4R50A

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with li+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
KEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r50A00
2W0FC 3K06A 3SJQC 4GX1A 2WLLA 4PA4A 5EBWC 5CBGA 4R50A 2HJFC 2HVJC 1R3LC 4RO2A 5CBHA 3SYCA 3STZC 2K1EA 3K0DA 4MW8A 2Q67A 2AHYA 2QKSA 2WLNA 4P30A 2EINC 5J9PC 4WFEA 5KUMA 2X6BA 3E8GA 4MTFA 3RVZA 3GB7C 3K0GA 2AHZA 4R6ZA 4PA3A 3T4DA 4MVSA 2EIMC 2R9RB 4TWKA 5EK0A 3HPLC 4GX0A 3E8HA 4JTCB 3LDEA 1M57C 3F7VC 4PDLA 2ATKC 3PJSK 4H37A 4KFMA 4PDRA 5BZBA 3OGCC 3ZRSA 3EFFK 4MVRA 3SYOA 3OR7C 1OCOC 4OXSA 2WLKA 4CBCA 4LP8A 2OCCC 3FB6C 1OCCC 4GX5A 5EC2C 2A0LA 4XDKA 1QLEC 1V55C 2EIJC 1K4CC 2YEVA 3UM7A 4RUEA 4JTDB 2DWDC 2ITCC 1OCRC 3JYCA 1P7BA 3E83A 1K4DC 2Q6AA 3FB8C 1OCZC 4QE9A 2DYSC 1BL8A 5B1BC 4RUFA 5IY5C 2HG5C 2Q68A 3FB5C 4P9PA 1ORQC 2HFEC 4PA6A 4RAIA 2IH3C 1R3JC 2BOCC 2H8PC 3SPCA 4XDJA 4MTOA 1J95A 2WLIA 3LDDA 4QNHB 2A9HA 3IFXA 3OUFA 3OR6C 2Q69A 3RVYA 3TCUA 4MVZA 2EIKC 3K04A 4GX2A 3RBZA 1LNQA 3K03A 3E8BA 3LUTB 4P2ZA 2ZXWC 4MVMA 3SPJA 2X6AA 4UUJC 4DXWA 2WLHA 2IH1C 3K08A 5EC1C 3SPIA 2KB1A 5B3SC 4JTAB 3ABKC 1M56C 2EILC 2WLIB 1ZWIC 2A79B 3AG1C 3T1CA 3SYQA 2WLMA 4R8CA 4G28B 3E89A 5E1AC 4MSWC 3SPGA 4LBEC 4P9OA 2NLJC 4MVQA 5EBLC 5CBFA 4PDVA 3SYPA 1R3KC 1XL6A 2JK5C 3KG2A 5KUKA 4BW5A 2HVKC 3ABMC 3R65A 3RW0A 3UKMA 3IGAC 2DYRC 1R3IC 3LNMB 5EBMC 4H33A 3VOUA 4G27B 3FB7C 4MTGA 3F7YC 4J9YB 4MVUA 5B1AC 3AG3C 4X89A 3T2MA 2X6CA 3E86A 4HYOA 4I9WA 4X8AA 2ITDC 4EKWA 3F5WC 4MW3A 4WFFA 3T4ZA 2QTOA 2ZD9A 3BEHA 4MVOA 4QE7A 3ASOC 1XL4A 4J9ZB 3AG2C 4WFHA 1G4YB 2DWEC 4XDLA 4ZBMA 2Y69C 1S5HC 3OUSA 4LCUC 3SYAA 4F4LA 4R7CA 2P7TC 3ABLC 3SPHA 4HZ3A 1V54C 2WLLB 4PDMA 4PA7A 3ZJZA 2WLJA 3E8FA 3WG7C 4X88A 3STLC 3LDCA 3TETA 3ASNC 4PA9A 1KKDA 1JVMA 2BOBC 4MS2A 3X2QC 4WFGA 3AG4C
chains in the Genus database with same CATH superfamily
4HBNA 4UVBA 2F66C 3PN1A 4LF5B 4O2AB 2CGOA 2QWNB 2AHYA 5B1BB 2ODMA 1BS3A 5LXTB 5L3EA 1K34A 3HPLC 4GX0A 4KHPB 3LDEA 2IM9A 4PDLA 4KFMA 5BZBA 3UT5A 4PD4F 4NXMO 2YSUB 1WP8A 2QKAA 2X0LA 2BE3A 2GTSA 1XMOB 1GN3A 3W7SA 4DYLA 1N33B 4LF7B 1KQSU 4JYCA 5CMUA 3B77A 3H9VA 4P9PA 2BOCC 1J5EO 1J95A 2KG7A 4NKGB 1Q7YW 1YIJV 4MVZA 3LUTB 3ZHRA 4I0XA 4K8XA 5IYZA 4LH6A 2YIBA 4I7ZB 1WN7A 3ZHUA 3K08A 1D2DA 5B3SC 1Q81W 1EN4A 1M56C 2HLDG 1YI2V 1Y74A 1AI7A 4J42A 1K92A 1Q3EA 4JYBA 4A5UB 3JAKA 4BW5A 5KUKA 2HVKC 4FLXA 1WPBA 3W7XA 2ZE5A 4LFAO 1BQZA 3T2MA 4TSFG 3E86A 3JCUZ 2Q7EA 1AI5A 2JIZG 1IBKB 2UXCB 2AW9A 2M7WA 2YXYA 4F4LA 1VMGA 2P7TC 1VQLV 4N23A 1QLNA 1JVMA 4DUYO 1Z5WA 1H2SB 3EHBB 5H6QA 3T1HO 4D6TH 3AG4C 2QEXV 4PA4A 4KL1A 2HJFC 3K9SA 4F6EA 5LOVB 4DV1B 5CBHA 2JGDB 2KSDA 1HNZB 2BSKB 5KX5B 1AILA 4FZ1A 3RN4A 2DW4A 1E79G 3FYIB 2CH7A 2EIMC 2GSMB 4FVMA 5IJ9B 1FXHA 3DXRB 2HKOA 4B3MB 4DRXA 3OGCC 3ZRSA 3UO3A 1OCZB 2IU0A 4OXSA 4CBCA 3H01A 3L75H 2LJ2A 4YY3O 1BMFG 3RYCB 3FYEB 4W4KA 1BGYH 5D5PA 3UM7A 3CD6V 3JYCA 1FXVA 4QE9A 3J81N 5EZYB 1DTOA 2Q68A 1GM7A 3B4SA 4UCUA 4IIJA 2Q4PA 3CCSV 3J7AU 4TQDA 1IBKO 2XHBA 3IFXA 1XDCA 3OR6C 4DR1B 3OD4A 4MVMA 2DMXA 2G38A 2ZCEA 2HR3A 5FL7G 3EXAA 2UUAB 1BZKA 3ZS8C 1K3EA 4DR4O 1SQPH 1QVFU 2NLJC 4MVQA 4FFBA 2HHHB 2E76B 3RW0A 4J7KA 3ASOB 1RM1B 2ITDC 4LC1A 4EFBA 1WA8B 4MW3A 4FPPA 1YZBA 2VQEO 5KHIA 3SPHA 3ZJZA 2EBOA 3AG2B 3JCZA 2LO1A 1JMKC 1SESA 4JF3A 4AQYO 3CRAA 1TA8A 3CC4V 5EBWC 1YSCA 4JASA 4GKJO 1BT8A 4LF6B 2N05A 2HP8A 3AG4B 4DV4B 5J9PC 2MK3A 4FIPC 3RVZA 4Z2WA 3T4DA 3QF7A 1E1RG 4J7ZA 1XOUA 5CA0A 2ZDIA 2ZM6B 1YTFB 1K5QA 2EIMB 2FB5A 2XTAA 4DR4B 4NYKA 4DR7O 1K4CC 1IBLB 2GUZA 3CCRV 1YJWV 1CP9A 4YHHO 4KHPO 3ZMUA 4PJ0Z 4GUNA 4GYCB 3CMEV 3A0HZ 5LP6C 1MZEA 4NXMB 3P3PA 2ZIMA 4BIUA 1QBZA 3CXHF 2X6AA 1GN4A 4ZHQA 2QSAA 3CC2V 4GCZA 2IH1C 1D5AA 4JTAB 1N0NA 1YITV 1JFFA 2Q73A 2WLMA 1NS1A 4OGQB 4MSWC 4GT1A 5IJ0A 5IYZB 4P9OA 3IAYA 1IXMA 1S3JA 3IGAC 1OV9A 2JRIA 5C8YA 5B1AC 3OT7A 4B3RB 4JI6B 3K5NA 1KP2A 4DV1O 3AG2C 1VF6A 3BABA 4D7SA 3AG3B 4DO2A 4IYHA 4HZ3A 2D2CB 4I50B 5BY1A 1S77D 2GV9A 2EJRA 3HR0A 3Q4HB 3JSLA 1EN6A 3WB1A 1R3LC 1VQ8V 3M8AA 1CPYA 4FJCC 1VF7A 4MTFA 4I4TA 1ZSPA 3JASB 1Q8IA 5L3FA 1Y76A 3F7VC 2BSKA 5KX5A 4HNAA 1SS3A 3CE2A 2ZNJA 2IJHA 1AP5A 2XUMA 3G67A 2F4VO 5CN0A 1O9GA 1NH2B 3BHPA 1MG1A 4DW1A 1OCZC 1KU9A 2DYSC 4IHJA 2H94A 2Q7GA 3CHXA 4I9QA 4RAIA 2EJ7A 2OCCB 4B3RO 4TV9B 3SPCA 4DW0A 4NXNB 2Q0OC 2PUSA 3ZIAG 4UUJC 2QGNA 3WB0A 3JALB 1NVPB 5EIBD 1PKXA 4IIJB 1K97A 3SYQA 5E1AC 2QWPB 2VQEB 1H2GA 2AZ0A 4NTXA 2KKWA 1U96A 2F23A 5L3DA 5GONA 5JVDA 3ABMC 4FZ0A 4O4JB 4JYAO 4H33A 5D5QA 3AG3C 5IDJA 1NU1H 2YXHA 2FKXA 4K0KB 5JH7B 4GZRB 4CS3A 2JDIG 1H2KA 4WBNA 4DR5O 3ZRWB 1V54C 2WLLB 1V55B 2HHHO 4DV2B 3GWOA 2UUCO 2YUAA 4CS4A 4DV3B 2PF4E 1KD1W 4FMTA 3O9OA 3B09A 2W0FC 1DF4A 3OTOB 1L0LH 1WB7A 3SJBC 3AK3A 2RJZA 2ZDIC 3K0DA 1B3QA 4B7EA 3A0RA 3HKEB 4JI3B 3ZCCA 4KXRA 3APOA 1M56B 4I0XB 2JS3A 2XAHA 3RYIA 2F93B 3A8TA 2LGWA 4DR6O 1JCHA 3VQWA 2F95B 1P7GA 1TVKB 2BCCH 5KMGA 5BMVA 4TT3G 1NI8A 4DV0B 2R9IA 4DV5O 4J41A 1OCCC 4FLVA 2OTJV 3QVNA 4EB6B 1JX9A 4E4EA 1Y4MA 4IT5A 3E83A 5LMNB 1JPXA 3GWKC 3JD0A 1VIBA 3BY6A 4IL6Z 4FK5C 4JV5B 1HR0O 1R3JC 4Q6GA 2WWWA 1Q6UA 3SJCC 4LF9B 2WA3A 3K03A 3CB2A 4DR7B 2RQ6A 5JWPA 2R9AA 1F23A 5B1NA 2IW5A 4LFCO 3ZEDA 4O4HA 1S0VA 2K9PA 3AG1C 5IWAO 1GRJA 3SDLA 4G28B 4UXNA 3D3IA 4ZHQB 5FPOA 4QPKA 4PDVA 2JGDA 1XL6A 2A06H 4J80A 1UJWB 4O4IB 1A32A 1J5EB 1EN5A 1HP8A 4LF4B 3JD1A 4JI2B 3CCEV 3T4ZA 2QDOA 1SQQH 1F4MA 3ASNB 1YXBA 4LH7A 5LGNA 1I7FA 3CCUV 1S72V 3E8FA 3DGEA 4B08A 4DV5B 2BOBC 3ZHTA 1Q5OA 2RCVA 2PI5A 1BHAA 2FYUH 1FJGB 5CB4A 3CCVV 2Q8VA 4JPRA 1I94B 3A0BZ 1GN2A 2Q67A 3DTUB 2L35A 3W7TA 4JV5O 5LMUB 3Q4HA 1WAZA 1ROPA 4TWKA 1O9HA 2O57A 4K3AA 4K8ZA 2CAZC 2BTQB 1GH6A 4UCRA 3AEIA 5IWAB 1GM9A 1KKCA 2FL4A 4ICGA 3TK1A 3C90A 1NH2D 3K58A 3AK2A 3L72H 2ITCC 4E2LA 4FLUA 1H2MA 3FB8C 4X1YB 1WA8A 3IC7A 1I5XA 4LF4O 1ORQC 5IE9A 2H8PC 1YTFD 2HEPA 4TUYA 1NQTA 4JYAB 3K79A 3LSQA 5B5EZ 2XAJA 5DM6V 1PNMA 5KA6A 2UUBB 1L8DA 1IVSA 2EINB 5LP6A 3JALA 1FJGO 1N34O 4FM2A 4JI4O 3N2KA 4RWUA 4LF8O 2OWOA 1XBLA 2EULA 4YJ2A 3RGBA 4EKWA 1F51A 2NR5A 4K35A 4OPHA 5GONB 1BE3H 2QTSA 4ZOLA 4YJ3B 1OCCB 3OTOO 2E3CA 4UCSA 1U97A 1Y67A 5KA5A 2ZT9B 2HJDA 3STLC 4DK0A 5C93A 5JH7A 1OJHA 4DR6B 3X2QC 2QWQB 3G71V 2AGAA 2WLLA 3JSNA 3P30A 4R50A 3MAQA 4LF8B 2HVJC 2DQ3A 1V54B 1GM8A 1M4UA 2N74A 2CTWA 1NR7A 1AR1B 2WLNA 3C3TA 1RP3B 4WFEA 3T1YO 1N32B 1EBOA 4UCVA 1M9NA 5FNVB 5IYBO 3U0ZA 1ZX3A 1GTOA 2UUBO 3HKEA 5H9CA 2OT5A 4QIWF 4B3TO 1OCOC 1MOFA 3RYIB 3CC7V 4GX5A 3DXRA 1FPOA 1DK1A 1V55C 1COWG 1TVKA 3H1KH 5KMGB 2W6IG 3RYFA 1EM1A 2ZINA 1W59A 5B1BC 3RT3C 2Q5ZA 1QVGU 3U11A 3RYCA 4XDJA 1Z2GA 2QWOB 2D3OW 5A2QN 1R6KA 4GKKB 3ABUA 1VF6C 2BTOA 3E8BA 3SPJA 4DXWA 1N33O 4FM0A 5LMNO 4LWSA 1NTMH 3L71H 1JJ2U 1N8RW 2DQ0A 1ZLZA 1TUBB 1VQNV 4LBEC 1W2BU 4KUMA 3KG2A 4FFKA 1SZXA 4DR2O 3UQ8A 3ZN0A 1MMMA 2DYRC 2XT9A 5LA6B 1DGSA 3FD9A 3E2EA 2PTMA 3F5WC 1VEWA 3BEHA 3ASOC 4DV7B 3UO2A 4MT8A 1T5EA 2QM7A 1S5HC 1HNZO 3G6BA 1NZ6A 4HNAB 3ABLC 4TV8B 2JVDA 1NR1A 2OIEA 3JATA 4DR2B 4YXWG 1QR8A 1G6UA 4G2KA 4JI8O 5K1XA 3MD0A 3D36A 4IHJB 3N27A 4B3MO 1M1KW 1XNRO 1H38A 5KHGA 3CP1A 3T1HB 1YCIA 3ABKB 4X65B 4QGPA 1OCOB 2WPDG 1L1FA 2ATKC 1I94O 3OMIB 4JZ2A 5H6RA 4LNUA 3OR7C 5JQGA 4I55A 3OE7G 2V7QG 1GN6A 1D5NA 2YIDA 4XDKA 3G80A 1OCRC 1K4DC 1FXKC 5IY5C 1NTZH 4QNHB 3OUFA 4WBNB 4X62B 2ZXWC 2CUGA 4UCTA 2ADQB 4ASUG 3JARB 1KYOF 1VARA 1WLEA 1XUQA 2F4VB 1EZVH 2F43G 1BQ0A 3H1JH 4FLZA 4U3JA 5KAIZ 4XBFA 2FMLA 1R3IC 1KECA 1ZUQA 2Y0PA 1FFTB 4J9YB 1I08A 3LNNA 2ZIOA 3RYHA 5KAFZ 4HYOA 2CH7B 1NKDA 5IJ9A 2YI9A 2DYRB 2QTOA 2CGNA 2Y48A 5E79Z 4J9ZB 2GBOA 4R7CA 4GKJB 1KP3A 5BMVB 5JJNB 2DE0X 2QWRB 1THZA 4X20B 4HAMA 2B5UA 1VQ6V 5IYCO 4ZOLB 1AROP 3SR2C 3M99B 4FLTA 5FLXN 2UU9O 2Q9LA 2VQFB 1H2LA 4I50A 2LGQA 2Y0IA 3CWBH 3ZX6A 5H5NA 1LR1A 1URFA 4JI2O 3L9DA 5EIBC 1NVPD 3ETEA 1N36O 1N4CA 5GTHZ 4AILC 2E75B 1WB8A 4JI1B 2PGGA 4H37A 3K5MA 4MTXA 3WFVA 1PNLA 3I5DA 2YEVB 3FFQA 1SETA 1QNMA 3CMAV 4OPAA 3KKYA 3JASA 3CJHA 4DUYB 1VQ4V 3G4SV 4X1IA 3AG1B 1XILA 1JR9A 3W7WA 4QPJA 3OEHG 4NTWA 3IC9A 4WFAV 2OYQA 4WFBV 1IX9A 4PA6A 5JJJB 4CC6A 3DSQA 5AG2A 5DEDA 1F7YA 5HFLA 2Q7HA 1HNXO 2GDSA 5A9GA 2VWKA 1SQFA 2P06A 1FS0G 1YJ9V 1SRYA 5CB4B 4JI6O 2LP7A 2RNBA 5CBFA 2VRZA 1M5IA 4G27B 5B3SB 3OAAG 4JI3O 1VF5B 4WFHA 3IJ4A 5JVDB 2CTPA 5LMUO 3OUSA 3TGUH 4L8JA 2V1DA 2BTQA 4IGGA 1I0HA 1WNSA 5JJEB 4PDMA 2CK3G 3WU2Z 1WPXA 1M93A 1X4TA 3WG7C 3HKBA 4DV0O 1YEWA 2ADPA 1FXKB 5IY5B 3ETDA 2VS0A 2GHYA 3ZRWA 3VQVA 4RO2A 4JI0O 5KHHA 4JI4B 3SYCA 3JATB 4X1KB 4YIPA 4B3SO 1GKFA 3E8GA 4F6RB 3GB7C 3K0GA 3HKCB 4H0LB 3ZMSA 3OEEG 5EK0A 2PYLA 1JFFB 1IDSA 3OFNG 2FTKA 4NR1A 2KQXA 4X9QA 5IJ0B 1VQPV 3QG5A 2Y4TA 5FPRA 5L3BA 5C8YB 3C3SA 2VWJA 4LF6O 3K9AA 4JTDB 2AZ2A 5JQGB 3ZHSA 1K73W 2OIGA 4O2AA 1N32O 1SQVH 3RVYA 1K8AW 3MHSC 1HNWB 1LNQA 3I55V 3R66A 3P32A 1W0JG 3B8NA 3OTFA 2IBZH 4PELA 2KB1A 4IYIA 1QU7A 4YY3B 1QLEB 2WA4A 3CEIA 1TAEA 1KC8W 3SYPA 1R3KC 3UKMA 3K5OA 2DJVA 2Z0AA 5LBQA 4PV1B 1MZFA 4X89A 2ZE6A 5CA1A 3OMAB 4U3JB 2DWEC 2P5OA 4O4IA 4LCUC 4JI7B 2KG7B 3SYAA 2EZOA 4EEQA 2EIJB 3HKDB 3ICXA 5JCOC 2WAMA 4X88A 3ASNC 1JQ0A 3CRMA 4PA9A 1KKDA 2EIKB 1Y74B 2H3OA 4KP4A 3CCLV 1AB3A 1UPGA 1KMIZ 5H2FZ 3ZN1A 1YDXA 5LGUA 2K1EA 1ZTEA 4DV2O 2RN9A 3JAKB 1S76D 4TQFA 2XAFA 1Q82W 3N2GB 5KUMA 2X6BA 3U10A 4JI5B 4DV3O 4MVSA 1HNWO 1EFRG 3FAVB 4LWSB 5J2TA 2VQFO 1IZ3A 4W4LA 2UU9B 4ZKIA 4MVRA 4LF9O 1BHBA 4LP8A 3TXSA 3NXSA 3FB6C 5J2UB 3BRCA 5EC2C 2A0LA 5HFMA 2QM4A 2EX3A 2YEVA 1G1XB 2LW1A 3CJHB 2HG5C 1TUEB 4MTOA 4C7UA 1K5SA 3CRCA 5DN6G 2YDEA 1PL0A 1BSMA 3L70H 1ZWIC 4TUYB 2ZNIA 1Q90D 2P90A 2A3QA 3E89A 1XHZA 3BPZA 1PL4A 4UV8A 1TGOA 2JK5C 4QJFB 3LNMB 3NR7A 4LFBB 1CXZB 4DV4O 2LFSA 4X8AA 1LUWA 4CC5A 3JAMN 3LSSA 4WFFA 4BIOA 4MVOA 1OZ0A 2Y69C 4WCEV 3N2KB 5EYPB 2JJ1G 2ZM6O 3BFRA 1NJIW 4YJ2B 2W0XA 2WLJA 1AI4A 2P22C 1FYJA 4MS2A 3ZMVA 3OM3B 4RQEA 1QHTA 2UXCO 4UVCA 3K06A 4H13B 4Q20A 3VQYA 3HKBB 1US6A 5LYJB 2Z5UA 4N21A 3ZRXA 4UFZA 4DR3O 2UXDO 2XNDG 1AJPA 2YICA 1IURA 2X7RB 4R6ZA 4PA3A 4LR3A 4O2BA 4H44B 3B40A 3E8HA 3JARA 4ABMA 3PJSK 4O4HB 4B3SB 1H2NA 2OCCC 1Y6XA 2CE4A 4L87A 5LHHA 3L74H 1R73A 2XOKG 5IYDO 4O4LB 4RUEA 1XNQO 3OW2U 2Q6AA 1BL8A 1Y66A 4UB8Z 2W6JG 1JOYA 2OCHA 1R1BA 3MHHC 2IH3C 3K57A 1AJQA 2WLIA 1H8HG 2EIKC 3CS5A 3RWRD 4PI2A 4D7TA 4X20A 2JGUA 3E22B 3H1HH 4CH6A 1GO3F 2P4KA 4FM1A 1K9MW 4TOIA 3ZMZA 1I5YA 1RPRA 1LUVA 1FFXB 4JYYA 1K7DA 3RFRA 1IXBA 4DUZB 3VOUA 1V9PA 3FB7C 4CH5A 2NNUA 3ETGA 3EVKA 2MW2B 1SQBH 3ZRVA 4DK1A 4CS2A 1FD9A 2XAGA 4OX9O 1RFYA 5BR8B 5LA6A 2B1GA 3ZHQA 1Q86W 5LOVA 5L3CA 1KBHA 2Y69B 4EFEA 1SQGA 3ABLB 4PI0A 1B06A 3JAWB 2QE7G 1Q43A 1YF2A 4GX1A 3ZMTA 3THOA 2QR4A 3F5TA 2ZR2A 4X1YA 1VQKV 1HDJA 1FAFA 2QKSA 4P30A 1M90W 2NN4A 3QO8A 2Z3YA 2AHZA 1QQCA 4DR5B 2B9ZA 3APQA 1M57C 4X66O 3AG7A 5KLVH 1DF5A 2R72A 5L3GA 3EFFK 2YC0A 3X2QB 1XI1A 4Z1VA 3JD4A 1NT2B 2GTAA 2UXXA 5LP6B 3AK1A 4ZI7A 1B6QA 1MA1A 3KCYA 2EIJC 3O65A 4BAYA 4LNUB 4FLYA 2QJ1A 4I55B 4RUFA 2L6LA 2HFEC 4AI8A 4YJ3A 1SKVA 3CYOA 3LDDA 3VBBA 2Q69A 3TCUA 2PY5A 3GVMA 1ZL8B 1GMGA 4ZIBA 3SJAC 2PI4A 1Y76B 1W0KG 1XEQA 3WB2A 4YHHB 2IJIA 4R8CA 3CXCU 1F4NA 3H1IH 2YS8A 2ZQMA 1YVWA 3B2EE 1AR5A 1GAXA 2CTRA 4LF5O 1CEZA 3R65A 3ZHVA 2CTQA 1SC5B 3ABTA 3HKCA 1MSDA 1NTKH 2X6CA 1XMQO 4NVPA 3BA9A 4UVAA 5DECA 2Y4UA 5FNVA 1RM1C 1L0NH 2C2AA 3TJTA 2JEUA 4PA7A 3RYHB 1XNRB 1G8MA 5LHGA 1GK9A 3LDCA 1PV0A 3TETA 1JJOA 4U7NA 2F1MA 3CX5F 3SJQC 4X65O 1KB9F 3K3WA 2YXLA 5CBGA 3K5LA 1N34B 1AVMA 2QKCA 1WP7A 3STZC 4MW8A 2IU3A 4UB6Z 4O4JA 5CA0B 5CA3A 1PP9H 3D8CA 1DLBA 2EILB 2PYJA 3B8MA 3FX7A 4BIZA 5LYJA 5BXZA 4B7KA 1NBMG 1IBMO 2XAQA 2GUZB 1FKAO 1ENVA 4NTYA 1TUBA 2WLKA 3ML0A 2JS5A 4Z1MG 1E1QG 2UXDB 4AQYB 1SQXH 1MABG 5KHKA 2CDYA 2DWDC 1P7BA 5CA1B 3CCQV 3CRRA 5K1PA 1S5LZ 5GW7A 5GTIZ 2OTLV 4JAVA 3K04A 4P2ZA 4TV8A 1OCRB 3ABMB 3CPWU 5EC1C 3SPIA 1WJZA 4B3TB 2ILMA 2WLIB 2DOSA 3J80N 3S3WA 1SA0A 3W7UA 2E5LO 4NXNO 4CH3A 2JJ2G 5EBLC 5ITZA 5B1AB 2ARHA 1SF9A 3E22A 5BR8O 3G6EV 1IBLO 5LHIA 2UUCB 4X62O 1M57B 3N2GA 3M7MX 5LL6Y 2AXTZ 2PZSA 2ZKOA 3JD2A 1FFXA 2ZXWB 4QE7A 5LGTA 5J2TB 3FKSG 1RSOB 4GKKO 3BA8A 3SGIA 2QM8A 1IBMB 4UCOA 2P6JA 1R6NA 2Q0AA 2YIAA 4JAUA 4FLWA 5J2UA 3E35A 1ZAUA 4K0KO 2IJJA 4I4TB 4I5SA 1QR9A 2XASA 5LXTA 1XREA 4OX9B 1P84F 4JI1O 4LFBO 3QTCA 3QO5A 5IT9N 3LSUA 1P49A 3VQXA 2EINC 3JAWA 3UT5B 4X64O 1VQOV 1PNKA 3QNEA 2R9RB 3QO7A 3KZIZ 4JTCB 4WF9V 5JCOA 1N0JA 1VQMV 1VP7A 5B66Z 4PHZA 3KCXA 4NB5A 2RDCA 4AHCA 2N04A 1N36B 4DV6B 3CCJV 1HNXB 3P3NA 1YJNV 4U7OA 2ZR3A 3CRQA 4ZI7B 4X66B 1XMOO 5EYPA 3L73H 3RBZA 4GX2A 1SZTA 4CH4A 2QA4V 3DC6A 2M6YA 2V4DA 3DC5A 4LFAB 4RQFA 2ZE8A 4LF7O 2A79B 1HR0B 1ZL8A 3SPGA 2LW7A 1XNQB 5EBMC 4MTGA 4LFCB 3F7YC 4MVUA 2YI8A 5B1OA 3BAAA 1MSWD 4X64B 2YIBD 4O2BB 1AJNA 4DR3B 1VQ5V 3OMNB 2ZD9A 5TISZ 3ZBHA 1EZJA 2LQTA 1PM9A 4J7JA 2B1IA 4JI0B 1PD3A 3MDSA 3UCSC 2JEXA 1P4RA 2IJKA 4X1IB 1X59A 4GLXA 1MNGA 4O4LA 1XMQB 1H8EG 3HKDA 4DV6O 4UV9A 3CCMV 1Z5VA 4DRXB 1KUQA 4U3FH 2ZE7A 1VQ7V 4BR6A 4EB6A 3WG7B 2P4VA 4PDRA 3D36C 3OGIB 1AP6A 1XQ8A 1XHXA 1PPJH 2DN9A 3HB3B 3I56V 3A2FA 3JD3A 3SYOA 4JGSA 1R6TA 5EZYA 2ETNA 4JI8B 3K59A 1UFIA 1BCCH 3FAVA 1AR4A 1QLEC 3ETQA 1SERA 3S3XA 2RMKB 3H1LH 1OHHG 1B04A 4DUZO 3FB5C 2E5LB 1AI6A 1QCEA 2A7WA 2UXBB 2A9HA 3D3QA 4DV7O 3BVOA 1VQ9V 2UXNA 2WLHA 4JZGA 4FFBB 1FXKA 4YIOA 3ABKC 2EILC 1S5JA 4BW9A 4J11A 1YHQV 4DR1O 1HWYA 4JI7O 1JA8A 4X1KA 2DYSB 1Q6IA 2WSSG 1RPOA 4BWAA 3TXQA 2EZPA 4F6RA 1SA0B 3RYFB 2R70A 2UXBO 4I9WA 2UUAO 5ITZB 5KHJA 2LFRA 3T1CA 1XL4A 4ZBMA 1G4YB 4TV9A 4XDLA 1HW7A 1Q6HA 1K33A 2E74B 3T1YB 4JAAA 4CZZA 2P67A 4J10A 3BCCH 1RSOA 5F2VO 4JI5O 3CSXA 4WFGA
chains in the Genus database with same CATH topology
3M99B 2W0FC 4UVBA 2QE7G 1DF4A 4GX1A 3ZMTA 2ZR2A 1VQKV 2ZDIC 3K0DA 2AHYA 2QKSA 4P30A 1M90W 3A0RA 3QO8A 5B1BB 3ZCCA 2Z3YA 2AHZA 1NVPD 3ETEA 1M56B 2XAHA 5L3EA 1K34A 3HPLC 4GX0A 3LDEA 1M57C 4PDLA 1JCHA 4H37A 4KFMA 5BZBA 4MTXA 3WFVA 1PNLA 2YEVB 5L3GA 1DF5A 3EFFK 4TT3G 1SETA 3X2QB 2R9IA 3CMAV 2YSUB 3JD4A 2X0LA 1VQ4V 2UXXA 1OCCC 3G4SV 2OTJV 3AG1B 1B6QA 3W7SA 2EIJC 3W7WA 1JX9A 4QPJA 3OEHG 1Y4MA 4BAYA 3E83A 1KQSU 1JPXA 3JD0A 3BY6A 4JYCA 5CMUA 3B77A 4RUFA 4WFAV 4FK5C 4WFBV 4P9PA 2HFEC 4PA6A 1R3JC 2BOCC 3CYOA 2WWWA 1J95A 3LDDA 3VBBA 1Q7YW 2Q69A 3TCUA 1YIJV 4MVZA 3K03A 3LUTB 5HFLA 1GMGA 2PI4A 1F23A 5B1NA 1W0KG 3K08A 2IW5A 1FS0G 1YJ9V 5B3SC 1Q81W 1M56C 2IJIA 1S0VA 1SRYA 2HLDG 3AG1C 1YI2V 4R8CA 4G28B 3CXCU 1F4NA 1AI7A 4UXNA 2LP7A 3D3IA 1K92A 2ZQMA 4QPKA 4PDVA 4JYBA 5CBFA 1XL6A 5KUKA 4BW5A 2HVKC 1CEZA 3W7XA 3R65A 1UJWB 4G27B 5B3SB 3ABTA 3JD1A 2X6CA 3OAAG 3E86A 4TSFG 3T2MA 1AI5A 3CCEV 4UVAA 3T4ZA 2JIZG 4WFHA 1F4MA 3ASNB 3OUSA 1RM1C 2M7WA 4F4LA 2V1DA 5LGNA 3CCUV 2P7TC 1VQLV 1S72V 2C2AA 4N23A 2JEUA 4PDMA 2CK3G 4PA7A 1WPXA 1QLNA 3E8FA 3WG7C 1G8MA 5LHGA 1GK9A 3LDCA 3TETA 3DGEA 1JVMA 2BOBC 4U7NA 1FXKB 5IY5B 3EHBB 3ETDA 5H6QA 2GHYA 2PI5A 1BHAA 3AG4C 3SJQC 3ZRWA 2QEXV 3CCVV 4PA4A 3K3WA 5CBGA 4JPRA 2HJFC 4RO2A 5CBHA 3SYCA 3STZC 4MW8A 2IU3A 2Q67A 3DTUB 3W7TA 5CA3A 1GKFA 2DW4A 1E79G 3E8GA 3GB7C 3K0GA 3FYIB 1DLBA 1ROPA 2EILB 2EIMC 2GSMB 3B8MA 3OEEG 4TWKA 5EK0A 3ZMSA 4BIZA 1FXHA 1NBMG 2HKOA 3OFNG 3OGCC 3ZRSA 2XAQA 1OCZB 2FTKA 1ENVA 2IU0A 3AEIA 4OXSA 2WLKA 4CBCA 3ML0A 1GM9A 3H01A 4Z1MG 1E1QG 1VQPV 1MABG 1BMFG 3TK1A 5L3BA 3FYEB 1NH2D 3UM7A 3K9AA 4JTDB 3CD6V 2DWDC 2ITCC 3JYCA 4E2LA 1P7BA 1FXVA 3FB8C 4QE9A 1K73W 3CCQV 1DTOA 3IC7A 1I5XA 2Q68A 1GM7A 1ORQC 5GW7A 2H8PC 3CCSV 1YTFD 2OTLV 1NQTA 3IFXA 3OR6C 3RVYA 1K8AW 3MHSC 4JAVA 3K04A 1LNQA 3I55V 4P2ZA 4MVMA 3K79A 3LSQA 1OCRB 3ABMB 2XAJA 3P32A 1W0JG 5DM6V 1PNMA 3B8NA 5KA6A 3CPWU 4PELA 5EC1C 2HR3A 2KB1A 3SPIA 5FL7G 2WLIB 3W7UA 1QLEB 2EINB 1K3EA 2JJ2G 1QVFU 2NLJC 4MVQA 5EBLC 5B1AB 1KC8W 3SYPA 1R3KC 3G6EV 3RW0A 3UKMA 5LHIA 3ASOB 5LBQA 1M57B 1RM1B 4X89A 2ITDC 3OMAB 4LC1A 4EKWA 4MW3A 1F51A 3JD2A 4FPPA 2ZXWB 4QE7A 5LGTA 2DWEC 3FKSG 1OCCB 4LCUC 3SYAA 2QM8A 3SPHA 5KA5A 2EZOA 2EIJB 3ZJZA 2EBOA 1R6NA 2P6JA 2WAMA 3AG2B 4X88A 3STLC 4JAUA 3JCZA 3ASNC 1JQ0A 4PA9A 3E35A 1KKDA 1SESA 5C93A 2EIKB 4JF3A 3X2QC 3G71V 2IJJA 4KP4A 3CCLV 2WLLA 3P30A 5EBWC 1YSCA 3CC4V 4I5SA 1QR9A 2XASA 4JASA 2HVJC 4R50A 2DQ3A 3ZN1A 5LGUA 1V54B 1GM8A 2K1EA 3QO5A 1S76D 3AG4B 1NR7A 1AR1B 2WLNA 2XAFA 2EINC 1Q82W 5J9PC 4WFEA 2MK3A 2X6BA 5KUMA 1VQOV 4FIPC 1EBOA 3RVZA 1PNKA 3T4DA 3QNEA 2R9RB 3QO7A 1M9NA 4MVSA 1E1RG 1EFRG 4JTCB 4WF9V 2ZDIA 1VQMV 1YTFB 5IYBO 1GTOA 5H9CA 2OT5A 4QIWF 4ZKIA 4MVRA 1K5QA 2EIMB 1OCOC 1MOFA 1BHBA 4LP8A 3NXSA 3FB6C 3CC7V 4GX5A 5EC2C 5HFMA 2A0LA 1V55C 1K4CC 1COWG 2YEVA 3CCJV 3CCRV 1YJWV 1CP9A 2W6IG 1YJNV 5B1BC 3ZMUA 2HG5C 4U7OA 3CMEV 1QVGU 2ZR3A 1TUEB 4XDJA 2D3OW 4MTOA 1K5SA 1R6KA 4BIUA 3ABUA 3RBZA 4GX2A 3E8BA 1SZTA 1QBZA 3SPJA 5DN6G 2X6AA 4DXWA 1PL0A 2QA4V 3CC2V 4GCZA 2IH1C 4RQFA 4JTAB 1YITV 1ZWIC 2A79B 2P90A 2WLMA 1JJ2U 1N8RW 3E89A 2DQ0A 4MSWC 4GT1A 3SPGA 4LBEC 1VQNV 4P9OA 1W2BU 4UV8A 4KUMA 3KG2A 2JK5C 4QJFB 1IXMA 3ZN0A 1S3JA 3IGAC 2DYRC 3LNMB 5EBMC 4MTGA 3F7YC 4MVUA 2LFSA 5B1AC 5B1OA 1MSWD 3E2EA 4X8AA 3F5WC 1AJNA 3LSSA 4WFFA 1VQ5V 3OMNB 3BEHA 2ZD9A 1KP2A 4MVOA 3ASOC 1EZJA 3AG2C 4MT8A 2QM7A 1OZ0A 2Y69C 1S5HC 4WCEV 3AG3B 2B1IA 2JJ1G 4DO2A 3ABLC 4HZ3A 1PD3A 1NJIW 2WLJA 1NR1A 2JEXA 1AI4A 1P4RA 2IJKA 1S77D 4MS2A 3ZMVA 3OM3B 4RQEA 2EJRA 4UVCA 4YXWG 3K06A 1QR8A 1H8EG 4G2KA 4Q20A 4UV9A 1VQ8V 1R3LC 3MD0A 3D36A 3CCMV 1M1KW 2Z5UA 4N21A 3ZRXA 1H38A 1CPYA 4FJCC 2XNDG 1AJPA 3CP1A 4MTFA 2X7RB 4R6ZA 3ABKB 4PA3A 1VQ7V 5L3FA 1OCOB 2WPDG 3E8HA 1L1FA 3F7VC 2ATKC 3PJSK 3OMIB 4PDRA 3WG7B 5H6RA 3HB3B 2IJHA 3I56V 3JD3A 3SYOA 4JGSA 3OR7C 2OCCC 3OE7G 2V7QG 4L87A 5LHHA 5CN0A 1R73A 1QLEC 4XDKA 2XOKG 5IYDO 1NH2B 1SERA 4RUEA 1MG1A 1OCRC 3OW2U 1K4DC 1OHHG 2Q6AA 1OCZC 2DYSC 1BL8A 1FXKC 5IY5C 1Y66A 2H94A 2W6JG 3FB5C 1JOYA 3MHHC 4RAIA 2IH3C 2OCCB 3SPCA 1AI6A 1QCEA 1AJQA 2WLIA 4QNHB 2A9HA 3OUFA 1H8HG 2EIKC 2ZXWC 3ZIAG 4UUJC 1VQ9V 2UXNA 2WLHA 1NVPB 1PKXA 4ASUG 1FXKA 3ABKC 1GO3F 1WLEA 2EILC 1K97A 3SYQA 5E1AC 1K9MW 1YHQV 2F43G 1H2GA 1I5YA 3ZMZA 1HWYA 1RPRA 5L3DA 4XBFA 1K7DA 3ABMC 2DYSB 2WSSG 1R3IC 1KECA 1RPOA 4H33A 3VOUA 3FB7C 2EZPA 1FFTB 4J9YB 2NNUA 3ETGA 3AG3C 5IDJA 4HYOA 4I9WA 3ZRVA 1NKDA 2DYRB 2LFRA 2QTOA 3T1CA 2Y48A 2XAGA 1XL4A 4J9ZB 4ZBMA 1G4YB 4XDLA 2JDIG 4R7CA 3ZRWB 1KP3A 1K33A 2B1GA 1V54C 2WLLB 1V55B 3GWOA 1THZA 4CZZA 5L3CA 1Q86W 2P67A 4HAMA 2B5UA 1VQ6V 2Y69B 5IYCO 1KD1W 1AROP 3ABLB 4FMTA 4WFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0F C;  3K06 A;  3SJQ C;  4GX1 A;  2WLL A;  4PA4 A;  5EBW C;  5CBG A;  4R50 A;  2HJF C;  2HVJ C;  1R3L C;  4RO2 A;  5CBH A;  3SYC A;  3STZ C;  2K1E A;  3K0D A;  4MW8 A;  2Q67 A;  2AHY A;  2QKS A;  2WLN A;  4P30 A;  2EIN C;  5J9P C;  4WFE A;  5KUM A;  2X6B A;  3E8G A;  4MTF A;  3RVZ A;  3GB7 C;  3K0G A;  2AHZ A;  4R6Z A;  4PA3 A;  3T4D A;  4MVS A;  2EIM C;  2R9R B;  4TWK A;  5EK0 A;  3HPL C;  4GX0 A;  3E8H A;  4JTC B;  3LDE A;  1M57 C;  3F7V C;  4PDL A;  2ATK C;  3PJS K;  4H37 A;  4KFM A;  4PDR A;  5BZB A;  3OGC C;  3ZRS A;  3EFF K;  4MVR A;  3SYO A;  3OR7 C;  1OCO C;  4OXS A;  2WLK A;  4CBC A;  4LP8 A;  2OCC C;  3FB6 C;  1OCC C;  4GX5 A;  5EC2 C;  2A0L A;  4XDK A;  1QLE C;  1V55 C;  2EIJ C;  1K4C C;  2YEV A;  3UM7 A;  4RUE A;  4JTD B;  2DWD C;  2ITC C;  1OCR C;  3JYC A;  1P7B A;  3E83 A;  1K4D C;  2Q6A A;  3FB8 C;  1OCZ C;  4QE9 A;  2DYS C;  1BL8 A;  5B1B C;  4RUF A;  5IY5 C;  2HG5 C;  2Q68 A;  3FB5 C;  4P9P A;  1ORQ C;  2HFE C;  4PA6 A;  4RAI A;  2IH3 C;  1R3J C;  2BOC C;  2H8P C;  3SPC A;  4XDJ A;  4MTO A;  1J95 A;  2WLI A;  3LDD A;  4QNH B;  2A9H A;  3IFX A;  3OUF A;  3OR6 C;  2Q69 A;  3RVY A;  3TCU A;  4MVZ A;  2EIK C;  3K04 A;  4GX2 A;  3RBZ A;  1LNQ A;  3K03 A;  3E8B A;  3LUT B;  4P2Z A;  2ZXW C;  4MVM A;  3SPJ A;  2X6A A;  4UUJ C;  4DXW A;  2WLH A;  2IH1 C;  3K08 A;  5EC1 C;  3SPI A;  2KB1 A;  5B3S C;  4JTA B;  3ABK C;  1M56 C;  2EIL C;  2WLI B;  1ZWI C;  2A79 B;  3AG1 C;  3T1C A;  3SYQ A;  2WLM A;  4R8C A;  4G28 B;  3E89 A;  5E1A C;  4MSW C;  3SPG A;  4LBE C;  4P9O A;  2NLJ C;  4MVQ A;  5EBL C;  5CBF A;  4PDV A;  3SYP A;  1R3K C;  1XL6 A;  2JK5 C;  3KG2 A;  5KUK A;  4BW5 A;  2HVK C;  3ABM C;  3R65 A;  3RW0 A;  3UKM A;  3IGA C;  2DYR C;  1R3I C;  3LNM B;  5EBM C;  4H33 A;  3VOU A;  4G27 B;  3FB7 C;  4MTG A;  3F7Y C;  4J9Y B;  4MVU A;  5B1A C;  3AG3 C;  4X89 A;  3T2M A;  2X6C A;  3E86 A;  4HYO A;  4I9W A;  4X8A A;  2ITD C;  4EKW A;  3F5W C;  4MW3 A;  4WFF A;  3T4Z A;  2QTO A;  2ZD9 A;  3BEH A;  4MVO A;  4QE7 A;  3ASO C;  1XL4 A;  4J9Z B;  3AG2 C;  4WFH A;  1G4Y B;  2DWE C;  4XDL A;  4ZBM A;  2Y69 C;  1S5H C;  3OUS A;  4LCU C;  3SYA A;  4F4L A;  4R7C A;  2P7T C;  3ABL C;  3SPH A;  4HZ3 A;  1V54 C;  2WLL B;  4PDM A;  4PA7 A;  3ZJZ A;  2WLJ A;  3E8F A;  3WG7 C;  4X88 A;  3STL C;  3LDC A;  3TET A;  3ASN C;  4PA9 A;  1KKD A;  1JVM A;  2BOB C;  4MS2 A;  3X2Q C;  4WFG A;  3AG4 C; 
#chains in the Genus database with same CATH topology
 4HBN A;  4UVB A;  2F66 C;  3PN1 A;  4LF5 B;  4O2A B;  2CGO A;  2QWN B;  2AHY A;  5B1B B;  2ODM A;  1BS3 A;  5LXT B;  5L3E A;  1K34 A;  3HPL C;  4GX0 A;  4KHP B;  3LDE A;  2IM9 A;  4PDL A;  4KFM A;  5BZB A;  3UT5 A;  4PD4 F;  4NXM O;  2YSU B;  1WP8 A;  2QKA A;  2X0L A;  2BE3 A;  2GTS A;  1XMO B;  1GN3 A;  3W7S A;  4DYL A;  1N33 B;  4LF7 B;  1KQS U;  4JYC A;  5CMU A;  3B77 A;  3H9V A;  4P9P A;  2BOC C;  1J5E O;  1J95 A;  2KG7 A;  4NKG B;  1Q7Y W;  1YIJ V;  4MVZ A;  3LUT B;  3ZHR A;  4I0X A;  4K8X A;  5IYZ A;  4LH6 A;  2YIB A;  4I7Z B;  1WN7 A;  3ZHU A;  3K08 A;  1D2D A;  5B3S C;  1Q81 W;  1EN4 A;  1M56 C;  2HLD G;  1YI2 V;  1Y74 A;  1AI7 A;  4J42 A;  1K92 A;  1Q3E A;  4JYB A;  4A5U B;  3JAK A;  4BW5 A;  5KUK A;  2HVK C;  4FLX A;  1WPB A;  3W7X A;  2ZE5 A;  4LFA O;  1BQZ A;  3T2M A;  4TSF G;  3E86 A;  3JCU Z;  2Q7E A;  1AI5 A;  2JIZ G;  1IBK B;  2UXC B;  2AW9 A;  2M7W A;  2YXY A;  4F4L A;  1VMG A;  2P7T C;  1VQL V;  4N23 A;  1QLN A;  1JVM A;  4DUY O;  1Z5W A;  1H2S B;  3EHB B;  5H6Q A;  3T1H O;  4D6T H;  3AG4 C;  2QEX V;  4PA4 A;  4KL1 A;  2HJF C;  3K9S A;  4F6E A;  5LOV B;  4DV1 B;  5CBH A;  2JGD B;  2KSD A;  1HNZ B;  2BSK B;  5KX5 B;  1AIL A;  4FZ1 A;  3RN4 A;  2DW4 A;  1E79 G;  3FYI B;  2CH7 A;  2EIM C;  2GSM B;  4FVM A;  5IJ9 B;  1FXH A;  3DXR B;  2HKO A;  4B3M B;  4DRX A;  3OGC C;  3ZRS A;  3UO3 A;  1OCZ B;  2IU0 A;  4OXS A;  4CBC A;  3H01 A;  3L75 H;  2LJ2 A;  4YY3 O;  1BMF G;  3RYC B;  3FYE B;  4W4K A;  1BGY H;  5D5P A;  3UM7 A;  3CD6 V;  3JYC A;  1FXV A;  4QE9 A;  3J81 N;  5EZY B;  1DTO A;  2Q68 A;  1GM7 A;  3B4S A;  4UCU A;  4IIJ A;  2Q4P A;  3CCS V;  3J7A U;  4TQD A;  1IBK O;  2XHB A;  3IFX A;  1XDC A;  3OR6 C;  4DR1 B;  3OD4 A;  4MVM A;  2DMX A;  2G38 A;  2ZCE A;  2HR3 A;  5FL7 G;  3EXA A;  2UUA B;  1BZK A;  3ZS8 C;  1K3E A;  4DR4 O;  1SQP H;  1QVF U;  2NLJ C;  4MVQ A;  4FFB A;  2HHH B;  2E76 B;  3RW0 A;  4J7K A;  3ASO B;  1RM1 B;  2ITD C;  4LC1 A;  4EFB A;  1WA8 B;  4MW3 A;  4FPP A;  1YZB A;  2VQE O;  5KHI A;  3SPH A;  3ZJZ A;  2EBO A;  3AG2 B;  3JCZ A;  2LO1 A;  1JMK C;  1SES A;  4JF3 A;  4AQY O;  3CRA A;  1TA8 A;  3CC4 V;  5EBW C;  1YSC A;  4JAS A;  4GKJ O;  1BT8 A;  4LF6 B;  2N05 A;  2HP8 A;  3AG4 B;  4DV4 B;  5J9P C;  2MK3 A;  4FIP C;  3RVZ A;  4Z2W A;  3T4D A;  3QF7 A;  1E1R G;  4J7Z A;  1XOU A;  5CA0 A;  2ZDI A;  2ZM6 B;  1YTF B;  1K5Q A;  2EIM B;  2FB5 A;  2XTA A;  4DR4 B;  4NYK A;  4DR7 O;  1K4C C;  1IBL B;  2GUZ A;  3CCR V;  1YJW V;  1CP9 A;  4YHH O;  4KHP O;  3ZMU A;  4PJ0 Z;  4GUN A;  4GYC B;  3CME V;  3A0H Z;  5LP6 C;  1MZE A;  4NXM B;  3P3P A;  2ZIM A;  4BIU A;  1QBZ A;  3CXH F;  2X6A A;  1GN4 A;  4ZHQ A;  2QSA A;  3CC2 V;  4GCZ A;  2IH1 C;  1D5A A;  4JTA B;  1N0N A;  1YIT V;  1JFF A;  2Q73 A;  2WLM A;  1NS1 A;  4OGQ B;  4MSW C;  4GT1 A;  5IJ0 A;  5IYZ B;  4P9O A;  3IAY A;  1IXM A;  1S3J A;  3IGA C;  1OV9 A;  2JRI A;  5C8Y A;  5B1A C;  3OT7 A;  4B3R B;  4JI6 B;  3K5N A;  1KP2 A;  4DV1 O;  3AG2 C;  1VF6 A;  3BAB A;  4D7S A;  3AG3 B;  4DO2 A;  4IYH A;  4HZ3 A;  2D2C B;  4I50 B;  5BY1 A;  1S77 D;  2GV9 A;  2EJR A;  3HR0 A;  3Q4H B;  3JSL A;  1EN6 A;  3WB1 A;  1R3L C;  1VQ8 V;  3M8A A;  1CPY A;  4FJC C;  1VF7 A;  4MTF A;  4I4T A;  1ZSP A;  3JAS B;  1Q8I A;  5L3F A;  1Y76 A;  3F7V C;  2BSK A;  5KX5 A;  4HNA A;  1SS3 A;  3CE2 A;  2ZNJ A;  2IJH A;  1AP5 A;  2XUM A;  3G67 A;  2F4V O;  5CN0 A;  1O9G A;  1NH2 B;  3BHP A;  1MG1 A;  4DW1 A;  1OCZ C;  1KU9 A;  2DYS C;  4IHJ A;  2H94 A;  2Q7G A;  3CHX A;  4I9Q A;  4RAI A;  2EJ7 A;  2OCC B;  4B3R O;  4TV9 B;  3SPC A;  4DW0 A;  4NXN B;  2Q0O C;  2PUS A;  3ZIA G;  4UUJ C;  2QGN A;  3WB0 A;  3JAL B;  1NVP B;  5EIB D;  1PKX A;  4IIJ B;  1K97 A;  3SYQ A;  5E1A C;  2QWP B;  2VQE B;  1H2G A;  2AZ0 A;  4NTX A;  2KKW A;  1U96 A;  2F23 A;  5L3D A;  5GON A;  5JVD A;  3ABM C;  4FZ0 A;  4O4J B;  4JYA O;  4H33 A;  5D5Q A;  3AG3 C;  5IDJ A;  1NU1 H;  2YXH A;  2FKX A;  4K0K B;  5JH7 B;  4GZR B;  4CS3 A;  2JDI G;  1H2K A;  4WBN A;  4DR5 O;  3ZRW B;  1V54 C;  2WLL B;  1V55 B;  2HHH O;  4DV2 B;  3GWO A;  2UUC O;  2YUA A;  4CS4 A;  4DV3 B;  2PF4 E;  1KD1 W;  4FMT A;  3O9O A;  3B09 A;  2W0F C;  1DF4 A;  3OTO B;  1L0L H;  1WB7 A;  3SJB C;  3AK3 A;  2RJZ A;  2ZDI C;  3K0D A;  1B3Q A;  4B7E A;  3A0R A;  3HKE B;  4JI3 B;  3ZCC A;  4KXR A;  3APO A;  1M56 B;  4I0X B;  2JS3 A;  2XAH A;  3RYI A;  2F93 B;  3A8T A;  2LGW A;  4DR6 O;  1JCH A;  3VQW A;  2F95 B;  1P7G A;  1TVK B;  2BCC H;  5KMG A;  5BMV A;  4TT3 G;  1NI8 A;  4DV0 B;  2R9I A;  4DV5 O;  4J41 A;  1OCC C;  4FLV A;  2OTJ V;  3QVN A;  4EB6 B;  1JX9 A;  4E4E A;  1Y4M A;  4IT5 A;  3E83 A;  5LMN B;  1JPX A;  3GWK C;  3JD0 A;  1VIB A;  3BY6 A;  4IL6 Z;  4FK5 C;  4JV5 B;  1HR0 O;  1R3J C;  4Q6G A;  2WWW A;  1Q6U A;  3SJC C;  4LF9 B;  2WA3 A;  3K03 A;  3CB2 A;  4DR7 B;  2RQ6 A;  5JWP A;  2R9A A;  1F23 A;  5B1N A;  2IW5 A;  4LFC O;  3ZED A;  4O4H A;  1S0V A;  2K9P A;  3AG1 C;  5IWA O;  1GRJ A;  3SDL A;  4G28 B;  4UXN A;  3D3I A;  4ZHQ B;  5FPO A;  4QPK A;  4PDV A;  2JGD A;  1XL6 A;  2A06 H;  4J80 A;  1UJW B;  4O4I B;  1A32 A;  1J5E B;  1EN5 A;  1HP8 A;  4LF4 B;  3JD1 A;  4JI2 B;  3CCE V;  3T4Z A;  2QDO A;  1SQQ H;  1F4M A;  3ASN B;  1YXB A;  4LH7 A;  5LGN A;  1I7F A;  3CCU V;  1S72 V;  3E8F A;  3DGE A;  4B08 A;  4DV5 B;  2BOB C;  3ZHT A;  1Q5O A;  2RCV A;  2PI5 A;  1BHA A;  2FYU H;  1FJG B;  5CB4 A;  3CCV V;  2Q8V A;  4JPR A;  1I94 B;  3A0B Z;  1GN2 A;  2Q67 A;  3DTU B;  2L35 A;  3W7T A;  4JV5 O;  5LMU B;  3Q4H A;  1WAZ A;  1ROP A;  4TWK A;  1O9H A;  2O57 A;  4K3A A;  4K8Z A;  2CAZ C;  2BTQ B;  1GH6 A;  4UCR A;  3AEI A;  5IWA B;  1GM9 A;  1KKC A;  2FL4 A;  4ICG A;  3TK1 A;  3C90 A;  1NH2 D;  3K58 A;  3AK2 A;  3L72 H;  2ITC C;  4E2L A;  4FLU A;  1H2M A;  3FB8 C;  4X1Y B;  1WA8 A;  3IC7 A;  1I5X A;  4LF4 O;  1ORQ C;  5IE9 A;  2H8P C;  1YTF D;  2HEP A;  4TUY A;  1NQT A;  4JYA B;  3K79 A;  3LSQ A;  5B5E Z;  2XAJ A;  5DM6 V;  1PNM A;  5KA6 A;  2UUB B;  1L8D A;  1IVS A;  2EIN B;  5LP6 A;  3JAL A;  1FJG O;  1N34 O;  4FM2 A;  4JI4 O;  3N2K A;  4RWU A;  4LF8 O;  2OWO A;  1XBL A;  2EUL A;  4YJ2 A;  3RGB A;  4EKW A;  1F51 A;  2NR5 A;  4K35 A;  4OPH A;  5GON B;  1BE3 H;  2QTS A;  4ZOL A;  4YJ3 B;  1OCC B;  3OTO O;  2E3C A;  4UCS A;  1U97 A;  1Y67 A;  5KA5 A;  2ZT9 B;  2HJD A;  3STL C;  4DK0 A;  5C93 A;  5JH7 A;  1OJH A;  4DR6 B;  3X2Q C;  2QWQ B;  3G71 V;  2AGA A;  2WLL A;  3JSN A;  3P30 A;  4R50 A;  3MAQ A;  4LF8 B;  2HVJ C;  2DQ3 A;  1V54 B;  1GM8 A;  1M4U A;  2N74 A;  2CTW A;  1NR7 A;  1AR1 B;  2WLN A;  3C3T A;  1RP3 B;  4WFE A;  3T1Y O;  1N32 B;  1EBO A;  4UCV A;  1M9N A;  5FNV B;  5IYB O;  3U0Z A;  1ZX3 A;  1GTO A;  2UUB O;  3HKE A;  5H9C A;  2OT5 A;  4QIW F;  4B3T O;  1OCO C;  1MOF A;  3RYI B;  3CC7 V;  4GX5 A;  3DXR A;  1FPO A;  1DK1 A;  1V55 C;  1COW G;  1TVK A;  3H1K H;  5KMG B;  2W6I G;  3RYF A;  1EM1 A;  2ZIN A;  1W59 A;  5B1B C;  3RT3 C;  2Q5Z A;  1QVG U;  3U11 A;  3RYC A;  4XDJ A;  1Z2G A;  2QWO B;  2D3O W;  5A2Q N;  1R6K A;  4GKK B;  3ABU A;  1VF6 C;  2BTO A;  3E8B A;  3SPJ A;  4DXW A;  1N33 O;  4FM0 A;  5LMN O;  4LWS A;  1NTM H;  3L71 H;  1JJ2 U;  1N8R W;  2DQ0 A;  1ZLZ A;  1TUB B;  1VQN V;  4LBE C;  1W2B U;  4KUM A;  3KG2 A;  4FFK A;  1SZX A;  4DR2 O;  3UQ8 A;  3ZN0 A;  1MMM A;  2DYR C;  2XT9 A;  5LA6 B;  1DGS A;  3FD9 A;  3E2E A;  2PTM A;  3F5W C;  1VEW A;  3BEH A;  3ASO C;  4DV7 B;  3UO2 A;  4MT8 A;  1T5E A;  2QM7 A;  1S5H C;  1HNZ O;  3G6B A;  1NZ6 A;  4HNA B;  3ABL C;  4TV8 B;  2JVD A;  1NR1 A;  2OIE A;  3JAT A;  4DR2 B;  4YXW G;  1QR8 A;  1G6U A;  4G2K A;  4JI8 O;  5K1X A;  3MD0 A;  3D36 A;  4IHJ B;  3N27 A;  4B3M O;  1M1K W;  1XNR O;  1H38 A;  5KHG A;  3CP1 A;  3T1H B;  1YCI A;  3ABK B;  4X65 B;  4QGP A;  1OCO B;  2WPD G;  1L1F A;  2ATK C;  1I94 O;  3OMI B;  4JZ2 A;  5H6R A;  4LNU A;  3OR7 C;  5JQG A;  4I55 A;  3OE7 G;  2V7Q G;  1GN6 A;  1D5N A;  2YID A;  4XDK A;  3G80 A;  1OCR C;  1K4D C;  1FXK C;  5IY5 C;  1NTZ H;  4QNH B;  3OUF A;  4WBN B;  4X62 B;  2ZXW C;  2CUG A;  4UCT A;  2ADQ B;  4ASU G;  3JAR B;  1KYO F;  1VAR A;  1WLE A;  1XUQ A;  2F4V B;  1EZV H;  2F43 G;  1BQ0 A;  3H1J H;  4FLZ A;  4U3J A;  5KAI Z;  4XBF A;  2FML A;  1R3I C;  1KEC A;  1ZUQ A;  2Y0P A;  1FFT B;  4J9Y B;  1I08 A;  3LNN A;  2ZIO A;  3RYH A;  5KAF Z;  4HYO A;  2CH7 B;  1NKD A;  5IJ9 A;  2YI9 A;  2DYR B;  2QTO A;  2CGN A;  2Y48 A;  5E79 Z;  4J9Z B;  2GBO A;  4R7C A;  4GKJ B;  1KP3 A;  5BMV B;  5JJN B;  2DE0 X;  2QWR B;  1THZ A;  4X20 B;  4HAM A;  2B5U A;  1VQ6 V;  5IYC O;  4ZOL B;  1ARO P;  3SR2 C;  3M99 B;  4FLT A;  5FLX N;  2UU9 O;  2Q9L A;  2VQF B;  1H2L A;  4I50 A;  2LGQ A;  2Y0I A;  3CWB H;  3ZX6 A;  5H5N A;  1LR1 A;  1URF A;  4JI2 O;  3L9D A;  5EIB C;  1NVP D;  3ETE A;  1N36 O;  1N4C A;  5GTH Z;  4AIL C;  2E75 B;  1WB8 A;  4JI1 B;  2PGG A;  4H37 A;  3K5M A;  4MTX A;  3WFV A;  1PNL A;  3I5D A;  2YEV B;  3FFQ A;  1SET A;  1QNM A;  3CMA V;  4OPA A;  3KKY A;  3JAS A;  3CJH A;  4DUY B;  1VQ4 V;  3G4S V;  4X1I A;  3AG1 B;  1XIL A;  1JR9 A;  3W7W A;  4QPJ A;  3OEH G;  4NTW A;  3IC9 A;  4WFA V;  2OYQ A;  4WFB V;  1IX9 A;  4PA6 A;  5JJJ B;  4CC6 A;  3DSQ A;  5AG2 A;  5DED A;  1F7Y A;  5HFL A;  2Q7H A;  1HNX O;  2GDS A;  5A9G A;  2VWK A;  1SQF A;  2P06 A;  1FS0 G;  1YJ9 V;  1SRY A;  5CB4 B;  4JI6 O;  2LP7 A;  2RNB A;  5CBF A;  2VRZ A;  1M5I A;  4G27 B;  5B3S B;  3OAA G;  4JI3 O;  1VF5 B;  4WFH A;  3IJ4 A;  5JVD B;  2CTP A;  5LMU O;  3OUS A;  3TGU H;  4L8J A;  2V1D A;  2BTQ A;  4IGG A;  1I0H A;  1WNS A;  5JJE B;  4PDM A;  2CK3 G;  3WU2 Z;  1WPX A;  1M93 A;  1X4T A;  3WG7 C;  3HKB A;  4DV0 O;  1YEW A;  2ADP A;  1FXK B;  5IY5 B;  3ETD A;  2VS0 A;  2GHY A;  3ZRW A;  3VQV A;  4RO2 A;  4JI0 O;  5KHH A;  4JI4 B;  3SYC A;  3JAT B;  4X1K B;  4YIP A;  4B3S O;  1GKF A;  3E8G A;  4F6R B;  3GB7 C;  3K0G A;  3HKC B;  4H0L B;  3ZMS A;  3OEE G;  5EK0 A;  2PYL A;  1JFF B;  1IDS A;  3OFN G;  2FTK A;  4NR1 A;  2KQX A;  4X9Q A;  5IJ0 B;  1VQP V;  3QG5 A;  2Y4T A;  5FPR A;  5L3B A;  5C8Y B;  3C3S A;  2VWJ A;  4LF6 O;  3K9A A;  4JTD B;  2AZ2 A;  5JQG B;  3ZHS A;  1K73 W;  2OIG A;  4O2A A;  1N32 O;  1SQV H;  3RVY A;  1K8A W;  3MHS C;  1HNW B;  1LNQ A;  3I55 V;  3R66 A;  3P32 A;  1W0J G;  3B8N A;  3OTF A;  2IBZ H;  4PEL A;  2KB1 A;  4IYI A;  1QU7 A;  4YY3 B;  1QLE B;  2WA4 A;  3CEI A;  1TAE A;  1KC8 W;  3SYP A;  1R3K C;  3UKM A;  3K5O A;  2DJV A;  2Z0A A;  5LBQ A;  4PV1 B;  1MZF A;  4X89 A;  2ZE6 A;  5CA1 A;  3OMA B;  4U3J B;  2DWE C;  2P5O A;  4O4I A;  4LCU C;  4JI7 B;  2KG7 B;  3SYA A;  2EZO A;  4EEQ A;  2EIJ B;  3HKD B;  3ICX A;  5JCO C;  2WAM A;  4X88 A;  3ASN C;  1JQ0 A;  3CRM A;  4PA9 A;  1KKD A;  2EIK B;  1Y74 B;  2H3O A;  4KP4 A;  3CCL V;  1AB3 A;  1UPG A;  1KMI Z;  5H2F Z;  3ZN1 A;  1YDX A;  5LGU A;  2K1E A;  1ZTE A;  4DV2 O;  2RN9 A;  3JAK B;  1S76 D;  4TQF A;  2XAF A;  1Q82 W;  3N2G B;  5KUM A;  2X6B A;  3U10 A;  4JI5 B;  4DV3 O;  4MVS A;  1HNW O;  1EFR G;  3FAV B;  4LWS B;  5J2T A;  2VQF O;  1IZ3 A;  4W4L A;  2UU9 B;  4ZKI A;  4MVR A;  4LF9 O;  1BHB A;  4LP8 A;  3TXS A;  3NXS A;  3FB6 C;  5J2U B;  3BRC A;  5EC2 C;  2A0L A;  5HFM A;  2QM4 A;  2EX3 A;  2YEV A;  1G1X B;  2LW1 A;  3CJH B;  2HG5 C;  1TUE B;  4MTO A;  4C7U A;  1K5S A;  3CRC A;  5DN6 G;  2YDE A;  1PL0 A;  1BSM A;  3L70 H;  1ZWI C;  4TUY B;  2ZNI A;  1Q90 D;  2P90 A;  2A3Q A;  3E89 A;  1XHZ A;  3BPZ A;  1PL4 A;  4UV8 A;  1TGO A;  2JK5 C;  4QJF B;  3LNM B;  3NR7 A;  4LFB B;  1CXZ B;  4DV4 O;  2LFS A;  4X8A A;  1LUW A;  4CC5 A;  3JAM N;  3LSS A;  4WFF A;  4BIO A;  4MVO A;  1OZ0 A;  2Y69 C;  4WCE V;  3N2K B;  5EYP B;  2JJ1 G;  2ZM6 O;  3BFR A;  1NJI W;  4YJ2 B;  2W0X A;  2WLJ A;  1AI4 A;  2P22 C;  1FYJ A;  4MS2 A;  3ZMV A;  3OM3 B;  4RQE A;  1QHT A;  2UXC O;  4UVC A;  3K06 A;  4H13 B;  4Q20 A;  3VQY A;  3HKB B;  1US6 A;  5LYJ B;  2Z5U A;  4N21 A;  3ZRX A;  4UFZ A;  4DR3 O;  2UXD O;  2XND G;  1AJP A;  2YIC A;  1IUR A;  2X7R B;  4R6Z A;  4PA3 A;  4LR3 A;  4O2B A;  4H44 B;  3B40 A;  3E8H A;  3JAR A;  4ABM A;  3PJS K;  4O4H B;  4B3S B;  1H2N A;  2OCC C;  1Y6X A;  2CE4 A;  4L87 A;  5LHH A;  3L74 H;  1R73 A;  2XOK G;  5IYD O;  4O4L B;  4RUE A;  1XNQ O;  3OW2 U;  2Q6A A;  1BL8 A;  1Y66 A;  4UB8 Z;  2W6J G;  1JOY A;  2OCH A;  1R1B A;  3MHH C;  2IH3 C;  3K57 A;  1AJQ A;  2WLI A;  1H8H G;  2EIK C;  3CS5 A;  3RWR D;  4PI2 A;  4D7T A;  4X20 A;  2JGU A;  3E22 B;  3H1H H;  4CH6 A;  1GO3 F;  2P4K A;  4FM1 A;  1K9M W;  4TOI A;  3ZMZ A;  1I5Y A;  1RPR A;  1LUV A;  1FFX B;  4JYY A;  1K7D A;  3RFR A;  1IXB A;  4DUZ B;  3VOU A;  1V9P A;  3FB7 C;  4CH5 A;  2NNU A;  3ETG A;  3EVK A;  2MW2 B;  1SQB H;  3ZRV A;  4DK1 A;  4CS2 A;  1FD9 A;  2XAG A;  4OX9 O;  1RFY A;  5BR8 B;  5LA6 A;  2B1G A;  3ZHQ A;  1Q86 W;  5LOV A;  5L3C A;  1KBH A;  2Y69 B;  4EFE A;  1SQG A;  3ABL B;  4PI0 A;  1B06 A;  3JAW B;  2QE7 G;  1Q43 A;  1YF2 A;  4GX1 A;  3ZMT A;  3THO A;  2QR4 A;  3F5T A;  2ZR2 A;  4X1Y A;  1VQK V;  1HDJ A;  1FAF A;  2QKS A;  4P30 A;  1M90 W;  2NN4 A;  3QO8 A;  2Z3Y A;  2AHZ A;  1QQC A;  4DR5 B;  2B9Z A;  3APQ A;  1M57 C;  4X66 O;  3AG7 A;  5KLV H;  1DF5 A;  2R72 A;  5L3G A;  3EFF K;  2YC0 A;  3X2Q B;  1XI1 A;  4Z1V A;  3JD4 A;  1NT2 B;  2GTA A;  2UXX A;  5LP6 B;  3AK1 A;  4ZI7 A;  1B6Q A;  1MA1 A;  3KCY A;  2EIJ C;  3O65 A;  4BAY A;  4LNU B;  4FLY A;  2QJ1 A;  4I55 B;  4RUF A;  2L6L A;  2HFE C;  4AI8 A;  4YJ3 A;  1SKV A;  3CYO A;  3LDD A;  3VBB A;  2Q69 A;  3TCU A;  2PY5 A;  3GVM A;  1ZL8 B;  1GMG A;  4ZIB A;  3SJA C;  2PI4 A;  1Y76 B;  1W0K G;  1XEQ A;  3WB2 A;  4YHH B;  2IJI A;  4R8C A;  3CXC U;  1F4N A;  3H1I H;  2YS8 A;  2ZQM A;  1YVW A;  3B2E E;  1AR5 A;  1GAX A;  2CTR A;  4LF5 O;  1CEZ A;  3R65 A;  3ZHV A;  2CTQ A;  1SC5 B;  3ABT A;  3HKC A;  1MSD A;  1NTK H;  2X6C A;  1XMQ O;  4NVP A;  3BA9 A;  4UVA A;  5DEC A;  2Y4U A;  5FNV A;  1RM1 C;  1L0N H;  2C2A A;  3TJT A;  2JEU A;  4PA7 A;  3RYH B;  1XNR B;  1G8M A;  5LHG A;  1GK9 A;  3LDC A;  1PV0 A;  3TET A;  1JJO A;  4U7N A;  2F1M A;  3CX5 F;  3SJQ C;  4X65 O;  1KB9 F;  3K3W A;  2YXL A;  5CBG A;  3K5L A;  1N34 B;  1AVM A;  2QKC A;  1WP7 A;  3STZ C;  4MW8 A;  2IU3 A;  4UB6 Z;  4O4J A;  5CA0 B;  5CA3 A;  1PP9 H;  3D8C A;  1DLB A;  2EIL B;  2PYJ A;  3B8M A;  3FX7 A;  4BIZ A;  5LYJ A;  5BXZ A;  4B7K A;  1NBM G;  1IBM O;  2XAQ A;  2GUZ B;  1FKA O;  1ENV A;  4NTY A;  1TUB A;  2WLK A;  3ML0 A;  2JS5 A;  4Z1M G;  1E1Q G;  2UXD B;  4AQY B;  1SQX H;  1MAB G;  5KHK A;  2CDY A;  2DWD C;  1P7B A;  5CA1 B;  3CCQ V;  3CRR A;  5K1P A;  1S5L Z;  5GW7 A;  5GTI Z;  2OTL V;  4JAV A;  3K04 A;  4P2Z A;  4TV8 A;  1OCR B;  3ABM B;  3CPW U;  5EC1 C;  3SPI A;  1WJZ A;  4B3T B;  2ILM A;  2WLI B;  2DOS A;  3J80 N;  3S3W A;  1SA0 A;  3W7U A;  2E5L O;  4NXN O;  4CH3 A;  2JJ2 G;  5EBL C;  5ITZ A;  5B1A B;  2ARH A;  1SF9 A;  3E22 A;  5BR8 O;  3G6E V;  1IBL O;  5LHI A;  2UUC B;  4X62 O;  1M57 B;  3N2G A;  3M7M X;  5LL6 Y;  2AXT Z;  2PZS A;  2ZKO A;  3JD2 A;  1FFX A;  2ZXW B;  4QE7 A;  5LGT A;  5J2T B;  3FKS G;  1RSO B;  4GKK O;  3BA8 A;  3SGI A;  2QM8 A;  1IBM B;  4UCO A;  2P6J A;  1R6N A;  2Q0A A;  2YIA A;  4JAU A;  4FLW A;  5J2U A;  3E35 A;  1ZAU A;  4K0K O;  2IJJ A;  4I4T B;  4I5S A;  1QR9 A;  2XAS A;  5LXT A;  1XRE A;  4OX9 B;  1P84 F;  4JI1 O;  4LFB O;  3QTC A;  3QO5 A;  5IT9 N;  3LSU A;  1P49 A;  3VQX A;  2EIN C;  3JAW A;  3UT5 B;  4X64 O;  1VQO V;  1PNK A;  3QNE A;  2R9R B;  3QO7 A;  3KZI Z;  4JTC B;  4WF9 V;  5JCO A;  1N0J A;  1VQM V;  1VP7 A;  5B66 Z;  4PHZ A;  3KCX A;  4NB5 A;  2RDC A;  4AHC A;  2N04 A;  1N36 B;  4DV6 B;  3CCJ V;  1HNX B;  3P3N A;  1YJN V;  4U7O A;  2ZR3 A;  3CRQ A;  4ZI7 B;  4X66 B;  1XMO O;  5EYP A;  3L73 H;  3RBZ A;  4GX2 A;  1SZT A;  4CH4 A;  2QA4 V;  3DC6 A;  2M6Y A;  2V4D A;  3DC5 A;  4LFA B;  4RQF A;  2ZE8 A;  4LF7 O;  2A79 B;  1HR0 B;  1ZL8 A;  3SPG A;  2LW7 A;  1XNQ B;  5EBM C;  4MTG A;  4LFC B;  3F7Y C;  4MVU A;  2YI8 A;  5B1O A;  3BAA A;  1MSW D;  4X64 B;  2YIB D;  4O2B B;  1AJN A;  4DR3 B;  1VQ5 V;  3OMN B;  2ZD9 A;  5TIS Z;  3ZBH A;  1EZJ A;  2LQT A;  1PM9 A;  4J7J A;  2B1I A;  4JI0 B;  1PD3 A;  3MDS A;  3UCS C;  2JEX A;  1P4R A;  2IJK A;  4X1I B;  1X59 A;  4GLX A;  1MNG A;  4O4L A;  1XMQ B;  1H8E G;  3HKD A;  4DV6 O;  4UV9 A;  3CCM V;  1Z5V A;  4DRX B;  1KUQ A;  4U3F H;  2ZE7 A;  1VQ7 V;  4BR6 A;  4EB6 A;  3WG7 B;  2P4V A;  4PDR A;  3D36 C;  3OGI B;  1AP6 A;  1XQ8 A;  1XHX A;  1PPJ H;  2DN9 A;  3HB3 B;  3I56 V;  3A2F A;  3JD3 A;  3SYO A;  4JGS A;  1R6T A;  5EZY A;  2ETN A;  4JI8 B;  3K59 A;  1UFI A;  1BCC H;  3FAV A;  1AR4 A;  1QLE C;  3ETQ A;  1SER A;  3S3X A;  2RMK B;  3H1L H;  1OHH G;  1B04 A;  4DUZ O;  3FB5 C;  2E5L B;  1AI6 A;  1QCE A;  2A7W A;  2UXB B;  2A9H A;  3D3Q A;  4DV7 O;  3BVO A;  1VQ9 V;  2UXN A;  2WLH A;  4JZG A;  4FFB B;  1FXK A;  4YIO A;  3ABK C;  2EIL C;  1S5J A;  4BW9 A;  4J11 A;  1YHQ V;  4DR1 O;  1HWY A;  4JI7 O;  1JA8 A;  4X1K A;  2DYS B;  1Q6I A;  2WSS G;  1RPO A;  4BWA A;  3TXQ A;  2EZP A;  4F6R A;  1SA0 B;  3RYF B;  2R70 A;  2UXB O;  4I9W A;  2UUA O;  5ITZ B;  5KHJ A;  2LFR A;  3T1C A;  1XL4 A;  4ZBM A;  1G4Y B;  4TV9 A;  4XDL A;  1HW7 A;  1Q6H A;  1K33 A;  2E74 B;  3T1Y B;  4JAA A;  4CZZ A;  2P67 A;  4J10 A;  3BCC H;  1RSO A;  5F2V O;  4JI5 O;  3CSX A;  4WFG A; 
#chains in the Genus database with same CATH homology
 3M99 B;  2W0F C;  4UVB A;  2QE7 G;  1DF4 A;  4GX1 A;  3ZMT A;  2ZR2 A;  1VQK V;  2ZDI C;  3K0D A;  2AHY A;  2QKS A;  4P30 A;  1M90 W;  3A0R A;  3QO8 A;  5B1B B;  3ZCC A;  2Z3Y A;  2AHZ A;  1NVP D;  3ETE A;  1M56 B;  2XAH A;  5L3E A;  1K34 A;  3HPL C;  4GX0 A;  3LDE A;  1M57 C;  4PDL A;  1JCH A;  4H37 A;  4KFM A;  5BZB A;  4MTX A;  3WFV A;  1PNL A;  2YEV B;  5L3G A;  1DF5 A;  3EFF K;  4TT3 G;  1SET A;  3X2Q B;  2R9I A;  3CMA V;  2YSU B;  3JD4 A;  2X0L A;  1VQ4 V;  2UXX A;  1OCC C;  3G4S V;  2OTJ V;  3AG1 B;  1B6Q A;  3W7S A;  2EIJ C;  3W7W A;  1JX9 A;  4QPJ A;  3OEH G;  1Y4M A;  4BAY A;  3E83 A;  1KQS U;  1JPX A;  3JD0 A;  3BY6 A;  4JYC A;  5CMU A;  3B77 A;  4RUF A;  4WFA V;  4FK5 C;  4WFB V;  4P9P A;  2HFE C;  4PA6 A;  1R3J C;  2BOC C;  3CYO A;  2WWW A;  1J95 A;  3LDD A;  3VBB A;  1Q7Y W;  2Q69 A;  3TCU A;  1YIJ V;  4MVZ A;  3K03 A;  3LUT B;  5HFL A;  1GMG A;  2PI4 A;  1F23 A;  5B1N A;  1W0K G;  3K08 A;  2IW5 A;  1FS0 G;  1YJ9 V;  5B3S C;  1Q81 W;  1M56 C;  2IJI A;  1S0V A;  1SRY A;  2HLD G;  3AG1 C;  1YI2 V;  4R8C A;  4G28 B;  3CXC U;  1F4N A;  1AI7 A;  4UXN A;  2LP7 A;  3D3I A;  1K92 A;  2ZQM A;  4QPK A;  4PDV A;  4JYB A;  5CBF A;  1XL6 A;  5KUK A;  4BW5 A;  2HVK C;  1CEZ A;  3W7X A;  3R65 A;  1UJW B;  4G27 B;  5B3S B;  3ABT A;  3JD1 A;  2X6C A;  3OAA G;  3E86 A;  4TSF G;  3T2M A;  1AI5 A;  3CCE V;  4UVA A;  3T4Z A;  2JIZ G;  4WFH A;  1F4M A;  3ASN B;  3OUS A;  1RM1 C;  2M7W A;  4F4L A;  2V1D A;  5LGN A;  3CCU V;  2P7T C;  1VQL V;  1S72 V;  2C2A A;  4N23 A;  2JEU A;  4PDM A;  2CK3 G;  4PA7 A;  1WPX A;  1QLN A;  3E8F A;  3WG7 C;  1G8M A;  5LHG A;  1GK9 A;  3LDC A;  3TET A;  3DGE A;  1JVM A;  2BOB C;  4U7N A;  1FXK B;  5IY5 B;  3EHB B;  3ETD A;  5H6Q A;  2GHY A;  2PI5 A;  1BHA A;  3AG4 C;  3SJQ C;  3ZRW A;  2QEX V;  3CCV V;  4PA4 A;  3K3W A;  5CBG A;  4JPR A;  2HJF C;  4RO2 A;  5CBH A;  3SYC A;  3STZ C;  4MW8 A;  2IU3 A;  2Q67 A;  3DTU B;  3W7T A;  5CA3 A;  1GKF A;  2DW4 A;  1E79 G;  3E8G A;  3GB7 C;  3K0G A;  3FYI B;  1DLB A;  1ROP A;  2EIL B;  2EIM C;  2GSM B;  3B8M A;  3OEE G;  4TWK A;  5EK0 A;  3ZMS A;  4BIZ A;  1FXH A;  1NBM G;  2HKO A;  3OFN G;  3OGC C;  3ZRS A;  2XAQ A;  1OCZ B;  2FTK A;  1ENV A;  2IU0 A;  3AEI A;  4OXS A;  2WLK A;  4CBC A;  3ML0 A;  1GM9 A;  3H01 A;  4Z1M G;  1E1Q G;  1VQP V;  1MAB G;  1BMF G;  3TK1 A;  5L3B A;  3FYE B;  1NH2 D;  3UM7 A;  3K9A A;  4JTD B;  3CD6 V;  2DWD C;  2ITC C;  3JYC A;  4E2L A;  1P7B A;  1FXV A;  3FB8 C;  4QE9 A;  1K73 W;  3CCQ V;  1DTO A;  3IC7 A;  1I5X A;  2Q68 A;  1GM7 A;  1ORQ C;  5GW7 A;  2H8P C;  3CCS V;  1YTF D;  2OTL V;  1NQT A;  3IFX A;  3OR6 C;  3RVY A;  1K8A W;  3MHS C;  4JAV A;  3K04 A;  1LNQ A;  3I55 V;  4P2Z A;  4MVM A;  3K79 A;  3LSQ A;  1OCR B;  3ABM B;  2XAJ A;  3P32 A;  1W0J G;  5DM6 V;  1PNM A;  3B8N A;  5KA6 A;  3CPW U;  4PEL A;  5EC1 C;  2HR3 A;  2KB1 A;  3SPI A;  5FL7 G;  2WLI B;  3W7U A;  1QLE B;  2EIN B;  1K3E A;  2JJ2 G;  1QVF U;  2NLJ C;  4MVQ A;  5EBL C;  5B1A B;  1KC8 W;  3SYP A;  1R3K C;  3G6E V;  3RW0 A;  3UKM A;  5LHI A;  3ASO B;  5LBQ A;  1M57 B;  1RM1 B;  4X89 A;  2ITD C;  3OMA B;  4LC1 A;  4EKW A;  4MW3 A;  1F51 A;  3JD2 A;  4FPP A;  2ZXW B;  4QE7 A;  5LGT A;  2DWE C;  3FKS G;  1OCC B;  4LCU C;  3SYA A;  2QM8 A;  3SPH A;  5KA5 A;  2EZO A;  2EIJ B;  3ZJZ A;  2EBO A;  1R6N A;  2P6J A;  2WAM A;  3AG2 B;  4X88 A;  3STL C;  4JAU A;  3JCZ A;  3ASN C;  1JQ0 A;  4PA9 A;  3E35 A;  1KKD A;  1SES A;  5C93 A;  2EIK B;  4JF3 A;  3X2Q C;  3G71 V;  2IJJ A;  4KP4 A;  3CCL V;  2WLL A;  3P30 A;  5EBW C;  1YSC A;  3CC4 V;  4I5S A;  1QR9 A;  2XAS A;  4JAS A;  2HVJ C;  4R50 A;  2DQ3 A;  3ZN1 A;  5LGU A;  1V54 B;  1GM8 A;  2K1E A;  3QO5 A;  1S76 D;  3AG4 B;  1NR7 A;  1AR1 B;  2WLN A;  2XAF A;  2EIN C;  1Q82 W;  5J9P C;  4WFE A;  2MK3 A;  2X6B A;  5KUM A;  1VQO V;  4FIP C;  1EBO A;  3RVZ A;  1PNK A;  3T4D A;  3QNE A;  2R9R B;  3QO7 A;  1M9N A;  4MVS A;  1E1R G;  1EFR G;  4JTC B;  4WF9 V;  2ZDI A;  1VQM V;  1YTF B;  5IYB O;  1GTO A;  5H9C A;  2OT5 A;  4QIW F;  4ZKI A;  4MVR A;  1K5Q A;  2EIM B;  1OCO C;  1MOF A;  1BHB A;  4LP8 A;  3NXS A;  3FB6 C;  3CC7 V;  4GX5 A;  5EC2 C;  5HFM A;  2A0L A;  1V55 C;  1K4C C;  1COW G;  2YEV A;  3CCJ V;  3CCR V;  1YJW V;  1CP9 A;  2W6I G;  1YJN V;  5B1B C;  3ZMU A;  2HG5 C;  4U7O A;  3CME V;  1QVG U;  2ZR3 A;  1TUE B;  4XDJ A;  2D3O W;  4MTO A;  1K5S A;  1R6K A;  4BIU A;  3ABU A;  3RBZ A;  4GX2 A;  3E8B A;  1SZT A;  1QBZ A;  3SPJ A;  5DN6 G;  2X6A A;  4DXW A;  1PL0 A;  2QA4 V;  3CC2 V;  4GCZ A;  2IH1 C;  4RQF A;  4JTA B;  1YIT V;  1ZWI C;  2A79 B;  2P90 A;  2WLM A;  1JJ2 U;  1N8R W;  3E89 A;  2DQ0 A;  4MSW C;  4GT1 A;  3SPG A;  4LBE C;  1VQN V;  4P9O A;  1W2B U;  4UV8 A;  4KUM A;  3KG2 A;  2JK5 C;  4QJF B;  1IXM A;  3ZN0 A;  1S3J A;  3IGA C;  2DYR C;  3LNM B;  5EBM C;  4MTG A;  3F7Y C;  4MVU A;  2LFS A;  5B1A C;  5B1O A;  1MSW D;  3E2E A;  4X8A A;  3F5W C;  1AJN A;  3LSS A;  4WFF A;  1VQ5 V;  3OMN B;  3BEH A;  2ZD9 A;  1KP2 A;  4MVO A;  3ASO C;  1EZJ A;  3AG2 C;  4MT8 A;  2QM7 A;  1OZ0 A;  2Y69 C;  1S5H C;  4WCE V;  3AG3 B;  2B1I A;  2JJ1 G;  4DO2 A;  3ABL C;  4HZ3 A;  1PD3 A;  1NJI W;  2WLJ A;  1NR1 A;  2JEX A;  1AI4 A;  1P4R A;  2IJK A;  1S77 D;  4MS2 A;  3ZMV A;  3OM3 B;  4RQE A;  2EJR A;  4UVC A;  4YXW G;  3K06 A;  1QR8 A;  1H8E G;  4G2K A;  4Q20 A;  4UV9 A;  1VQ8 V;  1R3L C;  3MD0 A;  3D36 A;  3CCM V;  1M1K W;  2Z5U A;  4N21 A;  3ZRX A;  1H38 A;  1CPY A;  4FJC C;  2XND G;  1AJP A;  3CP1 A;  4MTF A;  2X7R B;  4R6Z A;  3ABK B;  4PA3 A;  1VQ7 V;  5L3F A;  1OCO B;  2WPD G;  3E8H A;  1L1F A;  3F7V C;  2ATK C;  3PJS K;  3OMI B;  4PDR A;  3WG7 B;  5H6R A;  3HB3 B;  2IJH A;  3I56 V;  3JD3 A;  3SYO A;  4JGS A;  3OR7 C;  2OCC C;  3OE7 G;  2V7Q G;  4L87 A;  5LHH A;  5CN0 A;  1R73 A;  1QLE C;  4XDK A;  2XOK G;  5IYD O;  1NH2 B;  1SER A;  4RUE A;  1MG1 A;  1OCR C;  3OW2 U;  1K4D C;  1OHH G;  2Q6A A;  1OCZ C;  2DYS C;  1BL8 A;  1FXK C;  5IY5 C;  1Y66 A;  2H94 A;  2W6J G;  3FB5 C;  1JOY A;  3MHH C;  4RAI A;  2IH3 C;  2OCC B;  3SPC A;  1AI6 A;  1QCE A;  1AJQ A;  2WLI A;  4QNH B;  2A9H A;  3OUF A;  1H8H G;  2EIK C;  2ZXW C;  3ZIA G;  4UUJ C;  1VQ9 V;  2UXN A;  2WLH A;  1NVP B;  1PKX A;  4ASU G;  1FXK A;  3ABK C;  1GO3 F;  1WLE A;  2EIL C;  1K97 A;  3SYQ A;  5E1A C;  1K9M W;  1YHQ V;  2F43 G;  1H2G A;  1I5Y A;  3ZMZ A;  1HWY A;  1RPR A;  5L3D A;  4XBF A;  1K7D A;  3ABM C;  2DYS B;  2WSS G;  1R3I C;  1KEC A;  1RPO A;  4H33 A;  3VOU A;  3FB7 C;  2EZP A;  1FFT B;  4J9Y B;  2NNU A;  3ETG A;  3AG3 C;  5IDJ A;  4HYO A;  4I9W A;  3ZRV A;  1NKD A;  2DYR B;  2LFR A;  2QTO A;  3T1C A;  2Y48 A;  2XAG A;  1XL4 A;  4J9Z B;  4ZBM A;  1G4Y B;  4XDL A;  2JDI G;  4R7C A;  3ZRW B;  1KP3 A;  1K33 A;  2B1G A;  1V54 C;  2WLL B;  1V55 B;  3GWO A;  1THZ A;  4CZZ A;  5L3C A;  1Q86 W;  2P67 A;  4HAM A;  2B5U A;  1VQ6 V;  2Y69 B;  5IYC O;  1KD1 W;  1ARO P;  3ABL B;  4FMT A;  4WFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...