4R4XA

Structure of pngf-ii in c2 space group
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
546
structure length
544
Chain Sequence
b'AQTYEITYQNSFEGKINQNHIISITNSDKTLLFNEKIKNKKADFPFEVNEINRKNNEVSQFAFLNNNEIVKTSDNTILAKQEFKPTSETGKILGYNVKKAVTSVNSNTIEVWYTNDLKVKGGPSILGQDLGLVLKTVRNGSSVVEATSVKKIKALDDQSLFNGKNITEKDALTYKDMIWKSRFITIPVFENETINFSDASKSDQVIQRFGNGTIILKKVKIPEIKQGNTIFVELKQKSNGDAYDRTGDVFIIPQERAISYYTGLTQGVKSLPVYQNGNGKSYQGVALTPDYLPFIELMRFFTPFGIGHFNEKIQLKGKNWHNNTPYRQDITELRPQLSGKEILIGAFIGNYDKGGHQISLELSIHPDQQKIVNNNFVLPVFNTTNVMEMAGQDYPTMFNSDKGVEVDFILTKDLKNAQLRYITTGHGGWGAGDEFVPKENSIYLDGKLAHAFTPWRTDCGSYRLFNPASGNFEDGLSSSDLSRSNWCPGTITNPVYINLGNLNAGKHTIQVKIPQGAPEGSSQSFWNVSGVLLGQEHHHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PNGF-II
publication title Identification and Characterization of a Novel Prokaryotic Peptide: N-glycosidase from Elizabethkingia meningoseptica
rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
total genus 140
structure length 544
sequence length 546
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4xA03
2.60.120.1570 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4xA02
3MIDA 3PHMA 3MIBA 3MIEA 3MIHA 3MIFA 3KS7A 1SDWA 3PMSA 1PNFA 1YJKA 3MICA 3MLJA 1YJLA 1PNGA 3MLKA 1PGSA 4E4ZA 4R4ZA 3MIGA 3MLLA 1PHMA 1YIPA 4R4XA 4QHBA 1OPMA 1YI9A
chains in the Genus database with same CATH superfamily
1I3HA 4HKOA 4ARYA 4QWNA 1NCRB 4PF1A 1YNAA 4FP3A 1UZVA 2VL4A 2D43A 3LDRA 1MEC2 3AXEA 3VD9A 1X82A 2VZPA 5J09A 4YW6A 1LOAA 4Q5OA 2QQOA 1YWKA 3RWNA 3KVBA 4DRRA 3WZ1A 2JE7A 3I2JA 4CP9B 1W8NA 4C1XA 5FJKA 1LR5A 1W2UA 4WZCA 2DFBA 2JDNA 2W52A 3VZLA 4E9KA 5GZGA 2OT7A 4SBVA 1JZ2A 2Z42A 5LATA 2ILMA 1VALA 5A80A 4KG0A 1RUE3 3KSCA 4NIDA 2A3XA 2VPVA 2WL1A 4E4HA 1VB2A 3POWA 5FK7A 3S0MA 3BI3A 3CHXA 4HANA 2CYFA 2ZABA 4LE4A 3T2PA 4C91A 2VNOA 2ZXQA 5CYYA 3THPA 1SCRA 4XHXA 5SV8A 2ZX3A 3ES1A 2X53S 5CKMA 4LO7A 4QQLA 5EXOA 4OUMA 4LE3A 4QHOA 1EV13 2N7GA 4B29A 3NKGA 2DWRA 1GU3A 2O1QA 1TNRA 4N9IA 3LD8A 4FPYA 1NA1B 2R1BA 2A70A 5AC91 4JX0A 5CFDC 3AVSA 4FXKB 4IUGA 5IHRA 1G9FA 1SLCA 1TEIA 4FI9A 5JSPA 1LTEA 4BM8A 1NLRA 2HWE1 4YZ2A 3RYKA 1HRI3 3RZZA 1NE6A 1R081 4N7IA 5I91A 1HIXA 3K51A 1BMV1 4ZU7A 1OKOA 4WV8A 3AKPA 2NLRA 1S55A 1WMXA 5T55A 3WP6A 2K46A 4PLMA 3UYJA 5CBLA 5LA0A 2WWUA 3ABZA 3UGFA 3NAPC 1ODMA 3ZFEA 2P3JA 4DUVA 1RUNA 1LGBA 1UZZA 3CEWA 1KFUL 5FYCA 1GWMA 1JZ7A 1XPWA 1JMUB 3MIGA 5DPNA 5FO8B 4MXWA 5ANQA 4ZY9A 3AYCA 4Y5TA 3ZKYA 2ADDA 4AI0A 1PO11 2A6VA 2FDHA 4ATEA 5G05L 1C1LA 4A42A 4YVSB 4R9BA 5B4NA 1FNZA 2V73A 3ZX7A 2ZX1A 5K0UA 3BKZA 2V09A 4YM2A 1D2SA 2XL7A 1N1TA 4UFHA 3CJIA 2JDMA 4AQSA 1WD4A 2VQTA 3Q8FA 3D4KA 3RZHA 1A78A 3C7OA 1HB4A 1RMU3 1RUG1 2O8OA 3H50A 4JGZB 3AKQA 1OUSA 1U5XA 3B7MA 4B4PA 1U0AA 3C7HA 4HN1A 2K9ZA 4KGQA 1IZ3A 4XOGA 3DYMA 5DABA 4COZA 2W68A 4QHZA 1CVNA 2PHLA 3IN9A 3OBZA 3QACA 4PJYA 3B94A 5FXWA 4XAAA 2CSGA 1EAH1 5JPNB 2XWBB 1VRH2 4FT8A 1C8M3 4QKBA 3GCWA 4LJHA 3FE5A 3T08A 3ZXEA 4BB3A 1DHKB 1MQTB 2FDFA 4E2SA 3ROUA 3U14A 5KXBA 2VJXA 2EAKA 1O4TA 3NNFA 4MYEA 1KFXL 5FZAA 2W87A 1RUF1 1FOD3 5LY1A 1AR61 1H4GA 4G9SB 4QQHA 4OQ9A 1IS5A 4KNCA 3N9PA 1X9PA 4UYBA 3POIA 1XU1A 4BQ1A 3PUIA 5FYSA 3U75A 5J1XA 4HMZA 3K4ZA 1UKRA 3MFAA 3M1HA 4F8AA 1SMVA 2QKDA 4X6QB 4LUKA 3H9AA 1WLCA 4BYYA 1PGW2 3GZUC 2ARCA 3BOWA 1ULEA 4Q4V3 4XYXA 4YGEA 1PZ8A 2WFPA 4XTPA 3ZXGA 4ASMB 4CP2A 1X8EA 2JEMA 4Q2FA 1XE7A 3MF9A 4BE3A 4F83A 2A3WA 5FFOC 3C7EA 2DVAA 4DFSA 3N3HA 1H30A 4JZRA 3LGRA 1R1A1 2PHDA 3MW3A 4YM3A 2WRAA 4WBBA 4JGYC 2BNMA 4JDNA 1R091 3ZSMA 1S2EA 1E5IA 3WW1A 3P3NA 3KT1A 2D40A 3K4AA 2QQLA 4LXLA 4NHLA 4O9GA 3VBSC 1SFNA 3W20A 1WBFA 2F17A 3VDCA 3POJA 2XJQA 5FZMA 1QH6A 1QJY1 4JRLA 2A71A 2DVDA 4IGPA 2WO1A 1UXZA 1W99A 4XF9A 2VC9A 5DAQA 3WEZA 5J98B 3C7FA 4DUWA 4IEQA 5C9AC 3WQ7A 4N43B 4N53B 5FYHA 3WHTA 4A7KA 3PL0A 5GKAC 5C33A 5FQ0A 3MIBA 3NV4A 3B69A 4IXLA 4KWJA 3Q8AA 4P00B 4OHWA 5BNNA 5C8WA 3QOPA 5ACA1 1N3OA 2Q0AA 4GB31 3UNPA 4RHV2 2B45X 2CU5A 4LBOA 3FHQA 2JXAA 4Q27A 1ST8A 4AR2A 1E5SA 3JBG1 5CG9A 4RQPB 4A6OA 2WZR2 1C1FA 3RWKX 4DUXA 2TBVA 4MSVA 2HLEA 2XBO3 5KC5A 2L9LA 1RVF1 2P5BA 2WO2A 5K8SA 1ND2C 1VBB3 2BTVC 3SH4A 3BPSA 4AEMA 4KBZA 2ZHLA 2WFF2 4LA2A 5JPMB 3H1WA 5DG2A 2P6HA 1ASJ1 4I01A 5K4LA 3P6BA 1SLLA 1LB2A 3FLPA 3TWIA 1JOPA 1GNZA 1EPWA 5FYIA 1RB8G 2R0HA 1QJX2 3TAYA 2IXHA 3F2ZA 5BYNA 3WR0A 2B7YA 1TZOA 1W8WA 2YHJA 4V2VA 4Q0SA 1PHMA 4UT5A 1TNFA 3IPVA 4BCUA 4B4QA 1GOFA 1I6XA 3PTRB 5IJRA 3ZIWA 4LO6B 1BJQA 5FRAA 2IFRA 1REFA 4GIQA 5FZ9A 4META 4AEJA 3ZO0B 1AR73 4YZ3A 1UXXX 2JG9A 1O3TA 1ULDA 1CGPA 1PM4A 4AXOA 2RVAA 4NE9A 1LOCA 1V6IA 3GJBA 3JD72 3KF3A 3K75B 1RUH1 1XNDA 2BPA2 3S57A 1OF3A 2JICA 3VBFC 5C8CB 5C4WC 5IYYA 1UMHA 5CVRA 3RZGA 5D8AC 2BW8A 3V56A 1H1AA 2BP6A 2WNUA 2NN8A 3D3AA 5APAA 4NO4A 1CD3G 4OHXA 1G86A 3KV9A 3ETPA 4ZPIA 1QQP3 1T6BX 2WJSA 5IUQA 1HB1A 1OLQA 1B35C 4BHPA 5A1AA 3I2HA 2ERFA 2KM2A 3Q9OA 3T4VA 1O6UA 5F6KA 4D0QA 2GN3A 3NWKA 2SLIA 5FREA 4EQVA 1W0NA 4N7UA 4B7EA 1UF2C 2XVLA 1FMD1 2R062 4IESA 1ZZBA 3VV1A 5JXGA 4QKFA 1W6OA 5GZFA 3OY8A 3DKQA 4DQAA 4M3CB 3D82A 5C3OA 1DQ0A 1OA2A 5FZGA 4MX3A 2WQ4A 2R073 4LBJA 2JKXA 1UX6A 5F37A 4HXCA 2J1EA 1VAKA 2AUYA 1ZA7A 5AC93 1V9U3 1S0CA 3VDAA 5J96B 3ACHA 3I2OA 1WW5A 4CP0A 3HNBM 2WT2A 2ZZQA 3AZWA 3MF6A 3WDXA 2ES3A 4EN9B 2HWE3 5CA6A 5CKQA 4BQ3A 2QZ3A 4YW1A 4Y26A 1N1VA 1OHFA 2WO7A 5BNOA 2VOKA 5FLHA 2XUEA 5HBAA 1XE8A 1Q8QA 2W47A 5HXVA 2VR4A 4CEWA 5DUXA 2YB7A 1BLZA 5CG8A 1IQDC 3I3MA 1JYTA 1FPN1 2TEPA 1AR81 4OUSA 1YI7A 1NKGA 2WNVB 1POQA 3CF6E 4EYUA 2FDIA 4DO0A 2W91A 2XONA 2PHFA 4HPKA 1WW6A 1PO13 4HN0A 3PUSA 2WLQA 3AMHA 2FHRA 1ZRIA 1V0AA 5AFEA 1OD5A 2BGCA 4PT6A 1Q8PA 1L7QA 1MS4A 2D3RA 2PHRA 2VMGA 1GYKA 2ZJCA 3ATGA 3NKTA 4LHLA 1W6MA 4A7YA 1MACA 1S2KA 5ABJA 1UOFA 1US2A 1BEV2 3HQUA 1CAWA 1FATA 1W9TA 2W46A 3MIHA 3UGGA 4DXSA 1PM7A 4XFAA 3WNLA 2AZ5A 1RUG3 4PQQA 3ZN5A 1X8MA 1BZWA 1JYWA 4IQPA 3IIIA 3H3UA 4DB5A 4JKMA 4AVSA 4UFLA 2RR11 3OGGA 5KHHA 3U10A 2DCTA 2HWF1 2ZMNA 3GGLA 5JCTA 4JAAA 1Y3TA 4GZ9A 4NIGA 1EAH3 2J1SA 2BOIA 2LM3A 4QKNA 3RJRA 1DZQA 2OPKA 3OD0A 4UW4A 4AI1A 2B5HA 1PGL1 2LROA 3HMYA 5K0UB 3N7KA 4HL0A 1J3QA 5FUNA 4JTOA 2ZS6B 1JZ4A 4NJ4A 4LBQB 3WY6A 4EZ4A 1RUF3 2ZOEB 3OPWA 1JZ5A 1PO22 1WCSA 4AEKA 3H3ZA 3SH5A 4L99A 4BWOA 5FPZA 3N7LA 3IDCB 4L97A 1NCRA 4D7YA 3N9MA 4OI4A 2AGSA 1X36A 1VP6A 3PU3A 4AF9A 3UKNA 5FKCA 5HI0A 3ZR6A 5ACA2 1AHSA 2D7FA 4PI0A 1IQAA 5KXDA 4D7TA 3ACGA 3VDDB 4ZS3A 4F3JA 2QQIA 4BQXA 5IVEA 4R4XA 2PLV1 3DXUA 4CP9A 3WW4A 4XPVA 5JI9A 1R1A3 3G6JB 2DDUA 5FY0A 1NG0A 1K42A 1DG6A 4FPGA 2FCVA 5DUWA 1R093 3G7DA 1X33A 4Y33A 1CX1A 2VY0A 4GXLA 3N36A 2AEZA 3WVJA 2PXJA 3A22A 5EYXA 1LHVA 4CCOA 1GMMA 2VMIA 3U78A 3LFIA 1CESA 4MOAA 2ZGUA 1WCDJ 2IFWA 3N9QA 4R52A 5EPAA 3ZYJB 4K7JA 1QJY3 5LRRA 4CDWC 1GZ9A 1G9BA 5CADA 2JE8A 2QUOA 5FZHA 5C6CA 1KRIA 1AYN2 5FPAA 5JXHA 2E63A 5FJHA 5T5LA 4JQTA 1QH7A 3R6SA 4UWDA 5A6YA 3FFZA 4W50A 5FP8A 2WZPP 4XHBA 3T30A 2WS92 4YLZA 4MUVA 1K5MC 3Q8CA 1VIWB 1NUKA 3ZSKA 4CDXC 4FPHA 1NXD1 4CCCA 1Z7S1 5IVBA 1AXYA 1RUE1 1FXZA 3OUHA 3UESA 1PK6C 1SLBA 2RMU2 4CPBD 4TTGA 5F5IA 4GB33 4XVHA 5JZGC 3O14A 2Q8CA 2ZGQA 2QDNA 5CB7A 4XBQA 1VBC3 4Y22A 3VN4A 1GNHA 1BK1A 1ZZ7A 3M3IA 4XXAA 5EIYB 3MDPA 1ZBE3 3KV4A 1WZXA 5DG1A 3S30A 5FO7B 3ASIA 1RUH2 5KHGA 2HJIA 1YQ8A 4WVVA 2XVGA 1WMFA 1W28A 3PTYA 3AK0A 4D7SA 1QWRA 1KQRA 3LAGA 1RVF3 1GICA 1KJLA 1BHGA 3KCCA 4FQZA 5LRSA 3N4MA 3A0NA 3A4UA 4IEZA 2XJTA 3RS6A 3S7EA 1WLWA 5FMOS 3ZXFA 4FO9A 4EWAA 2PA7A 3H7YA 3ME2A 5FV3A 4KU8A 4I0BA 4CUCA 5FBJA 4YVSA 1ASJ3 3NNLA 5FY7A 3BYWA 3U1XA 2DCKA 5DQ0A 1FAYA 1SCSA 3I3QA 5F39A 1TMF3 3OPTA 3RI8A 5A1FA 3VZOA 4I09A 1DQ5A 3GHNA 3RNSA 2ZEXA 2Z5WA 2VAUA 1GWLA 1OH4A 4CCKA 5ISLA 4ASKA 3C2UA 1YIPA 2XVKA 3WG4A 1ACCA 1TG7A 1UY4A 1OLMA 1AX0A 3EHKA 4NUBA 4AFDA 4CEYB 5I0RA 3AVRA 4R9AA 2JDAA 3TN91 2XPJA 2AACA 2OXBA 3JUUA 4QM8A 1CZTA 3ILNA 3TRSB 3PJYA 4FFHA 3WNPA 5LBFA 3AL5A 1PX4A 4WM8A 3ZM8A 2Q1MA 3SC7X 3AMPA 2LUWA 1TME3 2ZHMA 4Q0PA 1SDWA 5BNQA 1XSRA 1O5UA 1XYOA 2UY9A 1ZBA1 2YMZA 1UYPA 1PVC2 1YEWA 3DGTA 3AZXA 1UNBA 3JB8A 3WQ1A 3IPVB 2QCSB 5GLUA 4MVTA 4U2AA 4WM7A 3GDBA 3WT3A 3WNOA 4LA3A 4OI0A 3CJXA 5FZ8A 2E6VA 4L2NA 1BKZA 3POSA 1CJPA 3FHAA 3IAPA 3GNEA 3ZFEC 2GC2A 2BZDA 4IV3B 1OPMA 2BGOA 4CU9A 1MZ6A 1H2KA 5FZ4A 1DGLA 1LESA 1O8SA 4MHRA 1Q56A 3LSEA 3T0AA 1RUJ3 1HB2A 4MO3M 3VKLA 1XRUA 4QD2A 4BU2A 1FMD3 1IPSA 3OGSA 4X6RB 3AP5A 3VHRA 5EJ3A 1QJEA 5ERLA 2GMMA 2VMFA 1P8JA 1FOD1 3H7JA 3WDVA 2A5ZA 5F5CA 1KJRA 2FBEA 2BRTA 5FXZA 3AKTA 3CJIC 4C1WA 3KGLA 3RQ0A 1Q43A 1UCXA 2XKOA 1ENQA 3PDQA 1N1SA 1W8TA 4FCAA 3OUJA 3VZMA 4ZZ5A 2VVDA 1AYM2 4Q4V1 4KWLA 1LULA 3Q8EA 4BPZA 4M0HA 1NE4A 2IXKA 4IEWA 3AB0A 4N9HA 3WUCA 5A3UA 2BDRA 2WKKA 2WT1A 5DN2A 2UWCA 4N43A 4N53A 3LB9A 4LBLA 2VQAA 4NPLA 4QPYA 1W6OB 1WLDA 3GBWA 1IG0A 3H1YA 1S0EA 4UBHA 2DCJA 3KD4A 1AR83 4QX3A 3UKTA 5GLVA 1C28A 4EZHA 2OQ7A 1VBE2 1SPPA 1J3RA 2YC0A 3LKJA 5GLWA 1OC1A 1PX3A 1V6KA 1DF0A 5B2GB 4QB1A 3NQHA 2RS33 2Z69A 2E7TA 4R8HA 4Y3OA 4QMAA 5BPXA 3DYOA 1UWWA 1D7PM 2J1UA 3AP7A 4RQPA 3NO8A 3SKJE 4MGIE 4IEYA 4Q29A 4GKXA 1CR7A 1UOJA 3FZ3A 4IEUA 3P1IA 2Q30A 4IE0A 1VRBA 2VW2A 1JHJA 5FKBA 2VW0A 1PZ7A 3VD5A 1W8UA 2PAKA 2RR13 3HNYM 5KC6A 1C4RA 1Z78A 4TN7A 1GZTA 2EIGA 2GN7A 2VTXJ 3LOIA 4HPKB 4W4ZA 4OHZA 3LIHA 5J3UA 1U12A 2VOVA 1H6YA 2HWD1 4AGVA 4IGQA 4YSFA 4QPGA 5J48A 4AZZA 4C90A 1DP0A 2XJUA 2JB4A 4H7LA 5C3SA 4P9YA 2D5FA 3B01A 2OX0A 5F7UA 4XC9A 5IVJA 1KGYA 1W2AX 2DFCA 3HIFA 1J1LA 2YBPA 3E1F1 1H8TA 1DYKA 4AFCA 1X9TA 5H9SA 1WMDA 1HRV2 1Y4WA 2RS13 5IAXA 2QQNA 3BTYA 2VZOA 1CN1A 3L9JT 1LJ7A 1YFUA 1H9PA 3PMSA 4AQ2A 5KXEA 3B02A 4DMIA 4WVWA 1NCQC 4RGGA 1RUE2 1ZM1A 4E8DA 2DUPA 1JZ6A 1XE0A 2LRPA 2J42A 3AFKA 5A32A 3BTZA 4YYOA 2XMLA 4E4SA 1UL9A 2X09A 4KU7A 5BNNC 4MZUA 2IZWA 2PLV3 3AKRA 3MBWA 2P3IA 3N7MA 4RS5B 2BFUL 3C8XA 4AEDC 4CCDA 3I97A 4W65A 1AR91 4XFHA 1YQ5A 5I0UA 4XCAA 4B7KA 1VBD3 3ZYIB 5L19A 4GD4A 3FWEA 2QDRA 1XNAA 3LCPA 1EV12 3LPGA 4S2DA 3LA7A 1GOGA 2P37A 2ZEYA 4CP1A 1T6GC 1AR71 2O8QA 4YZ4A 4Y24A 1ULPA 3UETA 1JUIA 2VQ0A 3CZJA 5FP4A 4J1XA 1WLTA 1W6NB 5KHIA 1GANA 4DY5A 1WWYA 2JDUA 1OKQA 5FWJA 2EICA 1HRI2 4OCTA 4R9CA 4GH4A 2F4PA 1S1AA 5EWSA 4TLGA 1YO8A 5JMOA 3LEMA 4M3CA 4R9DA 3HD8B 1RUI3 3PVOA 1D0HA 4QQ2A 1RUD1 3MEPA 5DXDA 4FXGB 4KG8A 3MPPG 2YY1A 4AVBA 2VBPA 5JR7B 1Q3EA 1Z7S3 2WDBA 2WN2A 3IT8A 3OUIA 1KDMA 1QQP1 2GSYA 1Q5OA 3R4UA 2D3PA 3R4SA 5FYTA 1QDOA 1F4HA 4ISQA 3LZZA 1YFYA 3NJZA 1UW8A 2CHHA 1H2NA 3ACLA 3OF1A 3VDBA 4LK7A 4EN7B 3J7MA 3KF5A 2JG9C 4UAPA 1LRHA 3J7HA 1Q8OA 2B42B 3BOPA 1YXWA 4NHXA 1LCLA 1DGWX 4XUTA 1W0OA 4YRDA 3VKFC 1PMIA 1DZRA 1BXHA 5JXJA 3L2HA 2R071 5L36A 1RMU2 2WNVA 2PN5A 4NRQA 3WQ0A 4PCRA 3IAQA 1V9U1 1YLLA 4JC1A 1UZYA 2WNUC 4DZGA 1OT5A 2VUCA 4IGOA 1MZEA 1MS9A 2JD4A 2VXJA 3ZFFC 3LFMA 3OBTA 4Y22B 5FZ0A 3VKOA 1C8M2 4I2OA 1W3XA 1YJLA 2Z4FA 2VW1A 2ZZJA 5CFCB 2LTNA 3B9IA 3PUQA 3TB0A 4CA9A 1WGPA 2GAUA 1FOD2 2PMWB 2X05A 2BEOA 2VD7A 4OZOA 2Q5TA 2YBSA 2A73B 5A7NA 2EAAA 2JDKA 2Y38A 5A7SA 3WCRA 2RM23 3QLQA 4IE5A 3RDIA 3SCGA 3TN93 4QM9A 3OBAA 4FAHA 3DEMA 4YW2A 2WYFA 2VBBA 2C9AA 4LKDA 4MV2A 4QU1A 1YI9A 2Y34A 2SBAA 2WYSA 3M4FA 2WIIB 3K4DA 4M0NA 4Q4Y1 2GC1A 5A6ZA 3O1PA 1MPXA 1RGSA 4Q4V2 4YVWB 2VZSA 5T5PA 1GP4A 5FYVA 3NNMA 3ZDVA 4AAPA 3PIJA 4LBQA 1ZRCA 3T4HB 1BQPA 1ZBA3 2WAOA 1NLQA 3O0VA 4DRVA 4AVVA 2LALA 2XB6C 5BNOC 1KITA 4RD7A 1EUUA 5F3EA 1LU1A 4ZU5A 1ZREA 5C5TA 5JOZA 4W6WA 4CEWC 1CPMA 1W9YA 1CZVA 1I9RA 5C3RA 1GZWA 4YZ5A 2WNEA 3R4DB 2GMEA 5FZ6A 1PIV1 3A23A 2EA7A 5T54A 3VBUA 3VDDA 4AAXA 2ZX4A 4K8FA 5L7OB 4QAWA 1K3IA 4WM8B 2PQQA 4OVEA 3KWVA 4E4DX 2CWMA 1UOBA 3I2DA 1OOPB 4O65A 4Q26A 3MIFA 2W1UA 3EYPA 4CDUA 5E89A 2QJVA 5A3OA 4HG6B 4S2HA 5ABJC 3H1MA 1OH3A 2J1TA 3WDYA 4XF3A 3ILRA 4L9BA 4DY3A 2EIBA 1ZRRA 4WM7B 3T0BA 1Y43B 1ND3B 4A45A 3EO6A 3EB7A 1IS4A 2A6YA 4FPLA 4M4PA 3U4SA 4AVCA 3T1MA 4LHKA 1CWPA 3P5BA 1UPIA 1QOTA 4RN5A 2RDNA 4YW4A 1QY4A 4AGGA 1I5ZA 3ILFA 4RGAA 5KHKA 3HT2A 2VCMA 4CCMA 3PUHA 2ZGMA 1DLLA 1LGNA 2ZGTA 2XWJB 4PBPA 4COUA 2ZX0A 3AYEA 3FMGA 2XBO2 5EHDA 4YG3A 5FAXA 5BNPA 1BYHA 4AVAA 4CCLA 5GZEA 3HN3A 4Q0QA 1W6PB 1VBB2 2JD9A 5DZGA 4FOYA 3I59B 3OEBA 2ID4A 3THDA 5GZCA 3J8F1 1WUVA 1NCRC 2VG9A 3W59A 4C8DA 3ZN4A 3GBFA 2PELA 2CY6A 2PQSA 2WNOA 2CAVA 4FPOB 2XJVA 2ADEA 3VBHA 4ISRA 3VBRA 3VHOA 1A8MA 1HX6A 1UIKA 3AP9A 5FMDA 5FXXA 2EXKA 4B8EA 1TE1B 3WF4A 2EIEA 1W05A 2QBXA 3T1LA 4FPEA 1OLRA 2WN3A 5EQUA 2VZQA 3M3OA 3UJOA 1RHI3 1D4M1 1O3RA 1RJ7A 4BLJA 4E2GA 1AF9A 4RYDA 1MS0A 1OA3A 3T2OA 4A44A 2GP3A 2H0VA 1VRH3 1VMHA 4K21A 4K3UA 1SPPB 3T3YA 1LEMA 3VLBB 2YFZA 1AR72 2HWD3 4M4RA 4CCNA 5JAXA 1VBC1 5T52A 3ES4A 2D6NA 4IDZA 1SEFA 3K48A 4GWMA 4NN0A 5F2WA 3EBRA 2WABA 1ZBE1 3AMMA 2WINB 4LR4A 1WKYA 5AVAA 2GU9A 3H0OA 1SLAA 2GC3A 1YQ2A 3INAA 2D5HA 3U37A 1JYNA 4C0HA 2W5FA 2UWAA 4NHKA 1FV3A 4E27A 5JWPA 4BIFA 4FFGA 3S7IA 5A7WB 4AI2A 4FSJA 4Q4X1 4XAEA 3ZMOA 2LW8A 1OSGA 4CEYA 2P4EA 2XQRA 2AENA 2Y6HA 3IKWA 4XDPA 2R1DA 2Q8DA 1MS1A 4UW6A 2XOMA 1CX4A 2VM9A 3NV3A 1UN1A 4MGKE 1C5HA 1AZDA 3U4XA 3WNMA 1NA1C 1K12A 4LIVA 1HJFA 4QPGB 1OQ1A 1LECA 1OVSA 1TMF1 2JWPA 4HONA 5FMCA 2ZACA 3EJKA 2IXJA 4E2QA 1AR93 4LO8A 5GLZA 3ZN6B 4BDVB 2KXLA 3ZYRA 4JKKA 1H8TB 4NR1A 2Y6LA 2H6CA 4P9GA 2O0OA 4QGMA 4FFIA 1UAIA 1CQ9A 1SLTA 1OD3A 2Y6JA 3WHUA 2R072 2ZMKA 5B4XA 1HQNA 3WF2A 1UZWA 4LBQD 4Z1VA 5C3QA 4IV3A 5AC92 1V9U2 1Y9QA 5LASA 3UJQA 1XYPA 3KV5A 1SLIA 1U5YA 2C26A 2Y33A 3I3DA 3RSJA 5A32B 1RINA 4EN0A 1S0FA 1TME1 1GV9A 2HWE2 4CUBA 4LULA 1QXJA 1NZIA 2Z79A 3HAGA 3TEYA 1R082 4YVSC 1OURA 4QXKA 1BMV2 2R49A 4NRMA 1X7NA 1RXFA 2RJKA 4HOOA 2QTWB 5A7OA 3AMQA 3VBOB 1RUD3 2PHWA 2D6PA 1IHMA 1RUC3 1W8OA 1RTVA 1XNBA 2DU0A 4S2GA 3IWZA 4OZXA 4XIOA 4NWVA 3PVEA 3JB4C 4JGZC 1HV0A 2P3YA 4GWJA 4AGRA 2V4AA 2A6ZA 2ZGSA 3DCQA 1PO12 2I2SA 1I1EA 1W8FA 1RUJ1 4BQ5A 2C6SA 4XJZA 4ZZ8A 5IATA 3L2YA 5FPBA 4EV0A 1PNGA 3AYDA 2E53A 3CU7A 4GH4B 3IBMA 4LLFA 5EYYA 4AFBA 2E32A 3MYXA 4D6SA 1MQTC 2QFEA 2V5YA 1CAVB 1RUG2 5C70A 2WA3A 4ZXKA 1QOOA 1GQHA 4HSJA 1GR3A 2JG8B 3M3EA 4ES9A 3ZYFA 3S6PA 2VCBA 2XG3A 3WP4A 4B1LA 5FLIA 4GMP3 5L9BA 5IFTA 2IVJA 3MI8A 5H9PA 1QJX3 2A6XA 5HV4A 5I8YA 1EAH2 2EF6A 4P9IA 5I93A 2W1QA 2UU8A 4HK8A 4NAOA 1JU4A 1OFNA 3V0AB 1ULFA 2YGLA 3RYRA 2JDYA 3NNJA 2X5IB 4H55A 2DTWA 3WNXA 3E6BA 3I2FA 2XJSA 2YU1A 1JYXA 3RVHA 1WW7A 4NPRA 5CIRA 3MLKA 2DCZA 1UD1A 3O0WA 1RUF2 5G04L 2ARAA 2Q4SA 4AVTA 1AR62 1LOFC 5KXCA 3TEWA 4V1PA 2Y0OA 3DF0A 1W8ZA 3POYA 3B3QE 2W39A 3GZTB 3NRUA 1H1MA 3POEA 4Q4W1 2B9UA 3ALQA 2XDVA 2DURA 4Q4Y3 4A41A 2CL2A 3FLRA 1JYCA 5D2AA 1UMZA 2RS31 2D44A 2QQJA 2WZEA 4IV1B 1F35A 3ZR5A 1V6MA 3NJVA 4YG0A 5GZDA 5FUIA 2W08A 5IVVA 3NJXA 3TNQA 3KQ4B 3ZYHA 1JXNA 3SLIA 3OEAA 5T5OA 2DVGA 5FP7A 4YZ1A 2XLGA 1LOBA 3O1RA 4J1WA 1GLHA 1FI2A 3BIWE 4AQTA 1AVBA 1R1A2 3WQBA 3GCXA 1DCSA 1IKPA 4N43C 4N53C 2XH6A 4JDMA 1A34A 1R092 1U5IA 2VNRA 2XGXA 3OGRA 4NIAA 1CIWA 2AC1A 5FZ7A 3QH6A 3ZLIA 1HN0A 1PIV3 2NZ9A 3OPZA 4N90A 3SISA 3KCYA 2D93A 3FUOA 1AX1A 4Z82A 1QJY2 1ALYA 2HEWF 1GBGA 2FD8A 4RS5A 3SXWA 4AI8A 1AL21 5BY5A 3WDWA 2JENA 2FQPA 4EE2A 1O4YA 1T2XA 2GC0A 4Q1PA 5KHJA 3RGBA 3TOJA 1COV1 2RS51 4HSLA 1OLME 2RS11 1IGOA 4RQPC 5JUVA 5D21A 4AI3A 4LOSA 2BBAA 2ORXA 3ZFGB 1VAVA 4TLFA 1VBA1 4CU6A 3UT0A 1XJAA 3AJYA 3M7AA 3VD3A 5DDJ3 2ENRA 1GZWB 2HWB1 2VULA 2PHXA 4I30A 5LBCA 2FDKA 2VZRA 4GB32 3VBUB 1W6NA 1VBC2 2W92A 3THTA 4AYUA 2XR4A 4SLIA 5F6LB 5EJ1B 2P6CA 2BWAA 2NMNA 4XMIA 2PYTA 2ETEA 3HEIA 3JBG2 4UFKA 5F3IA 1S0IA 2TNFA 1VBD1 2HEVF 4RR3B 4XTMA 5FK8A 4CDUB 2BOJA 4WVZA 2UWBA 5BXXA 3DPRB 1HQLA 1H2MA 4QPIB 4UOJA 4HZFA 1RVF2 1GP5A 2ZX2A 4I0WB 1GKBA 4KI5M 2WO3A 1HXS1 4CDQB 1SFYA 4OQ8A 1NY71 4PDWC 1O91A 2JDHA 4EN8B 1LHOA 1QJZA 2VBDA 5LBEA 1HQWA 4FOQA 3C3VA 1G6NA 3J8F3 4ITCA 1ASJ2 5FZKA 4CYDA 4MHUA 1UPSA 4Y20B 4UFJA 3O0XA 3OBRA 1ULCA 1UY3A 4PHZA 1YUDA 1TMF2 3GBGA 1OF4A 3OYWB 4JHZA 5JR2A 4JV4A 4EJRA 4AI9A 1RUI1 3FLTA 5C8CC 1AJKA 1D4M3 4FVVA 2WSUA 4V2WA 1STMA 5BNPB 3LPFA 5FZEA 1UYYA 4XF4A 4P9JA 2P3KA 3A7QA 2RDQA 2VO5A 2GNDA 4ZS2A 2YROA 3CKHA 4ONUA 2LS6A 3FBMA 5CNAA 2OUJA 4XFGA 4J25A 5K9YA 2DF7A 3VBHB 4QX7A 1ENSA 3MW4A 3GZEA 3VBRB 5CFCA 3I4IA 3I2KA 5FYBA 4XUNA 3ZIXA 3WG3A 4QXBA 3U07A 4NIHA 1JW6A 1PMJX 4O9EA 4Q4X3 5HCHA 5FZ1A 3POGA 2R16A 4RFRB 1ZZCA 5E1RA 1APNA 1Q8VA 2YXSA 5ANNA 1BBT3 5IAVA 3O1VA 3SMHA 2XLAA 1FYUA 4PI2A 5A33B 4IEVA 4K8RB 4HKWA 3HWJA 4Z2AA 1OQEA 5F5QA 4YVWA 5IVFA 4YWAA 2E31A 1MZ5A 1MZFA 5A3LA 1CAXB 1ZNPA 1D0GA 2EXIA 4XURA 1FMD2 2WUHA 3FN9A 5C3PA 1V6LA 1CZSA 2GNMA 1NCQB 2VUAA 2Y8KA 2KA3A 3JZVA 4D3WA 2DVBA 3H42B 1NXMA 5J7MA 5DAVA 4ZXEA 2VUJA 2RM21 1UOGA 1KS4A 2PHTA 5FZLA 3HQXA 3VBFA 1QU0A 2CAUA 2Q1FA 4P5HA 4QX8A 3UL2A 1AX2A 2G9ZA 4B3NA 2WT0A 1O5LA 2WNVC 5L7OA 2QE3A 3DECA 3VD7A 4LITA 1J59A 2QQKA 3NJYA 4GAZA 3WW2A 5LA1A 2OZJA 3ZYPA 4IEXA 2WS93 1OOPA 4YW3A 2D6LX 1CIYA 5IVYA 3ZXKA 1NAEA 2R043 1W2NA 3PNAA 4A2UA 1DLCA 5FZDA 1M4WA 4Y5Z0 2DUQA 1A3KA 2VCAA 3ZXJA 4CCEA 2FDGA 3E5XA 3BTXA 1ND3A 3FBYA 5JOYA 4AK3A 1FPN2 4XJ8A 1AR82 1ONAA 5GALA 3BB6A 1DQ6A 1HJGA 2UY8A 2PTMA 4XF1A 1JH5A 5GM0A 4NMIA 3MIDA 5IT6A 5FMOL 1J58A 4ARXA 1N3PA 5E16A 1US3A 2RS32 3BUCA 4QB6A 1LNSA 4HETA 2CDPA 5I0SA 5K0UC 1NLSA 2OPWA 1XU2A 4H2AA 4HFSA 3IDBB 5FP3A 2VE1A 2WWSA 3WOGA 3R05A 2V5DA 1W6PA 1W3VA 1X50A 1YFXA 3MLLA 3MO4A 3S5AA 1REEA 3C7GA 2D3SA 2RR12 3I59A 1YIFA 4FPJA 3BN6A 2HWF2 1JI6A 2X29A 1ENRA 3PU8A 4QX1A 3UKVA 1W9WA 3HT1A 5A70A 5FO9B 3W5NA 4RL7A 3LDBA 4INDA 4K6BA 2J7MA 2QVSB 2XUMA 1PGL2 1JUHA 1UIJA 3IDEA 3NV1A 4M3CE 4YM1A 1RIRA 2ET7A 4H3WA 4UW5A 3RG0A 3VDDC 3JQWA 1YJKA 4UXAA 3PUAA 5CFDB 1H0BA 5FIXA 3N9LA 5A1LA 2AREA 3SKVA 4JCKA 4BOWA 1OI6A 2MPFA 1QMJA 4PLNA 3X29B 1VMJA 4Q4W3 3KQRA 2YPJA 4URTA 1ZRFA 3NV2A 3PJQA 5IK4A 2MNGA 5FTTC 2W1SA 3NAPB 2ZTNA 1F9KA 4XZUG 3APBA 1F8VA 3LWCA 4MLOA 4DPNA 1EUTA 1K45A 2VGDA 4XJAA 1QHDA 4FOWA 1V70A 2BNOA 3E6DA 3KMHA 2PLV2 3WD5A 2WA4A 3JCIA 3BVCA 1ODNA 4JHTA 3LE0A 5EP9A 4IETA 5A7WA 2ZAHA 3SQOA 3T2TA 4XFIA 3HR9A 3ZXLA 4GWIA 5C71A 1RHI1 3OGJA 4GQ7A 3WDTA 2GNTA 2NQYA 4BISA 4K1YA 5I8TA 3KT7A 2PHUA 2QQWA 4LLOA 4F7ZA 1VRH1 5FBZA 1J3PA 4LNVA 2MEV3 3CLPA 2DVFA 3I3BA 1FNYA 1V6JA 4L92A 4P9LA 4YFZA 4LBKA 2OIIA 3KM5A 1AL23 4JTNA 5EZWA 1LENA 1I5PA 4MGZE 1VMFA 5DZEA 2QQVA 3IMMA 3ZN6A 4XABA 2BWCA 4MXVA 1XNCA 1OXCA 1COV3 2BV4A 2RS53 3POFA 4K40A 5FYYA 3PMEA 3N35A 1QKQA 1QJU3 1W6QB 2VNVA 4LUMA 1ZZ9A 1Y7BA 2JECA 1V6NA 2VECA 1PGW1 1RUI2 4Y1UA 5EJZB 3VZKA 3SH3A 2CWSA 4RGKA 1VBA3 1Z7S2 5JIAA 1XXNA 3AX4A 4IERA 4J6GA 2HWB3 3K2OA 2A3YA 2KD7A 2C0ZA 4IEOA 2VZ3A 3V64A 4Z2WA 3RFRA 1H9WA 5FOBB 4ZONA 1SBDA 4Y1YA 3K3NA 4RA0A 2HKXA 1YFWA 1UYZA 2VZTA 3WNNA 4YGCA 1VLNA 4LORA 3MUZ1 2YPDA 1XQNA 3ORJA 1QOSA 1HKDA 3LA3A 3HOBA 1REDA 3VBOA 1W39A 4X8NA 4CDWA 4XBLA 1OQDA 1W8HA 3EXUA 5T3NA 3CBNA 4KL1A 4DS0A 3B93A 4P14A 2BGPA 1HXS3 4QQOA 5DUUA 5FYZA 4I3GA 4XUQA 1YQCA 5FMBA 2GALA 2I07B 1J1TA 2YBKA 3NVCA 1O7FA 3UGHA 1IOAA 1KD7A 1K5MA 4JGYB 3D6EA 3RPQA 2EIDA 4HT1T 5FLJA 1TQ5A 2HH9A 4CUGA 1MS8A 3VBSB 3IIAA 1SDDB 3ZPOA 1PK6A 2OUHA 2ZGKA 5E88A 4OHVA 1CAVA 2ZEWA 4XJ9A 4UF0B 5L9RA 5JZGA 2NP0A 2YDEA 2K0GA 4XW3A 1UO9A 3WDUA 3HN1A 2TUNA 1RUC1 1HLCA 1OA4A 2JG8A 3ZSLA 3DYPA 2VXRA 4RHV1 3RYPA 4EWEA 1RUOA 1IPJA 4IEPA 1UU4A 1VE0A 1NT0A 2RM22 3KS7A 3TN92 4FOVA 4JKLA 3ZOIA 5IW0A 5C9AB 2ATFA 3O1OA 1LHNA 3E5QA 2WZR1 3EQEA 5D1IA 5T50A 3V0AA 4Q0UA 5GJ6A 4XJWA 5FY5A 4IV3C 3ITQA 2P2KA 2X5IA 3WW3A 4BQWA 2ZGNA 1XBFA 1HRV3 5F3GA 1QF3A 5K7PA 1UU6A 2GP5A 2JDPA 1XOYA 1GUIA 1ZBA2 3RZMA 3SNMA 2KR2A 3SHRA 1IPKA 2NM1A 2WFF1 4RFT0 2YV8A 2IXLA 5T5JA 3WCSA 5A6QA 3WP3A 3ACFA 4CRQA 5I0TA 2VVFA 2ZEZA 4FPKA 3RMYA 4GMP1 1URXA 3AZVA 3J7LA 3OSDA 3I2IA 4IV1A 1QJX1 3USSA 1UYXA 2IXIA 2VMDA 4AFAA 3WSOA 2AH2A 1E5RA 5A3TA 2WBKA 5FP9A 2F6BA 1ND2B 4DEQA 3M8LA 1LKNA 2HWC3 1EPZA 5M0TA 4D69A 2QQMA 4KBBA 2DUOA 4PQ9A 4QB2A 2XXZA 3AJZA 2J1AA 2VMHA 1GNYA 1HDKA 2F4LA 1RYYA 2ZKLA 2JJ6A 2G9FA 3PVBB 4BH9A 4DOUA 1MEC3 2CNAA 5A7QA 4NPMA 3KVAA 3AP4A 3JD71 2WAAA 1JN2P 1J83A 2BYVE 3M2MA 4S2FA 2E51A 1DQ1A 5I8SA 2RDRA 3MPBA 5L9VA 4LPLA 4A3XA 5LBBA 5A3PA 1GWKA 4GWNA 4CSWA 1PVXA 2FZ1A 2J1RA 3ON7A 2EXJA 4TZDA 4MGTA 5DAWA 4QPWA 1JOBA 2HBUA 1NQDA 3ST7A 3VL9A 4LKSA 1QNWA 3ZDSA 1HN1A 4CVUA 2IUWA 3SCHA 3Q8BA 4BLIA 3KV6A 3ZFGA 1UX7A 1UZ0A 2QZ2A 5LK7B 1LEDA 3VBFB 1U5ZA 1XNKA 1VJ2A 4KH9A 5C4WB 4HK9A 5JOWA 1NX9A 4XFCA 1D2QA 5C7GA 5E6HA 5D8AB 5CAZA 2OQ6A 2AEYA 4BXSV 3U0ZA 2R061 2EALA 4AQ6A 5FZIA 3V0BA 1PMHX 3B5LB 3KZ4C 4Q1RA 1GOHA 4K1ZA 4CTEA 5A6XA 1WCUA 2HBTA 2J1VA 2X10A 4RR3A 4XFFA 4BK5A 3OCPA 4KMQA 2OKXA 1B35B 2B46X 3WNKA 3DPRA 4QPIA 4AG4A 3AL6A 5DAPA 2VZVA 1N1YA 1RHI2 4FFFA 4CDQA 1DGRN 2JKBA 1B09A 4AE2A 4CXWA 4IL7A 4NRPA 3AZYA 5E8AA 4OMDA 5DDJ1 4HLTA 3VZJA 1AJOA 3DV8A 4GALA 4LK6A 5FZ3A 5LA2A 4Y20A 2HWD2 1WBLA 2WWJA 3I2GA 5FZCA 5FYMA 5JI7A 4D6RA 1DYOA 1CAUA 4YW5A 4PF5A 3CO2A 3OYWA 5LEJA 1ZYBA 3CIHA 4CXXA 3KGZA 3RZKA 1KXGA 5IWFA 5JSRA 2DBNA 4GJYA 1SHWB 3D0SA 1LOEA 4I0AA 4RS5C 3WXPA 4A3ZA 1A6CA 3DXTA 3T2QA 2BVVA 1DU3D 1KS5A 1PGSA 1UMIA 1GQPA 1RXGA 5DUVA 5LW9A 2BNNA 5JDBA 3VUOA 1O3QA 5FZOB 3LOBA 2Y6FA 2BQPA 1BEV1 1LGCA 4D6QA 4BXFA 1AUYA 2YC2A 4AOCA 3E6CC 4AWDA 2GMPA 1LHUA 1AXKA 3LF7A 3TEXA 5FDBA 1WD3A 3QBQA 1E57A 4XZPA 2J22A 5FUPA 1AR92 1OMIA 1WMEA 1UY2A 2NYYA 3NW4A 3OTFA 3ELNA 2VTFA 4P5YA 5HCAA 2EVXA 3I8TA 4UFMA 3SEPA 3O5SA 2WSVA 1MVEA 3CL1A 4QGNA 5A33A 2YFUA 5JVVA 4EROA 2CTVA 1W9SA 1CJDA 3E5UA 5J36A 2B4KA 1OPOA 1XYNA 2GDFA 1CAXA 1IS6A 4BMBA 2C24A 1PO21 2QQUA 4IE7A 4BK4A 2V72A 1NCQA 2BUKA 2JB8A 2YUEA 2E9QA 3NNGA 3WINE 5A3WA 2GH8A 2WR9A 1E5HA 2A75A 1RUD2 2VZ1A 2X8KA 4XF0A 1RUC2 4A4AA 1BBT1 1S0JA 1PNFA 2WZ8A 4XJUA 1QQP2 4UBGA 5TSWA 5LK5A 5CU1A 4AEDA 3VZNA 4MH0E 5HCBA 2I74A 3ZSJA 4OFGA 1VAMA 1QGLA 1W9FA 1ZVFA 2OVUA 2W95A 1G9CA 3OG2A 4QGLA 1S2BA 2Y6GA 1DZTA 3NL1A 4JVAA 2K2SA 1OUXA 4WVMA 4Y1VA 5EV7A 1F31A 3FX3A 1QXPA 1ZA4A 3FJSA 1GFF2 3W21A 3GF6A 1N47A 2XJPA 3AC0A 5AVPA 1GZCA 3M3QA 3VHPA 5CFCC 3D8CA 3NSTA 3PHMA 5J37A 3LEIA 2BJSA 5F8PA 3CMGA 2Y6KA 3I54A 3J9SA 2G1MA 3JXSA 1JHNA 2XHNA 1AYN1 1O59A 3O12A 5FY1A 5IK8A 1H6XA 3MICA 4MGYE 4XDOA 3J4UH 4BQYA 4Y1ZA 1WCKA 4L11A 1LHWA 3NMBA 5FPXA 3H8OA 4CE8A 4O61A 2WS91 2RV9A 4QXHA 4A7ZA 2R041 4XCBA 3ZXAC 4LKEA 2ZMLA 2OA2A 4I02A 4YVWC 5FZBA 4PDWB 4JDOA 4ATFA 5JSOA 2C9KA 3PURA 3HJRA 3WF3A 1QIQA 2B9VA 4CDWB 2RMU1 4YARA 4PIZA 4XBNA 2A7AA 4RHV3 4KQ7A 3MHZA 2BERA 2Z2SB 4XDQA 2GZWA 2RG4A 4YW7A 1G9AA 4DNYA 3ECQA 1FV2A 4OUEA 4YFWA 4FTEA 5A3NA 2WZR3 3ZSEA 4Q4Y2 1JZ8A 3USUA 1K5MB 4H14A 5AFBA 2JX9A 1W03A 4BMEA 4CDXB 2A1XA 3QH7A 4LTAA 4M3CF 4XQ4A 4XMAA 1QNYA 5L7OC 5CFDA 3N9NA 3FC0A 4WM8C 3O1TA 1PK6B 3GHMA 4EN6B 4ES8A 3ACIA 2AYHA 5JZGB 1G9DA 5CKNA 3OJBA 4XXPA 4XETA 1OOPC 2YZ4A 3BODA 2WFF3 2P1BA 4P9WA 2FMDA 2VCCA 3VB9A 3MZHA 2VTXA 2V4VA 1W04A 3DKWA 4ORFA 4Z8BA 1ZRDA 1OBNA 3IM0A 4HKLA 3I49A 2FDJA 5A3MA 4WM7C 1H4HA 5SV5A 4OI1A 3NAPA 2JDZA 1ND3C 4D8MA 1BVP1 3BU7A 1PIV2 3MFCA 2VNGA 4NROA 1YCIA 3LDKA 2XLFA 4I3PA 4CPBA 1XC6A 2CV6A 1V6OA 2WQZC 1POV1 2ZPXA 4P02B 1UU5A 4D94A 2AR6A 4Y1XA 4FTSA 1F5FA 4NHYA 3FL7A 1WCQA 4FPFA 4TSVA 4W8JA 2DU1A 5GLTA 5FY8A 1DQ4A 3KB5A 1A8DA 1RJ8A 4MGQA 2VH9A 3UV9A 3OD4A 4QX5A 3JD73 3MGUA 3RJ2X 2Q8OA 1BK0A 5HV0A 2VUDA 2OYZA 5DDJ2 2VOTA 1R083 2NMOA 4U36A 4YM0A 2YU2A 4CZSA 1AL0G 1PVC1 3O1MA 3V65A 4NOTA 5JIUA 3MW2A 3VGIA 4DXZA 5JXIA 1J84A 4LKFA 4HVOA 3FFQA 4UI9L 2YGMA 1EY2A 4KWUA 3PVNA 3SEEA 3LSDA 1W6QA 1YRZA 2PAEA 4Q0VA 3KT4A 3WG1A 2OW4A 4KGGA 4Y4RA 4Q8LA 4C0BA 2MEV1 3W58A 2UYBA 2R063 3M3CA 3BPZA 4AHXA 4G4FA 4BA6A 1SZBA 5FPUA 1L7LA 3D5OA 3J8F2 3HPNA 2G4IA 3B9CA 1JTZX 2IVIB 3RZLA 3IDAA 4NWWA 1V00A 1ULOA 3ZFFA 3DN7A 3CNAA 3ZFEB 1O3SA 1NOVA 3A0KA 3I3EA 1F4AA 1QJU1 1KDKA 2D97A 3AFGA 4OLLA 4X8PA 5HCFA 4XQDA 3WUDA 4Q8KA 2NPIA 1D4M2 4NVPA 1GP6A 4MGSA 4MXWB 1AYM1 5CZKA 5IFPA 4UW3A 3CQOA 2PAMA 1YYNA 3QD6A 2C4XA 4EWDA 5LA9A 3QCWA 4JGYA 4LO5B 5FWEA 3V0BB 4TXWA 5F1RA 2G9GA 4ET7A 3CJIB 1Y9GA 2XHKA 2E7QA 3T09A 5BV6A 3O1SA 4ZU4A 1ZBE2 3VBSA 1ZX5A 1C8NA 5FPLA 2GH2A 2MHFA 1BCXA 1C3HA 1AR63 2IXCA 4GMP0 4QPGC 4UF0A 3TNPB 1OFSA 4PBOA 3LEKA 5I0DA 1VBE1 1IS3A 1HV1A 2R6QA 3JU9A 3KHBA 4IE4A 1C5IA 1JODA 3VKMA 4CUAA 4Q4X2 1DGWA 2W2IA 4B4RA 3IMNA 3KHCA 1DFQA 4B1MA 2DCYA 3HNMA 1H8TC 1DIWA 1JU3A 4OYUA 4QT6A 1Z0HA 2VVEA 4FP2A 5C9AA 1BBT2 2ZAAA 3W9AA 4GJZA 1BEV3 3ZPYA 4CU7A 4M01A 5FPVA 4WZFA 1F5JA 3ZYGA 4HVRA 3IB3A 2HEYF 1SBFA 5JOXA 5DAXA 5F5AA 5A7PA 4FQ4A 4YGDA 1CAUB 5H9QA 4JQRA 1IKQA 3MV01 4L0PA 2VZUA 3DUIA 4ZKTB 2ZGRA 5EFUA 4FTBA 1HB3A 4Z07A 4QDRA 4DIQA 3VBOC 1H1IA 1SFPA 1UQXA 2W1WA 1VB4A 2D98A 2E33A 3LIGA 2ZA9A 1VPHA 3F95A 1JZ3A 3FUQA 2CDOA 4K9SA 5IK7A 1CPNA 2ZGOA 4PIXA 3GM8A 2H0BA 3ETQA 2VQUA 1ND2A 2W94A 2XL9A 1FX5A 1PO23 2BVBA 3U11A 1TME2 1HRV1 4XEZA 3WF0A 2R042 2VU9A 2Q1ZB 4BJ0A 3B00A 1DGRA 1JS9A 2Y60A 4ASLA 4QQPA 5LCWL 3AMNA 3MV11 1NA1A 5H9RA 4W6YA 3WG2A 4GH4C 2IWGB 3UK9A 5ACA3 5BUVA 3ZVXA 5KR7A 2YC4A 2ARXA 5IK5A 4LBNA 4Y5SA 3CDZB 2JG8C 1W2OA 3ZYBA 2WQ8A 1MS3A 3HBZA 3HVDA 2D6MA 3JBG3 4OI2A 2HYXA 4LEJA 3PIGA 1RUJ2 1FT9A 4R4ZA 3AP6A 2HWC1 1WA4A 4UFIA 4Z92B 1EV11 4AFMA 1QDCA 4HVQA 1D4VB 1UKGA 3FHIB 3K46A 5FQ0B 4A6SA 4CCJA 4DXRA 4LIUA 4BQ2A 2X5IC 4W6XA 5CEHA 1N3QA 4GKYA 4XQWA 1MEC1 2WC2A 5BNNB 1QXRA 3BTAA 3P3PA 2XJRA 5C4WA 5HXMA 1HW5A 4AEDB 1SG3A 1AYN3 2Q8EA 2ET1A 2W0XA 5D8AA 4QKDA 1HRI1 4LOTA 4COWA 1L7RA 1RC6A 3H3LA 3ENRA 2E26A 5FYUA 4E8CA 2R32A 3E97A 4WVMB 4CXYA 4H7MA 1OVPA 2DBIA 2QNKA 3PLQA 2OS2A 4IV1C 4JGZA 1KEXA 3HBKA 1B35A 1RITA 2VOXA 2P17A 1WA6X 2C1FA 2RMU3 3GXUA 1IG3A 2JE9A 2R30A 3HQRA 3VHNA 1LAJA 5C5UA 3EMRA 4LQRA 4AHYA 4DINB 5FY4A 4KWKA 3A21A 1JOJA 2UURA 4Q4W2 2ZGPA 5JLVA 4ZHNA 1MQTA 1XNTA 1RUH3 5FXVA 4M00A 4QDQA 3ZKUA 3AXDA 5IVCA 1O4ZA 2CGPA 1LU2A 1G7YA 2Y26A 4GULA 4XUPA 1ENXA 1W06A 1UY0A 3BALA 4XACA 5JMCA 3VD4A 3MLJA 2CGOA 4MADA 1RMU1 3URFA 2Y0IA 3POBA 1WW4A 1GSLA 4LMFA 4OMCA 3O7OA 1H2LA 4L8QA 1EP0A 2IC1A 2I45A 1DDLA 3MUY1 3CZUA 2FCUA 2G19A 4FPCA 4YGBA 2FMYA 5FZOA 1MR5A 2JG9B 1ZZ6A 3WV6A 4AHWA 4MG2A 1DQ2A 2W3JA 3OOXA 1XB9A 2CGNA 1C8M1 4O7XA 1G8WA 3TBDA 5DMYA 3OB8A 3ZFGC 4URAA 4IE6A 1K5JA 2MEV2 2ORZA 1GQGA 1YQ6A 2H6BA 4QXCA 4PIYA 4N8MA 1W90A 1LOFA 4P9XA 3USUB 2XQXA 1NYWA 1MVQA 5FCCA 1QEXA 2DYCA 2JIGA 3J26N 1POV3 4NAMA 4XE9A 4XUOA 1AL22 2W9XA 3RI9A 3VBUC 5FZFA 3T0DA 2B39A 2WNUB 3M70A 3DL3A 4IW3A 1TVGA 4AL9A 3GZAA 3KCXA 1L3JA 1COV2 2RS52 2ZBJA 3RRDA 3ZFFB 4AHZA 2RS12 3LA2A 1Q8SA 1W0PA 1QJU2 2YYOA 4CDUC 4RR3C 3BCWA 2A6WA 5LEKA 3D0JA 3KLSA 3H8RA 1O8PA 3DPRC 4QPIC 3H8XA 1VBA2 2C5DA 1S0GA 4Y4YA 4QX2A 1MS5A 1R64A 2HWB2 2P34A 3WP5A 5F3CA 4CDQC 1SQ4A 3BIEA 3AYAA 2ZHKA 1PVC3 1RL3A 1UY1A 1S0BA 4QU2A 5F32A 4DEVA 1M06G 1XSQA 3OY8B 4BIOA 2ZHNA 2BBVA 3TEZA 1LOGA 4FBFA 5LWBA 1FPN3 4YPJA 1VBD2 2ZGLA 3TYJA 2YG0A 3WF1A 4K20A 2JIJA 2R7EB 3GYDA 3SITA 4BZ4A 4QX0A 2Y64A 5FR3A 4JRAA 2D6KA 1CONA 1YC61 1HXS2 2BFUS 4LHNA 1PZ9A 3LQCA 5FOJB 1NY72 5BNPC 5KBFA 4BQ4A 2BU9A 3RMXA 1Y9MA 3K77A 1YHFA 3K3OA 1W2TA 4QHBA 5LB6A 1NQJA 4XIKA 5BNOB 3WLUA 2O14A 5LZ6A 3I7DA 3R0RA 4LO4B 4OHYA 1BVVA 2FCTA 4XILA 4CEWB 1JBCA 1NZCA 3LEGA 5F2SA 3JQXA 3WX5A 3BU0A 2EXHA 2ZCWA 1C57A 2WLPA 3O1UA 3GJAA 4QDSA 3VBHC 5KWRA 3VBRC 2VMCA 2QQPA 1QJFA 2DV9A 2HWF3 4NIIA 4GA9A 1AYM3 2B8MA 3GALA 3VL8A 4YNIA 4E4ZA 1SACA 2RJLA 4CU8A 3OGVA 1ULGA 2ARBA 4NHMA 1DYPA 2VOWA 1H8VA 4YG6A 1AXZA 1F15A 1S4CA 4XFBA 3VKNA 4LT5A 5ABJB 1W6MB 3W5MA 1ZZ8A 3AZZA 3ZXDA 4COYA 3AM2A 1CAWB 1EYBA 2XBO1 1R1ZA 2FZ2A 5CISA 4TWTA 4PDWA 1JYVA 2R0FA 3MIEA 3N9OA 1VBE3 1VBB1 2ZKNA 3N7JA 3ZMNA 2GNBA 2VMEA 4FAGA 2PFWA 5DZFA 2RDSA 3BGAA 4TYSA 5FY9A 1S0DA 1POV0 2E7AA 4AW7A 2OZ6A 3IZOA 4PLOA 4HBNA 4COVA 5F9TA 3AKSA 1LODA 2RE9A 3J7NA 1VR3A 4CEYC 1DBNA 4LBMA 3THCA 1F2NA 5C8CA 3SCFA 2HYKA 2DTYA 4LHSA 4OULA 4CDXA 1SBEA 4P08A 2UYAA 2XKPA 5L73A 2RHPA 3S5QA 2RJ2A 4RSUA 1JYIA 4DXTA 5HPOA 2HWC2 3H8UA 3RZJA 4G3YC 2D6OX 5LY2A
chains in the Genus database with same CATH topology
1I3HA 4HKOA 1NCRB 1YNAA 4FP3A 2D43A 1MEC2 3AXEA 1X82A 5J09A 1LOAA 1YWKA 3RWNA 4DRRA 3WZ1A 2JE7A 4C1XA 1LR5A 1W2UA 4WZCA 2DFBA 2W52A 3VZLA 4E9KA 5GZGA 4SBVA 2Z42A 2ILMA 1VALA 4KG0A 1RUE3 3KSCA 2A3XA 2VPVA 2WL1A 1VB2A 3POWA 3S0MA 4HANA 2CYFA 2ZABA 4LE4A 4C91A 2VNOA 3THPA 1SCRA 4XHXA 5SV8A 2ZX3A 3ES1A 2X53S 4LO7A 4QQLA 5EXOA 4OUMA 4LE3A 1EV13 2N7GA 4B29A 3NKGA 2DWRA 2O1QA 1TNRA 4N9IA 4FPYA 1NA1B 2R1BA 2A70A 5AC91 5CFDC 4FXKB 1G9FA 1SLCA 1TEIA 5JSPA 1LTEA 4BM8A 1NLRA 2HWE1 4YZ2A 3RYKA 1HRI3 3RZZA 1NE6A 1R081 4N7IA 5I91A 1HIXA 3K51A 1BMV1 4ZU7A 4WV8A 3AKPA 2NLRA 1S55A 5T55A 3WP6A 4PLMA 5CBLA 3NAPC 3ZFEA 2P3JA 1RUNA 1LGBA 1UZZA 3CEWA 1KFUL 3MIGA 5FO8B 4MXWA 3AYCA 1PO11 2A6VA 4ATEA 1C1LA 4YVSB 4R9BA 1FNZA 2V73A 3ZX7A 2ZX1A 5K0UA 2V09A 4YM2A 1D2SA 2XL7A 1N1TA 3CJIA 4AQSA 1WD4A 3D4KA 1A78A 1RMU3 1RUG1 2O8OA 3H50A 4JGZB 3AKQA 3B7MA 1U5XA 4B4PA 1U0AA 4HN1A 4KGQA 2K9ZA 4XOGA 1IZ3A 4COZA 2W68A 1CVNA 2PHLA 3IN9A 4PJYA 3QACA 3B94A 1EAH1 5JPNB 2XWBB 1VRH2 4FT8A 1C8M3 3FE5A 3ZXEA 1DHKB 1MQTB 4E2SA 3ROUA 5KXBA 2EAKA 1O4TA 4MYEA 1KFXL 1RUF1 1FOD3 1AR61 1H4GA 4G9SB 4QQHA 4BQ1A 1IS5A 4KNCA 4DY3A 1XU1A 4HMZA 1UKRA 3MFAA 3M1HA 4F8AA 1SMVA 2QKDA 4X6QB 4LUKA 3H9AA 1WLCA 4BYYA 1PGW2 3GZUC 3BOWA 1ULEA 4Q4V3 4XYXA 4YGEA 1PZ8A 2WFPA 4XTPA 3ZXGA 4ASMB 4CP2A 1X8EA 2JEMA 4Q2FA 1XE7A 3MF9A 4BE3A 4F83A 2A3WA 5FFOC 2DVAA 4DFSA 3N3HA 1H30A 3LGRA 1R1A1 2PHDA 3MW3A 4YM3A 4WBBA 4JGYC 2BNMA 4JDNA 1R091 3ZSMA 3WW1A 3P3NA 3KT1A 2D40A 4NHLA 4O9GA 3VBSC 1SFNA 1WBFA 2XJQA 1QH6A 1QJY1 4JRLA 2A71A 2DVDA 4XF9A 5J98B 4IEQA 5C9AC 3WQ7A 4N43B 4N53B 3WHTA 4A7KA 5GKAC 5C33A 5FQ0A 3MIBA 3NV4A 3B69A 4IXLA 4KWJA 4OHWA 5BNNA 5C8WA 3QOPA 5ACA1 1N3OA 2Q0AA 4GB31 4RHV2 2B45X 4LBOA 2JXAA 4Q27A 3JBG1 5CG9A 4RQPB 2WZR2 1C1FA 2TBVA 4MSVA 2XBO3 5KC5A 1RVF1 5K8SA 1ND2C 1VBB3 2BTVC 3SH4A 4AEMA 2ZHLA 2WFF2 4LA2A 5JPMB 3H1WA 5DG2A 1ASJ1 4I01A 1SLLA 1LB2A 3FLPA 3TWIA 1RB8G 1GNZA 1EPWA 2R0HA 1QJX2 3TAYA 2IXHA 5BYNA 3WR0A 2B7YA 2YHJA 4Q0SA 1PHMA 1TNFA 3IPVA 4BCUA 4B4QA 1I6XA 3ZIWA 4LO6B 1BJQA 5FRAA 2IFRA 1REFA 4GIQA 4META 4AEJA 3ZO0B 1AR73 4YZ3A 2JG9A 1O3TA 1ULDA 1CGPA 4AXOA 1LOCA 1V6IA 3JD72 1RUH1 1XNDA 2BPA2 2JICA 3VBFC 5C8CB 5C4WC 5CVRA 5D8AC 2BW8A 3V56A 1H1AA 2WNUA 2NN8A 4NO4A 1CD3G 4OHXA 1G86A 1QQP3 2WJSA 5IUQA 1OLQA 1B35C 4BHPA 2ERFA 2KM2A 3Q9OA 5F6KA 2GN3A 3NWKA 2SLIA 5FREA 4N7UA 4B7EA 1UF2C 2XVLA 1FMD1 2R062 4IESA 1ZZBA 3VV1A 5GZFA 1W6OA 4DQAA 3OY8A 4M3CB 3D82A 1DQ0A 1OA2A 4MX3A 2WQ4A 2R073 4LBJA 1UX6A 1VAKA 2AUYA 5AC93 1V9U3 1S0CA 5J96B 1WW5A 4CP0A 2WT2A 2ZZQA 3AZWA 3MF6A 3WDXA 2ES3A 4EN9B 2HWE3 5CA6A 2QZ3A 4YW1A 4Y26A 1N1VA 1OHFA 5BNOA 2VOKA 5FLHA 5HBAA 1XE8A 1Q8QA 5HXVA 4CEWA 5DUXA 5CG8A 1FPN1 2TEPA 1AR81 4OUSA 1YI7A 2WNVB 3CF6E 2PHFA 4HPKA 1WW6A 1PO13 4HN0A 2WLQA 3AMHA 2FHRA 5AFEA 1OD5A 2BGCA 1Q8PA 2PHRA 1MS4A 2D3RA 2VMGA 2ZJCA 1GYKA 3ATGA 4LHLA 3NKTA 4AI0A 1W6MA 5ABJA 1MACA 1S2KA 1BEV2 1CAWA 1FATA 3MIHA 1PM7A 4XFAA 2AZ5A 1RUG3 3ZN5A 1X8MA 1BZWA 4IQPA 3H3UA 4DB5A 4AVSA 2RR11 3OGGA 5KHHA 3U10A 2DCTA 2HWF1 2ZMNA 5JCTA 4JAAA 1Y3TA 1EAH3 2LM3A 3RJRA 1DZQA 2OPKA 3OD0A 4UW4A 4AI1A 2B5HA 1PGL1 5K0UB 3HMYA 3N7KA 4HL0A 1J3QA 4JTOA 2ZS6B 4LBQB 3WY6A 1RUF3 2ZOEB 1PO22 1WCSA 4AEKA 3H3ZA 3SH5A 4L99A 4BWOA 5FPZA 3N7LA 3IDCB 4L97A 1NCRA 4D7YA 4OI4A 2AGSA 1X36A 1VP6A 4AF9A 3UKNA 5HI0A 5ACA2 1AHSA 2D7FA 5KXDA 1IQAA 4D7TA 3VDDB 4F3JA 4R4XA 2PLV1 3WW4A 4XPVA 5JI9A 1R1A3 3G6JB 1NG0A 1DG6A 4FPGA 5DUWA 1R093 3G7DA 1X33A 2VY0A 4GXLA 3N36A 3WVJA 5EYXA 1LHVA 2VMIA 4FAGA 1CESA 2ZGUA 1WCDJ 2IFWA 4R52A 3ZYJB 5KC6A 4K7JA 1QJY3 5LRRA 4CDWC 1GZ9A 1G9BA 5CADA 2QUOA 5C6CA 1KRIA 1AYN2 2E63A 5T5LA 1QH7A 3R6SA 3FFZA 2WZPP 4XHBA 2WS92 4YLZA 4MUVA 1K5MC 1VIWB 3ZSKA 4CDXC 4FPHA 1NXD1 1Z7S1 1AXYA 1RUE1 1FXZA 1PK6C 1SLBA 2RMU2 4GB33 5JZGC 3O14A 2ZGQA 2QDNA 5CB7A 4XBQA 1VBC3 4Y22A 3VN4A 1GNHA 1BK1A 1ZZ7A 3M3IA 4XXAA 3MDPA 1ZBE3 3S30A 5DG1A 5FO7B 3ASIA 1RUH2 5KHGA 2HJIA 4WVVA 2XVGA 1WMFA 3PTYA 3AK0A 4D7SA 1QWRA 1KQRA 3LAGA 1RVF3 1GICA 1KJLA 3KCCA 4FQZA 5LRSA 3N4MA 3A0NA 3A4UA 4IEZA 2XJTA 3RS6A 3S7EA 1WLWA 5FMOS 3ZXFA 4FO9A 4EWAA 2PA7A 3H7YA 3ME2A 4KU8A 4I0BA 4YVSA 1ASJ3 2DCKA 1FAYA 1SCSA 1TMF3 3RI8A 3VZOA 4I09A 1DQ5A 3GHNA 3RNSA 2Z5WA 3C2UA 1YIPA 2XVKA 3WG4A 1AX0A 3EHKA 4AFDA 5I0RA 4CEYB 4R9AA 3TN91 2XPJA 3JUUA 4QM8A 3ILNA 3TRSB 3PJYA 4WM8A 2Q1MA 3AMPA 2LUWA 1TME3 2ZHMA 4Q0PA 1SDWA 5BNQA 1O5UA 1XYOA 2UY9A 1ZBA1 2YMZA 1PVC2 3DGTA 3AZXA 3WQ1A 3JB8A 3IPVB 2QCSB 5GLUA 4MVTA 4U2AA 4WM7A 3WT3A 4LA3A 4OI0A 3CJXA 2E6VA 4L2NA 1BKZA 3POSA 1CJPA 3GNEA 3ZFEC 2GC2A 4IV3B 1OPMA 1MZ6A 1H2KA 1DGLA 1LESA 1Q56A 3LSEA 1RUJ3 3VKLA 1XRUA 4QD2A 1FMD3 4X6RB 3AP5A 3VHRA 5EJ3A 2GMMA 1FOD1 3H7JA 3WDVA 2A5ZA 4C1WA 1KJRA 2FBEA 3AKTA 3CJIC 3KGLA 3RQ0A 1Q43A 1UCXA 2XKOA 1ENQA 4FCAA 1N1SA 3VZMA 2VVDA 1AYM2 4Q4V1 4KWLA 1LULA 4BPZA 4M0HA 1NE4A 2IXKA 4IEWA 3AB0A 4N9HA 3WUCA 2WKKA 2WT1A 2UWCA 4N43A 4N53A 3LB9A 4LBLA 2VQAA 4QPYA 1W6OB 1WLDA 3GBWA 3H1YA 1S0EA 4UBHA 2DCJA 3KD4A 1AR83 3UKTA 5GLVA 1C28A 1VBE2 2YC0A 1J3RA 3LKJA 5GLWA 1V6KA 1DF0A 5B2GB 2RS33 2Z69A 2E7TA 4R8HA 4QMAA 5BPXA 3AP7A 4RQPA 3NO8A 4MGIE 4IEYA 4Q29A 4GKXA 1CR7A 3FZ3A 4IEUA 2Q30A 2VW2A 2VW0A 1PZ7A 2PAKA 2RR13 1C4RA 1Z78A 2EIGA 2GN7A 3LOIA 4HPKB 4OHZA 5J3UA 1U12A 2VOVA 2HWD1 4AGVA 4YSFA 4QPGA 5J48A 4C90A 2XJUA 4H7LA 4P9YA 2D5FA 3B01A 2DFCA 3HIFA 1J1LA 1H8TA 1DYKA 4AFCA 5H9SA 1WMDA 1HRV2 2RS13 1CN1A 3L9JT 1LJ7A 1YFUA 1H9PA 3PMSA 4AQ2A 5KXEA 3B02A 4DMIA 4WVWA 1NCQC 4RGGA 1RUE2 1ZM1A 2DUPA 3AFKA 5A32A 4YYOA 4E4SA 1UL9A 4KU7A 5BNNC 4MZUA 2IZWA 2PLV3 3AKRA 4RS5B 2P3IA 3N7MA 4AEDC 2BFUL 4W65A 1AR91 4XFHA 5I0UA 4B7KA 5L19A 1VBD3 3ZYIB 3FWEA 2QDRA 3LCPA 1EV12 4S2DA 3LA7A 2P37A 4CP1A 1T6GC 1AR71 2O8QA 4YZ4A 4Y24A 1JUIA 2VQ0A 4J1XA 1WLTA 1W6NB 5KHIA 1GANA 4DY5A 1OKQA 1HRI2 4R9CA 4GH4A 2F4PA 1S1AA 5EWSA 1YO8A 4M3CA 4R9DA 3HD8B 1RUI3 3PVOA 1D0HA 4QQ2A 1RUD1 3MEPA 5DXDA 4FXGB 4KG8A 3MPPG 2YY1A 4AVBA 5JR7B 1Q3EA 1Z7S3 3U4XA 3R4UA 3IT8A 1KDMA 1QQP1 2GSYA 1Q5OA 2D3PA 3R4SA 1QDOA 4ISQA 3LZZA 1YFYA 3NJZA 1UW8A 1H2NA 3ACLA 3OF1A 4EN7B 2JG9C 1LRHA 1Q8OA 2B42B 3BOPA 1YXWA 3ZIXA 1LCLA 1DGWX 3VKFC 1W0OA 4YRDA 1PMIA 1DZRA 1BXHA 3L2HA 2R071 5L36A 1RMU2 2WNVA 2PN5A 3WQ0A 4PCRA 1V9U1 1YLLA 4JC1A 1UZYA 2WNUC 4DZGA 1MZEA 1MS9A 2JD4A 3ZFFC 3OBTA 4Y22B 3VKOA 1C8M2 4I2OA 1YJLA 2VW1A 2ZZJA 5CFCB 2LTNA 3B9IA 3TB0A 1WGPA 2GAUA 1FOD2 2BEOA 5JSOA 2Q5TA 2A73B 2EAAA 3WCRA 2Y38A 2RM23 3QLQA 3RDIA 3SCGA 3TN93 4QM9A 4FAHA 4YW2A 2C9AA 4MV2A 1YI9A 3M4FA 2SBAA 4M0NA 4Q4Y1 2WIIB 2GC1A 1RGSA 4Q4V2 4YVWB 5T5PA 1ZRCA 4LBQA 1BQPA 1ZBA3 3O0VA 4DRVA 4AVVA 2LALA 2XB6C 5BNOC 1KITA 4RD7A 1LU1A 4ZU5A 1ZREA 5JOZA 4W6WA 4CEWC 1CPMA 1I9RA 1GZWA 4YZ5A 2WNEA 3R4DB 2GMEA 1PIV1 2EA7A 5T54A 3VBUA 3VDDA 2ZX4A 4K8FA 5L7OB 4WM8B 2PQQA 4OVEA 4E4DX 2CWMA 3I2DA 1OOPB 4Q26A 3MIFA 4CDUA 5E89A 2QJVA 4S2HA 5ABJC 3H1MA 3WDYA 4XF3A 3ILRA 4L9BA 1ZRRA 4WM7B 1Y43B 1ND3B 3EO6A 1IS4A 2A6YA 4FPLA 4AVCA 3T1MA 4LHKA 1UPIA 1QOTA 4YW4A 1QY4A 4AGGA 1I5ZA 3ILFA 4RGAA 5KHKA 3HT2A 2ZGMA 1DLLA 1LGNA 2ZGTA 2XWJB 4PBPA 4COUA 2ZX0A 3AYEA 3FMGA 2XBO2 5FAXA 4YG3A 5BNPA 1BYHA 4AVAA 5GZEA 4Q0QA 1W6PB 1VBB2 5DZGA 4FOYA 3I59B 5GZCA 3J8F1 1WUVA 1NCRC 2VG9A 3W59A 3ZN4A 3GBFA 2PELA 2CY6A 4FPOB 2CAVA 3VBHA 2XJVA 3VHOA 3VBRA 4ISRA 1A8MA 1HX6A 1UIKA 3AP9A 4B8EA 2EXKA 1TE1B 3T1LA 4FPEA 1OLRA 3M3OA 3UJOA 1RHI3 1D4M1 1O3RA 1RJ7A 4BLJA 4E2GA 1AF9A 1MS0A 1OA3A 2H0VA 1VRH3 4K21A 4K3UA 1LEMA 3VLBB 1AR72 2HWD3 5JAXA 1VBC1 5T52A 3ES4A 2D6NA 1SEFA 3K48A 4GWMA 4NN0A 3EBRA 1ZBE1 3AMMA 2WINB 4LR4A 5AVAA 2GU9A 3H0OA 1SLAA 2GC3A 3INAA 2D5HA 4C0HA 4NHKA 2UWAA 5JWPA 1FV3A 4E27A 4BIFA 3S7IA 4AI2A 4FSJA 4Q4X1 3ZMOA 4CEYA 1OSGA 2AENA 3IKWA 2R1DA 1MS1A 4UW6A 1CX4A 3NV3A 1UN1A 4MGKE 1C5HA 1AZDA 1NA1C 4QPGB 1OQ1A 1LECA 1TMF1 2ZACA 3EJKA 2IXJA 4E2QA 1AR93 4LO8A 5GLZA 3ZN6B 2KXLA 3ZYRA 1H8TB 4NR1A 2H6CA 4P9GA 2O0OA 4QGMA 1UAIA 1CQ9A 1SLTA 3WHUA 2R072 2ZMKA 1HQNA 4LBQD 4Z1VA 4IV3A 5AC92 1V9U2 1Y9QA 3UJQA 1XYPA 1SLIA 1U5YA 3RSJA 5A32B 1RINA 4EN0A 1S0FA 1TME1 1GV9A 2HWE2 4LULA 1QXJA 2Z79A 3HAGA 1R082 4YVSC 4QXKA 1BMV2 2R49A 1X7NA 2RJKA 3AMQA 3VBOB 1RUD3 2PHWA 1IHMA 1RUC3 2D6PA 1RTVA 1XNBA 2DU0A 4S2GA 3IWZA 4OZXA 4XIOA 4NWVA 3PVEA 3JB4C 4JGZC 1HV0A 4AGRA 2A6ZA 2ZGSA 1PO12 2I2SA 1I1EA 1RUJ1 4XJZA 3L2YA 4EV0A 1PNGA 3AYDA 2E53A 3CU7A 4GH4B 3IBMA 4LLFA 5EYYA 4AFBA 3MYXA 1MQTC 2V5YA 2QFEA 1CAVB 1RUG2 2WA3A 4ZXKA 1QOOA 1GQHA 4HSJA 1GR3A 2JG8B 3M3EA 4ES9A 3S6PA 2XG3A 3WP4A 5FLIA 4GMP3 5H9PA 3MI8A 5I93A 1QJX3 2A6XA 5I8YA 1EAH2 2EF6A 4P9IA 2UU8A 4HK8A 1OFNA 3V0AB 1ULFA 2YGLA 3RYRA 2X5IB 4H55A 2DTWA 3WNXA 3E6BA 2XJSA 1WW7A 4NPRA 5CIRA 3MLKA 2DCZA 1UD1A 3O0WA 1RUF2 2Q4SA 4AVTA 1AR62 1LOFC 5KXCA 4V1PA 2Y0OA 3DF0A 3POYA 3B3QE 2W39A 3GZTB 1H1MA 4Q4W1 2B9UA 3ALQA 2DURA 4Q4Y3 2CL2A 3FLRA 1JYCA 1UMZA 2RS31 2D44A 4IV1B 1V6MA 4YG0A 5GZDA 2W08A 3TNQA 1JXNA 3SLIA 5T5OA 4YZ1A 2DVGA 2XLGA 1LOBA 4J1WA 1GLHA 1FI2A 3BIWE 4AQTA 1AVBA 1R1A2 1IKPA 4N43C 4N53C 2XH6A 4JDMA 1R092 1U5IA 2VNRA 2XGXA 1CIWA 3QH6A 2NZ9A 1PIV3 4N90A 3OPZA 3SISA 3KCYA 2D93A 3FUOA 1AX1A 4Z82A 1QJY2 1ALYA 2HEWF 1GBGA 4RS5A 3SXWA 4AI8A 1AL21 5BY5A 3WDWA 2JENA 2FQPA 1O4YA 2GC0A 4Q1PA 5KHJA 3TOJA 1COV1 2RS51 4HSLA 2RS11 1IGOA 4RQPC 4AI3A 3ZFGB 1VAVA 4TLFA 1VBA1 3AJYA 3M7AA 5DDJ3 2ENRA 1GZWB 2HWB1 2VULA 2PHXA 4I30A 4GB32 3VBUB 1W6NA 1VBC2 3THTA 4SLIA 5F6LB 2BWAA 2NMNA 4XMIA 2PYTA 2ETEA 3JBG2 1S0IA 2TNFA 1VBD1 2HEVF 4RR3B 4XTMA 4CDUB 4WVZA 2UWBA 5BXXA 3DPRB 1HQLA 1H2MA 4QPIB 4HZFA 1RVF2 2ZX2A 4I0WB 1GKBA 1HXS1 4CDQB 1SFYA 1NY71 4PDWC 1O91A 4EN8B 1LHOA 1QJZA 1HQWA 4FOQA 3C3VA 1G6NA 3J8F3 4ITCA 1ASJ2 4CYDA 4Y20B 1UPSA 3O0XA 3OBRA 1ULCA 1YUDA 1TMF2 3GBGA 3OYWB 4JV4A 4EJRA 1RUI1 3FLTA 5C8CC 1AJKA 1D4M3 4FVVA 2WSUA 5BNPB 4XF4A 4P9JA 2P3KA 2GNDA 2YROA 4ONUA 3FBMA 5CNAA 2OUJA 4XFGA 5K9YA 2DF7A 3VBHB 1ENSA 3MW4A 3VBRB 5CFCA 3I4IA 3WG3A 3U07A 1JW6A 4Q4X3 4O9EA 2R16A 5E1RA 1ZZCA 1APNA 1Q8VA 2YXSA 1BBT3 3SMHA 2XLAA 1FYUA 5A33B 4IEVA 4HKWA 3HWJA 1OQEA 5F5QA 4YVWA 1MZ5A 1MZFA 5A3LA 1CAXB 1ZNPA 1D0GA 2EXIA 1FMD2 1V6LA 2GNMA 1NCQB 2VUAA 2KA3A 3JZVA 4D3WA 2DVBA 1NXMA 5J7MA 2VUJA 2RM21 1KS4A 2PHTA 3HQXA 3VBFA 1QU0A 2CAUA 4P5HA 3UL2A 1AX2A 4B3NA 2WT0A 1O5LA 2WNVC 5L7OA 2QE3A 1J59A 3WW2A 2OZJA 3ZYPA 4IEXA 2WS93 1OOPA 4YW3A 2D6LX 3ZXKA 2R043 4A2UA 3PNAA 1M4WA 4Y5Z0 2DUQA 1A3KA 3ZXJA 3E5XA 1ND3A 3FBYA 5JOYA 4AK3A 1FPN2 4XJ8A 1AR82 1ONAA 5GALA 3BB6A 1DQ6A 4XF1A 2UY8A 2PTMA 1JH5A 5GM0A 3MIDA 5IT6A 5FMOL 1J58A 1N3PA 5E16A 2RS32 4HETA 5I0SA 5K0UC 1NLSA 1XU2A 4HFSA 3IDBB 2WWSA 3WOGA 3R05A 1W6PA 1X50A 1YFXA 3MLLA 1REEA 2D3SA 2RR12 3I59A 1YIFA 4FPJA 2HWF2 2X29A 1ENRA 3UKVA 5FO9B 3HT1A 4RL7A 4INDA 4K6BA 2XUMA 2QVSB 1PGL2 1JUHA 1UIJA 3IDEA 3NV1A 4M3CE 4YM1A 1RIRA 2ET7A 4H3WA 4UW5A 3RG0A 3VDDC 3JQWA 1YJKA 4UXAA 5CFDB 1H0BA 2AREA 4JCKA 4BOWA 1OI6A 2MPFA 1QMJA 4PLNA 3X29B 4Q4W3 3KQRA 2YPJA 4URTA 1ZRFA 3NV2A 3PJQA 5IK4A 2MNGA 5FTTC 3NAPB 2ZTNA 1F9KA 1F8VA 3APBA 3LWCA 4MLOA 4DPNA 2VGDA 4XJAA 1QHDA 4FOWA 1V70A 2BNOA 3E6DA 3KMHA 2PLV2 3WD5A 2WA4A 3JCIA 3ZXLA 4IETA 2ZAHA 3T2TA 4XFIA 3HR9A 1RHI1 3OGJA 4GQ7A 3WDTA 2GNTA 2NQYA 4K1YA 5I8TA 3KT7A 2PHUA 4LLOA 4F7ZA 1VRH1 5FBZA 1J3PA 4LNVA 2MEV3 3CLPA 2DVFA 1FNYA 1V6JA 4L92A 4P9LA 4YFZA 4LBKA 2OIIA 3KM5A 1AL23 4JTNA 5EZWA 1LENA 4MGZE 5DZEA 3ZN6A 2BWCA 4MXVA 1XNCA 1COV3 2RS53 4K40A 3PMEA 3N35A 1QKQA 1QJU3 1W6QB 4LUMA 1ZZ9A 1Y7BA 2JECA 1V6NA 2VECA 1PGW1 1RUI2 4Y1UA 3VZKA 3SH3A 2CWSA 1VBA3 1Z7S2 5JIAA 1XXNA 3AX4A 4IERA 4J6GA 2HWB3 2A3YA 4IEOA 2C0ZA 5FOBB 3V64A 4Z2WA 1H9WA 1SBDA 4Y1YA 4RA0A 2HKXA 1YFWA 4YGCA 1VLNA 1XQNA 1QOSA 1HKDA 3LA3A 3VBOA 1REDA 1W39A 4X8NA 4CDWA 4XBLA 1OQDA 3EXUA 5T3NA 4KL1A 4DS0A 3B93A 4P14A 1HXS3 4QQOA 5DUUA 4I3GA 2GALA 2I07B 1J1TA 3NVCA 1O7FA 1IOAA 1KD7A 1K5MA 4JGYB 3D6EA 3RPQA 4HT1T 5FLJA 1TQ5A 1MS8A 3VBSB 3IIAA 1PK6A 2OUHA 2ZGKA 5E88A 4OHVA 1CAVA 4XJ9A 2NP0A 5JZGA 2YDEA 2K0GA 4XW3A 3WDUA 3HN1A 2TUNA 1RUC1 1HLCA 1OA4A 2JG8A 3ZSLA 2VXRA 4RHV1 3RYPA 4EWEA 1RUOA 1IPJA 4IEPA 1UU4A 2RM22 3KS7A 3TN92 4FOVA 5C9AB 2ATFA 1LHNA 3E5QA 2WZR1 3EQEA 5D1IA 5T50A 3V0AA 4Q0UA 5GJ6A 4XJWA 4IV3C 3WW3A 2P2KA 2X5IA 2ZGNA 5K7PA 1HRV3 1QF3A 1UU6A 1ZBA2 3SNMA 3SHRA 1IPKA 2NM1A 2WFF1 4RFT0 2YV8A 2IXLA 5T5JA 3WCSA 3WP3A 4CRQA 5I0TA 2VVFA 4FPKA 3RMYA 4GMP1 1URXA 3AZVA 4IV1A 3USSA 1QJX1 2IXIA 4AFAA 2AH2A 2F6BA 1ND2B 3M8LA 1LKNA 2HWC3 1EPZA 4D69A 4KBBA 2DUOA 4PQ9A 3AJZA 2VMHA 1HDKA 2ZKLA 2JJ6A 2G9FA 3PVBB 4BH9A 4DOUA 1MEC3 2CNAA 3AP4A 3JD71 1JN2P 2BYVE 3M2MA 4S2FA 2E51A 1DQ1A 5I8SA 3MPBA 4A3XA 4GWNA 1PVXA 2FZ1A 4TZDA 2EXJA 1NQDA 3ST7A 3VL9A 1QNWA 3ZDSA 3SCHA 4BLIA 3ZFGA 2QZ2A 5LK7B 1LEDA 3VBFB 1U5ZA 1XNKA 1VJ2A 4KH9A 5C4WB 4HK9A 5JOWA 4XFCA 1D2QA 5D8AB 5CAZA 3U0ZA 3V0BA 2R061 2EALA 4AQ6A 3B5LB 3KZ4C 4Q1RA 4K1ZA 4CTEA 4RR3A 4XFFA 3OCPA 1B35B 2B46X 3DPRA 4QPIA 4AG4A 1N1YA 1RHI2 4CDQA 1DGRN 2JKBA 1B09A 4AE2A 4IL7A 3AZYA 5E8AA 5DDJ1 4HLTA 3VZJA 1AJOA 3DV8A 4GALA 4Y20A 2HWD2 1WBLA 5JI7A 4YW5A 1CAUA 4PF5A 3CO2A 3OYWA 5LEJA 1ZYBA 3KGZA 1KXGA 5JSRA 3D0SA 1LOEA 4I0AA 4RS5C 3WXPA 1A6CA 2BVVA 1DU3D 1KS5A 1PGSA 5DUVA 2BNNA 5JDBA 3VUOA 1O3QA 3LOBA 2BQPA 1BEV1 1LGCA 1AUYA 3E6CC 4AWDA 2GMPA 1LHUA 1AXKA 5FDBA 1WD3A 3QBQA 1E57A 4XZPA 1AR92 1OMIA 1WMEA 2NYYA 3NW4A 3OTFA 3ELNA 5HCAA 2EVXA 3I8TA 3O5SA 2WSVA 1MVEA 3CL1A 4QGNA 5A33A 5JVVA 4EROA 2CTVA 3E5UA 1CJDA 5J36A 1OPOA 1XYNA 2GDFA 1CAXA 1IS6A 4BMBA 1PO21 1NCQA 2BUKA 2YUEA 2E9QA 3WINE 2GH8A 2A75A 1RUD2 2X8KA 4XF0A 1RUC2 1BBT1 1S0JA 1PNFA 5TSWA 4XJUA 1QQP2 4UBGA 4AEDA 5LK5A 5CU1A 3VZNA 4MH0E 5HCBA 2I74A 3ZSJA 4OFGA 1VAMA 1QGLA 1ZVFA 2OVUA 1G9CA 4QGLA 1S2BA 3NL1A 1DZTA 4JVAA 4Y1VA 2K2SA 4WVMA 5EV7A 1F31A 3FX3A 1QXPA 1ZA4A 3FJSA 1GFF2 3GF6A 1N47A 2XJPA 5AVPA 1GZCA 3M3QA 3VHPA 5CFCC 3D8CA 3NSTA 3PHMA 5J37A