4R4XA

Structure of pngf-ii in c2 space group
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
546
structure length
544
Chain Sequence
AQTYEITYQNSFEGKINQNHIISITNSDKTLLFNEKIKNKKADFPFEVNEINRKNNEVSQFAFLNNNEIVKTSDNTILAKQEFKPTSETGKILGYNVKKAVTSVNSNTIEVWYTNDLKVKGGPSILGQDLGLVLKTVRNGSSVVEATSVKKIKALDDQSLFNGKNITEKDALTYKDMIWKSRFITIPVFENETINFSDASKSDQVIQRFGNGTIILKKVKIPEIKQGNTIFVELKQKSNGDAYDRTGDVFIIPQERAISYYTGLTQGVKSLPVYQNGNGKSYQGVALTPDYLPFIELMRFFTPFGIGHFNEKIQLKGKNWHNNTPYRQDITELRPQLSGKEILIGAFIGNYDKGGHQISLELSIHPDQQKIVNNNFVLPVFNTTNVMEMAGQDYPTMFNSDKGVEVDFILTKDLKNAQLRYITTGHGGWGAGDEFVPKENSIYLDGKLAHAFTPWRTDCGSYRLFNPASGNFEDGLSSSDLSRSNWCPGTITNPVYINLGNLNAGKHTIQVKIPQGAPEGSSQSFWNVSGVLLGQEHHHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PNGF-II
publication title Identification and Characterization of a Novel Prokaryotic Peptide: N-glycosidase from Elizabethkingia meningoseptica
rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
total genus 140
structure length 544
sequence length 546
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4xA03
2.60.120.1570 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4xA02
1PHMA 1YJLA 4E4ZA 3MIBA 1PGSA 3MIDA 3MICA 1YIPA 4R4XA 3MLLA 3PMSA 1PNGA 3MIEA 3MIGA 3MIHA 1PNFA 3MLKA 4R4ZA 1OPMA 1YI9A 3KS7A 3MLJA 3PHMA 1YJKA 3MIFA 1SDWA 4QHBA
chains in the Genus database with same CATH superfamily
5FUNA 5A3OA 4K40A 4UF0B 3QLQA 2JD9A 3FBMA 3VBFC 2CHHA 4LK6A 2RDNA 1W6OB 2AC1A 4P5HA 1CWPA 4TXWA 2RMU2 1O91A 2P3YA 4Q1PA 2ES3A 4AW7A 3OGSA 3ZXLA 3KM5A 5A7PA 2JIJA 3LZZA 4PQ9A 5IVVA 4K21A 3NJZA 4CDXB 4NRPA 2JEMA 1LU2A 1FPN2 1AXKA 1GR3A 2XJTA 2PFWA 3VKLA 1CN1A 4FQ4A 3ZSJA 5BNNC 4M01A 1JXNA 3EQEA 3IMMA 2VNOA 3P5BA 1JOPA 3K51A 3AC0A 4NIDA 2X29A 1LJ7A 3I3EA 2JDKA 2IWGB 4AL9A 3N7MA 3A0NA 4IL7A 1X33A 1RVF2 1RUD3 5C3PA 1SEFA 3FC0A 4XFAA 4U36A 2RS53 3NAPA 3ZN6A 1C4RA 3B93A 3LQCA 2VM9A 2EICA 1L7RA 1X9TA 5I0SA 3V0AB 4L0PA 3PMSA 2PYTA 2CYFA 1N3PA 4AEJA 2I45A 2V5DA 3OPTA 4XBLA 1W3XA 5JR7B 4B1LA 4AVTA 4KG0A 3THCA 5IK7A 5FZFA 4QHZA 1BLZA 1N1SA 1IG3A 1S0IA 5JOWA 3EBRA 3OPWA 5IWFA 2QDRA 2NPIA 4BISA 1FI2A 2AEZA 4QPGA 3VD5A 4GMP0 3THTA 5EJZB 1BXHA 4BK5A 4UFMA 1N1YA 5A32A 3NVCA 1OLRA 4P5YA 4MADA 1PO21 2WL1A 3THDA 1YQ8A 3L9JT 4Y1XA 3ZXJA 1XNCA 2YZ4A 4YW3A 1VBC3 2BNNA 3CU7A 2YC0A 1DYPA 2P4EA 3TEZA 2JDYA 2YPJA 4ONUA 1ZBA3 3U1XA 4AI1A 5BNQA 1J59A 3QOPA 3KVAA 3M7AA 4IEQA 3VBRA 4ZZ5A 2RDQA 2HWF3 3DF0A 5I0UA 1U0AA 4CU9A 4R9AA 5C4WC 3RZKA 1RUC1 3UNPA 2FDJA 1J3PA 1SHWB 1XPWA 2J1AA 4UW3A 2KA3A 3B00A 1TNFA 4S2FA 1S2KA 5KHIA 2VZQA 3TAYA 2CAVA 1XSQA 2PAMA 4BQYA 4CTEA 1KD7A 2ZX0A 1SLLA 1E5HA 4Y33A 1ZZCA 2NM1A 1UKGA 1JUHA 5HCHA 4CDWC 4CP2A 4E4SA 3EYPA 3WF0A 1AL23 2A3XA 3ZFEA 3LPGA 4L8QA 5FPLA 3LCPA 5FKBA 4UBGA 3MUY1 4QPGB 4QX1A 4PLOA 1XNTA 2E63A 1XYNA 3FLRA 4JKLA 1RXFA 2XPJA 1LESA 3IM0A 1IKQA 5A32B 4LPLA 1RINA 1WCKA 4WBBA 1PNFA 1RHI3 2JJ6A 4XABA 5LWBA 3J9SA 3K75B 4OCTA 2YBPA 1RUNA 2EVXA 1CQ9A 4YRDA 4CXXA 2EIDA 4MH0E 1IS6A 3VBRB 3GCXA 3TWIA 4CRQA 3K4ZA 4XHBA 2XB6C 4P9XA 1Q8VA 1HN1A 4YLZA 4UFJA 5DPNA 5T50A 4AVAA 2WQ8A 5DZGA 2ZGLA 2DV9A 2VOWA 3IB3A 3LKJA 3AKRA 3DKWA 1V6IA 1BBT3 3LF7A 2B45X 1ZA7A 4XFBA 4LUMA 3WXPA 4OHYA 4TLFA 2X5IC 4LO7A 3CL1A 2WYSA 3N9QA 1OH3A 1QJX2 2ZBJA 3I2FA 2NYYA 2A6XA 3ZFEB 4XVHA 3IBMA 4EYUA 4FAGA 2XKPA 1C5IA 2RMU3 2Q30A 1DQ5A 2WSUA 2VZRA 5FJKA 1UMZA 5A1AA 1NYWA 1REEA 5BV6A 1OF3A 4NRQA 1Z7S1 1NE6A 1FPN3 2YC4A 2P2KA 2VH9A 1JHJA 2HWB2 4XTMA 2RVAA 5A7QA 1XBFA 1UY3A 1OPOA 4CXWA 2VUDA 1UF2C 4LBNA 4BQWA 5C3QA 4BLJA 1QXPA 1RVF3 1ULOA 2ADEA 1XXNA 2QQPA 4AHYA 2KR2A 4EN8B 2P1BA 2ZEWA 1KQRA 5G04L 3ZKUA 3PMEA 5L9VA 4IDZA 3KF5A 2EF6A 4GMP3 3ZPYA 4Q26A 2DVAA 5A80A 1YFUA 1VBC1 1QGLA 2P5BA 3HQUA 1ZBA1 4F7ZA 4I2OA 3CJIC 3PJYA 3U4SA 2Q8CA 4DOUA 1AX1A 3OEAA 4GB31 3RMYA 5GLTA 5FPVA 3LEMA 3OYWA 4NAOA 5K8SA 1L7QA 1XJAA 2YC2A 1PGW2 3FHIB 3SEPA 1W06A 5F32A 3WQBA 1BJQA 3M8LA 1FMD1 5C5TA 1OD3A 4YPJA 3RNSA 1K12A 1ND2B 2W3JA 4ISRA 3WDVA 3DECA 2WSVA 4TYSA 1R092 1EP0A 1CVNA 4UAPA 4XILA 4AGGA 2Y6LA 4D6RA 1O4TA 1EUTA 4GKYA 3WF1A 1AL21 4YW7A 1Y9MA 2VCCA 4A44A 2OA2A 1QF3A 2MEV2 1ULPA 1FYUA 2Y6FA 4Q0UA 1C8M1 2HEYF 4HPKA 2XXZA 1QEXA 2JG8C 2YY1A 1QMJA 2Z5WA 1AL0G 2Y6HA 3BPSA 1JU3A 4QX5A 1W2AX 4KL1A 4XCBA 1HXS1 4DB5A 1R082 1J1TA 5C9AB 3ETQA 1ZRCA 2P3IA 3WW3A 2E7QA 4LIUA 4N53A 3O1PA 3T4HB 3JU9A 4CCNA 1TVGA 4LHSA 2WINB 1QJU1 3FFZA 3OYWB 4QB1A 3KCCA 3GF6A 1H8VA 1IPSA 1OLQA 2R16A 4J25A 2ZGPA 4L2NA 1ULGA 5AC91 4OI4A 4ZXEA 1UZ0A 1W9YA 4HFSA 1WLWA 2J1SA 2ZS6B 3ROUA 2BRTA 4K6BA 4MLOA 1DIWA 2EXIA 5ANQA 1IS5A 2P6CA 4A41A 2R30A 3LOIA 3LEKA 5FZ7A 4DXSA 4E27A 4LBQB 3DXTA 3ME2A 2DVBA 3PDQA 4MXWA 4XETA 3ZR6A 3WNLA 1JYNA 1W8ZA 1DU3D 4CCOA 3UGFA 5BNPB 5JR2A 4NRMA 2MHFA 2RMU1 3KLSA 4HPKB 3TN91 2VUAA 5EQUA 1C5HA 5CKQA 5B4XA 3ZR5A 3BOWA 2N7GA 4NHXA 3GZAA 3K4AA 1I5PA 2W94A 1YC61 3EMRA 1FPN1 4MGIE 4RHV2 2ZX3A 2ZX2A 4CDXC 4CVUA 4N53B 4A3XA 1QJX3 1V6MA 2VZOA 1HB4A 4LITA 3A4UA 1KFUL 1EPZA 5HXVA 2RDRA 4ZU7A 2QQVA 4XBQA 1RVF1 2ZPXA 2RJ2A 3LEGA 1GYKA 3VZNA 3J8F2 4CDQA 1G6NA 4FPJA 4MZUA 2VPVA 4CXYA 5F7UA 4GMP1 5JXHA 2AYHA 5FRAA 5T55A 3IDCB 1LODA 3M3QA 3HR9A 5LW9A 3AYAA 4LBJA 4MXWB 4COYA 4UW6A 2HWB3 1O59A 2JDAA 1O5UA 4H14A 3O1RA 4O61A 1NY71 1LECA 1RUG1 1UYZA 4ZHNA 3KB5A 1HJFA 4CDUA 1H4HA 1W2TA 2B8MA 2PA7A 2ZHNA 4QXHA 2W1WA 5IVYA 1JYTA 4QPYA 2RS11 2WQ4A 1UU6A 1HKDA 3MF9A 3OJBA 2VZTA 5C6CA 3ON7A 4CU8A 4LTAA 4J1WA 1OOPA 4LLFA 5FOBB 2A6ZA 4Z82A 1A3KA 2HWC2 1T6GC 3O12A 4XJAA 5HCBA 4AVBA 2DWRA 1RC6A 1X7NA 2FZ1A 2W1SA 2K2SA 3GXUA 5C8CA 3MIGA 1OD5A 4NR1A 3S5AA 4IEPA 3MI8A 1F35A 2G1MA 4CDQB 4DFSA 3NAPC 4NOTA 4Y4YA 1SPPA 4COZA 1W0OA 4OHXA 4QQOA 2WS92 3T0BA 1O3SA 1LAJA 1V00A 1R093 4XUOA 1D4VB 4BQ4A 3T2PA 1LEDA 1OUXA 3BU0A 3WLUA 2ZGKA 1YQ6A 2H6CA 3WEZA 1LULA 2MEV3 4COWA 1ULDA 2YFZA 2EIBA 5FYSA 1G9AA 5LEJA 5CG9A 2BYVE 1DZTA 2VULA 2WZEA 3PURA 5FZ3A 4FP3A 3NV3A 4CDUB 1ONAA 2PHXA 4S2DA 3V64A 2E7AA 1UZVA 4QPGC 2WNEA 5CISA 4KQ7A 2WO2A 3WHTA 2BNMA 4CUCA 4QAWA 1R083 2VQAA 1VBB2 2RE9A 4Q4W2 4KGQA 3FMGA 4UFKA 4HANA 4WV8A 1WCDJ 2ZGNA 1E5IA 2HBUA 3MFAA 5IAXA 3K3OA 1OOPB 1JODA 3KQ4B 1K5JA 1AXZA 4OULA 5A3WA 4EV0A 1VBD2 1JI6A 4PT6A 3TNQA 3RI8A 3VBRC 3C3VA 4DZGA 3VKOA 3CEWA 4AAXA 1SDWA 3HNBM 4BH9A 5F37A 3MPPG 4ARYA 4I30A 2BZDA 3RZJA 1J1LA 1GWKA 1OMIA 1SPPB 3ZXKA 5JDBA 1HDKA 4IEXA 5FZHA 3B01A 4GD4A 3ZYHA 1AJOA 4FOVA 4XE9A 1SLCA 2WJSA 1I3HA 4AGVA 3BB6A 3BN6A 2P17A 3MIHA 4YFZA 2HBTA 2BOIA 2DVGA 3LIGA 3AKPA 2QQNA 5E1RA 3ZFEC 2VL4A 1GWLA 4I09A 1UY0A 1T2XA 4OI0A 5CFCA 1JN2P 3NJVA 2J1RA 3VHOA 3RQ0A 2YXSA 2UU8A 4A6SA 4QGLA 3TOJA 4WM7B 3VD9A 1BYHA 1ODNA 1VLNA 2ATFA 4RHV3 2VZPA 4CCKA 2ZHMA 1W03A 4ZS2A 2HWB1 2WNOA 1K42A 1WW4A 4ATEA 1QU0A 1WW6A 1OFNA 1WMXA 4LO4B 3I2HA 3SITA 4J1XA 3KT7A 1DFQA 4CPBA 3NJXA 4XXAA 2DFCA 3SCHA 4HOOA 3ZKYA 3J8F3 4ASKA 1PZ9A 4D0QA 4QB2A 3WG4A 4UYBA 1XYPA 5JXJA 2O8QA 3RGBA 1DZRA 3T3YA 2RJLA 1TMF1 1ENQA 4TZDA 3ZO0B 2UY9A 3I49A 3WV6A 3H50A 4D3WA 1L3JA 5T5LA 5T52A 3UV9A 1ZVFA 3A7QA 4RYDA 1PGW1 5FK8A 3BTZA 5ANNA 3KGLA 5CFCB 3PLQA 1UY2A 2GNTA 3GHMA 2HEVF 3IPVA 4UT5A 4Y1UA 4X8PA 2XG3A 1YI7A 2VAUA 3KT1A 4Z1VA 2D44A 4IGQA 5J36A 3O1VA 1UL9A 2NQYA 3CZJA 3FBYA 3N36A 2AEYA 4URAA 3ZXDA 4JQTA 2HWC3 3JUUA 3ZSMA 4EN7B 3IIIA 2MEV1 5FPUA 1PVC2 4XFFA 2X8KA 2BVVA 5KHKA 3W20A 1OVPA 1O4ZA 2A6YA 2E31A 2TBVA 2V4VA 4CP0A 3DUIA 5FO8B 3RPQA 1OQ1A 1S0GA 4HSLA 1ND3A 4DXTA 5LZ6A 5FZ4A 3AYEA 3MV11 1UU5A 1R081 3WW4A 3QCWA 1PVXA 4FPKA 2WS93 4HVOA 2YB7A 4XF4A 1LTEA 1COV1 1KITA 1PO22 3I2GA 2JB4A 4IERA 3NNJA 2LRPA 4LBMA 5FYTA 2O8OA 4AEKA 4G4FA 1SG3A 2LW8A 1POV0 4IE0A 5FOJB 4D7TA 3NKTA 2DF7A 1BCXA 3IDBB 2BTVC 3WP3A 4BQ3A 4QQLA 2ENRA 3IPVB 2R1DA 1IZ3A 3PU3A 4ZY9A 1RUC2 4AI8A 1VBB3 2WAOA 2JECA 3LEIA 2JDZA 4Q4W3 3HNYM 4YNIA 1DDLA 3M3IA 2VZUA 3H3LA 5F39A 1XE0A 4NWWA 5FMOS 4LKDA 2R6QA 1VBD3 4MO3M 2IFRA 5HPOA 4CDWB 3ZXGA 2QFEA 4AI0A 3Q8BA 4DUVA 1ZM1A 2B7YA 1MVQA 4YW1A 4Q4V2 2IXHA 5CFDC 4BZ4A 4JC1A 5SV8A 4IEZA 2RR11 4BA6A 4AEDC 4CEWA 4RHV1 1JZ2A 5FYBA 1UU4A 3W9AA 4KNCA 3HT1A 2WUHA 1HB2A 1CAVA 3ATGA 1YYNA 4EQVA 2Q1MA 1ENSA 1Q3EA 3I54A 2DBNA 2WWSA 2JE7A 4LBQD 1WA4A 5J98B 1LOGA 2G9ZA 3TBDA 4YVSA 3U37A 5IFTA 1YO8A 1V9U1 3PUQA 5IVBA 5GZFA 3AZZA 1ACCA 3HJRA 2WFF1 1G7YA 2OXBA 3J8F1 1QKQA 4NHLA 3T08A 5KXBA 1F9KA 2B9VA 1H8TA 1ST8A 4XPVA 5KXCA 3ES4A 3VZMA 4QQ2A 3PTRB 2JDUA 1V6JA 1EAH2 3RZGA 1W6PB 1QY4A 3I7DA 1BHGA 1LGNA 1YQCA 3OSDA 3C7EA 4QKNA 4CUAA 4LUKA 4FPHA 4AWDA 2A6WA 1VPHA 3PUAA 2OIIA 2XMLA 2JE9A 3GYDA 2BNOA 4QXCA 1NLRA 3D4KA 4A42A 3RYPA 4CSWA 3FZ3A 3RVHA 2NMNA 4UFIA 1SBEA 5A6ZA 2G9FA 1DQ0A 4BU2A 1AR92 2LM3A 1YQ2A 1VAVA 1NA1A 1TZOA 2D97A 2NLRA 4OMCA 1AHSA 4NUBA 4O9GA 1CAVB 5GZEA 5FY7A 3DCQA 3FHQA 1Z7S2 1YWKA 3DKQA 2HWC1 3FX3A 4WVWA 5A1FA 1B35A 1LB2A 1RUOA 1XU1A 3KT4A 1DYKA 4X8NA 1H2KA 3LDKA 1GU3A 1X50A 2GDFA 1US3A 2UYBA 1YLLA 4V2VA 4YG3A 1WMEA 1G9DA 5I8YA 1H8TB 2D98A 4D7SA 1GQHA 3KS7A 3ZM8A 5C8WA 1UPSA 1EYBA 2JG9A 1U12A 3E5UA 1OUSA 4LHKA 2Q1FA 3AP6A 3CIHA 3JB8A 4L97A 3OF1A 1S1AA 1X8MA 2WQZC 4IEUA 2B5HA 2QZ3A 3PNAA 1PVC3 1JS9A 1UZYA 4Y3OA 3T1MA 5FP9A 5A3MA 4FPOB 1YFXA 4GB32 1CIYA 2QUOA 1PM4A 1W28A 1UCXA 1V0AA 3BODA 3OB8A 4CUBA 1POV3 1M4WA 4IEYA 4O9EA 4CCMA 1IKPA 3MW3A 4RGGA 4QGMA 1VBB1 4Q4W1 1GNHA 4LQRA 3BTAA 2VC9A 4Q4X2 1FMD2 3IT8A 1MVEA 3V56A 4F83A 1PO23 1J3RA 5K0UA 2QCSB 4FVVA 1O8PA 3GZEA 2ZGMA 5FWEA 2OPKA 4DRVA 1ZYBA 1CAUB 1OOPC 4CCEA 3UYJA 1B35B 3WCSA 5JPNB 1CPMA 5C8CC 1QNWA 3H3ZA 5J7MA 3TB0A 4AHWA 5CA6A 2D6OX 4Q8KA 3CF6E 2VBPA 1C8M2 1Q5OA 1RUC3 1PX4A 3AMNA 3M3CA 4NE9A 4AQ6A 5IK8A 2JG9B 1IOAA 5HI0A 3QACA 2Q8EA 3PUSA 3C7OA 1G8WA 1H1AA 1HXS2 2GSYA 5FYUA 5L9RA 2C5DA 3SC7X 3OD4A 3ZVXA 2AREA 2J7MA 3RS6A 3W5MA 3POGA 1SLIA 5FYIA 4ISQA 1I6XA 1TEIA 1UOGA 1GSLA 3USSA 4Q4V3 1HN0A 2WNUA 1OQDA 1QJU2 4LKEA 2YV8A 4EWAA 1PZ8A 3ZIXA 5CYYA 2LUWA 3H8OA 2C26A 3GZTB 5AC92 3ZXEA 2DURA 5HBAA 1OH4A 1JZ8A 1W39A 5FUPA 1NG0A 3NNGA 5CVRA 3E6BA 1J58A 1UXXX 2PQSA 1AUYA 5FY1A 5T5OA 3OBRA 5EJ1B 1XNBA 2GNDA 4AI9A 2ERFA 2P37A 4RL7A 2D5FA 2WDBA 2K46A 4MSVA 1MEC2 5C33A 3PU8A 3E97A 3POWA 5BY5A 3RDIA 1WCUA 5LA1A 4YGBA 3WR0A 2HKXA 3O0WA 4XJ9A 4PIXA 1UYPA 2ARBA 3TN92 3RZLA 5T54A 4YW4A 2R062 2WABA 1EAH3 4AF9A 1GZ9A 4N43A 5LBBA 2D3SA 3I2IA 5F6LB 3NV2A 1KDKA 5IVCA 1PK6A 3P1IA 4ZU5A 3BUCA 3ALQA 3AVRA 4JX0A 2ET7A 5D8AA 1DGRN 5BPXA 5KHHA 2XJUA 3WSOA 3WP4A 5A7SA 2YROA 5CFCC 2ZGRA 3OPZA 4NHYA 4LO6B 1IQDC 2VMDA 1AR93 1CX4A 4BOWA 1GV9A 5CAZA 3ZFGA 4ASMB 5C5UA 4OUEA 5HV4A 4QB6A 1Z7S3 2GU9A 1MS4A 4AQTA 4CYDA 1PVC1 1AR61 4PJYA 2BWCA 5A6QA 5J96B 1ODMA 1NY72 4DUXA 2WA4A 5H9PA 5EP9A 1POV1 5I93A 1RUG2 1UOBA 3WDTA 3BTXA 5DABA 1ENRA 3BVCA 5FR3A 4AI3A 4QX8A 4AZZA 1VB4A 5LBFA 4N43B 3U10A 3WZ1A 2QQLA 2Y38A 2RS12 5LB6A 5DUUA 1O5LA 1Z0HA 1PK6B 4XQWA 3HN1A 5D8AB 5BYNA 1MS8A 2VMCA 1YIPA 5EYXA 4OI1A 5JI9A 3GZUC 5ACA2 1CAWA 4GB33 3JQWA 3VBUC 4MX3A 2VU9A 4DPNA 1HRV2 2YMZA 1FOD2 3WP5A 1EUUA 1D0GA 1LHUA 5FFOC 1DZQA 4AR2A 4CPBD 1WCQA 2Q0AA 3NAPB 3ZN6B 4Q4X3 3ZFGB 1FMD3 4FFIA 3NO8A 5I0TA 2W08A 3AJYA 1UX7A 3K4DA 5JUVA 1UMHA 2WRAA 3OGRA 5GZCA 2W95A 4HK8A 3D5OA 4K3UA 5BXXA 3WT3A 3ZX7A 2BQPA 5M0TA 3PTYA 5EZWA 1TE1B 2BP6A 1ENXA 1W8OA 2UY8A 4GWNA 5F5CA 2WO3A 4P9YA 4B8EA 3OOXA 2FZ2A 1WMFA 4Q4V1 2V4AA 4OMDA 2W46A 3TNPB 3HNMA 1F2NA 4QPIA 1JYIA 1C8M3 1ND3C 5ISLA 4R4XA 1CJDA 5IK4A 1VBA2 4TLGA 1NCRA 4YGDA 1C1LA 2GNBA 1HXS3 4DXZA 1UYYA 2PHWA 3I2OA 1OT5A 3T09A 4FPYA 2VW1A 2VOKA 1R1A2 3IDAA 4NIAA 5A3TA 2XVGA 1CAWB 1KDMA 2ZZQA 4IE6A 5EWSA 1ULCA 3KV9A 4L99A 4BE3A 1HIXA 1E5SA 3KWVA 3M1HA 3JBG2 1F5JA 4QX3A 1QJU3 5FP8A 2ZMNA 1BVP1 1SFYA 4XJ8A 5AC93 1K3IA 1YHFA 3DYMA 4BHPA 2B42B 1EAH1 4QDSA 1L7LA 5GLUA 1YNAA 2VQUA 2VMIA 4Y1ZA 4GULA 3R4DB 4H7MA 3WCRA 1RJ8A 2VNVA 3KQRA 4AHXA 4COVA 3MHZA 1MEC3 1W8TA 1HJGA 4M00A 1W6QA 1ZRIA 2F4LA 4EZ4A 4K20A 1SACA 3U4XA 2V72A 3MLJA 4EWEA 1VALA 4QPIB 5FPAA 1K5MA 3OGJA 3TN93 5DZEA 4LULA 2Y0IA 3H8UA 4Y22A 1AR91 1H6YA 2JIGA 2YU2A 2XHKA 2WZPP 2BEOA 2R063 3PVEA 3IDEA 1FNYA 1IGOA 1NCRB 4PDWA 5DXDA 4AVCA 4CEWC 1O4YA 1MS5A 1LEMA 5FZBA 3HQXA 2OYZA 5LY2A 2VR4A 2WN2A 2UURA 1TG7A 1XNDA 4DNYA 2RS31 4YVSC 1QOOA 4XCAA 4DUWA 2ZEXA 5J37A 5IVJA 2PHUA 3AKTA 5JIAA 2QQKA 3M70A 3KVBA 1H8TC 3WW2A 5IATA 1KJLA 1DYOA 3BI3A 2VD7A 4IV3A 3GBGA 1LGCA 1NCQA 4OHZA 2D40A 2GH8A 1JMUB 3UGHA 1DBNA 1OHFA 4XOGA 3U11A 3FUQA 2F4PA 4WVVA 3X29B 2VVFA 3LPFA 3ST7A 3NV1A 1W6QB 4E9KA 3MF6A 1TMF2 2A3YA 2VNRA 2VMGA 4JCKA 4Q5OA 2OVUA 4AAPA 4PHZA 2Z4FA 1K5MB 1RUG3 3HWJA 3I2DA 5LA9A 1UN1A 4Y22B 3WINE 2C1FA 2E51A 3ZYIB 2IFWA 2PHLA 1O7FA 1RGSA 4Q4X1 5CG8A 1NA1C 5KWRA 2I2SA 2SBAA 1V6LA 2RS13 1PMIA 5SV5A 4BWOA 1QDOA 3WNNA 3NNLA 1HB3A 3AKQA 4OLLA 3KHBA 2W52A 4V1PA 5FLHA 4H7LA 5ACA3 1B35C 1SCSA 1YJKA 1H2LA 2G9GA 2QQWA 1OFSA 2Z42A 5KR7A 3BIEA 2PHDA 2YGLA 1FAYA 1HRV3 1SQ4A 4Q27A 2BDRA 1FOD3 2BGPA 3ZMNA 1IQAA 1QWRA 1BZWA 3CMGA 3IZOA 1O3QA 4Q4Y2 5CFDA 2V5YA 4IV3B 4A3ZA 1ZZ8A 2DCYA 1NCQB 3P6BA 2JG9C 2VZ1A 4G9SB 4LLOA 1SLAA 4YFWA 4AEDA 4DINB 5AFEA 5IVEA 5A3UA 2X53S 4B4QA 1UX6A 5FUIA 3ZFFA 1COV2 3TRSB 2PXJA 3AZXA 3KD4A 5DZFA 2ETEA 5JIUA 4AFAA 3HT2A 2OUHA 1LOAA 1QJEA 4I0WB 2AENA 1FV3A 5G05L 1KJRA 5HCFA 4YSFA 5DAXA 5L9BA 1DG6A 1GZTA 1NKGA 1VR3A 3N7JA 2GMMA 4FFHA 1UZWA 2ZHKA 5K0UC 1DQ2A 2ZEZA 4HN1A 1MEC1 1R1A3 3LFIA 3VDBA 1W2UA 3ENRA 3HMYA 4JKMA 3JD72 4MGTA 2IXKA 2VO5A 3S7IA 4RA0A 1XNKA 2GC1A 2HWD2 2Y26A 5FBJA 3WQ1A 1IHMA 1XOYA 2HH9A 2VW2A 1PGL1 5LBCA 2QNKA 4XMAA 5CFDB 2R061 2W2IA 3J7LA 2XDVA 3ZSLA 2NZ9A 2DVFA 4YM1A 5FMDA 3DXUA 1G86A 4JDNA 4AEDB 4HZFA 3CDZB 1GP5A 2W68A 2RR12 1RXGA 4A7KA 4DY3A 1B09A 1AVBA 4GAZA 4IGPA 3ZFFB 2ET1A 2R7EB 3H1YA 3W59A 3WNKA 2VOTA 4YZ4A 1BK0A 2W9XA 4KWKA 2JDMA 4Z92B 1H6XA 2BGOA 3VLBB 2WNUC 1CAXA 1RTVA 3B5LB 4AHZA 1V9U2 3AXDA 4P9LA 4PBOA 2WFF2 4QWNA 1AYN1 4JQRA 3THPA 4RGKA 4HMZA 4XW3A 2QBXA 2PMWB 4KGGA 5H9RA 5FXZA 3NV4A 1JOJA 5FLJA 1NXMA 3LDRA 4LOSA 1WCSA 1Y3TA 3VHRA 4FPCA 5FZ1A 5FIXA 1OURA 1W6MA 4UFHA 1XC6A 5FZOA 4XF9A 2V73A 2A6VA 2XJVA 3GALA 2GALA 1Y9QA 4FCAA 3VD7A 1O3RA 4ES9A 2EAAA 1WUVA 3ZPOA 3H8XA 1N3OA 3EB7A 1AZDA 2OUJA 1CZTA 1ZZ6A 2EXHA 4OFGA 2CTVA 3PVBB 4LOTA 1LU1A 4N43C 2E9QA 4M3CA 3N35A 2W5FA 1LHNA 4PQQA 3N9MA 1PK6C 3LA2A 4JV4A 3RJRA 5D8AC 4M0HA 5ACA1 5JOZA 1TMF3 4QPWA 4KBBA 5KHJA 2WNVA 1HRV1 1F5FA 1FOD1 3POIA 4QX0A 4LE3A 1U5YA 3MDPA 2VUJA 4AI2A 1S4CA 2RV9A 4ATFA 4YZ5A 4CUGA 3HIFA 3H7YA 4GH4A 2GMEA 4INDA 3ZFGC 2XLAA 1MZEA 4KMQA 4QQPA 3BIWE 1ZNPA 1CX1A 2H6BA 3Q8EA 3ZXFA 4PBPA 1POQA 4QX7A 3UJQA 1S55A 4QMAA 4HKOA 3IAPA 1W6MB 3C7FA 4XFCA 5FZOB 3LFMA 5ABJA 4M3CE 3FWEA 4BQXA 1PGSA 4NJ4A 4YW6A 4NIHA 3ES1A 2CU5A 4Q4Y3 1H2MA 1VBA1 1REFA 1XE7A 1CESA 2BFUS 2BWAA 2ZMKA 3AP5A 5DAQA 4DEVA 5IVFA 1QXRA 3MIEA 3VHPA 4P08A 5F5IA 2I74A 4M3CB 5LRSA 1LRHA 3MW4A 5JWPA 5A3LA 2TEPA 2ZEYA 1R1A1 1COV3 3WDXA 3BGAA 4Q8LA 1JH5A 4W6YA 5F3GA 1QOSA 3PL0A 4IEWA 1DGRA 3FLTA 2WNVB 2ZOEB 3AYDA 3JBG1 1LNSA 3ETPA 3JXSA 4O65A 3O1OA 3A22A 3Q8FA 3UL2A 3VBSA 5C8CB 1F4AA 1S0DA 1RIRA 3CNAA 3POFA 2VCAA 2ZAAA 4NIIA 3NWKA 2BUKA 1W8NA 2C4XA 2CGOA 3CKHA 3LB9A 3MIBA 3NNMA 4GH4B 3WUDA 1ZRDA 1F8VA 4EROA 4LHLA 3WW1A 3ZYJB 3E6DA 4F8AA 4SBVA 3H1MA 5I8SA 4X6RB 4PLMA 4XMIA 5FP3A 3SCFA 5LY1A 3JD73 3SH4A 4B29A 5HV0A 2WR9A 2Q8DA 4BMBA 2WT1A 5ABJB 2HWD3 3VKNA 3B69A 1V70A 2D6LX 1Q8SA 3LGRA 4QPIC 5FY4A 2JKBA 4NO4A 1NCRC 4N7IA 4XTPA 1UWWA 5JCTA 2RR13 1VBE2 1V6NA 2WYFA 3N3HA 2XWJB 3NJYA 3BTYA 1WGPA 4OHVA 3SH5A 4ZU4A 3OUHA 2IXLA 1PX3A 2WT2A 4XJZA 3IN9A 4OQ8A 5FZAA 2J1UA 2KM2A 1MS0A 3LAGA 5FPXA 2GN3A 4RR3A 3V0BA 1GICA 4RQPA 1CZSA 1GUIA 1NAEA 3FE5A 2K0GA 3VGIA 3I59A 4W8JA 1V9U3 1JHNA 1FT9A 2D3PA 2QZ2A 2PN5A 3M3EA 2WLPA 3ACFA 2WFF3 1ASJ1 3PUIA 5GLVA 4XAAA 2VNGA 2JD4A 4Q0QA 4QDQA 3AX4A 3RFRA 2R0HA 2RG4A 5H9QA 3SEEA 4AOCA 1S0JA 1Y43B 5GALA 2WBKA 1EV11 2Q1ZB 4FPFA 3Q8AA 4FPGA 1C28A 2VE1A 4B7KA 2ZGTA 1PIV2 1JYVA 5A7OA 2RM21 3ACIA 3O5SA 1G9CA 1H30A 4QM8A 1UOFA 3H3UA 4H3WA 1U5XA 3N9NA 3VBUA 2D7FA 4B7EA 1CJPA 4BLIA 1K5MC 1KFXL 4NPRA 1YQ5A 4YZ1A 4ZZ8A 4EWDA 4AFBA 2VTFA 2LTNA 3B9CA 2IZWA 1W90A 2DCKA 4PDWC 4E4HA 2WZ8A 1OC1A 3WP6A 3KV4A 2AGSA 2BBVA 2OW4A 1J83A 4C1XA 3MLKA 2JB8A 2Z2SB 3QH7A 2VQ0A 4YM3A 2E26A 5F3CA 4META 2VXJA 5FZ8A 1DQ4A 3ILRA 1LOEA 3DYPA 1OF4A 2VW0A 5JAXA 3WG1A 3V0BB 3AJZA 1MS9A 1VMHA 2TUNA 4OHWA 4PI0A 4RQPB 1AR62 3I59B 2DUPA 3U07A 2Y6GA 2DTYA 1FATA 2HWE2 2CDPA 4S2GA 4RN5A 1BVVA 4NPLA 4KU8A 3OGGA 4Q4Y1 4GXLA 2IC1A 3ZXAC 1JYXA 4CA9A 4IV3C 1GP4A 4IV1A 5DN2A 1NCQC 2ZGSA 3W58A 4AVVA 4HN0A 1GWMA 2VVDA 4P14A 4P9JA 5L19A 2Y34A 4L92A 4BCUA 3T0DA 4XF3A 2Y6JA 4MVTA 5EJ3A 4ET7A 3VDDA 2DUQA 2D6KA 1U5IA 2D93A 2XBO2 2WO1A 3MFCA 4W65A 5FLIA 4Y26A 3VBUB 3UESA 1ZRFA 2FHRA 2W47A 3VD3A 3W5NA 5L73A 3K2OA 2ZMLA 1GMMA 3LDBA 3C2UA 4COUA 1OA2A 1QJY2 1H4GA 1SCRA 4JHZA 3KGZA 4RD7A 1C1FA 3RYKA 2LROA 1W99A 4OZOA 4IGOA 3KSCA 2W92A 2KD7A 2ARCA 3JD71 3GGLA 4H2AA 4ZKTB 5B2GB 3C7HA 2HWD1 1W04A 2JX9A 4FPEA 1VE0A 1AJKA 3J7HA 1HRI1 4PF5A 1HV1A 3AFGA 1ND3B 3ITQA 3NMBA 4JRLA 3TEYA 2OS2A 5A33A 4IV1B 1S0FA 4UW5A 5FMBA 5EHDA 2PLV2 1N1TA 1RUE2 3S7EA 4E2QA 3H1WA 3OTFA 5CBLA 5F3IA 5HXMA 2XL7A 4WVZA 2Y6KA 4LBKA 2C24A 3ZFFC 4GJYA 1XRUA 3ACGA 3RRDA 3VDDB 5FO7B 2VY0A 4B1MA 4Z07A 2VVEA 2YYOA 4PLNA 1DQ6A 1UQXA 5LASA 5CB7A 4DS0A 1Q43A 1J84A 4LE4A 3K48A 1WD4A 5FJHA 3ZDSA 4E4ZA 3S57A 2PHRA 4AYUA 3EHKA 3CBNA 5IK5A 2O14A 4BXSV 2AACA 1QDCA 5LK5A 1W8UA 2DUOA 4A45A 4AE2A 1NOVA 1VBE3 2D6PA 2EIEA 2C6SA 1TME2 3AL6A 5FZCA 5FXWA 1CR7A 1W2OA 2YG0A 4K7JA 2JWPA 2R042 1IS4A 4MGSA 1BKZA 4P00B 1RJ7A 3C8XA 3J4UH 3LA3A 1IPJA 4XAEA 3HVDA 4Q1RA 3H42B 5FYZA 2W87A 2QQIA 4XQ4A 1ZX5A 4N90A 3D3AA 5A33B 1CPNA 5F9TA 3NNFA 4JTOA 5KXDA 2GC2A 1H9PA 5C3OA 3LD8A 4CEWB 3WVJA 3ZYFA 1YUDA 2K9ZA 3FUOA 4FP2A 4EN0A 5E8AA 5JPMB 3WDUA 2XWBB 1PIV3 4GALA 2JENA 2VJXA 4YVWA 1GZWA 2OZJA 1W2NA 4R9DA 1H9WA 3U75A 4BK4A 4C91A 4YZ2A 1LOBA 4YVSB 4GWJA 3T30A 4FPLA 2ZHLA 1RMU1 2O0OA 2RS32 5F5QA 5CZKA 1WZXA 4XDPA 4CCLA 4QGNA 4PCRA 2WKKA 1LKNA 1JOBA 3PHMA 4QXBA 3OUJA 4LIVA 4KWUA 4W6XA 2E33A 1YIFA 5A6YA 5DMYA 1X82A 4NHMA 1RUD2 2Y64A 4X6QB 4N7UA 1W8FA 2JKXA 4XUQA 3WNOA 2YU1A 2XKOA 1UMIA 4N8MA 5LA0A 1AR63 3E6CC 1RUI1 2QQOA 4QDRA 2HWE3 4A2UA 2OX0A 2ZXQA 1DCSA 2XVKA 2LALA 3UKNA 1NXD1 4AK3A 5FWJA 4CEYA 5DAVA 2FCUA 1BK1A 1C57A 1YFWA 3M4FA 2X10A 3SXWA 3BKZA 2EALA 2QE3A 1DF0A 2C9AA 4N9IA 4XYXA 1NA1B 5FV3A 5CEHA 1H1IA 4FOYA 2P6HA 4DIQA 1DGLA 2GC3A 1RUJ1 2P34A 1HLCA 4NPMA 2Q8OA 1BEV1 1S0CA 2QDNA 3DGTA 2GC0A 3ZSKA 4JAAA 4YVWB 5IT6A 4FTEA 2EAKA 5E88A 1KGYA 1STMA 2XBO3 4BQ5A 3NL1A 3KF3A 1GBGA 1QNYA 1SLBA 2R49A 2WNVC 3HQRA 1I5ZA 3GHNA 4K1YA 5C70A 5JMCA 5AFBA 3VBHA 5K9YA 4MUVA 3VZOA 4QD2A 1U5ZA 1XB9A 2FMYA 1QJY3 4YWAA 3D0JA 4D6SA 1LR5A 1D4M1 4GH4C 4DXRA 4ES8A 1RUF1 4GA9A 1W3VA 4XDOA 3HPNA 4E2SA 5CKNA 3J7NA 1CGPA 1AXYA 3DEMA 1W05A 1CD3G 1UXZA 1VAMA 1OQEA 1OSGA 2CGNA 2VMHA 3OY8A 3QD6A 4YYOA 5ABJC 1RYYA 3ZLIA 1Q8QA 2XQRA 4XHXA 4UF0A 4UWDA 5DDJ1 3I97A 5FXVA 3U14A 2PLV3 1VBE1 4FQZA 1RUE3 3CZUA 2RJKA 4P9IA 2IXJA 4UXAA 3S30A 3UK9A 1JZ3A 3SNMA 4IETA 4B4RA 2L9LA 5KC6A 5K0UB 1WA6X 3BCWA 4TTGA 5FP4A 2FBEA 1D7PM 3LSEA 3PUHA 4HT1T 4KWJA 4RGAA 3VBOA 1OKQA 1D2SA 5A70A 1Q8PA 5DG1A 2UWBA 2A75A 3I2KA 1OXCA 2G19A 4KWLA 4AFMA 3VBSC 5J48A 3VBHB 1GOHA 1QQP1 1WBLA 1ZZ9A 4EE2A 4LA3A 5KXEA 1Q56A 2FMDA 1PGL2 2WC2A 2DCTA 5FYMA 1TME3 3VKFC 5JLVA 1OA3A 5D21A 3UETA 1SZBA 3AVSA 1BMV2 2BERA 1W9TA 3AYCA 4K1ZA 1PIV1 2R043 3KV5A 3D8CA 4XC9A 3SCGA 2EXKA 2QKDA 5FK7A 5FPBA 2VTXJ 3NQHA 3AP7A 1HV0A 2P3JA 3KMHA 3OD0A 3OY8B 3OGVA 4L9BA 5GKAC 3VB9A 3VL9A 3WF4A 3V0AA 2Z69A 2BV4A 4ZXKA 2OZ6A 3RZZA 4Z8BA 5IYYA 1A8DA 1XU2A 5JMOA 1YXWA 3DPRA 1LHVA 2P3KA 4QKBA 2WNUB 1C8NA 2HEWF 2B39A 3M3OA 1J3QA 3ASIA 1S2EA 4AFDA 1AYN2 3G6JB 2QQMA 2W1QA 4LORA 5CKMA 1EPWA 3VBOB 4XIKA 5T5JA 4LMFA 4RR3C 4TN7A 5ERLA 3AMMA 4RQPC 3OBZA 2HWE1 4UW4A 2RS33 3JQXA 4XJUA 4HK9A 1XQNA 1OLME 3IMNA 2VCBA 3PVOA 4Y24A 2XLGA 1AYM2 3AZWA 5I8TA 4SLIA 5GJ6A 3T4VA 1I9RA 1PMJX 3HD8B 5E6HA 3B3QE 5A6XA 4I3GA 2VTXA 2XHNA 4JTNA 4K9SA 1SBDA 1RUH1 2XBO1 3DN7A 3QH6A 2RHPA 2WIIB 4LHNA 4NHKA 5DAWA 4MG2A 2VXRA 1R1ZA 2DYCA 4AQSA 2JXAA 3ACLA 4MGQA 3DPRB 4AGRA 1MR5A 3ZOIA 3QBQA 1LGBA 1NUKA 1ZZBA 1W0NA 2PTMA 1DHKB 1N3QA 1JBCA 2GP3A 2KXLA 2XQXA 5FZEA 1QJY1 4M3CF 2XJPA 3JB4C 1US2A 2DCZA 4QQHA 1W6NA 3URFA 3N9PA 2WN3A 4HVQA 3HAGA 1RL3A 4D8MA 1URXA 3KHCA 4URTA 4CP9A 3EO6A 4I0BA 3WNPA 2YHJA 1PO11 1F4HA 2XOMA 4XUPA 1YJLA 2E6VA 4Y1VA 1W0PA 2O1QA 5T3NA 3CO2A 3IKWA 5EXOA 5GLWA 2EIGA 3D82A 2NN8A 5FY9A 5APAA 2XUEA 2BFUL 1YEWA 4YG0A 1VJ2A 5IW0A 5T5PA 2B46X 2PLV1 2ADDA 1RUE1 1GNZA 3D6EA 4M0NA 4IV1C 3T2OA 2FDIA 3E5XA 1O6UA 1ULEA 1YI9A 1OA4A 1DLCA 2OQ7A 4PF1A 1WMDA 1OVSA 5JZGA 4HVRA 5KBFA 5FXXA 2FD8A 1UKRA 2QTWB 4CP9B 4JKKA 4KH9A 3VDDC 3T0AA 3SKJE 3MV01 1AR71 3UT0A 3S0MA 3FHAA 4IEOA 3LOBA 4JRAA 3HOBA 1KRIA 2VOXA 1CZVA 5FY0A 3ZSEA 5EFUA 3VL8A 1RB8G 1WD3A 3AM2A 1W6NB 4JDMA 2DBIA 1TME1 4EN6B 5I0DA 3MPBA 5CU1A 2GP5A 2FDGA 4IUGA 4Q0SA 2W91A 2GAUA 2R041 1KEXA 4PIZA 5A1LA 1XE8A 3RJ2X 5FTTC 5JOYA 4C90A 1C3HA 2XL9A 3GJAA 1AR82 1ZA4A 3IIAA 2CNAA 4OUMA 4LT5A 5KC5A 1IPKA 2J1EA 5H9SA 4BIFA 3L2YA 2H0VA 3ZYPA 3CJXA 4AQ2A 4MHUA 3Q8CA 1AF9A 4E8DA 1JUIA 1GKBA 3S5QA 1UY4A 1JYWA 4WM8C 1T6BX 4BPZA 4BQ2A 4XFGA 3TEWA 1HW5A 1PM7A 5JZGB 5I91A 4HL0A 4QKFA 3O1TA 1LOFA 4UOJA 3E1F1 3HBKA 3ILNA 1Q8OA 4Q0VA 4GWMA 4CU6A 1DQ1A 4C0HA 3VZLA 3WQ0A 2ARXA 1REDA 1S2BA 2VBBA 3N4MA 4JGYA 2Z79A 2ZCWA 1A8MA 5JVVA 5FZMA 1W8WA 2R072 5DG2A 2YGMA 4XZPA 4QHOA 2WT0A 1RUD1 4OZXA 3VDAA 1ASJ2 1AYN3 2VZSA 2RS51 1VRH2 1GOFA 4NAMA 1UIKA 2VMFA 2W39A 3B9IA 5LA2A 2ZZJA 1SFPA 3W21A 4LR4A 2G4IA 3MIFA 1EV12 3O7OA 3OUIA 1ND2A 4IE4A 4MYEA 5DAPA 3WX5A 5CADA 1I1EA 1PHMA 2XH6A 4CP1A 3O0XA 3AZYA 5B4NA 2RM22 1GOGA 2VECA 1HQLA 2AH2A 4F3JA 5EIYB 1PMHX 4AEMA 4IW3A 4KG8A 4Y5SA 1AYM3 3RMXA 3R6SA 3SLIA 4PDWB 5DUWA 1UW8A 3WQ7A 4XFIA 2BVBA 1FNZA 2FQPA 4WZFA 4Y4RA 3WNXA 4R9CA 2B9UA 1H0BA 2ZKLA 3ZN4A 3FJSA 2DTWA 4YVWC 3RWNA 3ZN5A 2F6BA 1E57A 4I3PA 4W50A 5C9AA 1NQDA 4NMIA 4ZS3A 1N47A 3RZHA 3EJKA 2OQ6A 5FZGA 3U0ZA 1QH6A 5LATA 4JGYB 2XONA 3BOPA 3BPZA 3NKGA 4XACA 2HWF1 1H1MA 2XVLA 4FI9A 1A78A 4HONA 4A4AA 5EV7A 1H2NA 3OCPA 4MGYE 2EXJA 1MZ6A 2VMEA 1IG0A 4R9BA 5A7NA 4LBQA 4C8DA 3POBA 1MS1A 1Y7BA 2PAEA 3GJBA 5K4LA 3LIHA 1MQTA 1OPMA 1TQ5A 2XUMA 3R05A 5C71A 4YM2A 4CEYC 3KCYA 2D6MA 2R0FA 3ELNA 2E32A 5BNPA 2VZ3A 2Y8KA 2CGPA 1TNRA 2FDHA 1NE4A 1VBA3 1UIJA 1WLTA 3AFKA 3E5QA 3O1UA 2WWUA 4QU1A 3U78A 3O1MA 5FMOL 3BU7A 3N9LA 4XXPA 1RHI1 3OEBA 3AXEA 3GCWA 4L11A 5GLZA 4DO0A 5A3PA 2EA7A 1RITA 5JI7A 3WNMA 4HETA 4ORFA 4E4DX 1GZCA 1O8SA 3JBG3 5L36A 1WLCA 5FQ0A 3VBHC 2A71A 4BQ1A 4CCJA 3LSDA 2ZTNA 1XSRA 4JVAA 1BMV1 5EPAA 1HRI2 4Q29A 4Y5Z0 3M2MA 4QX2A 2J22A 3T2QA 2J42A 3I3MA 1UPIA 4P9WA 3V65A 1BBT1 4I01A 3I3BA 1AR83 2DFBA 4KBZA 1NLQA 5FMCA 4FOQA 4AVSA 2ILMA 5GM0A 3SQOA 1MQTB 4HSJA 2XJRA 3T2TA 2WWJA 1MZ5A 2TNFA 3FFQA 3HN3A 1FV2A 4PIYA 1JTZX 2F17A 4Z2WA 5BNOA 2AZ5A 5F5AA 1F15A 3AP4A 5FZ9A 5FZKA 4R8HA 1S0EA 4FTSA 4OI2A 5JXIA 4FXKB 1JZ6A 3VKMA 4GZ9A 1VMFA 3NW4A 2JDPA 4TWTA 3VBOC 4Z2AA 2CDOA 3VUOA 2UWAA 2ZX1A 2WZR2 4NIGA 1W8HA 1DLLA 1ZBE2 2XR4A 5LCWL 1UYXA 5FQ0B 5AVAA 3ZMOA 3CLPA 4I0AA 5KHGA 1WLDA 1AYM1 2R073 3POSA 4OYUA 4BB3A 4EN9B 1UOJA 4D6QA 2ZAHA 4DEQA 1MS3A 4QKDA 1KXGA 2WFPA 1VMJA 1ASJ3 2YUEA 3HBZA 1MACA 1VRH3 4UBHA 3WG2A 3A23A 2ID4A 4FT8A 4J6GA 4MV2A 4S2HA 1FX5A 4LKFA 1EV13 4ITCA 3DYOA 3KZ4C 4LBLA 2CV6A 4Y5TA 4BM8A 1G9FA 1UAIA 2RDSA 2RM23 3UKVA 3SHRA 3DPRC 4DQAA 1CAXB 3N7KA 5BNOB 1NLSA 3INAA 4LEJA 4V2WA 1RMU2 4CE8A 1LHWA 3RG0A 3LWCA 4AG4A 2PELA 4LXLA 2MNGA 1EY2A 3POYA 4WZCA 2Y33A 4E8CA 1NX9A 4QU2A 3MYXA 4MOAA 4RS5A 5GZDA 2ARAA 2FDFA 3MGUA 3D0SA 1XNAA 2SLIA 5JOXA 5LRRA 4LA2A 1RUI2 2C0ZA 3AZVA 4XURA 5CIRA 3AL5A 5TSWA 2J1TA 3T1LA 3JCIA 4M4RA 5F3EA 5L7OA 5FBZA 4YGCA 4YG6A 4A6OA 1QH7A 1WW7A 1NT0A 4XDQA 4LJHA 1RUJ2 2BBAA 4GQ7A 1BEV2 3EXUA 2DCJA 4AXOA 2CSGA 5F1RA 1X9PA 2GN7A 2X09A 1A34A 2YDEA 3WHUA 5JSPA 1DP0A 4NROA 2OKXA 4LKSA 4QHBA 2W1UA 3DL3A 3MEPA 3OG2A 5EYYA 3AB0A 1SMVA 4JGZA 1D4M2 4NWVA 3RYRA 1RUF2 5IAVA 1AR81 4RS5B 3K77A 4WM7A 5FAXA 3B02A 5JSOA 5FZDA 4FFFA 5D1IA 3ZIWA 4XF1A 3R4SA 1JZ4A 2PAKA 2A5ZA 2JE8A 4IEVA 3UJOA 1HX6A 5J1XA 3O1SA 4FSJA 1JYCA 1VAKA 2Q5TA 3IAQA 1ZREA 4ZONA 3TYJA 5FY5A 2ZJCA 3WUCA 2D5HA 4BYYA 3ACHA 1D2QA 4FAHA 3VBFA 1HRI3 5F6KA 5FYYA 3ZDVA 5L7OB 2ZABA 5FZLA 4YGEA 1P8JA 2B4KA 5DDJ2 2J1VA 2ZACA 5FREA 4OQ9A 4YARA 3IWZA 2AR6A 3I3DA 5JZGC 4NN0A 3VHNA 2UYAA 2BU9A 1OBNA 2IUWA 4C1WA 3GBWA 3R0RA 2Q4SA 5HCAA 3PIGA 4XBNA 5FDBA 4KU7A 4MGKE 3VN4A 1QJX1 3H0OA 5BNNA 2HJIA 3VBSB 3FL7A 3A0KA 3O14A 5J09A 2R071 4ASLA 5IHRA 2ZX4A 2JDNA 3ILFA 4LO5B 4BXFA 2QQUA 5E16A 2VCMA 1QQP2 5F2WA 4B3NA 4DMIA 4JGZB 1VRH1 5FYCA 3O0VA 4XZUG 5A3NA 5FYVA 3LE0A 3RI9A 1HQWA 3F2ZA 2BPA2 4UFLA 2WZR3 3I2JA 1R64A 1ZBE3 2R1BA 5IUQA 4FTBA 1HQNA 3FLPA 4D7YA 2E7TA 1VP6A 3P3PA 4R52A 4UI9L 2MPFA 1KS4A 3N9OA 1ULFA 1WWYA 2A7AA 3BALA 3VBFB 4W4ZA 1QHDA 2BJSA 5LBEA 1ALYA 2A73B 1UNBA 3NSTA 2QVSB 5FZ6A 3NRUA 4A7ZA 1ZZ7A 4A7YA 4W6WA 5BUVA 3G7DA 3RSJA 3PIJA 2WLQA 4O7XA 4PI2A 3SMHA 1LOFC 5IFPA 3MZHA 2DU0A 1LHOA 4RR3B 4B4PA 5BNNB 5F2SA 5FYHA 2GZWA 2BOJA 1X36A 4JGYC 1RMU3 3APBA 3ZYBA 4FBFA 3HEIA 1AX0A 1UY1A 2ORXA 5C4WA 5DUVA 4Q0PA 5LK7B 2CWSA 2JDHA 3USUA 4LK7A 5CNAA 4GWIA 2UWCA 2PQQA 1QOTA 3ECQA 4RSUA 1ND2C 3DV8A 1DGWA 3J26N 3MLLA 1R091 1Z78A 4HKLA 3H8RA 1S0BA 3AKSA 1RUH2 3KCXA 4XF0A 3N7LA 1YFYA 3R4UA 1RUI3 1SDDB 2D3RA 2DU1A 2VBDA 3AMQA 3K46A 4FO9A 2QQJA 2XLFA 4MXVA 5E89A 4CDWA 3OBAA 2IXCA 5GZGA 3SKVA 1WKYA 4HKWA 4M4PA 2XJSA 4LNVA 2W0XA 4LO8A 5DQ0A 3H7JA 1GANA 2D43A 4AFCA 2DDUA 1RUJ3 3UGGA 5DUXA 4QT6A 1BEV3 4RFRB 2QJVA 2XJQA 1V6KA 5FZ0A 3SH3A 4JDOA 3MUZ1 4IE7A 2GNMA 2WO7A 3P3NA 4CCCA 5C9AC 1PO12 1W9WA 1JZ5A 5K7PA 3BYWA 1F31A 4YZ3A 3WF2A 1LOCA 1E5RA 1QJZA 2BGCA 2FCVA 4D69A 3VV1A 2ZA9A 4RFT0 5C4WB 4WM8A 4BJ0A 2E53A 1D4M3 3USUB 5FY8A 1RUF3 2HYKA 1SFNA 4KI5M 5FO9B 4OUSA 5JXGA 2XGXA 1O3TA 2PHTA 2X05A 2VQTA 3B94A 3PVNA 1GQGA 4NVPA 1BQPA 1FXZA 3GDBA 1QIQA 1W6PA 1M06G 3VZJA 2ZGQA 2X5IA 1MQTC 1AR72 1W9FA 1WW5A 4D94A 2NP0A 1GNYA 2JICA 4EZHA 4HBNA 5BNPC 4WVMA 4MHRA 5DDJ3 1Y4WA 4GKXA 2HLEA 4K8FA 3F95A 2ZGOA 4FFGA 4I02A 1XYOA 5AVPA 3CQOA 1PZ7A 2NMOA 5C7GA 3TEXA 1LENA 3WDWA 2I07B 2WZR1 3C7GA 4OVEA 1ZBE1 4Y20A 2H0BA 4N53C 1A6CA 3S6PA 4XUTA 2FDKA 3ZYRA 2A1XA 2DVDA 1YCIA 1QQP3 4JHTA 2VZVA 3GNEA 3ABZA 2OPWA 1G9BA 4WM8B 5C3RA 2VUCA 1AX2A 2FCTA 4GIQA 1UZZA 2VOVA 3MICA 4HXCA 4QXKA 1CONA 3I3QA 1APNA 3GM8A 3Q9OA 5A7WA 2X5IB 3GBFA 1K45A 2HYXA 1OI6A 1JU4A 3ZYGA 3WDYA 3CJIA 3VDCA 2ORZA 5BNOC 4WVMB 1QJFA 2ZGUA 3I8TA 4IXLA 3FN9A 5D2AA 4CCDA 3VZKA 3L2HA 2BW8A 5F8PA 3JZVA 2IVJA 2Y60A 1QXJA 4HG6B 3POEA 4IESA 2RS52 4ZPIA 1GLHA 4U2AA 3A21A 3VD4A 4IQPA 4DY5A 3RWKX 4Y20B 1IS3A 2GMPA 3K3NA 4DRRA 1CAUA 4XJWA 2V09A 4XQDA 3LA7A 2YFUA 4MGZE 5FP7A 4BDVB 1ZRRA 4CZSA 4P02B 2IXIA 1VB2A 3MBWA 1DGWX 2JG8A 1GFF2 4XIOA 4R4ZA 4YM0A 4CDQC 1SBFA 3WG3A 2WS91 3WD5A 3KV6A 1GZWB 1N1VA 1UD1A 1RUH3 2CY6A 3PJQA 5A7WB 4P9GA 1VBC2 4N9HA 4YW5A 3CJIB 3I4IA 3AMPA 1ZBA2 1GQPA 4XFHA 1MZFA 1KS5A 2A3WA 1SLTA 1OKOA 3POJA 1NZCA 5LEKA 2HWF2 4CDUC 2VG9A 4BIOA 3MIDA 3MO4A 5FPZA 5IJRA 1CIWA 3UKTA 2WA3A 1NQJA 4RS5C 3MW2A 4FXGB 5JSRA 2A70A 1PNGA 1PO13 4EJRA 2D6NA 4GJZA 2YBKA 1WBFA 4HLTA 1GP6A 2GH2A 1LCLA 1VBD1 1V6OA 2AUYA 1X8EA 3J7MA 5C3SA 2YBSA 3AP9A 4QM9A 1D0HA 4JZRA 3AK0A 2CAUA 4CEYB 1HB1A 3SISA 4XEZA 1AL22 4K8RB 4BMEA 1NZIA 5L7OC 2JG8B 1W6OA 2Y0OA 4H55A 3CHXA 3AMHA 3H9AA 5FZIA 1W9SA 5J3UA 1VIWB 4IE5A 3WF3A 2WAAA 4TSVA 3RZMA 3WOGA 2ZKNA 3OBTA 1RHI2 2C9KA 3WY6A 4Q2FA 4CDXA 3B7MA 1AR73 4Y1YA 2YPDA 5FCCA 4XUNA 2OT7A 4CU7A 5I0RA 4YW2A 1JW6A 4LBOA 2CL2A 2LS6A 4FOWA 1MPXA 4E2GA 1VRBA 2IVIB 2VGDA 4JGZC 1Y9GA 4ARXA 5FKCA 2R32A 4G3YC 2PHFA 3ORJA 1YRZA 4WM7C 1UO9A 4C0BA 2CWMA 1BBT2 1OLMA 1JZ7A
chains in the Genus database with same CATH topology
4K40A 3QLQA 3FBMA 3VBFC 1W6OB 4P5HA 2RMU2 1O91A 4Q1PA 2ES3A 4AW7A 3ZXLA 3KM5A 3LZZA 4PQ9A 4K21A 3NJZA 4CDXB 2JEMA 1LU2A 1FPN2 1AXKA 1GR3A 2XJTA 2PFWA 3VKLA 1CN1A 4FQ4A 3ZSJA 5BNNC 4M01A 1JXNA 3EQEA 2VNOA 3K51A 2X29A 1LJ7A 2IWGB 3N7MA 3A0NA 4IL7A 1X33A 1RVF2 1RUD3 1SEFA 3FC0A 4XFAA 4U36A 2RS53 3NAPA 3ZN6A 1C4RA 3B93A 5I0SA 3V0AB 3PMSA 2PYTA 2CYFA 1N3PA 4AEJA 2I45A 4XBLA 5JR7B 4AVTA 4KG0A 5IK7A 1N1SA 1S0IA 5JOWA 3EBRA 2QDRA 2NPIA 1FI2A 4QPGA 4GMP0 3THTA 1BXHA 1N1YA 5A32A 3NVCA 1OLRA 1PO21 2WL1A 3L9JT 4Y1XA 3ZXJA 1XNCA 2YZ4A 4YW3A 1VBC3 2BNNA 3CU7A 2YC0A 1DYPA 4ONUA 2YPJA 5BNQA 1ZBA3 4AI1A 1J59A 3QOPA 3M7AA 4IEQA 3VBRA 2HWF3 3DF0A 5I0UA 1U0AA 5C4WC 4R9AA 1RUC1 1J3PA 4UW3A 2KA3A 3B00A 1TNFA 4S2FA 1S2KA 5KHIA 3TAYA 2CAVA 2PAMA 4CTEA 1KD7A 2ZX0A 1SLLA 1ZZCA 2NM1A 1UKGA 1JUHA 4CDWC 4CP2A 4E4SA 1AL23 2A3XA 3ZFEA 4L8QA 3LCPA 4UBGA 4QPGB 4PLOA 2E63A 1XYNA 3FLRA 2XPJA 1LESA 3IM0A 1IKQA 5A32B 1RINA 1WCKA 4WBBA 1PNFA 1RHI3 2JJ6A 3J9SA 1RUNA 2EVXA 1CQ9A 4YRDA 4MH0E 1IS6A 3VBRB 4CRQA 3TWIA 4XHBA 2XB6C 4P9XA 1Q8VA 4YLZA 5T50A 4AVAA 5DZGA 2ZGLA 2DV9A 2VOWA 3LKJA 3AKRA 3DKWA 1V6IA 1BBT3 2B45X 4XFBA 4LUMA 3WXPA 4OHYA 4TLFA 2X5IC 4LO7A 3CL1A 2ZBJA 1QJX2 2NYYA 2A6XA 3ZFEB 4FAGA 3IBMA 2XKPA 1C5IA 2RMU3 2Q30A 1DQ5A 2WSUA 1UMZA 1NYWA 1REEA 5BV6A 1Z7S1 1NE6A 1FPN3 2P2KA 2VH9A 2HWB2 4XTMA 1OPOA 4LBNA 1UF2C 4BLJA 1QXPA 1RVF3 1XXNA 2QQPA 4AHYA 4EN8B 1KQRA 3PMEA 2EF6A 4GMP3 3ZPYA 4Q26A 2DVAA 1YFUA 1VBC1 1QGLA 1ZBA1 4F7ZA 3CJIC 3PJYA 4DOUA 1AX1A 4GB31 3RMYA 5GLTA 3OYWA 5K8SA 1PGW2 3FHIB 1BJQA 3M8LA 1FMD1 3RNSA 1ND2B 4ISRA 3WDVA 2WSVA 4TYSA 1R092 1EP0A 1CVNA 4AGGA 1O4TA 4GKYA 1AL21 2OA2A 1QF3A 2MEV2 1FYUA 4Q0UA 1C8M1 2HEYF 4HPKA 4XILA 3USSA 2JG8C 2YY1A 1QMJA 2Z5WA 1AL0G 4QX5A 4KL1A 1HXS1 4DB5A 1R082 1J1TA 5C9AB 3ETQA 1ZRCA 2P3IA 3WW3A 2E7QA 4N53A 3JU9A 2WINB 1QJU1 3FFZA 3OYWB 3RYPA 3KCCA 3GF6A 1H8VA 2R16A 1OLQA 2ZGPA 4L2NA 1ULGA 5AC91 4OI4A 3ROUA 4HFSA 5J37A 1WLWA 2ZS6B 4K6BA 4MLOA 1DIWA 2EXIA 1IS5A 2R30A 3LOIA 4E27A 4LBQB 3ME2A 2DVBA 4XETA 4MXWA 1DU3D 5BNPB 2MHFA 2RMU1 3KLSA 4HPKB 3TN91 2VUAA 1C5HA 3BOWA 2N7GA 3GZAA 1FPN1 4MGIE 4RHV2 2ZX3A 2ZX2A 4CDXC 4N53B 4A3XA 1QJX3 1V6MA 3A4UA 1KFUL 1EPZA 5HXVA 4ZU7A 4XBQA 1RVF1 2ZPXA 1GYKA 3VZNA 3J8F2 4CDQA 1G6NA 4FPJA 4MZUA 2VPVA 4GMP1 2AYHA 5FRAA 5T55A 3IDCB 1LODA 3M3QA 3HR9A 3AYAA 4LBJA 4MXWB 4COYA 4UW6A 2HWB3 4H14A 1O5UA 1NY71 1LECA 1RUG1 3KB5A 4CDUA 1H4HA 2B8MA 2PA7A 2ZHNA 4QPYA 2RS11 2WQ4A 1UU6A 1HKDA 3MF9A 3OJBA 5C6CA 4LTAA 4J1WA 1OOPA 4LLFA 5FOBB 2A6ZA 4Z82A 1A3KA 2HWC2 1T6GC 3O12A 4XJAA 5HCBA 4AVBA 2DWRA 1RC6A 1X7NA 2FZ1A 2K2SA 5C8CA 3MIGA 1OD5A 4NR1A 4IEPA 3MI8A 4DFSA 4CDQB 3NAPC 4NOTA 4Y4YA 4COZA 1W0OA 4OHXA 4QQOA 2WS92 1O3SA 1V00A 1R093 1D4VB 1LEDA 3WLUA 2ZGKA 2H6CA 1LULA 2MEV3 4COWA 1ULDA 5LEJA 1G9AA 5CG9A 2BYVE 1DZTA 2VULA 4CDUB 4FP3A 3NV3A 1ONAA 2PHXA 4S2DA 3V64A 2E7AA 4QPGC 2WNEA 4KQ7A 3WHTA 2BNMA 1R083 2VQAA 1VBB2 2RE9A 4Q4W2 4KGQA 3FMGA 4HANA 4WV8A 1WCDJ 2ZGNA 3MFAA 1OOPB 4EV0A 1AXZA 4OULA 1VBD2 3TNQA 3RI8A 3VBRC 3C3VA 4DZGA 3VKOA 3CEWA 1SDWA 4BH9A 3MPPG 4I30A 1J1LA 1OMIA 3ZXKA 5JDBA 1HDKA 4IEXA 3B01A 1AJOA 4FOVA 4XE9A 1SLCA 2WJSA 1I3HA 4AGVA 3BB6A 2P17A 3MIHA 4YFZA 2DVGA 3AKPA 5E1RA 3ZFEC 4I09A 4OI0A 5CFCA 1JN2P 3VHOA 3RQ0A 2YXSA 2UU8A 4QGLA 3TOJA 4WM7B 1BYHA 1VLNA 2ATFA 4RHV3 2ZHMA 2HWB1 1WW4A 4ATEA 1QU0A 1WW6A 1OFNA 4LO4B 3SITA 4J1XA 3KT7A 1DFQA 4XXAA 2DFCA 3SCHA 3J8F3 1PZ9A 3WG4A 1XYPA 2O8QA 1DZRA 2RJLA 1TMF1 1ENQA 4TZDA 3ZO0B 2UY9A 3WV6A 3H50A 4D3WA 1L3JA 5T5LA 5T52A 3UV9A 1ZVFA 1PGW1 3KGLA 5CFCB 3PLQA 2GNTA 3GHMA 3IPVA 2HEVF 4Y1UA 4X8PA 2XG3A 1YI7A 3KT1A 4Z1VA 2D44A 5J36A 1UL9A 2NQYA 3FBYA 3N36A 3ZXDA 3ZSMA 2HWC3 3JUUA 4EN7B 2MEV1 1PVC2 4XFFA 2X8KA 2BVVA 5KHKA 1O4ZA 2A6YA 2TBVA 4CP0A 3DUIA 5FO8B 3RPQA 1OQ1A 1S0GA 4HSLA 1ND3A 3AYEA 1UU5A 1R081 3WW4A 3QCWA 1PVXA 4FPKA 2WS93 4HVOA 4XF4A 1LTEA 1COV1 1KITA 1PO22 4IERA 4LBMA 2O8OA 4AEKA 4G4FA 1POV0 5FOJB 4D7TA 3NKTA 2DF7A 1BCXA 3IDBB 2BTVC 3WP3A 4QQLA 2ENRA 3IPVB 2R1DA 1IZ3A 1RUC2 4AI8A 1VBB3 4Q4W3 2JECA 4YNIA 2JDZA 1DDLA 3M3IA 4NWWA 5FMOS 2R6QA 1VBD3 2IFRA 4CDWB 3ZXGA 2QFEA 4AI0A 1ZM1A 2B7YA 1MVQA 4YW1A 4Q4V2 2IXHA 5CFDC 4BZ4A 4JC1A 5SV8A 4IEZA 2RR11 4BA6A 4AEDC 4CEWA 4RHV1 1UU4A 3W9AA 4KNCA 3HT1A 1CAVA 3ATGA 1YYNA 2Q1MA 1ENSA 1Q3EA 3I54A 2WWSA 2JE7A 4LBQD 1WA4A 5J98B 1LOGA 3TBDA 4YVSA 1YO8A 1V9U1 5GZFA 3AZZA 2WFF1 1G7YA 3J8F1 4NHLA 1QKQA 5KXBA 1F9KA 1H8TA 4XPVA 5KXCA 3ES4A 3VZMA 4QQ2A 1V6JA 1EAH2 1W6PB 1QY4A 3I7DA 1LGNA 4LUKA 4FPHA 4AWDA 2A6WA 2OIIA 2JE9A 3GYDA 2BNOA 1NLRA 3D4KA 3FZ3A 2NMNA 1SBEA 2G9FA 1DQ0A 1AR92 2LM3A 1VAVA 1NA1A 2D97A 2NLRA 1AHSA 4O9GA 1CAVB 5GZEA 1Z7S2 1YWKA 2HWC1 3FX3A 4WVWA 1B35A 1LB2A 1RUOA 1XU1A 3KT4A 1DYKA 4X8NA 1H2KA 1X50A 2GDFA 4YG3A 2UYBA 1YLLA 1G9DA 1WMEA 5I8YA 1H8TB 2D98A 4D7SA 1GQHA 3KS7A 5C8WA 1UPSA 1EYBA 2JG9A 1U12A 3E5UA 4LHKA 3AP6A 3JB8A 4L97A 3OF1A 1S1AA 1X8MA 2WQZC 4IEUA 2B5HA 2QZ3A 3PNAA 1PVC3 1UZYA 3T1MA 5A3MA 4FPOB 1YFXA 4GB32 2QUOA 1UCXA 3BODA 1POV3 1M4WA 4IEYA 4O9EA 1IKPA 3MW3A 4RGGA 4QGMA 1VBB1 4Q4W1 1GNHA 3BTAA 4Q4X2 1FMD2 3IT8A 1MVEA 3V56A 4F83A 1PO23 1J3RA 5K0UA 2QCSB 4FVVA 2ZGMA 4DRVA 2OPKA 1ZYBA 1CAUB 1OOPC 1B35B 3WCSA 5JPNB 1CPMA 5C8CC 1QNWA 3H3ZA 5J7MA 3TB0A 4AHWA 5CA6A 2D6OX 4Q8KA 3CF6E 4AQ6A 1C8M2 1Q5OA 1RUC3 5IK8A 3AMNA 3M3CA 2JG9B 1IOAA 5HI0A 3QACA 1G8WA 1H1AA 1HXS2 2GSYA 2C5DA 3OD4A 3ZVXA 2AREA 3RS6A 1SLIA 4ISQA 1I6XA 1TEIA 1GSLA 4Q4V3 2WNUA 1OQDA 1QJU2 2YV8A 4EWAA 1PZ8A 3ZIXA 2LUWA 3GZTB 5AC92 3ZXEA 2DURA 5HBAA 1W39A 1NG0A 5CVRA 3E6BA 1J58A 1AUYA 5T5OA 3OBRA 1XNBA 2GNDA 2ERFA 2P37A 4RL7A 2D5FA 5C33A 4MSVA 1MEC2 3E97A 3POWA 5BY5A 3RDIA 4YGBA 3WR0A 2HKXA 3O0WA 4XJ9A 4PIXA 2ARBA 3TN92 5T54A 4YW4A 2R062 1EAH3 4AF9A 1GZ9A 4N43A 2D3SA 5F6LB 3NV2A 1KDKA 1PK6A 4ZU5A 3ALQA 5D8AA 5BPXA 2ET7A 1DGRN 5KHHA 2XJUA 3WP4A 2YROA 5CFCC 2ZGRA 3OPZA 4LO6B 1AR93 1CX4A 4BOWA 1GV9A 5CAZA 3ZFGA 4ASMB 1Z7S3 2GU9A 1MS4A 4AQTA 4CYDA 1PVC1 1AR61 4PJYA 2BWCA 5J96B 1NY72 2WA4A 5H9PA 5I93A 1POV1 1RUG2 3WDTA 1ENRA 4AI3A 1VB4A 4N43B 3U10A 3WZ1A 2Y38A 2RS12 5DUUA 1O5LA 1Z0HA 1PK6B 4XQWA 3HN1A 5D8AB 5BYNA 1MS8A 1YIPA 5EYXA 4OI1A 5JI9A 3GZUC 5ACA2 1CAWA 4GB33 3JQWA 3VBUC 4MX3A 2VU9A 4DPNA 1HRV2 2YMZA 1FOD2 3WP5A 1D0GA 1LHUA 5FFOC 1DZQA 2Q0AA 3NAPB 3ZN6B 4Q4X3 3ZFGB 1FMD3 3NO8A 5I0TA 2W08A 3AJYA 5GZCA 4K3UA 4HK8A 3D5OA 5BXXA 3WT3A 3ZX7A 2BQPA 3PTYA 5EZWA 1TE1B 4GWNA 1ENXA 4B8EA 2UY8A 5JOXA 4P9YA 2FZ2A 1WMFA 4Q4V1 3TNPB 4QPIA 1F2NA 1JYIA 1C8M3 1ND3C 4R4XA 1CJDA 5IK4A 1VBA2 1NCRA 4YGDA 1C1LA 2GNBA 1HXS3 4DXZA 2PHWA 4FPYA 2VW1A 2VOKA 1R1A2 2XVGA 1CAWB 1KDMA 2ZZQA 5EWSA 1ULCA 4L99A 4BE3A 1HIXA 3M1HA 3JBG2 1F5JA 1QJU3 2ZMNA 1BVP1 1SFYA 4XJ8A 5AC93 4BHPA 1YHFA 2B42B 1EAH1 5GLUA 1YNAA 4Y1ZA 2VMIA 3WCRA 4GULA 3R4DB 4H7MA 4AHXA 1RJ8A 3KQRA 4COVA 1MEC3 4M00A 1W6QA 4K20A 1SACA 3U4XA 3MLJA 4EWEA 1VALA 4QPIB 1K5MA 3OGJA 3TN93 5DZEA 4LULA 2Y0IA 3H8UA 4Y22A 1AR91 2XHKA 2WZPP 2BEOA 2R063 3PVEA 3IDEA 1FNYA 1IGOA 1NCRB 4PDWA 5DXDA 4AVCA 4CEWC 1O4YA 1MS5A 1LEMA 2OYZA 3HQXA 2UURA 4DNYA 1XNDA 2RS31 4YVSC 1QOOA 2PHUA 3AKTA 5JIAA 3M70A 1H8TC 3WW2A 1KJLA 4IV3A 3GBGA 1LGCA 1NCQA 4OHZA 2D40A 2GH8A 1DBNA 1OHFA 4XOGA 3U11A 3FUQA 2F4PA 4WVVA 3X29B 2VVFA 3ST7A 3NV1A 1W6QB 4E9KA 3MF6A 1TMF2 2A3YA 2VNRA 2VMGA 4JCKA 2OVUA 1K5MB 1RUG3 3HWJA 3I2DA 1UN1A 4Y22B 3WINE 2C1FA 2E51A 3ZYIB 2IFWA 2PHLA 1O7FA 1RGSA 4Q4X1 5CG8A 1NA1C 5KWRA 2I2SA 2SBAA 1V6LA 2RS13 1PMIA 5SV5A 4BWOA 1QDOA 3AKQA 4OLLA 2W52A 4V1PA 5FLHA 4H7LA 5ACA3 1B35C 1SCSA 1YJKA 1H2LA 2G9GA 2Z42A 1OFSA 2PHDA 2YGLA 1FAYA 1HRV3 1SQ4A 4Q27A 1FOD3 3ZMNA 1IQAA 1QWRA 1BZWA 1O3QA 4Q4Y2 5CFDA 2V5YA 4IV3B 1ZZ8A 2DCYA 1NCQB 4LLOA 2JG9C 4YFWA 4G9SB 4AEDA 1SLAA 4C91A 4DINB 5AFEA 2X53S 4B4QA 1UX6A 3ZFFA 1COV2 3TRSB 3AZXA 3KD4A 5DZFA 2ETEA 5JIUA 4AFAA 3HT2A 2OUHA 1LOAA 4I0WB 2AENA 1FV3A 1KJRA 5HCFA 4YSFA 1DG6A 1VR3A 3N7JA 2GMMA 2ZHKA 5K0UC 1DQ2A 4HN1A 1MEC1 1R1A3 1W2UA 3ENRA 3HMYA 3JD72 2IXKA 3S7IA 4RA0A 1XNKA 2GC1A 2HWD2 2Y26A 3WQ1A 1IHMA 2VW2A 1PGL1 2QNKA 4XMAA 5CFDB 2R061 3ZSLA 2NZ9A 2DVFA 4YM1A 1G86A 4JDNA 4AEDB 4HZFA 2W68A 2RR12 4A7KA 4DY3A 1B09A 1AVBA 3ZFFB 2ET1A 3H1YA 3W59A 4YZ4A 4KWKA 4Z92B 3VLBB 2WNUC 1CAXA 1RTVA 3B5LB 4AHZA 1V9U2 3AXDA 4P9LA 4PBOA 2WFF2 1AYN1 4JQRA 3THPA 4HMZA 4XW3A 4KGGA 5H9RA 3NV4A 1JOJA 5FLJA 1NXMA 1WCSA 1Y3TA 3VHRA 4FPCA 1W6MA 4XF9A 2V73A 2A6VA 2XJVA 3GALA 2GALA 1Y9QA 4FCAA 1O3RA 4ES9A 2EAAA 1WUVA 1N3OA 1AZDA 2OUJA 1ZZ6A 2EXHA 4OFGA 2CTVA 3PVBB 4N43C 1LU1A 2E9QA 4M3CA 3N35A 1LHNA 1PK6C 3LA2A 4JV4A 3RJRA 5D8AC 4M0HA 5ACA1 5JOZA 1TMF3 4KBBA 5KHJA 2WNVA 1HRV1 1F5FA 1FOD1 4LE3A 1U5YA 3MDPA 2VUJA 4AI2A 4ATFA 4YZ5A 3HIFA 3H7YA 4GH4A 2GMEA 4INDA 3ZFGC 2XLAA 1MZEA 4QQPA 3BIWE 1ZNPA 2H6BA 3ZXFA 4PBPA 3UJQA 1S55A 4QMAA 4HKOA 1W6MB 4XFCA 5ABJA 4M3CE 3FWEA 1PGSA 3ES1A 4Q4Y3 1H2MA 1VBA1 1REFA 1XE7A 1CESA 2BFUS 2BWAA 2ZMKA 3AP5A 1QXRA 3MIEA 3VHPA 2I74A 4M3CB 5LRSA 1LRHA 3MW4A 5JWPA 5A3LA 2TEPA 1R1A1 1COV3 3WDXA 4Q8LA 1JH5A 4W6YA 1QOSA 4IEWA 1DGRA 3FLTA 2WNVB 2ZOEB 3AYDA 3JBG1 3UL2A 3VBSA 5C8CB 1S0DA 1RIRA 3CNAA 2ZAAA 3NWKA 2BUKA 2CGOA 3LB9A 3MIBA 3WUDA 1ZRDA 4GH4B 1F8VA 4EROA 4LHLA 3WW1A 3ZYJB 3E6DA 4F8AA 4SBVA 3H1MA 5I8SA 4X6RB 4PLMA 4XMIA 3SCFA 3JD73 3SH4A 4B29A 4BMBA 2WT1A 5ABJB 2HWD3 3VKNA 3B69A 1V70A 2D6LX 1Q8SA 3LGRA 4QPIC 2JKBA 4NO4A 1NCRC 4N7IA 4XTPA 5JCTA 2RR13 1VBE2 1V6NA 3N3HA 2XWJB 1WGPA 4OHVA 3SH5A 4ZU4A 2IXLA 2WT2A 4XJZA 3IN9A 5FPXA 2KM2A 1MS0A 3LAGA 2GN3A 4RR3A 3V0BA 1GICA 4RQPA 3VGIA 3FE5A 2K0GA 3I59A 1V9U3 1JHNA 1FT9A 2D3PA 2QZ2A 2PN5A 3M3EA 2WLPA 2WFF3 1ASJ1 5GLVA 2VNGA 2JD4A 4Q0QA 3AX4A 2R0HA 5H9QA 1S0JA 1Y43B 5GALA 1EV11 2Q1ZB 4FPFA 4FPGA 1C28A 4B7KA 2ZGTA 1PIV2 2RM21 3O5SA 1G9CA 1H30A 4QM8A 3H3UA 4H3WA 4B7EA 1U5XA 3VBUA 4BLIA 2D7FA 1CJPA 1K5MC 1KFXL 4NPRA 4YZ1A 4EWDA 4AFBA 2LTNA 3B9CA 2IZWA 4PDWC 2DCKA 3WP6A 2BBVA 2AGSA 2OW4A 4C1XA 3MLKA 2Z2SB 3QH7A 2VQ0A 4YM3A 4META 1DQ4A 3ILRA 1LOEA 2VW0A 5JAXA 3WG1A 3V0BB 3AJZA 1MS9A 2TUNA 4OHWA 4RQPB 1AR62 3I59B 2DUPA 3U07A 2DTYA 1FATA 2HWE2 4S2GA 1BVVA 4Q4Y1 4KU8A 3OGGA 4GXLA 2IC1A 3ZXAC 4IV3C 4IV1A 1NCQC 2ZGSA 3W58A 4AVVA 4HN0A 2VVDA 4P14A 4P9JA 5L19A 4L92A 4BCUA 4XF3A 4MVTA 5EJ3A 3VDDA 2DUQA 2D6KA 1U5IA 2D93A 2XBO2 1ZRFA 3MFCA 4W65A 5FLIA 4Y26A 3VBUB 2FHRA 5L73A 2ZMLA 3C2UA 4COUA 1OA2A 1QJY2 1H4GA 1SCRA 3KGZA 4RD7A 1C1FA 3RYKA 3KSCA 3JD71 4ZKTB 5B2GB 2HWD1 2JX9A 4FPEA 1AJKA 1HRI1 4PF5A 1HV1A 3AFGA 1ND3B 4JRLA 5A33A 4IV1B 1S0FA 4UW5A 2PLV2 1N1TA 1RUE2 3S7EA 4E2QA 3H1WA 3OTFA 5CBLA 2XL7A 4WVZA 4LBKA 3ZFFC 1XRUA 3RRDA 3VDDB 5FO7B 2VY0A 4Z07A 2VVEA 2YYOA 4PLNA 1DQ6A 5CB7A 4DS0A 1Q43A 4LE4A 3K48A 1WD4A 4E4ZA 3ZDSA 2PHRA 4AYUA 3EHKA 5IK5A 1QDCA 5LK5A 2DUOA 4AE2A 1NOVA 1VBE3 2D6PA 1TME2 1CR7A 4K7JA 2R042 1IS4A 1BKZA 1RJ7A 3LA3A 3J4UH 1IPJA 4Q1RA 4XQ4A 1ZX5A 4N90A 5A33B 1CPNA 5F9TA 5KXDA 4JTOA 2GC2A 1H9PA 4CEWB 3WVJA 1YUDA 2K9ZA 3FUOA 4FP2A 4EN0A 5E8AA 5JPMB 3WDUA 2XWBB 1PIV3 4GALA 2JENA 4YVWA 1GZWA 2OZJA 4R9DA 1H9WA 4YZ2A 1LOBA 4YVSB 4FPLA 2ZHLA 1RMU1 2O0OA 2RS32 5F5QA 4QGNA 4PCRA 2WKKA 1LKNA 3PHMA 4W6XA 1YIFA 1X82A 4NHMA 1RUD2 4X6QB 4N7UA 2XKOA 1AR63 3E6CC 1RUI1 2HWE3 4A2UA 4AK3A 3UKNA 2XVKA 2LALA 1NXD1 4CEYA 1BK1A 1C57A 1YFWA 3M4FA 3SXWA 2EALA 2QE3A 1DF0A 2C9AA 4N9IA 4XYXA 1NA1B 1H1IA 4FOYA 1DGLA 2GC3A 1RUJ1 2P34A 1HLCA 2Q8OA 1BEV1 1S0CA 2QDNA 3DGTA 2GC0A 3ZSKA 4JAAA 4YVWB 5IT6A 4FTEA 2EAKA 5E88A 2XBO3 3NL1A 2WNVC 1GBGA 1QNYA 1SLBA 2R49A 4K1YA 1I5ZA 3GHNA 5JMCA 5AFBA 3VBHA 5K9YA 4MUVA 3VZOA 4QD2A 1U5ZA 2FMYA 1QJY3 3D0JA 1LR5A 1D4M1 4GH4C 4ES8A 1RUF1 4GA9A 4E2SA 1CGPA 1AXYA 1CD3G 2CGNA 1VAMA 1OQEA 1OSGA 2VMHA 3OY8A 3QD6A 4YYOA 5ABJC 1Q8QA 5DDJ1 2PLV3 1VBE1 4FQZA 1RUE3 2RJKA 4P9IA 2IXJA 4UXAA 3S30A 3UK9A 3SNMA 4IETA 4B4RA 5KC6A 5K0UB 3BCWA 2FBEA 4HT1T 3LSEA 4RGAA 4KWJA 3VBOA 1OKQA 1D2SA 1Q8PA 5DG1A 2UWBA 2A75A 4KWLA 4AFMA 3VBSC 5J48A 3VBHB 1QQP1 1WBLA 1ZZ9A 5KXEA 4LA3A 1Q56A 2FMDA 1PGL2 2WC2A 2DCTA 1TME3 3VKFC 5JLVA 1OA3A 1BMV2 3AYCA 4K1ZA 1PIV1 2R043 3D8CA 3SCGA 2EXKA 2QKDA 3AP7A 1HV0A 2P3JA 3KMHA 3OD0A 3OY8B 5GKAC 4L9BA 3VL9A 3V0AA 2Z69A 4ZXKA 3RZZA 2OZ6A 4Z8BA 1A8DA 1XU2A 1YXWA 3DPRA 1LHVA 2P3KA 2WNUB 1C8NA 2HEWF 2B39A 3M3OA 1J3QA 3ASIA 4AFDA 1AYN2 3G6JB 3VBOB 1EPWA 4XIKA 5T5JA 4RR3C 3AMMA 4RQPC 2HWE1 4UW4A 2RS33 3JQXA 4XJUA 4HK9A 1XQNA 3IMNA 3PVOA 4Y24A 2XLGA 1AYM2 3AZWA 5I8TA 4SLIA 5GJ6A 1I9RA 3HD8B 3B3QE 4I3GA 4JTNA 4K9SA 1SBDA 1RUH1 2XBO1 3DN7A 3QH6A 2RHPA 2WIIB 4LHNA 4NHKA 2VXRA 1R1ZA 2DYCA 4AQSA 2JXAA 3ACLA 3DPRB 4AGRA 1MR5A 3QBQA 1LGBA 1ZZBA 2PTMA 1DHKB 1N3QA 1JBCA 2KXLA 1QJY1 4M3CF 2XJPA 3JB4C 4QQHA 2DCZA 1W6NA 3URFA 4HVQA 3HAGA 1RL3A 1URXA 4URTA 3EO6A 4I0BA 2YHJA 1PO11 1YJLA 2E6VA 4Y1VA 1W0PA 2O1QA 5T3NA 3CO2A 3IKWA 5EXOA 5GLWA 2EIGA 3D82A 2NN8A 4YG0A 2BFUL 1VJ2A 5T5PA 2B46X 2PLV1 4M0NA 1RUE1 1GNZA 3D6EA 4IV1C 3E5XA 1ULEA 1YI9A 1OA4A 5JZGA 1WMDA 5KBFA 4HVRA 1UKRA 4KH9A 3VDDC 3S0MA 1AR71 3LOBA 4IEOA 4JRAA 1KRIA 2VOXA 3ZSEA 5EFUA 3VL8A 1RB8G 1WD3A 3AM2A 1W6NB 4JDMA 1TME1 4EN6B 3MPBA 5CU1A 4Q0SA 2GAUA 2R041 4PIZA 5JOYA 1XE8A 3RJ2X 5FTTC 4C90A 1C3HA 2XL9A 1AR82 1ZA4A 3IIAA 2CNAA 4OUMA 4LT5A 5KC5A 1IPKA 5H9SA 4BIFA 3L2YA 2H0VA 3ZYPA 3CJXA 4AQ2A 1AF9A 1JUIA 1GKBA 4WM8C 4BPZA 4XFGA 1HW5A 1PM7A 5JZGB 5I91A 4HL0A 1LOFA 3ILNA 1Q8OA 4Q0VA 4GWMA 1DQ1A 4C0HA 3VZLA 3WQ0A 2ARXA 1REDA 1S2BA 3N4MA 4JGYA 2Z79A 2ZCWA 1A8MA 5JVVA 2R072 5DG2A 2YGMA 4XZPA 2WT0A 1RUD1 4OZXA 1ASJ2 1AYN3 2RS51 1VRH2 1UIKA 3B9IA 2W39A 2ZZJA 4LR4A 2G4IA 3MIFA 1EV12 3O7OA 4MYEA 1ND2A 5CADA 3WX5A 1I1EA 1PHMA 2XH6A 4CP1A 3O0XA 3AZYA 2RM22 2VECA 1HQLA 2AH2A 4F3JA 4AEMA 4KG8A 1AYM3 3RMXA 3R6SA 3SLIA 4PDWB 5DUWA 1UW8A 3WQ7A 4XFIA 2BVBA 1FNZA 2FQPA 4WZFA 3WNXA 3ZN4A 4R9CA 2B9UA 1H0BA 2ZKLA 3FJSA 2DTWA 4YVWC 3RWNA 3ZN5A 2F6BA 1E57A