4A 2VY3A 4QQBX 2EQSA 3VDYA 3PO3G 4MNOA 3HOVG 3L7ZC 4KLKA 4NXNL 2R92H 3F8TA 4KI0A 3D0FA 1HZAA 3PCOB 3CCQA 3EBEA 2PI2A 3I4MG 3RN2A 1CSPA 4BBRH 4DR1Q 1JMCA 1Y14B 1TWGH 4R4QA 3RLOA 4QL5A 1JB7A 4A76A 1PA6A 1PH8A 2HHHL 4DR5L 2CKZB 2JJQA 3FKIH 4APVA 1XNQQ 1BVSA 5ELOA 5GROA 2N8NA 2R6GA 2QEXA 4A3DG 4HJ9A 4JI2Q 4YY3L 5JJLA 3GTLH 5IP7H 4DV4L 3KLWA 2DGYA 4JI1Q 1CKOA 4B3ML 2VNUD 4GNXA 3EIVA 5IWAL 3S14H 4LUZA 4A93G 1SR3A 4P74A 4YCUA 1L2FA 3CP0A 1OXVA 1D8LA 1MIUA 1A8VA 2AWNA 5IYBH 4LF9L 5IP9H 1AE2A 2R7FA 2ES2A 4DR4L 3NBHB 2ZM6L 4OO1I 1CSQA 2JEBI 2K52A 1Y1VG 4O0AA 3SGIA 1I5FA 2RHSB 2UUBL 2NVTH 5GADC 5C4JH 2ALYB 5GAGC 2HIXA 2LSSA 1GVPA 3E9IA 3HOVH 4B3SL 1EIFA 4L5RC 3ZJYC 2YTYA 4GS3A 2VQFL 4HJAA 3I4NH 3MXNB 4JG2A 4LF4Q 1IZ6A 2A1AA 3CXCA 5IT9c 1HZBA 4WJ4A 4UPAA 1U5KA 1XTDA 4A3GH 3UDFA 4YCWA 1HNZQ 2JA7G 4A3LG 3K81C 4OWXB 1L0WA 1Q81C 2UU9Q 3STBC 1YITA 2BH2A 2VW9A 4UP8A 1KL9A 2UXDQ 2D0OA 2KHIA 1XJVA 4IOAA 1TWHH 1IBML 1X65A 1OXSC 4IPGA 2WAQE 4DAYB 4Y52H 4A93H 3A5ZB 4QIWE 4K0KQ 1N32L 2N49A 1PH7A 3CCLA 4DV3L 2YU9H 1OXUA 4A3IG 1LYLA 1NY4A 1QVCA 4YWLA 4DUYL 4B3TQ 4X6AH 1I6HH 5C0XJ 2YYZA 1WCMG 5BR8Q 1EYGA 1VQIA 1D7QA 1VCIA 3A5UA 3G6EA 2PQAB 1QVGA 4JI7L 4L5QA 4GKKQ 2ZJRA 3OW2A 3T1YQ 2DUDA 2HQLA 1NBWA 2K5NA 3KF6A 4PZ6A 5M3MG 1C9OA 1KIXA 1V43A 1SN8A 1X3EA 4XTCS 1FJGL 1JE5A 3G4SA 3J7A5 2JA9A 3U4ZA 1VQOA 1GD7A 4DR1L 4BA2I 1S3OA 1K0RA 4X62Q 4POFA 5GAHC 2NN6G 4AQYQ 3KJPA 1QZHA 1X3GA 3AFPA 3KDFA 1U0LA 1PH2A 3UDIA 1G291 1XNQL 2K5VA 4LUOA 1C7YA 2CFMA 1FGUA 1VQMA 1LUZA 1VQ9A 2GN5A 3IRBA 4JI2L 2VUMG 1HR0W 3TQYA 3TS0A 1H95A 4JI1L 1IXRA 3KOJA 1W3SA 4LF5Q 1N9WA 4AYBG 3I2ZA 4LFAQ 4A3MH 1VQAA 4A3EG 3DM3A 4EQ5A 1XMOQ 5FJ8H 2IX0A 1WCMH 4TVAB 3L2PA 1MJEA 4JI5Q 4XIGS 2F4VQ 2CWPA 2R92G 2ZTCA 4DV1Q 2RF4A 1TWCH 3J81c 2B63G 5FLXc 1XPRA 5M3MH 4DV6Q 3S16H 1L1OB 1K3RA 1K73C 2V1CC 5FLMH 4LF4L 3FKIG 1OXTA 1SRUA 4JI8Q 4LWCA 3I56A 4J15A 1YHBA 1Z9FA 3HKZE 3BZCA 4GN5A 4YHHQ 2F52A 2MNAA 1HNZL 5LMNQ 2JK8A 4PMWA 3TRZA 4DR7Q 2JEAI 5IP7G 1VQ7A 1Q12A 3JAMi 2UU9L 2R93H 1OXXK 1WOCA 2Z6KC 4NB3A 3GTKH 2UXDL 2JA5H 4QGUA 3RLNA 5M5YH 3CMAA 3CCSA 1YIJA 4YWKA 1B70B 2UXCQ 3I4OA 3BZKA 5IP9G 4RMFA 2WB1E 3CCUA 3D31A 2ZJPA 4A4IA 2EXDA 1PH1A 2VS1A 4X65Q 4ALPA 1KQSA 4LFCQ 3AYHB 1E7ZA 1NTGA 3I7FA 3CPWA 3HOUG 5K36G 3HOZG 4OONA 4C3IH 2N3SA 4B3TL 1TXYA 3CQZH 4IFDI 3K0XA 3PGZA 4TQUS 3I4NG 5BR8L 2B63H 1XPUA 1PV4A 3AEVA 4JCVE 4QJFA 1YJWA 1LM0A 4A3JH 1K8AC 2E5LQ 4A3GG 3A0JA 1HNXQ 5LMUQ 4GKKL 2R7DA 4R4OA 1K83H 1PYBA 1EQQA 3T1YL 4GKJQ 3RLFA 3S24A 4IJLA 4LF8Q 5DLQE 3F2DA 3CC7A 1NJIC 4YCVA 4A3FH 2L15A 5JJKA 1AE3A 1VQBA 2Y0SG 3W1BA 1PH6A 3M4PA 2BA0A 4KHZA 1E1OA 4AYBE 4JBWA 2K14A 3M9BA 3CD6A 4X62L 4AQYL 4JV5Q 3OYYA 3PV0A 1BKBA 3ULLA 2IT1A 2KENA 2VQEQ 2PQAA 3PO2G 2OQ0A 1Q46A 1VQ6A 4JOIC 3GTGH 4GLVB 4IPHA 1N34Q 3UDGA 2ATWA 3HOUH 3HOXH 2IX1A 5EAYA 3HOZH 4LF5L 3E0EA 3CF5A 4LFAL 1EOVA 4HIDA 1XMQQ 4DV0Q 2R7ZG 1HR0Q 5LMNW 2JQOA 1G51A 2NVXH 1I50H 3T1HQ 4JI5L 3K7AH 1E22A 1UE7A 3OTOQ 2F4VL 4DV1L 4BXXH 1VQEA 1X56A 3A74A 3GTQH 4PG3A 2I5HA 3CW2C 3CC2A 3K7UC 3AQQA 4DV6L 3PSIA 2E2HH 2Q2TA 2NVQH 3Q8DA 3JC66 4GOPC 4DR2Q 4JI8L 4GN4B 4YHHL 2RHQB 5C0XG 5LMNL 4DR7L 4DV2Q 5IYCH 1YEZA 1HNWQ 3PO2H 1J5EQ 3M4OH 2MQHA 4A3MG 2OTJA 4LF6Q 4GN3B 5C44H 3U58A 2UXCL 2OQKA 4DPGA 4OXPA 5FJ8G 4JI3Q 4JI6Q 1V9PA 1TWAH 1L1OA 2IHEA 1OTCA 2Q2IA 1NE3A 2K50A 1PH5A 4X65L 1JJ2A 2R7ZH 4LFCL 3HFZB 3RR5A 4HJ7A 5IYDH 4MTNA 3F2CA 5IE8A 4IOCA 1X55A 2Y0SE 3DLLA 3S1QH 1YI2A 4JI0Q 4PZ7A 1PVOA 1SMXA 1Q82C 2LXKA 3W5OA 1ASYA 3UE1A 5FLMG 2GVAA 2A19A 3K8AA 5H1SE 1YJ9A 2Q2UA 4DAMA 3HOWH 4LW1A 1VQDA 2XTIA 2E5LL 1LTLA 3CCEA 5LMUL 3F2BA 3GD7A 1GKHA 1HNXL 1AH9A 1IYJB 1S72A 2CQOA 1N8RC 5JEAJ 3RZDH 2I0QA 4GKJL 2R93G 4LF8L 2WP8J 1WJJA 2JA5G 4GNXC 3H3VI 4UP7A 3CCVA 1EUJA 4O2DA 3G71A 4DR3Q 2PNHA 1IBLQ 4HIOA 4A3BH 4A3CH 4JV5L 4EX5A 1MKHA 4LNQA 2MFIA 4OX9Q 4DV5Q 2VQEL 1P8LA 1VQHA 2F3IA 1I3QH 3S2HH 3RZOH 4K0KL 1N34L 4R4CA 2MO0A 1RL2A 1Q86C 1PH4A 4IFDJ 1WFQA 1A0IA 1YNXA 1V1QA 3M4QA 4BBSG 3CPFA 2HIVA 2I5MX 2NZOA 4A3JG 2YTXA 4POGA 3RN5A 1XMQL 4DV0L 1ASZA 1HR0L 2JA8G 1XNRQ 4R4IA 2KCMA 3T1HL 2UXBQ 3KF8B 3OTOL 3HKSA 1QUQB 3PUXA 4RG1A 3M3YH 4OWWB 4A3FG 2AKWB 3CCMA 2A8VA 2VL6A 1X54A 1EFWA 1PYSB 5GAEC 4PZ8A 2XGTA 1KC8C 4OO1G 1SLJA 1YBYA 5C4XH 1EWIA 2QGQA 3AFQA 2YV5A 4DR2L 1HJPA 2H5XA 4P71A 1C0AA 4X64Q 3TS2A 1FVIA 3S15H 1BBUA 5AJ3Q 1PFSA 4DV2L 1HNWL 3HOXG 3S1MH 1KRTA 1J5EL 2FXQA 4HIKA 2CWAA 3GTPH 3S1RH 1TWFH 1VQNA 3UE0A 4LF6L 2K75A 3STBD 2IHFA 5J3BA 1VQGA 2NVYH 4JI3L 4JI6L 1Y1WG 4BBSH 3UDXA 4DV7Q 2JA8H 4BXXG 3RNUA 4QY7A 5IY0A 3CC4A 1KAWA 1T9HA 4R1JA 4DUZQ 1VQ8A 2NN6I 1EIYB 1NMFA 5C3EH 4JI0L 4B3RQ 1G6PA 4P75A 2WAQG 1CKNB 3TEHB 4X66Q 3M7NA 1M1KC 1W2BA 2YTVA 4HJ8A 1VQLA 1S40A 4GLAC 4A3KH 1WI5A 3ULJA 2OTLA 1N36Q 5IYCG 4UP9A 1FJGQ 3K80C 2JA6G 1A62A 4IPDA 1J6QA 3M85A 1R9TH 4KHPQ 4JBJA 4LFBQ 4IPCA 3J81j 5C44G 2PI2E 5E7NA 3KYHC 2EIFA 1YHQA 4DR3L 1IBLL 2AHOB 3PIOA 2VZAA 1X9NA 1KHIA 4OX9L 3PUWA 1KRSA 5GQOA 2CCZA 1PHJA 3TREA 4UY8C 1XMOL 3BJUA 5IYDG 4DV5L 4MZ9A 4L5SA 1YHAA 2UUAQ 4GLXA 1Y1WH 2BA1A 4LF7Q 1SE8A 4Y7NH 1Q1EA 3S1NH 4H02A 2RCNA 3H0GH 3J80i 1B8AA 2QA4A 1N33Q 2I5LX 1O7IA 2KHJA 1VQFA 2ZTEA 2K4KA 3HOWG 2D0PA 1YVCA 1XNRL 5M3FG 4GOPB 2UXBL 3J81i 4C2MH 5JJIA 1CUKA 2LXJA 2BH8A 1IBKQ 3PO3H 4JBKA 3LGJA 3PIPA 4JYAQ 3GTOH 4HJ5A 1YJNA 1A63A 4AH6A 2JA6H 4JC0A 4A3BG 2D62A 3B6YA 4A3CG 1UE6A 5HGQA 3JAMc 1VS0A 2ID0A 3WWVA 3I4MH 4IJHA 3L0OA 3KJOA 2N78A 4X64L 4DR6Q 5AJ3L 1QUQA 4NXMQ 1X3FA 2NZHA 2OCEA 4A3DH 3G48A 3W1GA 1SROA 3NENA 3CCJA 4JI4Q 3PUVA 2Z6KA 1UEBA 3NELA 1YZ6A 5JEAG 2UUCQ 2WFWA 1VQPA 1UE1A 1UWVA 2KBNA 3HKZG 3PF5A 4YWMA 3ER0A 4JBMA 1GO3E 4DV7L 3H3VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 Q;  3FHW A;  1UE5 A;  4C3J H;  1Q8K A;  4DKA C;  5M3F H;  4DUZ L;  4BY7 G;  2B3G A;  4ME3 A;  4NXN Q;  3S2D H;  1Y1V H;  4GNX B;  2E2J H;  2AMC B;  4A75 A;  4DK3 C;  4B3R L;  5C4X G;  2ZJQ A;  3GTM H;  1VQ4 A;  4NPS A;  3ICE A;  2WB1 G;  3ERS X;  4X66 L;  2HHH Q;  1HZC A;  1JJC B;  3FP9 A;  4DR5 Q;  3U50 C;  4IFD G;  1DGS A;  1N36 L;  4KHP L;  1VQ5 A;  4A3L H;  1EQR A;  4YY3 Q;  2JA7 H;  2ASB A;  2Z0S A;  1VQJ A;  1IL2 A;  4LFB L;  4DV4 Q;  2PMZ E;  4C3H H;  2GVB A;  4B3M Q;  5IWA Q;  4DNI A;  3F1Z A;  3GTJ H;  1WYD A;  1CKN A;  4LF9 Q;  3KFU A;  1KD1 C;  5ELN A;  4DR4 Q;  3GDE A;  2ZM6 Q;  4LUV A;  1X6O A;  2UUA L;  4LF7 L;  2AWO A;  3H15 A;  1VQK A;  2UUB Q;  3E9H A;  4P72 A;  5C3E G;  2E8G A;  2Q2H A;  4HIM A;  1N33 L;  1QVF A;  4JOI A;  4A3I H;  4BY1 G;  3J80 c;  2ZTD A;  4BA1 I;  4BY7 H;  1E1T A;  1JT8 A;  4B3S Q;  5C0X I;  2KCT A;  2VQF Q;  1M90 C;  3HOY G;  1BBW A;  4A3K G;  3PUY A;  2OWO A;  4L5T A;  3GO5 A;  1K8G A;  1PH3 A;  3S17 H;  4OWT B;  3CAM A;  1IBK L;  4BBR G;  1Z47 A;  4JYA L;  1E24 A;  2K5H A;  1MJC A;  1GM5 A;  2B29 A;  1L1O C;  1PH9 A;  3MEF A;  1HH2 P;  1IBM Q;  1SFO H;  3ULP A;  1CKM A;  3PUZ A;  2HT1 A;  1Q1B A;  2E2I H;  5M5W H;  3J7Z C;  5HY6 A;  3EN2 A;  3KF6 B;  3CME A;  1NMG A;  4IO9 A;  1N32 Q;  1FL0 A;  4GOP A;  3H0G G;  4DV3 Q;  4DR6 L;  1JJG A;  3I55 A;  4NXM L;  1P16 A;  4P73 A;  4DUY Q;  2IY5 B;  2VUM H;  1RIP A;  2C35 B;  1KXL A;  1XPO A;  1E3P A;  3NEM A;  3U4V A;  1QZG A;  4JI4 L;  4FDB A;  3BU2 A;  5IYB G;  4WJ3 M;  3KDF B;  4R4T A;  2UUC L;  5M5X H;  2MO1 A;  4BY1 H;  1B7Y B;  2JE6 I;  1Q7Y C;  4JI7 Q;  4DK6 C;  1K9M C;  4A3E H;  1HZ9 A;  4AIM A;  3CCR A;  1VQC A;  3HOY H;  1I94 L;  3PF4 A;  2VY3 A;  4QQB X;  2EQS A;  3VDY A;  3PO3 G;  4MNO A;  3HOV G;  3L7Z C;  4KLK A;  4NXN L;  2R92 H;  3F8T A;  4KI0 A;  3D0F A;  1HZA A;  3PCO B;  3CCQ A;  3EBE A;  2PI2 A;  3I4M G;  3RN2 A;  1CSP A;  4BBR H;  4DR1 Q;  1JMC A;  1Y14 B;  1TWG H;  4R4Q A;  3RLO A;  4QL5 A;  1JB7 A;  4A76 A;  1PA6 A;  1PH8 A;  2HHH L;  4DR5 L;  2CKZ B;  2JJQ A;  3FKI H;  4APV A;  1XNQ Q;  1BVS A;  5ELO A;  5GRO A;  2N8N A;  2R6G A;  2QEX A;  4A3D G;  4HJ9 A;  4JI2 Q;  4YY3 L;  5JJL A;  3GTL H;  5IP7 H;  4DV4 L;  3KLW A;  2DGY A;  4JI1 Q;  1CKO A;  4B3M L;  2VNU D;  4GNX A;  3EIV A;  5IWA L;  3S14 H;  4LUZ A;  4A93 G;  1SR3 A;  4P74 A;  4YCU A;  1L2F A;  3CP0 A;  1OXV A;  1D8L A;  1MIU A;  1A8V A;  2AWN A;  5IYB H;  4LF9 L;  5IP9 H;  1AE2 A;  2R7F A;  2ES2 A;  4DR4 L;  3NBH B;  2ZM6 L;  4OO1 I;  1CSQ A;  2JEB I;  2K52 A;  1Y1V G;  4O0A A;  3SGI A;  1I5F A;  2RHS B;  2UUB L;  2NVT H;  5GAD C;  5C4J H;  2ALY B;  5GAG C;  2HIX A;  2LSS A;  1GVP A;  3E9I A;  3HOV H;  4B3S L;  1EIF A;  4L5R C;  3ZJY C;  2YTY A;  4GS3 A;  2VQF L;  4HJA A;  3I4N H;  3MXN B;  4JG2 A;  4LF4 Q;  1IZ6 A;  2A1A A;  3CXC A;  5IT9 c;  1HZB A;  4WJ4 A;  4UPA A;  1U5K A;  1XTD A;  4A3G H;  3UDF A;  4YCW A;  1HNZ Q;  2JA7 G;  4A3L G;  3K81 C;  4OWX B;  1L0W A;  1Q81 C;  2UU9 Q;  3STB C;  1YIT A;  2BH2 A;  2VW9 A;  4UP8 A;  1KL9 A;  2UXD Q;  2D0O A;  2KHI A;  1XJV A;  4IOA A;  1TWH H;  1IBM L;  1X65 A;  1OXS C;  4IPG A;  2WAQ E;  4DAY B;  4Y52 H;  4A93 H;  3A5Z B;  4QIW E;  4K0K Q;  1N32 L;  2N49 A;  1PH7 A;  3CCL A;  4DV3 L;  2YU9 H;  1OXU A;  4A3I G;  1LYL A;  1NY4 A;  1QVC A;  4YWL A;  4DUY L;  4B3T Q;  4X6A H;  1I6H H;  5C0X J;  2YYZ A;  1WCM G;  5BR8 Q;  1EYG A;  1VQI A;  1D7Q A;  1VCI A;  3A5U A;  3G6E A;  2PQA B;  1QVG A;  4JI7 L;  4L5Q A;  4GKK Q;  2ZJR A;  3OW2 A;  3T1Y Q;  2DUD A;  2HQL A;  1NBW A;  2K5N A;  3KF6 A;  4PZ6 A;  5M3M G;  1C9O A;  1KIX A;  1V43 A;  1SN8 A;  1X3E A;  4XTC S;  1FJG L;  1JE5 A;  3G4S A;  3J7A 5;  2JA9 A;  3U4Z A;  1VQO A;  1GD7 A;  4DR1 L;  4BA2 I;  1S3O A;  1K0R A;  4X62 Q;  4POF A;  5GAH C;  2NN6 G;  4AQY Q;  3KJP A;  1QZH A;  1X3G A;  3AFP A;  3KDF A;  1U0L A;  1PH2 A;  3UDI A;  1G29 1;  1XNQ L;  2K5V A;  4LUO A;  1C7Y A;  2CFM A;  1FGU A;  1VQM A;  1LUZ A;  1VQ9 A;  2GN5 A;  3IRB A;  4JI2 L;  2VUM G;  1HR0 W;  3TQY A;  3TS0 A;  1H95 A;  4JI1 L;  1IXR A;  3KOJ A;  1W3S A;  4LF5 Q;  1N9W A;  4AYB G;  3I2Z A;  4LFA Q;  4A3M H;  1VQA A;  4A3E G;  3DM3 A;  4EQ5 A;  1XMO Q;  5FJ8 H;  2IX0 A;  1WCM H;  4TVA B;  3L2P A;  1MJE A;  4JI5 Q;  4XIG S;  2F4V Q;  2CWP A;  2R92 G;  2ZTC A;  4DV1 Q;  2RF4 A;  1TWC H;  3J81 c;  2B63 G;  5FLX c;  1XPR A;  5M3M H;  4DV6 Q;  3S16 H;  1L1O B;  1K3R A;  1K73 C;  2V1C C;  5FLM H;  4LF4 L;  3FKI G;  1OXT A;  1SRU A;  4JI8 Q;  4LWC A;  3I56 A;  4J15 A;  1YHB A;  1Z9F A;  3HKZ E;  3BZC A;  4GN5 A;  4YHH Q;  2F52 A;  2MNA A;  1HNZ L;  5LMN Q;  2JK8 A;  4PMW A;  3TRZ A;  4DR7 Q;  2JEA I;  5IP7 G;  1VQ7 A;  1Q12 A;  3JAM i;  2UU9 L;  2R93 H;  1OXX K;  1WOC A;  2Z6K C;  4NB3 A;  3GTK H;  2UXD L;  2JA5 H;  4QGU A;  3RLN A;  5M5Y H;  3CMA A;  3CCS A;  1YIJ A;  4YWK A;  1B70 B;  2UXC Q;  3I4O A;  3BZK A;  5IP9 G;  4RMF A;  2WB1 E;  3CCU A;  3D31 A;  2ZJP A;  4A4I A;  2EXD A;  1PH1 A;  2VS1 A;  4X65 Q;  4ALP A;  1KQS A;  4LFC Q;  3AYH B;  1E7Z A;  1NTG A;  3I7F A;  3CPW A;  3HOU G;  5K36 G;  3HOZ G;  4OON A;  4C3I H;  2N3S A;  4B3T L;  1TXY A;  3CQZ H;  4IFD I;  3K0X A;  3PGZ A;  4TQU S;  3I4N G;  5BR8 L;  2B63 H;  1XPU A;  1PV4 A;  3AEV A;  4JCV E;  4QJF A;  1YJW A;  1LM0 A;  4A3J H;  1K8A C;  2E5L Q;  4A3G G;  3A0J A;  1HNX Q;  5LMU Q;  4GKK L;  2R7D A;  4R4O A;  1K83 H;  1PYB A;  1EQQ A;  3T1Y L;  4GKJ Q;  3RLF A;  3S24 A;  4IJL A;  4LF8 Q;  5DLQ E;  3F2D A;  3CC7 A;  1NJI C;  4YCV A;  4A3F H;  2L15 A;  5JJK A;  1AE3 A;  1VQB A;  2Y0S G;  3W1B A;  1PH6 A;  3M4P A;  2BA0 A;  4KHZ A;  1E1O A;  4AYB E;  4JBW A;  2K14 A;  3M9B A;  3CD6 A;  4X62 L;  4AQY L;  4JV5 Q;  3OYY A;  3PV0 A;  1BKB A;  3ULL A;  2IT1 A;  2KEN A;  2VQE Q;  2PQA A;  3PO2 G;  2OQ0 A;  1Q46 A;  1VQ6 A;  4JOI C;  3GTG H;  4GLV B;  4IPH A;  1N34 Q;  3UDG A;  2ATW A;  3HOU H;  3HOX H;  2IX1 A;  5EAY A;  3HOZ H;  4LF5 L;  3E0E A;  3CF5 A;  4LFA L;  1EOV A;  4HID A;  1XMQ Q;  4DV0 Q;  2R7Z G;  1HR0 Q;  5LMN W;  2JQO A;  1G51 A;  2NVX H;  1I50 H;  3T1H Q;  4JI5 L;  3K7A H;  1E22 A;  1UE7 A;  3OTO Q;  2F4V L;  4DV1 L;  4BXX H;  1VQE A;  1X56 A;  3A74 A;  3GTQ H;  4PG3 A;  2I5H A;  3CW2 C;  3CC2 A;  3K7U C;  3AQQ A;  4DV6 L;  3PSI A;  2E2H H;  2Q2T A;  2NVQ H;  3Q8D A;  3JC6 6;  4GOP C;  4DR2 Q;  4JI8 L;  4GN4 B;  4YHH L;  2RHQ B;  5C0X G;  5LMN L;  4DR7 L;  4DV2 Q;  5IYC H;  1YEZ A;  1HNW Q;  3PO2 H;  1J5E Q;  3M4O H;  2MQH A;  4A3M G;  2OTJ A;  4LF6 Q;  4GN3 B;  5C44 H;  3U58 A;  2UXC L;  2OQK A;  4DPG A;  4OXP A;  5FJ8 G;  4JI3 Q;  4JI6 Q;  1V9P A;  1TWA H;  1L1O A;  2IHE A;  1OTC A;  2Q2I A;  1NE3 A;  2K50 A;  1PH5 A;  4X65 L;  1JJ2 A;  2R7Z H;  4LFC L;  3HFZ B;  3RR5 A;  4HJ7 A;  5IYD H;  4MTN A;  3F2C A;  5IE8 A;  4IOC A;  1X55 A;  2Y0S E;  3DLL A;  3S1Q H;  1YI2 A;  4JI0 Q;  4PZ7 A;  1PVO A;  1SMX A;  1Q82 C;  2LXK A;  3W5O A;  1ASY A;  3UE1 A;  5FLM G;  2GVA A;  2A19 A;  3K8A A;  5H1S E;  1YJ9 A;  2Q2U A;  4DAM A;  3HOW H;  4LW1 A;  1VQD A;  2XTI A;  2E5L L;  1LTL A;  3CCE A;  5LMU L;  3F2B A;  3GD7 A;  1GKH A;  1HNX L;  1AH9 A;  1IYJ B;  1S72 A;  2CQO A;  1N8R C;  5JEA J;  3RZD H;  2I0Q A;  4GKJ L;  2R93 G;  4LF8 L;  2WP8 J;  1WJJ A;  2JA5 G;  4GNX C;  3H3V I;  4UP7 A;  3CCV A;  1EUJ A;  4O2D A;  3G71 A;  4DR3 Q;  2PNH A;  1IBL Q;  4HIO A;  4A3B H;  4A3C H;  4JV5 L;  4EX5 A;  1MKH A;  4LNQ A;  2MFI A;  4OX9 Q;  4DV5 Q;  2VQE L;  1P8L A;  1VQH A;  2F3I A;  1I3Q H;  3S2H H;  3RZO H;  4K0K L;  1N34 L;  4R4C A;  2MO0 A;  1RL2 A;  1Q86 C;  1PH4 A;  4IFD J;  1WFQ A;  1A0I A;  1YNX A;  1V1Q A;  3M4Q A;  4BBS G;  3CPF A;  2HIV A;  2I5M X;  2NZO A;  4A3J G;  2YTX A;  4POG A;  3RN5 A;  1XMQ L;  4DV0 L;  1ASZ A;  1HR0 L;  2JA8 G;  1XNR Q;  4R4I A;  2KCM A;  3T1H L;  2UXB Q;  3KF8 B;  3OTO L;  3HKS A;  1QUQ B;  3PUX A;  4RG1 A;  3M3Y H;  4OWW B;  4A3F G;  2AKW B;  3CCM A;  2A8V A;  2VL6 A;  1X54 A;  1EFW A;  1PYS B;  5GAE C;  4PZ8 A;  2XGT A;  1KC8 C;  4OO1 G;  1SLJ A;  1YBY A;  5C4X H;  1EWI A;  2QGQ A;  3AFQ A;  2YV5 A;  4DR2 L;  1HJP A;  2H5X A;  4P71 A;  1C0A A;  4X64 Q;  3TS2 A;  1FVI A;  3S15 H;  1BBU A;  5AJ3 Q;  1PFS A;  4DV2 L;  1HNW L;  3HOX G;  3S1M H;  1KRT A;  1J5E L;  2FXQ A;  4HIK A;  2CWA A;  3GTP H;  3S1R H;  1TWF H;  1VQN A;  3UE0 A;  4LF6 L;  2K75 A;  3STB D;  2IHF A;  5J3B A;  1VQG A;  2NVY H;  4JI3 L;  4JI6 L;  1Y1W G;  4BBS H;  3UDX A;  4DV7 Q;  2JA8 H;  4BXX G;  3RNU A;  4QY7 A;  5IY0 A;  3CC4 A;  1KAW A;  1T9H A;  4R1J A;  4DUZ Q;  1VQ8 A;  2NN6 I;  1EIY B;  1NMF A;  5C3E H;  4JI0 L;  4B3R Q;  1G6P A;  4P75 A;  2WAQ G;  1CKN B;  3TEH B;  4X66 Q;  3M7N A;  1M1K C;  1W2B A;  2YTV A;  4HJ8 A;  1VQL A;  1S40 A;  4GLA C;  4A3K H;  1WI5 A;  3ULJ A;  2OTL A;  1N36 Q;  5IYC G;  4UP9 A;  1FJG Q;  3K80 C;  2JA6 G;  1A62 A;  4IPD A;  1J6Q A;  3M85 A;  1R9T H;  4KHP Q;  4JBJ A;  4LFB Q;  4IPC A;  3J81 j;  5C44 G;  2PI2 E;  5E7N A;  3KYH C;  2EIF A;  1YHQ A;  4DR3 L;  1IBL L;  2AHO B;  3PIO A;  2VZA A;  1X9N A;  1KHI A;  4OX9 L;  3PUW A;  1KRS A;  5GQO A;  2CCZ A;  1PHJ A;  3TRE A;  4UY8 C;  1XMO L;  3BJU A;  5IYD G;  4DV5 L;  4MZ9 A;  4L5S A;  1YHA A;  2UUA Q;  4GLX A;  1Y1W H;  2BA1 A;  4LF7 Q;  1SE8 A;  4Y7N H;  1Q1E A;  3S1N H;  4H02 A;  2RCN A;  3H0G H;  3J80 i;  1B8A A;  2QA4 A;  1N33 Q;  2I5L X;  1O7I A;  2KHJ A;  1VQF A;  2ZTE A;  2K4K A;  3HOW G;  2D0P A;  1YVC A;  1XNR L;  5M3F G;  4GOP B;  2UXB L;  3J81 i;  4C2M H;  5JJI A;  1CUK A;  2LXJ A;  2BH8 A;  1IBK Q;  3PO3 H;  4JBK A;  3LGJ A;  3PIP A;  4JYA Q;  3GTO H;  4HJ5 A;  1YJN A;  1A63 A;  4AH6 A;  2JA6 H;  4JC0 A;  4A3B G;  2D62 A;  3B6Y A;  4A3C G;  1UE6 A;  5HGQ A;  3JAM c;  1VS0 A;  2ID0 A;  3WWV A;  3I4M H;  4IJH A;  3L0O A;  3KJO A;  2N78 A;  4X64 L;  4DR6 Q;  5AJ3 L;  1QUQ A;  4NXM Q;  1X3F A;  2NZH A;  2OCE A;  4A3D H;  3G48 A;  3W1G A;  1SRO A;  3NEN A;  3CCJ A;  4JI4 Q;  3PUV A;  2Z6K A;  1UEB A;  3NEL A;  1YZ6 A;  5JEA G;  2UUC Q;  2WFW A;  1VQP A;  1UE1 A;  1UWV A;  2KBN A;  3HKZ G;  3PF5 A;  4YWM A;  3ER0 A;  4JBM A;  1GO3 E;  4DV7 L;  3H3V H; 
#chains in the Genus database with same CATH topology
 2XWJ B;  4XDX A;  1WTX A;  1XYI A;  4DUZ L;  4BY7 G;  2PW7 A;  2AQ3 B;  2E2J H;  2X6L A;  4DK3 C;  3VYU A;  4X3S A;  3HZX A;  4OIK A;  4NPS A;  2HHH Q;  1M8A A;  4F88 A;  1JOK A;  4DR5 Q;  2H4O A;  4XT1 B;  4XYQ A;  3HOU B;  3HOX B;  1EQR A;  3V2T A;  2ASB A;  4C3H H;  2H1E A;  3C46 A;  3F1Z A;  3MTS A;  1KD1 C;  5ELN A;  3KFU A;  3GDE A;  2ZM6 Q;  4LUV A;  1TY0 A;  2AWO A;  1VQK A;  2EXZ A;  1N33 L;  2B8F A;  1EY6 A;  3TP5 A;  4B3S Q;  1TS2 A;  4QCL A;  1LLR D;  4RKB A;  5C3W A;  2VQF Q;  4MTK A;  3HOY G;  1BBW A;  1NSN S;  3BVG A;  5CV5 A;  2JA6 B;  2VB2 X;  2K04 A;  4H44 C;  4OWT B;  1PH3 A;  2NBF A;  3FDT A;  3A55 A;  1E24 A;  4KD4 A;  5CV4 A;  1MJC A;  1L1O C;  3SEB A;  3P75 A;  1HH2 P;  1SFO H;  3CKI B;  3PUZ A;  2HT1 A;  3J81 L;  1EOT A;  2E2I H;  5M5W H;  5HY6 A;  4Q0F A;  1GHJ A;  4IO9 A;  4FYD A;  1SYB A;  5IGC A;  4DR6 L;  1MI2 A;  1JJG A;  3TP7 A;  1IW7 C;  4DUY Q;  1RIP A;  2C35 B;  4P2C B;  1KXL A;  1QNK A;  4FDB A;  3KDF B;  4R4T A;  4Z9C B;  5M3F B;  4CGY B;  2Z4H A;  5FKA C;  5KNC A;  1ZYR C;  4A3E H;  3Q24 A;  2VY3 A;  4QQB X;  5CMD A;  4FP5 D;  4EQO A;  2K03 A;  1H9M A;  1QE6 A;  3DXJ C;  3EBE A;  3CCQ A;  3I4M G;  1CSP A;  1Y8O B;  3C1F A;  1AP0 A;  3RLO A;  2HHH L;  3S2H B;  1H9S A;  4A76 A;  4DR5 L;  2JJQ A;  3FKI H;  3VR3 A;  4APV A;  1JE4 A;  3QWN A;  2CH4 A;  2N8N A;  5JJZ A;  4JI2 Q;  3P1H A;  1STB A;  5IP7 H;  1WTR A;  5ELD A;  3KLW A;  3SDZ A;  4A93 G;  1TU2 B;  4LUZ A;  4P74 A;  4XT3 B;  2WKD A;  2AWN A;  2ES2 A;  1AE2 A;  2BE5 C;  3NBH B;  2ZM6 L;  4RGT A;  1Y1V G;  5E3F A;  4K5W A;  2WII B;  3HOV H;  4B3S L;  2G9H D;  1CHQ D;  3OSO A;  2VQF L;  4JG2 A;  4WJ4 A;  1EEF D;  4DFA A;  4BWG B;  1XTD A;  4N8F A;  3CRL C;  3S1R B;  2KA7 A;  2UU9 Q;  2NVY B;  1FD7 D;  1UAP A;  4BBS B;  4IOA A;  2DY8 A;  2I07 B;  1X65 A;  3TZU A;  4Y52 H;  5C4H A;  1SYD A;  1U4R A;  3CCL A;  2A6E C;  4DUY L;  1I6H H;  1V8Q A;  1DCZ A;  1ILQ A;  5BR8 Q;  2CVR A;  4DXF A;  4L5Q A;  4GKK Q;  4J1M A;  2XRS D;  1GUN A;  1STH A;  2EYJ A;  2DUD A;  1KIX A;  1JB3 A;  1ML0 D;  2KED A;  2RVL A;  1V43 A;  1C48 A;  4DA2 A;  3J7A 5;  2JA9 A;  2B2V C;  1GD7 A;  2EYM A;  4AQY Q;  2NN6 G;  1YNJ D;  3KJP A;  3GTL B;  2PZU A;  3S1N B;  1STY A;  1G29 1;  3KLR A;  4PMC A;  3I4L A;  4ULL A;  1VQM A;  1VQ9 A;  4JI2 L;  2VUM G;  3TS0 A;  4C56 C;  3I2Z A;  4BS9 A;  4C2M B;  1ENF A;  2NVT B;  1XMO Q;  5KRU A;  2IX0 A;  1WCM H;  4TVA B;  3T16 A;  2R92 G;  1LTA D;  2L1B A;  3I4M B;  5CV8 A;  1XPR A;  3S16 H;  4FXK C;  4F8M A;  2O5I C;  1K3R A;  3VR2 A;  4LWC A;  3I56 A;  3HKZ E;  1B44 D;  4C1N K;  3JAM i;  2WKC A;  2UU9 L;  4ZRZ A;  3CCS A;  1YIJ A;  2UXC Q;  3MHB A;  3BZK A;  1G91 A;  2ZJP A;  4A4I A;  1Y1V B;  1KQS A;  2KUM A;  2B2T C;  2VS1 A;  4X65 Q;  1CFM A;  5K36 G;  4CJ0 B;  4C3I H;  2L9H A;  2LKV A;  5LL6 X;  2EYP A;  5JPN C;  4OEL B;  3TBI B;  4RGN A;  5BR8 L;  4QJF A;  2F0H A;  2IWH A;  4A3G G;  4GKK L;  2K01 A;  4FNF A;  5COR A;  5C3X A;  1PFN A;  4G7H C;  3I73 A;  4R4O A;  1PYB A;  2AUJ D;  4LF8 Q;  1DOK A;  4A3F H;  2L15 A;  5JJK A;  1AE3 A;  2DY7 A;  4C1N I;  4KHZ A;  5F2D A;  4JBW A;  4B9X A;  4AQY L;  1F9P A;  1HTL D;  3OYY A;  5M9O A;  3HKZ B;  3BVZ A;  1RF2 D;  2PQA A;  3PO2 G;  3ND9 A;  1PZI D;  3GTG H;  5D3I B;  4IPH A;  3UDG A;  1RDP D;  1F2Z A;  1GUW A;  4G7Z C;  1H9R A;  3CF5 A;  1ENC A;  4HID A;  4HSV A;  4DV0 Q;  1AZQ A;  1G51 A;  1I50 H;  3T1H Q;  2OEO A;  1SNM A;  2A68 C;  5L37 A;  1VQE A;  3GTQ H;  1BOS A;  3R8B A;  1SNP A;  2I5H A;  3K7U C;  2A74 C;  3AQQ A;  3EJI A;  1D5M C;  4GOP C;  4DR2 Q;  2R61 A;  5M5Y B;  1JOO A;  2VUM B;  2RHQ B;  1UUP A;  3X3M A;  1HQM C;  1CQV A;  5M5X B;  1J5E Q;  2UXC L;  4DPG A;  1HA5 A;  1V9P A;  2R92 B;  1M4V A;  2Q2I A;  2ZXR A;  1PH5 A;  4X65 L;  4RFB A;  2R7Z H;  5FOB B;  1JQY D;  3RR5 A;  4HJ7 A;  5IE8 A;  1PRT B;  4KHV A;  3DLL A;  2BDO A;  3S1Q H;  4K2L A;  1Q82 C;  2CH4 W;  2Q8I B;  1DD2 A;  5FLM G;  2A73 B;  1IW7 D;  3HOW H;  1NUC A;  1VQD A;  1LTL A;  1EFI D;  3RZD H;  2I0Q A;  2R93 G;  4LF8 L;  1WJJ A;  3EQL C;  2JA5 G;  1VDZ A;  3NK9 A;  4UP7 A;  2Z8L A;  5C0X H;  4O2D A;  3SK4 A;  3G71 A;  2FJ2 A;  4A3B H;  4A3C H;  2MFI A;  4OX9 Q;  5C4J B;  1VQH A;  1BCP B;  3IL8 A;  5COY A;  1HPC A;  1S5E D;  4R4C A;  2MO0 A;  1A2U A;  1A0I A;  5DAU A;  2NZO A;  2JA8 G;  4POG A;  4A3G B;  3RN5 A;  4DV0 L;  1CHP D;  4HCE A;  1E2V A;  1XNR Q;  4RA8 A;  4XYO A;  3T1H L;  2K33 A;  3KF8 B;  1NNX A;  2NVQ B;  3CCM A;  4ZKC B;  3VA7 A;  1YNN D;  2BE5 D;  1PYS B;  2KVM A;  3SXH A;  4F87 A;  1G6Z A;  1KC8 C;  3KK7 A;  2RDG A;  2QGQ A;  4DR2 L;  3J80 L;  1A2T A;  2H5X A;  1I4H A;  1F2L A;  4IFD H;  1SND A;  2EY6 A;  3S1M H;  3OPO A;  1J5E L;  2FXQ A;  4MIU A;  2SNS A;  3UE0 A;  4PQX A;  2MPM A;  3ERO A;  4ZKB B;  2XSC A;  4R9W A;  1HCZ A;  4HN7 A;  4HMJ A;  5BN5 A;  2NN6 I;  3ND8 A;  1NMF A;  3NTH A;  1KAA A;  5C3E H;  2A6E D;  2LS0 1;  4P75 A;  3E0J A;  2HCC A;  4X66 Q;  4E6I A;  3Q0A A;  2X6G A;  4HJ8 A;  1VQL A;  4NP5 A;  5EPK A;  4A3K H;  2KEC A;  4UP9 A;  1A62 A;  1VMC A;  3VR5 A;  4HR7 B;  1BBX C;  4EQN A;  3KYH C;  2EIF A;  1YHQ A;  2AHO B;  1CI3 M;  3RZO B;  3D4D A;  1DJR D;  1X9N A;  4OX9 L;  4CKB A;  1PHJ A;  2ZXO A;  5IYD G;  4MZ9 A;  1YHA A;  1B2T A;  1SE8 A;  4Y7N H;  1Q1E A;  3RUZ A;  1O7I A;  2KHJ A;  5LL6 S;  1VQF A;  4IUP A;  1YVC A;  3E5S A;  1XNR L;  2R93 B;  3J81 i;  1D5X C;  1CUK A;  2JA5 B;  1G2S A;  4JYA Q;  1B4O A;  1EY8 A;  1AEX A;  1A6X A;  1NAP A;  2AUK A;  2F0G A;  4ZLT F;  3WWV A;  1MSG A;  4IJH A;  1BXT A;  3J80 E;  5IGG A;  1X3F A;  2OCE A;  2JA8 B;  1SRO A;  4JI4 Q;  1JOR A;  3PUV A;  5E4W C;  1K83 B;  1HTP A;  4JBM A;  3H3V H;  3ER0 A;  2PO4 A;  2EJG C;  1UE5 A;  4C3J H;  4DKA C;  2B2W A;  4NXN Q;  3HP3 A;  2MJ8 A;  3S2D H;  2KCN A;  2AMC B;  4A75 A;  2N88 A;  1ZXT A;  2ZJQ A;  2FFK B;  2WB1 G;  3ERS X;  4X66 L;  3OMG A;  3CHB D;  1JJC B;  2M9V A;  3DUZ A;  1DGS A;  5TSS A;  4A3L H;  4YY3 Q;  1DOL A;  2JA7 H;  1GOZ A;  4DV4 Q;  2WV6 D;  2XWB B;  4B3M Q;  4DNI A;  3GTJ H;  2Z6B A;  1CKN A;  4XQQ A;  3H15 A;  2E2H B;  1QVF A;  2E8G A;  1B9N A;  1ESF A;  4JOI A;  4K5V A;  4A3I H;  2KCT A;  1ET6 A;  3OOC A;  1EU3 A;  1F77 A;  5D65 A;  4L5T A;  4FXG C;  1FNU A;  1SEB D;  1K28 A;  4JYA L;  1TKW B;  2A68 D;  2K5H A;  3W2D A;  2B29 A;  1PH9 A;  2BCO A;  3MEF A;  4EVO A;  5FK9 C;  2A5H A;  2QW7 A;  1WTP A;  3J7Z C;  2B2Y A;  3CME A;  2LFN A;  5J39 A;  1B50 A;  1FL0 A;  1LAC A;  3H0G G;  1T5E A;  5D3D A;  3H3V C;  3R93 A;  1E3P A;  3U4V A;  4JI4 L;  1D1K A;  1X3P A;  3OHX C;  3QOL A;  4BY1 H;  4JI7 Q;  3PO3 G;  3VDY A;  4DK0 A;  4M1U B;  3HOV G;  2HDM A;  3L7Z C;  4NXN L;  3F8T A;  4IUQ A;  4KI0 A;  4PMB A;  2TSS A;  3PCO B;  2EJF C;  4DXG A;  3C2P A;  3NTK A;  4I65 A;  1CK1 A;  2QIL A;  4DR1 Q;  1VMP A;  4R4Q A;  1I3Q B;  1XNQ Q;  3PQI A;  2QEX A;  3T51 B;  2QF7 A;  4YY3 L;  4DV4 L;  3G7L A;  4O1N A;  1RTO A;  4B3M L;  1AW7 A;  4GNX A;  2A6H C;  3S14 H;  2VNU D;  1L2F A;  3CP0 A;  3P20 A;  1D8L A;  1MIU A;  5IYB H;  3I70 A;  1B53 A;  4LAA A;  4O0A A;  2K52 A;  4ID6 A;  2RHS B;  2E76 C;  1I6V C;  1PTO C;  5KYI A;  2ALY B;  5GAG C;  3BS1 A;  3RD4 A;  1GVP A;  2YTY A;  3I4N H;  4LF4 Q;  1IZ6 A;  3QR8 A;  4ILW A;  5IT9 c;  3CXC A;  3VYS A;  4UPA A;  4U68 A;  3UDF A;  3K57 A;  3GTP B;  1L0W A;  4UDU C;  3I90 A;  2VW9 A;  2E2I B;  2UXD Q;  5KNB A;  4HMI A;  5EBD A;  4IPG A;  5HGT A;  4QIW E;  2N49 A;  3BDL A;  3QG1 A;  3KLS A;  1OXU A;  1LYL A;  1NY4 A;  2J4X A;  5EPJ A;  5I6W A;  2YYZ A;  1WCM G;  5IGB A;  1A15 A;  3BVM A;  1D7Q A;  4JI7 L;  2PQA B;  1R9T B;  1LTS D;  3SK6 A;  1EWC A;  2EYH A;  1TY2 A;  2EVB A;  3KF6 A;  4PZ6 A;  3T1Y Q;  1FJG L;  5NUC A;  3PIO 3;  1JE5 A;  4DR1 L;  4BA2 I;  4X62 Q;  4POF A;  1Y1W B;  1X3G A;  3H0G B;  4MN3 A;  1XNQ L;  1STG A;  2GN5 A;  3IRB A;  1H95 A;  4CKE A;  2BOS A;  4XQN A;  3KOJ A;  1BNZ A;  1W3S A;  4AYB G;  4LFA Q;  4A3M H;  1J9O A;  4QIW B;  2AQ1 B;  5CC4 A;  4R8N A;  5FJ8 H;  3PO3 B;  4C3I G;  3FRP B;  1DOM A;  4XIG S;  2F0U A;  3HOV B;  2QDB A;  2ZTC A;  4DV1 Q;  1KTK A;  2Q8T A;  1SNO A;  3KBG A;  5FLX c;  3URY A;  2ENB A;  4DV6 Q;  4MHE A;  4I7A A;  4Q5V A;  4LF4 L;  1OXT A;  1H9J A;  2NWG A;  2OXP A;  4JI8 Q;  4J15 A;  1YHB A;  3BZC A;  4NKL A;  2MNA A;  2F52 A;  4WJW A;  2JK8 A;  1QOH A;  1Q12 A;  1OXX K;  2Z6K C;  3GTK H;  2UXD L;  3RLN A;  1KAB A;  4YWK A;  3LNN A;  3I4O A;  1XX8 A;  4RH6 A;  5IP9 G;  1SNQ A;  1PH1 A;  3AYH B;  4IUU A;  3NSW A;  3GTM B;  1GUT A;  1NR4 A;  4ODG A;  3NBI A;  3CQZ H;  3K0X A;  3PGZ A;  3OWF A;  1LM0 A;  1E0B A;  4A3J H;  1K8A C;  2PQE A;  2R7D A;  4DAY A;  1EQQ A;  2L55 A;  2RQX A;  3T1Y L;  4GKJ Q;  3S24 A;  1EYD A;  3F2D A;  5BN3 A;  4KN7 C;  3V96 A;  1PTO F;  1QB5 D;  1VQB A;  3DM1 A;  5A2Q L;  4AYB E;  1R4Q B;  4X62 L;  2KEE A;  4PV1 C;  3ULL A;  2VQE Q;  4FXD A;  2OQ0 A;  1VQ6 A;  3T4A C;  1YNN C;  4BY7 B;  2PPB C;  4QB4 A;  3HOU H;  1WCM B;  3HOX H;  3E0E A;  5A35 A;  2L0C A;  4LFA L;  1EOV A;  2SOB A;  2R7Z G;  2K1B A;  1AN8 A;  2F0F A;  2JP1 A;  4DV1 L;  4BXX H;  3MXP A;  3A74 A;  3D3R A;  1WTW A;  3CW2 C;  3CC2 A;  4DV6 L;  2JYO A;  3F2U A;  3W3A A;  3JC6 6;  3K59 A;  4JI8 L;  1CZW A;  4GN4 B;  5C0X G;  2Z4I A;  5CV9 A;  2HDL A;  4AYB B;  3M4O H;  2OTJ A;  4FF4 A;  4LF6 Q;  3HOY B;  3V05 A;  4OXP A;  4C3I B;  4JI3 Q;  4JI6 Q;  4J6H A;  1TWA H;  1L1O A;  5CBA E;  2WAC A;  4HCS A;  4N8X 1;  1JJ2 A;  1D6E C;  3NPP A;  1VF7 A;  1RCV D;  4L8J A;  4MTN A;  3TP6 A;  5C5M A;  1CZG A;  5I2X A;  1TWG B;  3A8I E;  1YI2 A;  4PZ7 A;  2HD3 A;  1SMX A;  1PVO A;  2LXK A;  4KJN A;  3W5O A;  3UE1 A;  1YJ9 A;  3C1E A;  5CYU A;  1KLU D;  2XTI A;  3GD7 A;  1N8R C;  3GP7 A;  4GKJ L;  2B2U C;  2HUG A;  3IKJ A;  4ZUJ A;  2ZXP A;  2P5Z X;  1TVX A;  4QF4 A;  4HIO A;  1MKH A;  2B39 A;  5A2Q E;  4KTA A;  2VQE L;  1J8I A;  2F3I A;  3S2H H;  1FYC A;  1V1P A;  3M4Q A;  3CPF A;  2HIV A;  3GTQ B;  4HSP A;  1ASZ A;  2EY2 A;  2A6H D;  3HKS A;  3PUX A;  2F0P A;  2AKW B;  1X54 A;  4JW0 A;  4PZ8 A;  4N9T A;  1ENA A;  2F0E A;  4OO1 G;  3G6J B;  4A93 B;  1A3V A;  1HXY D;  1EWI A;  1PTO D;  1Z7T A;  1HJP A;  2YU9 B;  1BBU A;  5AJ3 Q;  1PFS A;  3L3O C;  1KRT A;  4HIK A;  3S1R H;  4ZAI A;  2R7Z B;  4LF6 L;  1BQQ T;  2IHF A;  1VQG A;  2NVY H;  3GQB A;  3I8Z A;  4JI3 L;  5C6A A;  4JI6 L;  4BBS H;  3TP8 A;  3T53 B;  1T5X D;  1HUN A;  1U9R A;  3RNU A;  5IY0 A;  3CC4 A;  1T9H A;  3L9A X;  5EJW A;  5CV6 A;  4RKL A;  4B3R Q;  3AU7 A;  4RWS C;  3RZD B;  3NWT A;  2DJG C;  2WAQ G;  4RGM A;  1CKN B;  4HTH A;  1EZ8 A;  5K5P A;  3P7J A;  1S40 A;  2M2L A;  3ULJ A;  2OTL A;  1EYC A;  5IYC G;  1N36 Q;  4KHP Q;  3K80 C;  5IIF A;  2GA4 B;  4IPC A;  3J81 j;  4KK7 A;  1PXU A;  5C44 G;  3SR1 A;  2B2V A;  2VZA A;  3DWP A;  4UY8 C;  1KRS A;  5GQO A;  2CCZ A;  1TWC B;  1XMO L;  3BJU A;  2F03 A;  4L5S A;  3S1N H;  2BA1 A;  4LF7 Q;  4H02 A;  2I5L X;  5FO7 B;  2CW0 C;  1ESR A;  1CA5 A;  1X3Q A;  2ZTE A;  2K4K A;  1ICW A;  1PZK D;  2D9U A;  4C2M H;  5EPL A;  2F0N A;  2LXJ A;  1IBK Q;  1A3T A;  3LGJ A;  3QOJ A;  5EKL A;  4HJ5 A;  1PFM A;  4AH6 A;  3VA5 A;  2D62 A;  3JAM c;  5FO9 B;  5AFW A;  3I4M H;  3O13 A;  5CR3 A;  5AJ3 L;  2X69 A;  3N52 A;  2NZH A;  2DN8 A;  4DAV A;  3NEL A;  5JEA G;  4HAE A;  5CV7 A;  2LY7 A;  2RSN A;  2UUC Q;  2Q8R E;  4FF1 A;  1VQP A;  1UE1 A;  2KBN A;  3PF5 A;  1GO3 E;  1O7L A;  1I94 Q;  3FHW A;  3VR6 A;  5G3L F;  2K5D A;  5DM6 3;  1Q8K A;  2KHS A;  5I4D A;  3J7A F;  3Q22 A;  2B3G A;  4ME3 A;  2B2T A;  1Y1V H;  5I9P A;  4GNX B;  4B3R L;  3A8K E;  5C4X G;  3KUP A;  3ICE A;  2WIN B;  1PLF A;  5EBC A;  1N36 L;  4KHP L;  3GV3 A;  2XNA C;  1A3U A;  1UNS A;  1IL2 A;  1VQJ A;  4LJZ C;  5T1I A;  3D6C A;  2GVB A;  2NVX B;  5IWA Q;  5HUR A;  4Y7N B;  2PW5 A;  4LF9 Q;  4DR4 Q;  1X6O A;  4LF7 L;  2UUB Q;  4WRD A;  1FGB D;  4P72 A;  4KD3 A;  4BY1 G;  2ZTD A;  4BA1 I;  3M4Y A;  1E1T A;  1EWH A;  5DEH A;  1EY9 A;  1JR0 D;  3VYR A;  5C0X I;  1HHV A;  3OMC A;  2OWO A;  3PO2 B;  1K8G A;  3S17 H;  3TSS A;  1IBK L;  5C44 B;  1Z47 A;  1RD9 D;  4ZYS A;  2L5T A;  1GM5 A;  3DEO A;  1IBM Q;  3ULP A;  1TS4 A;  4WOR A;  2NN6 H;  3KF6 B;  4KV6 A;  1NMG A;  1N32 Q;  4B08 A;  4GOP A;  3I55 A;  4P73 A;  2IY5 B;  2IPK D;  2VUM H;  2F0V A;  1SBB B;  2F0L A;  5IYB G;  2F0Q A;  4WJ3 M;  3I3C A;  1I4X A;  1ZEQ X;  5M5X H;  2UUC L;  2MO1 A;  2JE6 I;  3K58 A;  2F0W A;  1K9M C;  4AIM A;  3CCR A;  1VQC A;  1I94 L;  1EEI D;  2EQS A;  4MNO A;  1F9S A;  4KLK A;  2R92 H;  2PNR C;  1HZA A;  4G57 A;  4BBR H;  1KNE A;  1JMC A;  1JB7 A;  4QL5 A;  4NDX A;  2CKZ B;  4KJO A;  1S5F D;  1BVS A;  2F0S A;  5GRO A;  2PZT A;  2R6G A;  3OIP A;  4A3D G;  4HJ9 A;  2JXM B;  3T56 B;  1K8M A;  1Q90 A;  3K5M A;  4JI1 Q;  1LTT D;  3FVQ A;  3EIV A;  5IWA L;  1SR3 A;  2E74 C;  4YCU A;  1OXV A;  3M3Y B;  1A8V A;  3K5N A;  4LF9 L;  4DR4 L;  1STN A;  2NB0 A;  4OO1 I;  1CSQ A;  5EKK A;  2UUB L;  3SGI A;  1I5F A;  5K36 H;  5C4X B;  5GAD C;  5C4J H;  3D4W A;  2LSS A;  4R8I A;  3E9I A;  1QCB D;  4L5R C;  3ZJY C;  4GS3 A;  3S15 B;  1GUO A;  1JIC A;  1HZB A;  1U4M A;  5IOD A;  1U5K A;  4A3G H;  1SE4 A;  4YCW A;  1HNZ Q;  2SDF A;  4OWX B;  1TWF B;  3T13 A;  1JWS D;  2BH2 A;  4C3H G;  3NWS A;  4UP8 A;  2SEB D;  2D0O A;  3OIQ A;  4JVZ A;  2KHI A;  4ABN A;  1TWH H;  1IBM L;  4DAY B;  1JC7 A;  4DU9 A;  2FMC A;  3RMH A;  4K0K Q;  1N32 L;  1PH7 A;  1OO9 B;  5IGE A;  4RHS A;  1QVC A;  4B3T Q;  4X6A H;  3ITP A;  5C0X J;  1IYV A;  3I91 A;  2RDH A;  4OL7 A;  1EYG A;  1VCI A;  1QVG A;  1I4G A;  1E2W A;  3OW2 A;  1NBW A;  4ZK9 B;  2DNC A;  1HFN A;  1SN8 A;  1PRT C;  1VQO A;  1K0R A;  1QZH A;  4KMU C;  2G9D A;  4CBV A;  5JAV A;  5GAH C;  1KDB A;  1CT1 D;  1SE3 A;  3NTI A;  1PH2 A;  3UDI A;  1BO0 A;  2K5V A;  1DYQ A;  1C7Y A;  1FGU A;  1LUZ A;  1HR0 W;  3TQY A;  1GHK A;  4JI1 L;  1IXR A;  1TR5 A;  4LF5 Q;  2XVS A;  1VQA A;  3PIP 3;  4A3E G;  4RGO S;  1PTO H;  1BCP C;  3L2P A;  1MJE A;  3GTO B;  1FNV A;  5EGT A;  2RF4 A;  3J81 c;  2EE1 A;  4DK1 A;  5M3M H;  1TS3 A;  2PCF B;  1L1O B;  1K73 C;  2CW0 D;  5FLM H;  3FKI G;  1AZP A;  4V0B A;  1XWE A;  4A3D B;  4YHH Q;  1HNZ L;  3TRZ A;  1EQV A;  4DR7 Q;  5IP7 G;  1VQ7 A;  2R93 H;  2JSO A;  2JA5 H;  3A56 A;  4QGU A;  4J8Q A;  1HUM A;  2J7Z A;  1B70 B;  1BUV T;  1LV9 A;  2Z9H A;  3AMU A;  4RMF A;  1FR3 A;  2EYF A;  2WB1 E;  3CCU A;  3D31 A;  3MXN A;  5IOC A;  3DEP A;  2F1M A;  4K0K L;  4ALP A;  2E2J B;  4X3K A;  1NTG A;  3CPW A;  4K2K A;  3HOU G;  1G2T A;  4CDC C;  4OON A;  2NTS A;  4B3T L;  1IKL A;  3MXU A;  5ELE A;  1WTQ A;  4ME5 A;  1O78 A;  1CA6 A;  1PV4 A;  2B63 H;  4JCV E;  3AEV A;  1LT5 D;  3A0J A;  5LMU Q;  2QKI C;  1K83 H;  1V1P B;  4C3H B;  2SNM A;  4IJL A;  1ROD A;  4IN3 A;  3CC7 A;  1PMR A;  3EA6 A;  2Y0S G;  3W1B A;  3M4P A;  1E1O A;  2K14 A;  3M9B A;  3CD6 A;  2IW3 A;  1BKB A;  1DM0 B;  2IT1 A;  2RBM A;  1RJT A;  1UEA B;  4IZ8 A;  4GLV B;  1LT4 D;  1SYE A;  4X3T A;  5CBE E;  2IX1 A;  1II3 A;  2F0K A;  3HOZ H;  4LF5 L;  2WB1 B;  1B3A A;  1XMQ Q;  2JQO A;  3MWY W;  3K7A H;  1E22 A;  1UE7 A;  1O80 A;  1F2Y A;  1TS5 A;  1X56 A;  5EQ0 A;  1WTH A;  1SFO B;  5M5W B;  3PSI A;  2E2H H;  2Q2T A;  3Q6S A;  3A54 A;  2EJM A;  3Q8D A;  3GTK B;  1MHW C;  4XXE A;  4YHH L;  3TDQ A;  2K28 A;  4DR7 L;  2VB3 X;  1YEZ A;  1WTO A;  1EL0 A;  1PRT F;  3IFT A;  3MEH A;  4TRD A;  1RHP A;  3ERQ A;  2MQH A;  4KY7 A;  4A3E B;  3U58 A;  1GUG A;  3HRZ C;  2IHE A;  1OTC A;  1NE3 A;  3CQZ B;  4H7B A;  3HFZ B;  5IYD H;  3F2C A;  1QWY A;  3K0Y A;  1X55 A;  2Y0S E;  2F4I A;  1ASY A;  4WFN 3;  3FKI B;  5I2Y A;  3K8A A;  2Q2U A;  3BDC A;  4LW1 A;  2BDN A;  5LMU L;  1AH9 A;  1GKH A;  3WOF A;  5LHY 1;  1BCP F;  2CQO A;  1S72 A;  2CQA A;  5JEA J;  3E6Z X;  3FPU B;  3R2T A;  3MFY A;  1EUJ A;  1AFP A;  2PNH A;  1SE2 A;  2E75 C;  3H09 A;  4G4K A;  1HA6 A;  4DV5 Q;  1I3Q H;  5I6Y A;  3MAQ A;  4FO2 A;  3MXG A;  4G7O C;  1SSO A;  1MD2 D;  4BBS G;  1BF4 A;  5C5L A;  2C5C A;  2YTX A;  1XMQ L;  3MFG A;  1GXD C;  1CTM A;  2UXB Q;  3DWA A;  4FVM A;  4OWW B;  4A3F G;  1K8O A;  2Y0S B;  4IUT A;  1D2B A;  2A8V A;  2VL6 A;  1KNA A;  4K6D A;  4OIJ A;  5GAE C;  3FEW X;  5KIX A;  2XGT A;  1SLJ A;  1YBY A;  3NHH A;  2YV5 A;  4KN4 C;  3M4O B;  3CU7 A;  4K5X A;  4X64 Q;  4UAI A;  5CGK A;  1I6H B;  4IUN A;  2EDG A;  1TWA B;  5ISR A;  4NMZ A;  1IYU A;  3GTP H;  5J1Z A;  5E4X A;  2ICI A;  3QIA A;  5J3B A;  3M7G A;  1KDC A;  1Y8P B;  3S9W A;  1L0Y B;  1Q3L A;  4QY7 A;  1EIY B;  1BR9 A;  1G6P A;  3VYT A;  3NUC A;  1I4Q A;  3TEH B;  3M7N A;  1W2B A;  2YTV A;  3QJY A;  2K7V A;  4FF3 A;  2QEJ C;  1J6Q A;  4IPD A;  1R9T H;  3DHQ A;  4LFB Q;  1ICF B;  2F0D A;  5E7N A;  3EFX D;  1F2M A;  1SNC A;  1PRT D;  1SJE D;  3PIO A;  1EU4 A;  2O4X A;  4DV5 L;  1Y69 U;  4EGV A;  1SXT A;  4LMQ D;  2UUA Q;  1Y1W H;  2MGS A;  4U67 3;  3S16 B;  2RCN A;  3H0G H;  1EZ6 A;  1B8A A;  3J80 i;  2QA4 A;  4N9P A;  3HOW G;  2D0P A;  3A8J E;  3K5L A;  2HCI A;  4GOP B;  2UXB L;  5JJI A;  4RCO A;  3DMU A;  1GUS A;  4K8I A;  4JBK A;  3PO3 H;  4ZQ3 A;  1BCP D;  1YJN A;  2JA6 H;  1IL8 A;  4A3B G;  3SVM A;  2EYL A;  4A3C G;  1S5B D;  4YIJ A;  4NW2 A;  1JWM D;  2ID0 A;  2MHV A;  4IUV A;  5BN4 A;  1FNW A;  3L0O A;  2N78 A;  4X64 L;  3R3O A;  1WTV A;  3H94 A;  1X32 A;  1QUQ A;  2XRQ D;  4NXM Q;  1JCK B;  5IT9 L;  1F9Q A;  1SAP A;  1Y8N B;  3G48 A;  3NEN A;  4F7X A;  2Z6K A;  3NQT A;  1UWV A;  3HKZ G;  3J81 E;  4YWM A;  1W6J A;  4A3F B;  1SJH D;  2C9O A;  5M3F H;  3KLS X;  1EY0 A;  4ZCK A;  3GTM H;  1VQ4 A;  2A69 C;  1HZC A;  3GTG B;  3FP9 A;  3U50 C;  1V1O A;  4IFD G;  1VQ5 A;  4LFB L;  2Z0S A;  2PMZ E;  3U9S A;  3TZD A;  5KND A;  1I50 B;  3R2I A;  5J22 A;  1CQF A;  1S5C D;  1WYD A;  3VR4 A;  2UUA L;  4CDD C;  2E2D C;  2O2L D;  1Z6H A;  3HS0 C;  3E9H A;  5C3E G;  4HIM A;  2Q2H A;  3DWQ A;  2G5D A;  3J80 c;  1ILP A;  1JT8 A;  2RDF A;  2K6A A;  2MP1 A;  4BY7 H;  1DZ1 A;  2N55 A;  2FHT A;  3BZD B;  3WOE A;  1M90 C;  1G8Z D;  2O5J C;  1HQR D;  4A3K G;  3PUY A;  3GO5 A;  4H0L C;  3CAM A;  4BBR G;  4CJ2 C;  1EY5 A;  2L12 A;  1U4P A;  1CKM A;  1PYW D;  1Q1B A;  5FLX L;  3EN2 A;  4KKT A;  3S1Q B;  4DV3 Q;  2EPB A;  2RCF A;  2PMZ B;  4NXM L;  1P16 A;  3QB3 A;  3HOW B;  1XPO A;  1LTR D;  3NEM A;  2EYO A;  5IT9 E;  2EY5 A;  1QZG A;  3BU2 A;  5JPM C;  2F3V A;  1B7Y B;  4HED A;  4OGQ C;  1Q7Y C;  2VXW A;  4KKS A;  4DK6 C;  1HZ9 A;  3HOY H;  3PF4 A;  4K14 A;  1NCV A;  1K0S A;  4A3B B;  3D0F A;  2PI2 A;  2FMM A;  3RN2 A;  4KY6 A;  1Y14 B;  1TWG H;  4PNY A;  3U9O A;  3MA2 B;  2D5D A;  1PA6 A;  1PH8 A;  4B9W A;  4DGZ A;  5ELO A;  1WD0 A;  1C8C A;  5KEE A;  3IFD A;  5JJL A;  2OT2 A;  3GTL H;  2B2U A;  2DGY A;  1CKO A;  3NE5 B;  3OWE B;  5JVG 3;  1EY7 A;  3K5O A;  1MBY A;  4CDE C;  5KGU A;  5IP9 H;  2RA4 A;  2R7F A;  4C3J G;  5C4Z A;  4L63 B;  2V4D A;  2JEB I;  2KJX A;  2NVT H;  1LTI D;  2HIX A;  3S17 B;  1EIF A;  2I46 A;  4JK1 C;  4HJA A;  3MXN B;  2A1A A;  4DAP A;  3S1M B;  1PDQ A;  4RCN A;  4A3L G;  2JA7 G;  3K81 C;  1EY4 A;  1Q8I A;  1Q81 C;  3STB C;  1YIT A;  4IQZ A;  1KL9 A;  1XJV A;  1OXS C;  2D2C C;  2WAQ E;  3GV6 A;  4A93 H;  2CHB D;  1E2Z A;  3A5Z B;  2M00 A;  5FLX E;  5C3E B;  4DV3 L;  4KKU A;  1GJX A;  2YU9 H;  4A3I G;  4YWL A;  3QO2 A;  1XXG A;  3CRK C;  4A3K B;  1VQI A;  3A5U A;  3G6E A;  1I4P A;  2F0T A;  2ZJR A;  3LWU A;  4BBR B;  2HQL A;  2K5N A;  5M3M G;  1C9O A;  4XTC S;  1X3E A;  4I7Z C;  3G4S A;  3U4Z A;  1LO5 D;  1PZJ D;  1S3O A;  3HGB A;  1O7Y A;  4DN4 M;  5DM7 3;  2ZT9 C;  1SMY C;  3AFP A;  3KDF A;  3ONA B;  1U0L A;  1VF5 C;  5JVH 3;  1W6K A;  1ZYR D;  4LUO A;  2CFM A;  3PMF A;  2AQ2 B;  1N9W A;  2WAQ B;  2TMP A;  2QDL A;  3DM3 A;  4EQ5 A;  1ONL A;  5FO8 B;  4JI5 Q;  2PYK A;  3HEJ A;  2F4V Q;  2CWP A;  1BDO A;  1TWC H;  2MUY A;  2KCC A;  3H6M A;  3SK8 A;  1R4P B;  2B63 G;  2JN4 A;  5T1G A;  3AB9 A;  4EQP A;  2V1C C;  3HG9 A;  1SRU A;  3LWE A;  2DJF C;  1Z9F A;  4GN5 A;  4FF2 A;  3TME A;  1TWH B;  5LMN Q;  4PMW A;  1C4Q A;  3NBH A;  2JEA I;  1WOC A;  4NB3 A;  2IX3 A;  3CMA A;  5M5Y H;  4OEM B;  1D1I A;  1DXM A;  4C3J B;  1F9R A;  1ET9 A;  3S2D B;  1QNU A;  1JOQ A;  2EXD A;  2B2W C;  4LFC Q;  1E7Z A;  3I7F A;  4L6T B;  5ELC A;  3HOZ G;  2N3S A;  4M8A A;  1TXY A;  4IFD I;  4TQU S;  3I4N G;  5ELF A;  1XPU A;  1YJW A;  2E5L Q;  2JA7 B;  1HNX Q;  1O7Z A;  5DNF A;  1LTG D;  2OF1 A;  2LMC B;  3TN2 A;  3RLF A;  1MGS A;  1IHZ A;  2NUC A;  5DLQ E;  3BDO A;  4QUF A;  3A7L A;  4YCV A;  1NJI C;  3GTJ B;  1PH6 A;  4IUR A;  2BA0 A;  4O42 A;  4OO1 H;  4JV5 Q;  3PV0 A;  4QUC A;  1STE A;  2KEN A;  2XN9 C;  1KLG D;  4V19 0;  1Q46 A;  4A3I B;  2A69 D;  4JOI C;  3BYT B;  1EIH A;  1QJO A;  1N34 Q;  3MC0 B;  3N6R A;  1PTO B;  2ATW A;  2K05 A;  3LX0 A;  5E1F A;  5EAY A;  5IGD A;  5G3L D;  3KBX A;  2NZ1 D;  1MSH A;  1PFB A;  2R3Z A;  1S4Z A;  5LMN W;  1HR0 Q;  2F0I A;  1DON A;  2NVX H;  2J0T D;  4JI5 L;  5D14 A;  4LK1 C;  5M3M B;  3OTO Q;  2F4V L;  1WD1 A;  2FIN B;  1WVL A;  1B3Q A;  4PG3 A;  3A7A B;  2DNE A;  4RHR A;  1RTN A;  2NVQ H;  2B2Y C;  1D5Z C;  3NQI A;  2EOT A;  5LMN L;  4DV2 Q;  5IYC H;  1HNW Q;  1LAB A;  3PO2 H;  2HQE A;  2F0M A;  4QMG A;  4BY1 B;  4A3M G;  4GN3 B;  5C44 H;  3NXW A;  1L0X B;  2OQK A;  5FJ8 G;  2K5Q A;  1SYF A;  3J7A V;  2K50 A;  3JAM L;  4LFC L;  2B63 B;  4XQJ A;  1TII D;  1LT3 D;  4IOC A;  3UI2 A;  3K6O A;  2NTT A;  3E3X A;  4JI0 Q;  1H9S B;  3D8G A;  1JWU D;  2GVA A;  2A19 A;  1U4L A;  5H1S E;  4DAM A;  2PZW A;  2E5L L;  3CCE A;  1HNX L;  2F3W A;  3F2B A;  1IYJ B;  5ELB A;  4H13 C;  1NR2 A;  1K3B C;  3S14 B;  1XTC D;  2WP8 J;  3H3V I;  4GNX C;  3CCV A;  1S5D D;  4DR3 Q;  1IBL Q;  4ZUI A;  4JV5 L;  4EX5 A;  4DNR B;  5I9O A;  4KY5 A;  4LNQ A;  2K32 A;  3HOZ B;  1P8L A;  3RZO H;  2XIW A;  4K6L A;  4CJ1 B;  3D4R A;  1N34 L;  1RL2 A;  1Q86 C;  1PH4 A;  3I4N B;  1RKN A;  2KQ3 A;  1WFQ A;  1YNX A;  4IFD J;  3K7A B;  1V1Q A;  2F0J A;  2I5M X;  4CDF C;  4A3J G;  1HR0 L;  5JEA H;  4R4I A;  1QG7 A;  2KCM A;  5KYL A;  2QCP X;  3C3L A;  4CHT B;  2RSO A;  3OTO L;  1QUQ B;  4RG1 A;  3M3Y H;  3EVQ A;  4TSS A;  1STA A;  1EFW A;  4IAL A;  4UHV A;  4CKC A;  4JPB W;  2B8G A;  5C4X H;  3AFQ A;  1CM9 A;  4DF7 A;  1IKM A;  4P71 A;  1C0A A;  2IL8 A;  3TS2 A;  1FVI A;  3S15 H;  3IAY A;  3WDN A;  4DV2 L;  4GZY C;  1HNW L;  1EYA A;  3FMC A;  3HOX G;  4S3S A;  2CWA A;  1TWF H;  3MVV A;  3J7Y W;  1VQN A;  2K75 A;  2EY1 A;  3STB D;  1I4R A;  1Y1W G;  3FPP A;  3UDX A;  3BYY B;  4DV7 Q;  2JA8 H;  4BXX G;  2L11 A;  1KAW A;  4R1J A;  4DUZ Q;  1VQ8 A;  3JAM E;  1YNJ C;  4JI0 L;  2IJ0 A;  2L4N A;  4DNT B;  3H91 A;  1QIL A;  2EZV A;  1B1Z A;  1M1K C;  2NYZ D;  2K5W A;  5EKI A;  4GLA C;  1FJG Q;  1WI5 A;  2JA6 G;  1HRJ A;  3Q23 A;  3M85 A;  1SDF A;  4JBJ A;  4A3M B;  5IGF A;  2ICE C;  3OW7 A;  2PI2 E;  4DR3 L;  1IBL L;  1HFG A;  1H9K A;  1LTB D;  1KHI A;  4K8J A;  3PUW A;  1ZKO A;  3TRE A;  1B9M A;  2KOL A;  5JOB A;  4GLX A;  2RKS A;  1SMY D;  1N33 Q;  1SYG A;  1TQO A;  3BG3 A;  3X3N A;  5M3F G;  3NP8 A;  4TKO B;  1KDA A;  3ZYY X;  2BH8 A;  3I72 A;  3D6W A;  3PIP A;  4X3U A;  3GTO H;  1TT2 A;  1A63 A;  4JC0 A;  3B6Y A;  3SE0 A;  1UE6 A;  5HGQ A;  1VS0 A;  3SHL A;  3SK5 A;  4OHJ A;  3KJO A;  4DR6 Q;  3KF8 A;  1LT6 D;  3MZ5 A;  4A3D H;  2Z1C A;  2F0O A;  3W1G A;  4A3J B;  3CCJ A;  1UEB A;  1EIG A;  1YZ6 A;  2WFW A;  1SYC A;  1EQT A;  4RAU C;  4DV7 L; 
#chains in the Genus database with same CATH homology
 1I94 Q;  3FHW A;  1UE5 A;  4C3J H;  1Q8K A;  4DKA C;  5M3F H;  4DUZ L;  4BY7 G;  2B3G A;  4ME3 A;  4NXN Q;  3S2D H;  1Y1V H;  4GNX B;  2E2J H;  2AMC B;  4A75 A;  4DK3 C;  4B3R L;  5C4X G;  2ZJQ A;  3GTM H;  1VQ4 A;  4NPS A;  3ICE A;  2WB1 G;  3ERS X;  4X66 L;  2HHH Q;  1HZC A;  1JJC B;  3FP9 A;  4DR5 Q;  3U50 C;  4IFD G;  1DGS A;  1N36 L;  4KHP L;  1VQ5 A;  4A3L H;  1EQR A;  4YY3 Q;  2JA7 H;  2ASB A;  2Z0S A;  1VQJ A;  1IL2 A;  4LFB L;  4DV4 Q;  2PMZ E;  4C3H H;  2GVB A;  4B3M Q;  5IWA Q;  4DNI A;  3F1Z A;  3GTJ H;  1WYD A;  1CKN A;  4LF9 Q;  3KFU A;  1KD1 C;  5ELN A;  4DR4 Q;  3GDE A;  2ZM6 Q;  4LUV A;  1X6O A;  2UUA L;  4LF7 L;  2AWO A;  3H15 A;  1VQK A;  2UUB Q;  3E9H A;  4P72 A;  5C3E G;  2E8G A;  2Q2H A;  4HIM A;  1N33 L;  1QVF A;  4JOI A;  4A3I H;  4BY1 G;  3J80 c;  2ZTD A;  4BA1 I;  4BY7 H;  1E1T A;  1JT8 A;  4B3S Q;  5C0X I;  2KCT A;  2VQF Q;  1M90 C;  3HOY G;  1BBW A;  4A3K G;  3PUY A;  2OWO A;  4L5T A;  3GO5 A;  1K8G A;  1PH3 A;  3S17 H;  4OWT B;  3CAM A;  1IBK L;  4BBR G;  1Z47 A;  4JYA L;  1E24 A;  2K5H A;  1MJC A;  1GM5 A;  2B29 A;  1L1O C;  1PH9 A;  3MEF A;  1HH2 P;  1IBM Q;  1SFO H;  3ULP A;  1CKM A;  3PUZ A;  2HT1 A;  1Q1B A;  2E2I H;  5M5W H;  3J7Z C;  5HY6 A;  3EN2 A;  3KF6 B;  3CME A;  1NMG A;  4IO9 A;  1N32 Q;  1FL0 A;  4GOP A;  3H0G G;  4DV3 Q;  4DR6 L;  1JJG A;  3I55 A;  4NXM L;  1P16 A;  4P73 A;  4DUY Q;  2IY5 B;  2VUM H;  1RIP A;  2C35 B;  1KXL A;  1XPO A;  1E3P A;  3NEM A;  3U4V A;  1QZG A;  4JI4 L;  4FDB A;  3BU2 A;  5IYB G;  4WJ3 M;  3KDF B;  4R4T A;  2UUC L;  5M5X H;  2MO1 A;  4BY1 H;  1B7Y B;  2JE6 I;  1Q7Y C;  4JI7 Q;  4DK6 C;  1K9M C;  4A3E H;  1HZ9 A;  4AIM A;  3CCR A;  1VQC A;  3HOY H;  1I94 L;  3PF4 A;  2VY3 A;  4QQB X;  2EQS A;  3VDY A;  3PO3 G;  4MNO A;  3HOV G;  3L7Z C;  4KLK A;  4NXN L;  2R92 H;  3F8T A;  4KI0 A;  3D0F A;  1HZA A;  3PCO B;  3CCQ A;  3EBE A;  2PI2 A;  3I4M G;  3RN2 A;  1CSP A;  4BBR H;  4DR1 Q;  1JMC A;  1Y14 B;  1TWG H;  4R4Q A;  3RLO A;  4QL5 A;  1JB7 A;  4A76 A;  1PA6 A;  1PH8 A;  2HHH L;  4DR5 L;  2CKZ B;  2JJQ A;  3FKI H;  4APV A;  1XNQ Q;  1BVS A;  5ELO A;  5GRO A;  2N8N A;  2R6G A;  2QEX A;  4A3D G;  4HJ9 A;  4JI2 Q;  4YY3 L;  5JJL A;  3GTL H;  5IP7 H;  4DV4 L;  3KLW A;  2DGY A;  4JI1 Q;  1CKO A;  4B3M L;  2VNU D;  4GNX A;  3EIV A;  5IWA L;  3S14 H;  4LUZ A;  4A93 G;  1SR3 A;  4P74 A;  4YCU A;  1L2F A;  3CP0 A;  1OXV A;  1D8L A;  1MIU A;  1A8V A;  2AWN A;  5IYB H;  4LF9 L;  5IP9 H;  1AE2 A;  2R7F A;  2ES2 A;  4DR4 L;  3NBH B;  2ZM6 L;  4OO1 I;  1CSQ A;  2JEB I;  2K52 A;  1Y1V G;  4O0A A;  3SGI A;  1I5F A;  2RHS B;  2UUB L;  2NVT H;  5GAD C;  5C4J H;  2ALY B;  5GAG C;  2HIX A;  2LSS A;  1GVP A;  3E9I A;  3HOV H;  4B3S L;  1EIF A;  4L5R C;  3ZJY C;  2YTY A;  4GS3 A;  2VQF L;  4HJA A;  3I4N H;  3MXN B;  4JG2 A;  4LF4 Q;  1IZ6 A;  2A1A A;  3CXC A;  5IT9 c;  1HZB A;  4WJ4 A;  4UPA A;  1U5K A;  1XTD A;  4A3G H;  3UDF A;  4YCW A;  1HNZ Q;  2JA7 G;  4A3L G;  3K81 C;  4OWX B;  1L0W A;  1Q81 C;  2UU9 Q;  3STB C;  1YIT A;  2BH2 A;  2VW9 A;  4UP8 A;  1KL9 A;  2UXD Q;  2D0O A;  2KHI A;  1XJV A;  4IOA A;  1TWH H;  1IBM L;  1X65 A;  1OXS C;  4IPG A;  2WAQ E;  4DAY B;  4Y52 H;  4A93 H;  3A5Z B;  4QIW E;  4K0K Q;  1N32 L;  2N49 A;  1PH7 A;  3CCL A;  4DV3 L;  2YU9 H;  1OXU A;  4A3I G;  1LYL A;  1NY4 A;  1QVC A;  4YWL A;  4DUY L;  4B3T Q;  4X6A H;  1I6H H;  5C0X J;  2YYZ A;  1WCM G;  5BR8 Q;  1EYG A;  1VQI A;  1D7Q A;  1VCI A;  3A5U A;  3G6E A;  2PQA B;  1QVG A;  4JI7 L;  4L5Q A;  4GKK Q;  2ZJR A;  3OW2 A;  3T1Y Q;  2DUD A;  2HQL A;  1NBW A;  2K5N A;  3KF6 A;  4PZ6 A;  5M3M G;  1C9O A;  1KIX A;  1V43 A;  1SN8 A;  1X3E A;  4XTC S;  1FJG L;  1JE5 A;  3G4S A;  3J7A 5;  2JA9 A;  3U4Z A;  1VQO A;  1GD7 A;  4DR1 L;  4BA2 I;  1S3O A;  1K0R A;  4X62 Q;  4POF A;  5GAH C;  2NN6 G;  4AQY Q;  3KJP A;  1QZH A;  1X3G A;  3AFP A;  3KDF A;  1U0L A;  1PH2 A;  3UDI A;  1G29 1;  1XNQ L;  2K5V A;  4LUO A;  1C7Y A;  2CFM A;  1FGU A;  1VQM A;  1LUZ A;  1VQ9 A;  2GN5 A;  3IRB A;  4JI2 L;  2VUM G;  1HR0 W;  3TQY A;  3TS0 A;  1H95 A;  4JI1 L;  1IXR A;  3KOJ A;  1W3S A;  4LF5 Q;  1N9W A;  4AYB G;  3I2Z A;  4LFA Q;  4A3M H;  1VQA A;  4A3E G;  3DM3 A;  4EQ5 A;  1XMO Q;  5FJ8 H;  2IX0 A;  1WCM H;  4TVA B;  3L2P A;  1MJE A;  4JI5 Q;  4XIG S;  2F4V Q;  2CWP A;  2R92 G;  2ZTC A;  4DV1 Q;  2RF4 A;  1TWC H;  3J81 c;  2B63 G;  5FLX c;  1XPR A;  5M3M H;  4DV6 Q;  3S16 H;  1L1O B;  1K3R A;  1K73 C;  2V1C C;  5FLM H;  4LF4 L;  3FKI G;  1OXT A;  1SRU A;  4JI8 Q;  4LWC A;  3I56 A;  4J15 A;  1YHB A;  1Z9F A;  3HKZ E;  3BZC A;  4GN5 A;  4YHH Q;  2F52 A;  2MNA A;  1HNZ L;  5LMN Q;  2JK8 A;  4PMW A;  3TRZ A;  4DR7 Q;  2JEA I;  5IP7 G;  1VQ7 A;  1Q12 A;  3JAM i;  2UU9 L;  2R93 H;  1OXX K;  1WOC A;  2Z6K C;  4NB3 A;  3GTK H;  2UXD L;  2JA5 H;  4QGU A;  3RLN A;  5M5Y H;  3CMA A;  3CCS A;  1YIJ A;  4YWK A;  1B70 B;  2UXC Q;  3I4O A;  3BZK A;  5IP9 G;  4RMF A;  2WB1 E;  3CCU A;  3D31 A;  2ZJP A;  4A4I A;  2EXD A;  1PH1 A;  2VS1 A;  4X65 Q;  4ALP A;  1KQS A;  4LFC Q;  3AYH B;  1E7Z A;  1NTG A;  3I7F A;  3CPW A;  3HOU G;  5K36 G;  3HOZ G;  4OON A;  4C3I H;  2N3S A;  4B3T L;  1TXY A;  3CQZ H;  4IFD I;  3K0X A;  3PGZ A;  4TQU S;  3I4N G;  5BR8 L;  2B63 H;  1XPU A;  1PV4 A;  3AEV A;  4JCV E;  4QJF A;  1YJW A;  1LM0 A;  4A3J H;  1K8A C;  2E5L Q;  4A3G G;  3A0J A;  1HNX Q;  5LMU Q;  4GKK L;  2R7D A;  4R4O A;  1K83 H;  1PYB A;  1EQQ A;  3T1Y L;  4GKJ Q;  3RLF A;  3S24 A;  4IJL A;  4LF8 Q;  5DLQ E;  3F2D A;  3CC7 A;  1NJI C;  4YCV A;  4A3F H;  2L15 A;  5JJK A;  1AE3 A;  1VQB A;  2Y0S G;  3W1B A;  1PH6 A;  3M4P A;  2BA0 A;  4KHZ A;  1E1O A;  4AYB E;  4JBW A;  2K14 A;  3M9B A;  3CD6 A;  4X62 L;  4AQY L;  4JV5 Q;  3OYY A;  3PV0 A;  1BKB A;  3ULL A;  2IT1 A;  2KEN A;  2VQE Q;  2PQA A;  3PO2 G;  2OQ0 A;  1Q46 A;  1VQ6 A;  4JOI C;  3GTG H;  4GLV B;  4IPH A;  1N34 Q;  3UDG A;  2ATW A;  3HOU H;  3HOX H;  2IX1 A;  5EAY A;  3HOZ H;  4LF5 L;  3E0E A;  3CF5 A;  4LFA L;  1EOV A;  4HID A;  1XMQ Q;  4DV0 Q;  2R7Z G;  1HR0 Q;  5LMN W;  2JQO A;  1G51 A;  2NVX H;  1I50 H;  3T1H Q;  4JI5 L;  3K7A H;  1E22 A;  1UE7 A;  3OTO Q;  2F4V L;  4DV1 L;  4BXX H;  1VQE A;  1X56 A;  3A74 A;  3GTQ H;  4PG3 A;  2I5H A;  3CW2 C;  3CC2 A;  3K7U C;  3AQQ A;  4DV6 L;  3PSI A;  2E2H H;  2Q2T A;  2NVQ H;  3Q8D A;  3JC6 6;  4GOP C;  4DR2 Q;  4JI8 L;  4GN4 B;  4YHH L;  2RHQ B;  5C0X G;  5LMN L;  4DR7 L;  4DV2 Q;  5IYC H;  1YEZ A;  1HNW Q;  3PO2 H;  1J5E Q;  3M4O H;  2MQH A;  4A3M G;  2OTJ A;  4LF6 Q;  4GN3 B;  5C44 H;  3U58 A;  2UXC L;  2OQK A;  4DPG A;  4OXP A;  5FJ8 G;  4JI3 Q;  4JI6 Q;  1V9P A;  1TWA H;  1L1O A;  2IHE A;  1OTC A;  2Q2I A;  1NE3 A;  2K50 A;  1PH5 A;  4X65 L;  1JJ2 A;  2R7Z H;  4LFC L;  3HFZ B;  3RR5 A;  4HJ7 A;  5IYD H;  4MTN A;  3F2C A;  5IE8 A;  4IOC A;  1X55 A;  2Y0S E;  3DLL A;  3S1Q H;  1YI2 A;  4JI0 Q;  4PZ7 A;  1PVO A;  1SMX A;  1Q82 C;  2LXK A;  3W5O A;  1ASY A;  3UE1 A;  5FLM G;  2GVA A;  2A19 A;  3K8A A;  5H1S E;  1YJ9 A;  2Q2U A;  4DAM A;  3HOW H;  4LW1 A;  1VQD A;  2XTI A;  2E5L L;  1LTL A;  3CCE A;  5LMU L;  3F2B A;  3GD7 A;  1GKH A;  1HNX L;  1AH9 A;  1IYJ B;  1S72 A;  2CQO A;  1N8R C;  5JEA J;  3RZD H;  2I0Q A;  4GKJ L;  2R93 G;  4LF8 L;  2WP8 J;  1WJJ A;  2JA5 G;  4GNX C;  3H3V I;  4UP7 A;  3CCV A;  1EUJ A;  4O2D A;  3G71 A;  4DR3 Q;  2PNH A;  1IBL Q;  4HIO A;  4A3B H;  4A3C H;  4JV5 L;  4EX5 A;  1MKH A;  4LNQ A;  2MFI A;  4OX9 Q;  4DV5 Q;  2VQE L;  1P8L A;  1VQH A;  2F3I A;  1I3Q H;  3S2H H;  3RZO H;  4K0K L;  1N34 L;  4R4C A;  2MO0 A;  1RL2 A;  1Q86 C;  1PH4 A;  4IFD J;  1WFQ A;  1A0I A;  1YNX A;  1V1Q A;  3M4Q A;  4BBS G;  3CPF A;  2HIV A;  2I5M X;  2NZO A;  4A3J G;  2YTX A;  4POG A;  3RN5 A;  1XMQ L;  4DV0 L;  1ASZ A;  1HR0 L;  2JA8 G;  1XNR Q;  4R4I A;  2KCM A;  3T1H L;  2UXB Q;  3KF8 B;  3OTO L;  3HKS A;  1QUQ B;  3PUX A;  4RG1 A;  3M3Y H;  4OWW B;  4A3F G;  2AKW B;  3CCM A;  2A8V A;  2VL6 A;  1X54 A;  1EFW A;  1PYS B;  5GAE C;  4PZ8 A;  2XGT A;  1KC8 C;  4OO1 G;  1SLJ A;  1YBY A;  5C4X H;  1EWI A;  2QGQ A;  3AFQ A;  2YV5 A;  4DR2 L;  1HJP A;  2H5X A;  4P71 A;  1C0A A;  4X64 Q;  3TS2 A;  1FVI A;  3S15 H;  1BBU A;  5AJ3 Q;  1PFS A;  4DV2 L;  1HNW L;  3HOX G;  3S1M H;  1KRT A;  1J5E L;  2FXQ A;  4HIK A;  2CWA A;  3GTP H;  3S1R H;  1TWF H;  1VQN A;  3UE0 A;  4LF6 L;  2K75 A;  3STB D;  2IHF A;  5J3B A;  1VQG A;  2NVY H;  4JI3 L;  4JI6 L;  1Y1W G;  4BBS H;  3UDX A;  4DV7 Q;  2JA8 H;  4BXX G;  3RNU A;  4QY7 A;  5IY0 A;  3CC4 A;  1KAW A;  1T9H A;  4R1J A;  4DUZ Q;  1VQ8 A;  2NN6 I;  1EIY B;  1NMF A;  5C3E H;  4JI0 L;  4B3R Q;  1G6P A;  4P75 A;  2WAQ G;  1CKN B;  3TEH B;  4X66 Q;  3M7N A;  1M1K C;  1W2B A;  2YTV A;  4HJ8 A;  1VQL A;  1S40 A;  4GLA C;  4A3K H;  1WI5 A;  3ULJ A;  2OTL A;  1N36 Q;  5IYC G;  4UP9 A;  1FJG Q;  3K80 C;  2JA6 G;  1A62 A;  4IPD A;  1J6Q A;  3M85 A;  1R9T H;  4KHP Q;  4JBJ A;  4LFB Q;  4IPC A;  3J81 j;  5C44 G;  2PI2 E;  5E7N A;  3KYH C;  2EIF A;  1YHQ A;  4DR3 L;  1IBL L;  2AHO B;  3PIO A;  2VZA A;  1X9N A;  1KHI A;  4OX9 L;  3PUW A;  1KRS A;  5GQO A;  2CCZ A;  1PHJ A;  3TRE A;  4UY8 C;  1XMO L;  3BJU A;  5IYD G;  4DV5 L;  4MZ9 A;  4L5S A;  1YHA A;  2UUA Q;  4GLX A;  1Y1W H;  2BA1 A;  4LF7 Q;  1SE8 A;  4Y7N H;  1Q1E A;  3S1N H;  4H02 A;  2RCN A;  3H0G H;  3J80 i;  1B8A A;  2QA4 A;  1N33 Q;  2I5L X;  1O7I A;  2KHJ A;  1VQF A;  2ZTE A;  2K4K A;  3HOW G;  2D0P A;  1YVC A;  1XNR L;  5M3F G;  4GOP B;  2UXB L;  3J81 i;  4C2M H;  5JJI A;  1CUK A;  2LXJ A;  2BH8 A;  1IBK Q;  3PO3 H;  4JBK A;  3LGJ A;  3PIP A;  4JYA Q;  3GTO H;  4HJ5 A;  1YJN A;  1A63 A;  4AH6 A;  2JA6 H;  4JC0 A;  4A3B G;  2D62 A;  3B6Y A;  4A3C G;  1UE6 A;  5HGQ A;  3JAM c;  1VS0 A;  2ID0 A;  3WWV A;  3I4M H;  4IJH A;  3L0O A;  3KJO A;  2N78 A;  4X64 L;  4DR6 Q;  5AJ3 L;  1QUQ A;  4NXM Q;  1X3F A;  2NZH A;  2OCE A;  4A3D H;  3G48 A;  3W1G A;  1SRO A;  3NEN A;  3CCJ A;  4JI4 Q;  3PUV A;  2Z6K A;  1UEB A;  3NEL A;  1YZ6 A;  5JEA G;  2UUC Q;  2WFW A;  1VQP A;  1UE1 A;  1UWV A;  2KBN A;  3HKZ G;  3PF5 A;  4YWM A;  3ER0 A;  4JBM A;  1GO3 E;  4DV7 L;  3H3V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...