4R50A

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with li+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
KEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r50A00
1R3LC 3ASOC 3SJQC 2X6CA 5B1AC 4QNHB 4H37A 2K1EA 2EIJC 4GX2A 4HYOA 4UUJC 4WFFA 4XDLA 3E8HA 4GX5A 3K03A 4R50A 3OGCC 3EFFK 2HG5C 4MVMA 3RBZA 2QKSA 3KG2A 4LBEC 4KFMA 4MVUA 3T4ZA 3IFXA 4XDJA 5B1BC 2A0LA 4P2ZA 4EKWA 1M57C 3F7YC 1XL6A 5EC2C 1OCRC 2X6BA 3ZJZA 2DWDC 3LDEA 3LNMB 4PDVA 2DWEC 5B3SC 3ABLC 4MVOA 5EBWC 2A9HA 3AG1C 1KKDA 4MTGA 3STLC 1BL8A 2WLNA 4RUEA 2QTOA 3SYOA 5EC1C 4MVZA 4PA4A 3RVYA 3OR7C 4MVQA 1OCZC 2W0FC 4GX1A 3SYAA 4QE7A 1ZWIC 3UKMA 4PA7A 3SPIA 2EIMC 4P9PA 1R3JC 3ABKC 1J95A 3SYCA 3ASNC 3E83A 2P7TC 4P9OA 3K04A 2OCCC 3OUFA 4XDKA 3STZC 4RUFA 3F5WC 2X6AA 3HPLC 4GX0A 4QE9A 1M56C 3TCUA 5CBHA 1P7BA 3BEHA 3K06A 4TWKA 2BOCC 4JTCB 2AHYA 4MSWC 5E1AC 2WLIB 1K4CC 4H33A 4HZ3A 4WFEA 3OR6C 3UM7A 1V55C 3F7VC 4MTOA 2H8PC 4RO2A 3FB8C 4MVRA 4MW8A 3SYPA 4F4LA 3GB7C 2BOBC 4R7CA 4OXSA 2Q67A 4DXWA 4PDRA 2Q6AA 4X89A 2KB1A 4PA3A 4J9YB 4RAIA 3R65A 2AHZA 2ITCC 4WFHA 5EBLC 3E86A 2Q69A 4MTFA 2ATKC 2DYSC 3AG3C 2EINC 4PA9A 3RW0A 3ZRSA 5CBFA 3LUTB 3ABMC 2WLKA 4MVSA 2Y69C 3E8GA 3TETA 4BW5A 3K08A 3SPHA 5CBGA 4PA6A 4LP8A 3E8FA 3RVZA 4P30A 5BZBA 3IGAC 5EBMC 1ORQC 1QLEC 2WLIA 4LCUC 4R6ZA 2A79B 3FB5C 3VOUA 1S5HC 2WLLB 2WLLA 1JVMA 2IH1C 4MS2A 1OCCC 4G27B 2WLJA 1G4YB 2EIKC 2ZXWC 3E8BA 3E89A 3K0DA 4PDMA 5J9PC 3FB6C 4CBCA 5KUKA 1V54C 2DYRC 2WLMA 1K4DC 5IY5C 2HJFC 3LDCA 2HVKC 4X88A 3X2QC 2Q68A 3PJSK 3T1CA 4X8AA 3JYCA 5KUMA 4J9ZB 2ZD9A 4I9WA 2HFEC 4PDLA 4WFGA 3SPGA 3OUSA 2R9RB 3SYQA 4G28B 4JTDB 4R8CA 1R3KC 1OCOC 3T2MA 1LNQA 2NLJC 3FB7C 3WG7C 2HVJC 2YEVA 2EILC 5EK0A 3AG2C 4ZBMA 1XL4A 3AG4C 4JTAB 3LDDA 3SPCA 3SPJA 3K0GA 2WLHA 3T4DA 1R3IC 4MW3A 2ITDC 2IH3C 2JK5C
chains in the Genus database with same CATH superfamily
3ASOC 2XT9A 4QNHB 1SQFA 4JI1O 4GX2A 5CMUA 4JI5O 1TUBA 4IGGA 4Z2WA 5B1BB 3OT7A 2W0XA 1S77D 3CCLV 1IZ3A 4PDVA 3ABLC 2QWNB 2GTSA 4YJ3A 2XAFA 4LH7A 2QTOA 3CCEV 4P9PA 2FMLA 4DV4O 3R66A 3SJBC 1VF7A 1FD9A 5LBQA 1M5IA 3TCUA 5CBHA 1N0JA 1P7BA 2IJKA 4WFEA 3FAVA 4UCRA 1AI5A 4JI7B 1KBHA 2Q67A 4UV9A 5BR8B 4LNUB 2AHZA 3D36C 1LUWA 5CA0A 3JALB 1X4TA 4TQDA 3JATA 5CBGA 4CH5A 2P90A 3CMEV 1Z2GA 2YEVB 2MW2B 5LL6Y 4F6RA 2EIKB 2ZXWB 4CBCA 1L0NH 3CRMA 1NU1H 1PNMA 1D2DA 2O57A 2Q0OC 1AJPA 1BMFG 2QM8A 1P84F 4TUYA 3K5LA 1K5QA 4JI6O 5L3CA 3AK2A 3OEEG 1XMOB 3OTOB 3WG7C 2RQ6A 1XNRB 3ZMZA 1AP6A 1PM9A 2E75B 5B1AB 4DV7O 4AHCA 3FYIB 4CS4A 2BCCH 3EFFK 4JZGA 4NXMB 1RSOB 2CAZC 1XHZA 2DQ0A 4O2BA 1M57C 2Y4TA 3OMNB 2HP8A 1HDJA 1H2GA 3NR7A 4JASA 4J7KA 1F4NA 2FB5A 3JCZA 1YZBA 1EN4A 1BS3A 3JARA 2RMKB 2Q7HA 3SYAA 1K7DA 1X59A 2QWQB 4CH4A 1DK1A 1J95A 4LF4O 1JR9A 3ASNC 3SYCA 3OFNG 3I5DA 1GM7A 4IIJA 3ZEDA 1XILA 1Q5OA 1AR1B 2ZE6A 3GWOA 1NZ6A 1SESA 1KD1W 5JCOC 2ZCEA 3RYCA 1JFFB 4MW8A 4W4KA 3JASB 2ZDIA 2V4DA 1YIJV 4X65B 4J9YB 4FM2A 3JAWB 1R6TA 3JAMN 3H1HH 4G2KA 1ROPA 3BPZA 4DR6O 1I94O 3SGIA 2WLLB 5IWAB 2DE0X 5EZYB 2UXDB 5HFMA 4GKJO 4X62B 1ZLZA 1CEZA 2IJJA 3CCMV 2HEPA 3P32A 4QPKA 2UUBO 2Q68A 1IBLB 2CTWA 3JD4A 2ADQB 1KECA 3T1YO 3JSNA 3B09A 4L87A 3T2MA 1PL4A 4JYBA 1GN4A 3RN4A 2UXBB 3G6EV 4DR4B 1R1BA 1Q6HA 1L0LH 4YHHO 4PV1B 4NKGB 2K1EA 2EIJC 3HKDB 4AILC 4U3JB 2Q7GA 5KA5A 2HG5C 3D3QA 4TV8A 1IDSA 5JH7B 1VQ8V 2X7RB 1VP7A 2RN9A 2ZR2A 2X6BA 1HR0B 4O4IA 3BY6A 4YJ3B 3EXAA 2GDSA 1I7FA 5CN0A 1H2LA 3SJCC 1OCZB 1IXBA 3APOA 4DV6B 3P3NA 5L3BA 1R3JC 3ABKB 4JAVA 3L71H 1AR4A 4QE9A 1IVSA 1XI1A 1KB9F 4FFKA 5JJEB 3BEHA 1NS1A 5KX5B 2OWOA 1GRJA 1B04A 3UO2A 1BHBA 1V55B 5L3DA 4MVRA 4LFBB 4LWSA 3W7SA 1VARA 4U7OA 4IYHA 4FIPC 1L1FA 4PELA 2ODMA 4FM0A 1FXKC 4CS2A 2QWOB 4FFBA 4FZ1A 1NKDA 2YC0A 2Z3YA 4LFCB 3JATB 1G6UA 5JJJB 4TQFA 1WB8A 3CCRV 1AR5A 1XNQO 2WLIA 3ZIAG 2A79B 1GTOA 4HAMA 4YIOA 1K92A 2BTOA 4F6RB 3J7AU 1ZAUA 3HKEB 4NTWA 1VF6C 4DUZO 3H1JH 2A06H 1FFXB 1KUQA 3T1HB 2FL4A 4TUYB 1VQ9V 2JVDA 2BSKB 1OZ0A 4QGPA 1OCOB 4ZI7B 4X66B 2EILC 4ZOLA 4I0XA 2VWJA 3PN1A 2OIGA 4H13B 4NXNO 1R3LC 3E22A 2DMXA 1KP3A 1S72V 5KHKA 2DQ3A 3OGCC 2EBOA 1YSCA 3P3PA 1ZX3A 5LGUA 2JGUA 3JCUZ 1OCRC 1IURA 3FFQA 1RP3B 1BSMA 2Q5ZA 4X1IA 5LYJB 2A7WA 3G6BA 4JZ2A 4O2AA 5EC1C 3ZHVA 3ZHUA 2MK3A 5HFLA 1EM1A 2ZIMA 2IU3A 1L8DA 4RUFA 1YHQV 1YI2V 2PZSA 3ZHTA 4JTCB 4LF9B 5KHHA 3CXHF 3OR6C 3U10A 3HB3B 3RYCB 2CGNA 2P06A 5KMGA 5J2UA 3WB2A 3GB7C 2DOSA 4OXSA 2Q6AA 1VQ7V 4OGQB 4UXNA 2P22C 3D36A 4EB6A 5LGNA 1H2MA 1KYOF 5IJ9A 2LW1A 4DV0O 2Y0IA 4OX9O 4OPHA 2GV9A 4LF5O 3CHXA 4LF6O 1S5HC 4ICGA 4ZKIA 1MOFA 1ZTEA 3FKSG 4RWUA 2LFRA 3ZMSA 4OPAA 1V54C 5H6QA 5KHGA 1K8AW 2DYRB 4JYAB 4LNUA 1YDXA 2V7QG 3UO3A 1PNKA 3PJSK 3JYCA 4FLVA 2HJDA 1AI7A 1XQ8A 2VQFO 1G8MA 4BIUA 2YEVA 3CCUV 3AG2C 3K57A 3E35A 5DM6V 1WJZA 2F1MA 2R70A 3LNNA 3TXSA 2QM7A 2ZINA 4B3SO 3L70H 1R3IC 2JK5C 3RYHB 1JJ2U 2N74A 4GX5A 3VQVA 3BA9A 2OCHA 3VQWA 1AVMA 4TV8B 4WBNA 4LBEC 4MVUA 4KFMA 3JD0A 2WSSG 4EKWA 5LMUB 1Q81W 2QWPB 5LGTA 4O4IB 2F4VB 4I9QA 2B1GA 4UVCA 1N34B 2ZE7A 4PA4A 2QM4A 2GTAA 4FZ0A 3UKMA 2EIMB 2PI5A 2IJHA 4UCSA 4KHPO 2H3OA 3OW2U 1H8EG 3ICXA 1UJWB 3CE2A 3RYIA 5ITZA 2X6AA 3K5NA 4B3TO 4JI3O 3CRQA 3RWRD 3F7VC 4RO2A 3FB8C 2YXYA 4I7ZB 3DC6A 5JCOA 4Z1VA 1TVKB 4WFBV 4H0LB 2YIBA 1VQ4V 2V1DA 4LF7B 4PDRA 2Q4PA 4PA3A 1HNZB 1NVPD 1U97A 2LO1A 2ZE8A 2OYQA 2EINB 4FFBB 4PA9A 4TV9A 3ABMB 2JS5A 1MSWD 3TETA 4WFAV 3CX5F 1NR7A 1ORQC 4NTYA 4JI0B 2IU0A 2P6JA 4LCUC 1WA8A 3JD2A 1Q86W 5B1OA 3QO8A 4JAUA 1G4YB 3K0DA 1I08A 1M9NA 5IY5B 3SDLA 3JAWA 2ZNIA 4X8AA 5KUMA 4I9WA 1VMGA 4JI7O 4D7SA 1JQ0A 1R3KC 5BR8O 1FKAO 3H01A 4I0XB 3LSQA 2YDEA 2H94A 3FD9A 3ASOB 5FPOA 3CEIA 5EZYA 1R6NA 5IYCO 1S0VA 1IXMA 2QR4A 4DR7B 4X1KA 1NH2B 2B9ZA 3G67A 3BVOA 5EIBC 2HKOA 4DR3O 3QF7A 1HNXB 5FNVA 3ABLB 4MVOA 5H2FZ 2A9HA 4FLYA 1BL8A 4O2AB 1Q3EA 1XUQA 3QTCA 2FYUH 4JI8O 1SERA 3CJHA 3OR7C 4GX1A 3UT5B 2HHHO 3N2KB 3HKDA 1FXVA 1SZTA 4U3JA 4J80A 5JH7A 5CB4A 5BXZA 1WP7A 1XNRO 1VQMV 1Y66A 4GZRB 5KMGB 5J2UB 5DEDA 4HNAA 4DO2A 3OD4A 4TT3G 4NXMO 4BWAA 1DGSA 3E86A 2Q69A 4X20A 1FXKA 4DV2B 4EB6B 1H2KA 1Q43A 5LA6B 4YY3B 3DXRA 4MT8A 4QJFB 4CH6A 2WA4A 1BQ0A 1MNGA 2FTKA 1VQPV 1Q82W 5IJ9B 5BZBA 5KX5A 1BE3H 2YXHA 2AZ0A 1WN7A 3FB5C 1KKCA 3J80N 2X0LA 4GKKB 1KQSU 1YCIA 4JYYA 2XAQA 3GVMA 3ABTA 1GO3F 1EN5A 5B1NA 1K73W 4K3AA 4JTDB 2KG7B 1MABG 1K9MW 3WG7B 3ZHSA 4X65O 5H6RA 1UFIA 3ETEA 3CRAA 1WPBA 3AG7A 2IH3C 5GONA 4NTXA 4X64B 3HKEA 1US6A 1XHXA 4WFFA 1Q7YW 4LC1A 4WBNB 2VQEB 4KXRA 4N21A 1FFXA 2VRZA 5IWAO 1M57B 2BSKA 2DWDC 2OTJV 3QO7A 1IX9A 4K8XA 2UXDO 4ZI7A 4X62O 1Y4MA 3WFVA 3WB0A 4J7JA 2AZ2A 3QVNA 2KSDA 1IBLO 2D2CB 4K35A 1MZEA 1RM1B 3C3TA 1TAEA 3ASNB 2ZR3A 2OCCC 5D5PA 3CRCA 1S76D 3OUFA 2UXBO 1NBMG 3RYIB 5ITZB 4B3MO 2P67A 3AK1A 1F4MA 3UM7A 4O4JB 4H33A 3LSUA 1R73A 3WU2Z 2ZM6B 5B5EZ 4FK5C 1QVFU 2CTRA 1OV9A 5LYJA 1HP8A 1I0HA 3TK1A 4LF8B 3JAKB 1GM9A 2Z5UA 4TV9B 1HR0O 5A9GA 1XDCA 1J5EB 4BW5A 1K97A 3B8NA 1YITV 4DV4B 3BABA 2N04A 1WA8B 4DYLA 4DV6O 1WP8A 5KA6A 1YTFB 4FLUA 1FPOA 4O4LB 3ZHQA 2G38A 2WLMA 3NXSA 1N0NA 3THOA 2HJFC 2HVKC 4AI8A 5GTIZ 4F6EA 3CMAV 4LFBO 3K5OA 4E4EA 5EK0A 5C93A 4CH3A 2UUCO 1XREA 5CA1A 3W7TA 3SPJA 4LFCO 3CB2A 4BAYA 2EIJB 4UUJC 4XDLA 2Q8VA 3FX7A 4R50A 4U3FH 3ETGA 2CGOA 4X1KB 1QU7A 5LHGA 4MVMA 2LP7A 1GAXA 3T4ZA 1EZVH 5EC2C 3ZJZA 4BIOA 3DGEA 2QSAA 1S5LZ 1KP2A 1Q6IA 5FNVB 1H8HG 2UU9O 4KP4A 2IJIA 4DW0A 4FLTA 4MVZA 3CJHB 3AK3A 3T1HO 4MVQA 3RYHA 4Q20A 1ZWIC 4ASUG 3HR0A 1N36B 2ARHA 2Q73A 1HNWB 3E83A 4X66O 1AJNA 5CB4B 1COWG 3CPWU 3S3XA 1FFTB 4FVMA 3ZMUA 2ZKOA 3SYPA 4HNAB 2RDCA 2Y4UA 4F4LA 3AG1B 2XHBA 1Q6UA 4DXWA 3DTUB 4GUNA 4X20B 1FXKB 2F43G 3Q4HA 2DYSC 3AG3C 4UCTA 3LUTB 3OMIB 2Y48A 3DXRB 1M1KW 4I5SA 3I55V 4I55B 4PA6A 4LF4B 3K5MA 1VQOV 4JGSA 2YICA 3IC7A 2OIEA 1LR1A 3VOUA 3I56V 1FJGO 1TVKA 2OT5A 2WLJA 3E8BA 4NVPA 4LFAB 1K4DC 4JI4B 3U0ZA 3JD3A 3X2QC 1FXHA 3ZRXA 1SQBH 3SYQA 1W0KG 4R8CA 1F23A 1H2NA 2EILB 2ZT9B 4JTAB 1GK9A 4DR5B 3BAAA 5LP6C 2RJZA 3OTFA 2ITDC 5GONB 1ENVA 1AI4A 1IBKB 2R9AA 1N32B 1HW7A 1JCHA 2M6YA 1Y76B 2RCVA 3CXCU 2Q7EA 1IBMB 3ZMTA 1OCRB 3LDEA 4TSFG 3G80A 5B3SC 5JJNB 4AQYB 4JYAO 3RT3C 1CP9A 2BTQA 2XAGA 4DK1A 3K3WA 1HWYA 3IC9A 2LGQA 4CZZA 1QR9A 3L74H 1DTOA 4B3RO 4J41A 3M7MX 3K04A 2UXCB 3O9OA 3KKYA 3K06A 5KAIZ 1JOYA 3FYEB 2W6JG 2CTQA 1SQGA 1EBOA 1UPGA 3UT5A 5LMUO 3C90A 3N2KA 5GTHZ 2WLKA 4A5UB 2F4VO 2CK3G 3E8GA 5E79Z 4DV3O 2WA3A 1MG1A 4DR1O 3IGAC 4FLWA 1QLEC 4J42A 2UUAB 4N23A 2AXTZ 4MS2A 5D5QA 1OCCC 4PDMA 4H44B 1E79G 5FL7G 1V54B 1JMKC 1ZSPA 3ZMVA 5LA6A 1WNSA 5FPRA 1SQPH 4RQEA 2YS8A 4LF7O 2NLJC 4DUYO 2CH7A 1HNZO 3AG2B 5CA1B 1KU9A 1BGYH 3F5TA 1YJNV 2Q9LA 4Z1MG 1URFA 4MTXA 2LJ2A 2ZNJA 3A0BZ 4JV5B 4JI0O 4XDJA 4P2ZA 1QQCA 4KUMA 3TGUH 2F23A 4WCEV 2QGNA 1BQZA 2KG7A 2UXNA 1M90W 5IYBO 2ZDIC 3STLC 3BA8A 2QKAA 1N33B 3BRCA 3LSSA 3SPIA 1I5YA 3EVKA 3QG5A 3U11A 5C8YB 2IW5A 3F5WC 1VQLV 1M56C 4TWKA 2M7WA 4HZ3A 3ZS8C 1SF9A 1GH6A 1YEWA 1ZL8B 2N05A 2BOBC 4DR7O 2E74B 5K1PA 4WFHA 2ITCC 3Q4HB 3RW0A 1GMGA 2NR5A 2Y69C 1HNXO 1THZA 2F66C 3O65A 3CCSV 3CRRA 4LP8A 2PY5A 1B06A 3M8AA 2ZIOA 4O4JA 4R6ZA 2EZOA 4EFBA 1SQQH 2IH1C 2P5OA 1WAZA 3ZRWB 4QPJA 1BT8A 4GLXA 4FM1A 3JAKA 3J81N 1BHAA 1K5SA 5DN6G 4DV1B 3ZN1A 4X1YA 5L3FA 2ZD9A 4PDLA 3RYFA 1E1RG 5K1XA 4J7ZA 4O4HA 4K0KB 1LNQA 1NH2D 5IDJA 3AG4C 1AILA 4BIZA 1SETA 4DV0B 4YY3O 3K58A 4O4LA 3OEHG 4Q6GA 1XMQB 1E1QG 2EJ7A 2B1IA 4CS3A 1K3EA 4XBFA 4UCOA 2K9PA 1U96A 3G4SV 3IFXA 1WPXA 1XL6A 2QEXV 4GKKO 1K33A 1GN6A 1GN2A 1PD3A 3W7WA 1KC8W 4DRXA 1NQTA 2BTQB 2ADPA 1W0JG 1M4UA 5JWPA 1T5EA 1YXBA 3VQXA 4JI2B 2AGAA 3B77A 5LMNB 4D7TA 2WPDG 1AP5A 4B3SB 3A0RA 5LXTB 3A2FA 1S3JA 4KL1A 5E1AC 1QVGU 2GHYA 4FMTA 2VQEO 3ZN0A 3WB1A 3VBBA 1Q90D 2DJVA 3UQ8A 2L6LA 1XMOO 3OTOO 2PF4E 3RFRA 3ML0A 5IE9A 4P30A 2KQXA 2QTSA 2F95B 2XOKG 5AG2A 4UB8Z 5KLVH 2ILMA 4E2LA 1XEQA 4X88A 3BCCH 1FAFA 2ZM6O 4J9ZB 4NR1A 4I55A 2IBZH 3OUSA 1NI8A 4DW1A 2R9RB 2ZE5A 3H1LH 1JA8A 2CH7B 4ZBMA 4LF8O 1FYJA 2YUAA 2YSUB 3P30A 4PA7A 5LP6A 4IHJA 1Y67A 3SJQC 4ABMA 1J5EO 3ETQA 4HYOA 2PI4A 1PP9H 1VF6A 4DR2B 3ABUA 5B1BC 1TGOA 1RFYA 2XNDG 3H9VA 2IM9A 2XUMA 5IT9N 3LNMB 3IJ4A 2QE7G 4JPRA 1AI6A 1AROP 2WLNA 4BW9A 4GT1A 1DLBA 3KZIZ 4YJ2B 1Z5WA 3OGIB 1P7GA 3OM3B 2P7TC 2YIBD 4P9OA 2OCCB 4U7NA 1Y76A 4D6TH 5IJ0A 2YI8A 3SR2C 3SJAC 2E5LB 4MTOA 2F93B 4LR3A 4UVAA 3CC4V 2W6IG 3H1IH 1F7YA 2RNBA 2JS3A 5EYPB 4DR3B 1XBLA 4X9QA 1G1XB 5J2TA 2ATKC 4JI8B 1YTFD 4DV5B 2HHHB 4JI1B 2GUZB 3HKBB 3SPHA 4DR4O 4JI5B 3CD6V 1DF4A 5GW7A 3MDSA 1AB3A 1NT2B 1N36O 4FJCC 1RPRA 3D8CA 1HNWO 3KCXA 5H9CA 2JGDA 2C2AA 2JIZG 2EIKC 2ZXWC 3E89A 3FB6C 2PGGA 1QHTA 2PTMA 4IYIA 1QNMA 4X1YB 1SC5B 2FKXA 2JRIA 2XTAA 5FLXN 1B3QA 4WFGA 3RYFB 4O4HB 1SZXA 2EX3A 1SS3A 2LFSA 4TOIA 3LDDA 2QDOA 2BE3A 4MW3A 1FS0G 5B1AC 2QA4V 1RM1C 5BMVA 2CTPA 3H1KH 3B40A 2A0LA 2NNUA 4ZHQB 1EN6A 3N2GB 4DRXB 4LFAO 1MA1A 5H5NA 1SA0A 3K59A 4JI4O 1D5NA 5JQGA 1MZFA 2D3OW 2JEUA 4UFZA 3VQYA 1CPYA 2YXLA 1Y6XA 4RQFA 2HLDG 3CC7V 3B2EE 3W7UA 4GX0A 4DR5O 5B66Z 4MSWC 2YI9A 3TXQA 2XAJA 1IBKO 4GYCB 4JI6B 1Y74B 2CE4A 4R7CA 4B08A 1N32O 3CS5A 3HKCA 1F51A 4MTFA 1IBMO 2DYSB 5KHIA 1CXZB 3AG3B 5LHHA 4JF3A 4AQYO 5C8YA 2L35A 4DV7B 2GBOA 3A0HZ 1R6KA 2CUGA 3OMAB 3L72H 5IYZB 2Q0AA 4B3MB 2A3QA 2QWRB 3KCYA 1ZL8A 5KUKA 3QNEA 4L8JA 1W2BU 2UXCO 4NB5A 3ZHRA 4PD4F 1GM8A 1O9GA 1TUBB 3X2QB 1BCCH 3D3IA 1YJWV 2HVJC 4I4TA 3K9AA 2R9IA 3K0GA 2YIAA 1K34A 4IHJB 5LP6B 3ZRWA 2OTLV 3K03A 4LF9O 5LOVA 2QKSA 4I50A 2P4KA 2UUAO 2EULA 3FAVB 2JJ2G 5B3SB 1NTKH 2HR3A 1M93A 3AG1C 1KKDA 3EHBB 3CC2V 1OCZC 4W4LA 2UUCB 4DR6B 1I94B 1VQ6V 3ABKC 2DW4A 5CA0B 4C7UA 1Q8IA 2E3CA 3N27A 4EFEA 2JEXA 4GKJB 4K8ZA 5IJ0B 1WLEA 2XAHA 5F2VO 1K4CC 2EZPA 2UUBB 1V55C 3L73H 1VQ5V 2YIDA 4PI2A 3T1YB 4DK0A 3CYOA 3MAQA 4JV5O 3K79A 2UU9B 3R65A 5J2TB 2LGWA 5DECA 3ZRSA 4B7KA 4YHHB 2WAMA 5LXTA 1S5JA 3K08A 2LQTA 3E8FA 1YVWA 5IYDO 5EBMC 1N33O 1QLEB 1QLNA 1N8RW 3W7XA 4JYCA 3CSXA 1I5XA 1JVMA 2JGDB 2NN4A 1OCCB 4G27B 1JJOA 3DC5A 5J9PC 1V9PA 1KMIZ 1A32A 1W59A 3CCJV 4O2BB 1N34O 2Y0PA 4G28B 4QIWF 1OCOC 3JD1A 2Z0AA 4IT5A 3K9SA 3B4SA 1ZUQA 2E76B 1QBZA 3JARB 1GN3A 2WWWA 5JVDA 1LUVA 3OE7G 3AEIA 1BZKA 1DF5A 1FJGB 5BMVB 1TA8A 2KKWA 1TUEB 4IIJB 3RBZA 3ZRVA 2CDYA 1PV0A 2QJ1A 1N4CA 3S3WA 3G71V 2GSMB 2DWEC 4PHZA 1XOUA 1SA0B 1PNLA 2VWKA 4RUEA 4DV1O 1YF2A 4YIPA 1XNQB 5JQGB 2W0FC 5L3GA 5LHIA 3JSLA 4IL6Z 4K0KO 1PPJH 4UB6Z 3L75H 2JDIG 1OJHA 3HPLC 1OHHG 3ETDA 1M56B 4DUZB 3IAYA 2PUSA 3C3SA 3ZCCA 1XMQO 2H8PC 1MSDA 3A8TA 4LH6A 1RPOA 4J11A 5KAFZ 4RAIA 3HKCB 4JAAA 2R72A 1JX9A 5CBFA 4YJ2A 3MHSC 1NJIW 3JALA 4NXNB 2Y69B 1PL0A 1SKVA 3ZBHA 4B3RB 1NTZH 1WB7A 1Z5VA 4JI2O 3QO5A 5LMNO 4GCZA 5KHJA 2DN9A 1NR1A 1MMMA 2XASA 4UCUA 3TJTA 5EYPA 2DYRC 2UXXA 1D5AA 1GKFA 1JPXA 3LDCA 1QR8A 3T1CA 3M99B 3SPGA 3CCQV 3CP1A 3UCSC 4NYKA 4FLXA 2GUZA 1EFRG 3HKBA 3FB7C 4I4TB 3AG4B 3SPCA 4DV3B 2PYJA 5EIBD 2WLHA 5TISZ 4DR1B 3B8MA 3T4DA 1P49A 1B6QA 3MHHC 2B5UA 2X6CA 4H37A 2ETNA 3E8HA 4B7EA 5A2QN 4J10A 5LOVB 4BR6A 3KG2A 4I50B 1RSOA 3F7YC 5BY1A 4ZIBA 3RGBA 5EBWC 2JJ1G 4LWSB 5L3EA 4MTGA 1VF5B 4CC6A 3SYOA 4DV2O 4DUYB 2EJRA 3RVYA 4OX9B 4LF5B 1SQXH 4QE7A 3CWBH 1EZJA 4PJ0Z 4LF6B 2EIMC 2QKCA 3MD0A 2ZQMA 4XDKA 3STZC 3E2EA 1PKXA 3BHPA 3CCVV 4YXWG 1SRYA 2BOCC 2AHYA 2WLIB 1QCEA 4ZHQA 3N2GA 1JFFA 2P4VA 1VEWA 1VIBA 3JASA 4PI0A 2VQFB 4DR2O 4X89A 2KB1A 4UVBA 5EBLC 1H2SB 3BFRA 3ZX6A 2EINC 1VQNV 5CA3A 3ABMC 4WF9V 4MVSA 1VQKV 2LW7A 4UCVA 1SQVH 4CC5A 2VS0A 3RVZA 4HBNA 1NVPB 4ZOLB 4X64O 3APQA 2WLLA 1NTMH 1Y74A 2PYLA 3GWKC 3DSQA 3E22B 5IY5C 1O9HA 1P4RA 1AJQA 4FLZA 2E5LO 3OAAG 2HFEC 4EEQA 4KHPB 1YJ9V 2AW9A 1XL4A 4FPPA 4X1IB 5IYZA 1H38A 4UV8A 4JI3B 4B3TB 5JVDB 3L9DA 4DV5O
chains in the Genus database with same CATH topology
3ASOC 1FS0G 4QNHB 5B1AC 2QA4V 1ENVA 1AI4A 4GX2A 1RM1C 1JJ2U 4GX5A 5CMUA 1JCHA 4LBEC 4MVUA 4KFMA 3CXCU 5B1BB 2A0LA 3JD0A 2NNUA 2WSSG 4EKWA 1Q81W 3ZMTA 1S77D 1OCRB 3CCLV 5LGTA 3LDEA 4PDVA 4TSFG 5B3SC 2B1GA 3ABLC 4UVCA 1CP9A 2XAGA 2XAFA 3K3WA 1HWYA 2QTOA 3CCEV 4PA4A 4CZZA 2D3OW 1QR9A 1DTOA 3UKMA 2JEUA 2EIMB 4P9PA 2PI5A 2IJHA 1CPYA 3OW2U 3K04A 4RQFA 1H8EG 2HLDG 3CC7V 1UJWB 3W7UA 2X6AA 4GX0A 5CBHA 3TCUA 5LBQA 1P7BA 3K06A 4MSWC 2IJKA 4WFEA 1JOYA 1AI5A 3F7VC 2XAJA 3FB8C 4RO2A 4WFBV 3FYEB 4R7CA 2Q67A 2W6JG 1VQ4V 2V1DA 4UV9A 4PDRA 4PA3A 1NVPD 2AHZA 1EBOA 1F51A 4MTFA 2DYSB 3AG3B 2EINB 4PA9A 3ABMB 5LHHA 2WLKA 4JF3A 1MSWD 2CK3G 3E8GA 3TETA 5CBGA 4WFAV 2P90A 3CMEV 1NR7A 1MG1A 1R6KA 2YEVB 3IGAC 1ORQC 1QLEC 3OMAB 2IU0A 2P6JA 4LCUC 3JD2A 4N23A 1Q86W 5B1OA 4MS2A 1OCCC 3QO8A 4JAUA 1G4YB 2EIKB 2ZXWB 3K0DA 4PDMA 5KUKA 3QNEA 1E79G 5FL7G 1V54B 4CBCA 1M9NA 1W2BU 3ZMVA 1PNMA 5IY5B 1GM8A 3X2QB 1AJPA 1BMFG 2QM8A 4X8AA 3D3IA 5KUMA 4I9WA 1K5QA 1YJWV 5L3CA 1JQ0A 3OEEG 1R3KC 4RQEA 2NLJC 3WG7C 2HVJC 3K9AA 3AG2B 3H01A 2R9IA 3K0GA 3ZMZA 3LSQA 1YJNV 1K34A 2H94A 4Z1MG 3ZRWA 3ASOB 4MTXA 2OTLV 5B1AB 1R6NA 5IYCO 3FYIB 3K03A 1S0VA 1IXMA 3EFFK 1NH2B 2QKSA 4XDJA 2DQ0A 4P2ZA 4KUMA 2HKOA 1M57C 3OMNB 4WCEV 1H2GA 2JJ2G 2UXNA 4JASA 5B3SB 1M90W 3ABLB 5IYBO 4MVOA 2HR3A 1F4NA 2ZDIC 2A9HA 3AG1C 3JCZA 3STLC 1KKDA 1BL8A 3EHBB 1SERA 3OR7C 3CC2V 1OCZC 4GX1A 3LSSA 3SYAA 1K7DA 1VQ6V 3SPIA 1I5YA 3ABKC 1FXVA 1SZTA 2DW4A 1J95A 3SYCA 3ASNC 3OFNG 2JEXA 1GM7A 2IW5A 3F5WC 1WLEA 1VQLV 1M56C 1VQMV 1AR1B 1Y66A 4TWKA 2XAHA 2M7WA 4HZ3A 1K4CC 3GWOA 2EZPA 1SESA 1KD1W 1V55C 1VQ5V 4MW8A 4DO2A 2ZDIA 2BOBC 3CYOA 3K79A 4TT3G 1YIJV 4J9YB 3R65A 4WFHA 2ITCC 3E86A 2Q69A 1FXKA 3RW0A 3ZRSA 1GMGA 4QJFB 4MT8A 2Y69C 1THZA 3CCSV 2WAMA 3K08A 2FTKA 3E8FA 4LP8A 1VQPV 5IYDO 1Q82W 4G2KA 1ROPA 5BZBA 5EBMC 1QLEB 1QLNA 4R6ZA 1N8RW 2EZOA 3FB5C 3W7XA 4JYCA 2WLLB 1I5XA 1JVMA 2IH1C 2X0LA 1OCCB 4G27B 3ZRWB 1KQSU 4QPJA 5J9PC 5HFMA 1CEZA 2IJJA 3CCMV 1BHAA 3P32A 1K5SA 4QPKA 5DN6G 3ZN1A 2Q68A 3CCJV 2XAQA 5L3FA 2ZD9A 4PDLA 3JD4A 3ABTA 1E1RG 1GO3F 5B1NA 1K73W 1KECA 4G28B 4L87A 4JTDB 4QIWF 1MABG 1OCOC 3JD1A 3T2MA 1LNQA 3WG7B 1K9MW 1NH2D 5H6RA 4JYBA 5IDJA 3AG4C 3G6EV 4BIZA 1QBZA 1SETA 3ETEA 2WWWA 2IH3C 3OEHG 3OE7G 3AEIA 2K1EA 1E1QG 2EIJC 1DF5A 2B1IA 4WFFA 1K3EA 4XBFA 1Q7YW 4LC1A 5KA5A 2HG5C 1VQ8V 1TUEB 3RBZA 3G4SV 4N21A 3ZRVA 2X7RB 3IFXA 1WPXA 1M57B 1XL6A 2ZR2A 2X6BA 2QEXV 1K33A 1PD3A 2DWDC 2OTJV 3G71V 3QO7A 3W7WA 2GSMB 2DWEC 3BY6A 1KC8W 1Y4MA 1NQTA 3WFVA 1PNLA 1W0JG 4RUEA 5CN0A 3B77A 1OCZB 2W0FC 5L3GA 2WPDG 5LHIA 5L3BA 1R3JC 3ABKB 4JAVA 1RM1B 3ASNB 2JDIG 2ZR3A 3A0RA 2OCCC 1S76D 3OUFA 1NBMG 4QE9A 3HPLC 1OHHG 1S3JA 1M56B 2P67A 3ETDA 1F4MA 3BEHA 3UM7A 5E1AC 4H33A 1QVGU 1R73A 1BHBA 2GHYA 1V55B 5L3DA 3ZCCA 2H8PC 4MVRA 4FK5C 4FMTA 1QVFU 3W7SA 1RPOA 4U7OA 3ZN0A 4FIPC 1L1FA 3TK1A 4PELA 4RAIA 1GM9A 3VBBA 1FXKC 1JX9A 2Z5UA 5CBFA 3MHSC 1NKDA 1NJIW 2Z3YA 2Y69B 1PL0A 3ML0A 4BW5A 1K97A 3B8NA 3CCRV 4P30A 1YITV 3QO5A 2WLIA 4GCZA 3ZIAG 2A79B 1GTOA 4HAMA 1NR1A 5KA6A 1K92A 1YTFB 2XOKG 2XASA 2DYRC 2WLMA 2UXXA 3NXSA 1GKFA 2HJFC 4E2LA 1JPXA 3LDCA 1QR8A 2HVKC 4X88A 3T1CA 3M99B 1VQ9V 4J9ZB 3SPGA 3CMAV 3CP1A 3CCQV 3OUSA 2R9RB 1EFRG 1OZ0A 1OCOB 3FB7C 5EK0A 2EILC 4ZBMA 5C93A 3AG4B 3SPCA 3W7TA 3SPJA 2WLHA 2YSUB 3B8MA 3P30A 3T4DA 4PA7A 1B6QA 4BAYA 1R3LC 3MHHC 3SJQC 2B5UA 2X6CA 4H37A 2EIJB 1KP3A 4HYOA 4UUJC 2PI4A 1S72V 4XDLA 3E8HA 2DQ3A 4R50A 3OGCC 3ETGA 2EBOA 1YSCA 5LHGA 4MVMA 2LP7A 3KG2A 3T4ZA 3ABUA 5B1BC 5LGUA 2XNDG 3F7YC 5EC2C 3ZJZA 1OCRC 3DGEA 1KP2A 3LNMB 1H8HG 2QE7G 4JPRA 1AI6A 5EBWC 2JJ1G 5L3EA 4KP4A 1AROP 4MTGA 2IJIA 2WLNA 3SYOA 5EC1C 4GT1A 4MVZA 2EJRA 3RVYA 1DLBA 4MVQA 2MK3A 4QE7A 4Q20A 1ZWIC 4ASUG 1EZJA 5HFLA 2EIMC 3E83A 3OM3B 2P7TC 4P9OA 2OCCB 4U7NA 2IU3A 1AJNA 3MD0A 1COWG 2ZQMA 4XDKA 3STZC 4RUFA 1YHQV 1YI2V 3E2EA 3CPWU 1PKXA 3CCVV 4YXWG 1SRYA 2BOCC 2AHYA 4JTCB 2WLIB 1FFTB 1QCEA 3OR6C 4MTOA 3HB3B 3ZMUA 4UVAA 3SYPA 3CC4V 2W6IG 4F4LA 3AG1B 3GB7C 4OXSA 4DXWA 3DTUB 2Q6AA 4X89A 2KB1A 1VQ7V 4UXNA 4UVBA 5EBLC 1FXKB 2F43G 2ATKC 2DYSC 3AG3C 2EINC 3D36A 1VQNV 1YTFD 3LUTB 3ABMC 3OMIB 5CA3A 2Y48A 5LGNA 4WF9V 1M1KW 4I5SA 4MVSA 1VQKV 3I55V 3SPHA 4PA6A 3RVZA 1VQOV 4JGSA 3CD6V 1DF4A 3IC7A 5GW7A 1NVPB 3VOUA 3I56V 4FJCC 1S5HC 4ZKIA 2WLLA 1MOFA 1RPRA 3FKSG 2JIZG 2C2AA 2OT5A 2WLJA 2LFRA 5H9CA 3ZMSA 2EIKC 2ZXWC 3E8BA 3E89A 3FB6C 1V54C 5H6QA 1K8AW 2DYRB 1K4DC 5IY5C 1P4RA 2V7QG 1AJQA 3OAAG 1PNKA 3JD3A 3PJSK 3X2QC 3JYCA 1FXHA 3ZRXA 2HFEC 4WFGA 1AI7A 3SYQA 1W0KG 4R8CA 1G8MA 1F23A 4BIUA 1YJ9V 2YEVA 2EILB 3CCUV 3AG2C 1XL4A 2LFSA 3E35A 4FPPA 4JTAB 3LDDA 5DM6V 1GK9A 2QM7A 1H38A 4UV8A 1R3IC 4MW3A 2ITDC 2JK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3L C;  3ASO C;  3SJQ C;  2X6C A;  5B1A C;  4QNH B;  4H37 A;  2K1E A;  2EIJ C;  4GX2 A;  4HYO A;  4UUJ C;  4WFF A;  4XDL A;  3E8H A;  4GX5 A;  3K03 A;  4R50 A;  3OGC C;  3EFF K;  2HG5 C;  4MVM A;  3RBZ A;  2QKS A;  3KG2 A;  4LBE C;  4KFM A;  4MVU A;  3T4Z A;  3IFX A;  4XDJ A;  5B1B C;  2A0L A;  4P2Z A;  4EKW A;  1M57 C;  3F7Y C;  1XL6 A;  5EC2 C;  1OCR C;  2X6B A;  3ZJZ A;  2DWD C;  3LDE A;  3LNM B;  4PDV A;  2DWE C;  5B3S C;  3ABL C;  4MVO A;  5EBW C;  2A9H A;  3AG1 C;  1KKD A;  4MTG A;  3STL C;  1BL8 A;  2WLN A;  4RUE A;  2QTO A;  3SYO A;  5EC1 C;  4MVZ A;  4PA4 A;  3RVY A;  3OR7 C;  4MVQ A;  1OCZ C;  2W0F C;  4GX1 A;  3SYA A;  4QE7 A;  1ZWI C;  3UKM A;  4PA7 A;  3SPI A;  2EIM C;  4P9P A;  1R3J C;  3ABK C;  1J95 A;  3SYC A;  3ASN C;  3E83 A;  2P7T C;  4P9O A;  3K04 A;  2OCC C;  3OUF A;  4XDK A;  3STZ C;  4RUF A;  3F5W C;  2X6A A;  3HPL C;  4GX0 A;  4QE9 A;  1M56 C;  3TCU A;  5CBH A;  1P7B A;  3BEH A;  3K06 A;  4TWK A;  2BOC C;  4JTC B;  2AHY A;  4MSW C;  5E1A C;  2WLI B;  1K4C C;  4H33 A;  4HZ3 A;  4WFE A;  3OR6 C;  3UM7 A;  1V55 C;  3F7V C;  4MTO A;  2H8P C;  4RO2 A;  3FB8 C;  4MVR A;  4MW8 A;  3SYP A;  4F4L A;  3GB7 C;  2BOB C;  4R7C A;  4OXS A;  2Q67 A;  4DXW A;  4PDR A;  2Q6A A;  4X89 A;  2KB1 A;  4PA3 A;  4J9Y B;  4RAI A;  3R65 A;  2AHZ A;  2ITC C;  4WFH A;  5EBL C;  3E86 A;  2Q69 A;  4MTF A;  2ATK C;  2DYS C;  3AG3 C;  2EIN C;  4PA9 A;  3RW0 A;  3ZRS A;  5CBF A;  3LUT B;  3ABM C;  2WLK A;  4MVS A;  2Y69 C;  3E8G A;  3TET A;  4BW5 A;  3K08 A;  3SPH A;  5CBG A;  4PA6 A;  4LP8 A;  3E8F A;  3RVZ A;  4P30 A;  5BZB A;  3IGA C;  5EBM C;  1ORQ C;  1QLE C;  2WLI A;  4LCU C;  4R6Z A;  2A79 B;  3FB5 C;  3VOU A;  1S5H C;  2WLL B;  2WLL A;  1JVM A;  2IH1 C;  4MS2 A;  1OCC C;  4G27 B;  2WLJ A;  1G4Y B;  2EIK C;  2ZXW C;  3E8B A;  3E89 A;  3K0D A;  4PDM A;  5J9P C;  3FB6 C;  4CBC A;  5KUK A;  1V54 C;  2DYR C;  2WLM A;  1K4D C;  5IY5 C;  2HJF C;  3LDC A;  2HVK C;  4X88 A;  3X2Q C;  2Q68 A;  3PJS K;  3T1C A;  4X8A A;  3JYC A;  5KUM A;  4J9Z B;  2ZD9 A;  4I9W A;  2HFE C;  4PDL A;  4WFG A;  3SPG A;  3OUS A;  2R9R B;  3SYQ A;  4G28 B;  4JTD B;  4R8C A;  1R3K C;  1OCO C;  3T2M A;  1LNQ A;  2NLJ C;  3FB7 C;  3WG7 C;  2HVJ C;  2YEV A;  2EIL C;  5EK0 A;  3AG2 C;  4ZBM A;  1XL4 A;  3AG4 C;  4JTA B;  3LDD A;  3SPC A;  3SPJ A;  3K0G A;  2WLH A;  3T4D A;  1R3I C;  4MW3 A;  2ITD C;  2IH3 C;  2JK5 C; 
#chains in the Genus database with same CATH topology
 3ASO C;  2XT9 A;  4QNH B;  1SQF A;  4JI1 O;  4GX2 A;  5CMU A;  4JI5 O;  1TUB A;  4IGG A;  4Z2W A;  5B1B B;  3OT7 A;  2W0X A;  1S77 D;  3CCL V;  1IZ3 A;  4PDV A;  3ABL C;  2QWN B;  2GTS A;  4YJ3 A;  2XAF A;  4LH7 A;  2QTO A;  3CCE V;  4P9P A;  2FML A;  4DV4 O;  3R66 A;  3SJB C;  1VF7 A;  1FD9 A;  5LBQ A;  1M5I A;  3TCU A;  5CBH A;  1N0J A;  1P7B A;  2IJK A;  4WFE A;  3FAV A;  4UCR A;  1AI5 A;  4JI7 B;  1KBH A;  2Q67 A;  4UV9 A;  5BR8 B;  4LNU B;  2AHZ A;  3D36 C;  1LUW A;  5CA0 A;  3JAL B;  1X4T A;  4TQD A;  3JAT A;  5CBG A;  4CH5 A;  2P90 A;  3CME V;  1Z2G A;  2YEV B;  2MW2 B;  5LL6 Y;  4F6R A;  2EIK B;  2ZXW B;  4CBC A;  1L0N H;  3CRM A;  1NU1 H;  1PNM A;  1D2D A;  2O57 A;  2Q0O C;  1AJP A;  1BMF G;  2QM8 A;  1P84 F;  4TUY A;  3K5L A;  1K5Q A;  4JI6 O;  5L3C A;  3AK2 A;  3OEE G;  1XMO B;  3OTO B;  3WG7 C;  2RQ6 A;  1XNR B;  3ZMZ A;  1AP6 A;  1PM9 A;  2E75 B;  5B1A B;  4DV7 O;  4AHC A;  3FYI B;  4CS4 A;  2BCC H;  3EFF K;  4JZG A;  4NXM B;  1RSO B;  2CAZ C;  1XHZ A;  2DQ0 A;  4O2B A;  1M57 C;  2Y4T A;  3OMN B;  2HP8 A;  1HDJ A;  1H2G A;  3NR7 A;  4JAS A;  4J7K A;  1F4N A;  2FB5 A;  3JCZ A;  1YZB A;  1EN4 A;  1BS3 A;  3JAR A;  2RMK B;  2Q7H A;  3SYA A;  1K7D A;  1X59 A;  2QWQ B;  4CH4 A;  1DK1 A;  1J95 A;  4LF4 O;  1JR9 A;  3ASN C;  3SYC A;  3OFN G;  3I5D A;  1GM7 A;  4IIJ A;  3ZED A;  1XIL A;  1Q5O A;  1AR1 B;  2ZE6 A;  3GWO A;  1NZ6 A;  1SES A;  1KD1 W;  5JCO C;  2ZCE A;  3RYC A;  1JFF B;  4MW8 A;  4W4K A;  3JAS B;  2ZDI A;  2V4D A;  1YIJ V;  4X65 B;  4J9Y B;  4FM2 A;  3JAW B;  1R6T A;  3JAM N;  3H1H H;  4G2K A;  1ROP A;  3BPZ A;  4DR6 O;  1I94 O;  3SGI A;  2WLL B;  5IWA B;  2DE0 X;  5EZY B;  2UXD B;  5HFM A;  4GKJ O;  4X62 B;  1ZLZ A;  1CEZ A;  2IJJ A;  3CCM V;  2HEP A;  3P32 A;  4QPK A;  2UUB O;  2Q68 A;  1IBL B;  2CTW A;  3JD4 A;  2ADQ B;  1KEC A;  3T1Y O;  3JSN A;  3B09 A;  4L87 A;  3T2M A;  1PL4 A;  4JYB A;  1GN4 A;  3RN4 A;  2UXB B;  3G6E V;  4DR4 B;  1R1B A;  1Q6H A;  1L0L H;  4YHH O;  4PV1 B;  4NKG B;  2K1E A;  2EIJ C;  3HKD B;  4AIL C;  4U3J B;  2Q7G A;  5KA5 A;  2HG5 C;  3D3Q A;  4TV8 A;  1IDS A;  5JH7 B;  1VQ8 V;  2X7R B;  1VP7 A;  2RN9 A;  2ZR2 A;  2X6B A;  1HR0 B;  4O4I A;  3BY6 A;  4YJ3 B;  3EXA A;  2GDS A;  1I7F A;  5CN0 A;  1H2L A;  3SJC C;  1OCZ B;  1IXB A;  3APO A;  4DV6 B;  3P3N A;  5L3B A;  1R3J C;  3ABK B;  4JAV A;  3L71 H;  1AR4 A;  4QE9 A;  1IVS A;  1XI1 A;  1KB9 F;  4FFK A;  5JJE B;  3BEH A;  1NS1 A;  5KX5 B;  2OWO A;  1GRJ A;  1B04 A;  3UO2 A;  1BHB A;  1V55 B;  5L3D A;  4MVR A;  4LFB B;  4LWS A;  3W7S A;  1VAR A;  4U7O A;  4IYH A;  4FIP C;  1L1F A;  4PEL A;  2ODM A;  4FM0 A;  1FXK C;  4CS2 A;  2QWO B;  4FFB A;  4FZ1 A;  1NKD A;  2YC0 A;  2Z3Y A;  4LFC B;  3JAT B;  1G6U A;  5JJJ B;  4TQF A;  1WB8 A;  3CCR V;  1AR5 A;  1XNQ O;  2WLI A;  3ZIA G;  2A79 B;  1GTO A;  4HAM A;  4YIO A;  1K92 A;  2BTO A;  4F6R B;  3J7A U;  1ZAU A;  3HKE B;  4NTW A;  1VF6 C;  4DUZ O;  3H1J H;  2A06 H;  1FFX B;  1KUQ A;  3T1H B;  2FL4 A;  4TUY B;  1VQ9 V;  2JVD A;  2BSK B;  1OZ0 A;  4QGP A;  1OCO B;  4ZI7 B;  4X66 B;  2EIL C;  4ZOL A;  4I0X A;  2VWJ A;  3PN1 A;  2OIG A;  4H13 B;  4NXN O;  1R3L C;  3E22 A;  2DMX A;  1KP3 A;  1S72 V;  5KHK A;  2DQ3 A;  3OGC C;  2EBO A;  1YSC A;  3P3P A;  1ZX3 A;  5LGU A;  2JGU A;  3JCU Z;  1OCR C;  1IUR A;  3FFQ A;  1RP3 B;  1BSM A;  2Q5Z A;  4X1I A;  5LYJ B;  2A7W A;  3G6B A;  4JZ2 A;  4O2A A;  5EC1 C;  3ZHV A;  3ZHU A;  2MK3 A;  5HFL A;  1EM1 A;  2ZIM A;  2IU3 A;  1L8D A;  4RUF A;  1YHQ V;  1YI2 V;  2PZS A;  3ZHT A;  4JTC B;  4LF9 B;  5KHH A;  3CXH F;  3OR6 C;  3U10 A;  3HB3 B;  3RYC B;  2CGN A;  2P06 A;  5KMG A;  5J2U A;  3WB2 A;  3GB7 C;  2DOS A;  4OXS A;  2Q6A A;  1VQ7 V;  4OGQ B;  4UXN A;  2P22 C;  3D36 A;  4EB6 A;  5LGN A;  1H2M A;  1KYO F;  5IJ9 A;  2LW1 A;  4DV0 O;  2Y0I A;  4OX9 O;  4OPH A;  2GV9 A;  4LF5 O;  3CHX A;  4LF6 O;  1S5H C;  4ICG A;  4ZKI A;  1MOF A;  1ZTE A;  3FKS G;  4RWU A;  2LFR A;  3ZMS A;  4OPA A;  1V54 C;  5H6Q A;  5KHG A;  1K8A W;  2DYR B;  4JYA B;  4LNU A;  1YDX A;  2V7Q G;  3UO3 A;  1PNK A;  3PJS K;  3JYC A;  4FLV A;  2HJD A;  1AI7 A;  1XQ8 A;  2VQF O;  1G8M A;  4BIU A;  2YEV A;  3CCU V;  3AG2 C;  3K57 A;  3E35 A;  5DM6 V;  1WJZ A;  2F1M A;  2R70 A;  3LNN A;  3TXS A;  2QM7 A;  2ZIN A;  4B3S O;  3L70 H;  1R3I C;  2JK5 C;  3RYH B;  1JJ2 U;  2N74 A;  4GX5 A;  3VQV A;  3BA9 A;  2OCH A;  3VQW A;  1AVM A;  4TV8 B;  4WBN A;  4LBE C;  4MVU A;  4KFM A;  3JD0 A;  2WSS G;  4EKW A;  5LMU B;  1Q81 W;  2QWP B;  5LGT A;  4O4I B;  2F4V B;  4I9Q A;  2B1G A;  4UVC A;  1N34 B;  2ZE7 A;  4PA4 A;  2QM4 A;  2GTA A;  4FZ0 A;  3UKM A;  2EIM B;  2PI5 A;  2IJH A;  4UCS A;  4KHP O;  2H3O A;  3OW2 U;  1H8E G;  3ICX A;  1UJW B;  3CE2 A;  3RYI A;  5ITZ A;  2X6A A;  3K5N A;  4B3T O;  4JI3 O;  3CRQ A;  3RWR D;  3F7V C;  4RO2 A;  3FB8 C;  2YXY A;  4I7Z B;  3DC6 A;  5JCO A;  4Z1V A;  1TVK B;  4WFB V;  4H0L B;  2YIB A;  1VQ4 V;  2V1D A;  4LF7 B;  4PDR A;  2Q4P A;  4PA3 A;  1HNZ B;  1NVP D;  1U97 A;  2LO1 A;  2ZE8 A;  2OYQ A;  2EIN B;  4FFB B;  4PA9 A;  4TV9 A;  3ABM B;  2JS5 A;  1MSW D;  3TET A;  4WFA V;  3CX5 F;  1NR7 A;  1ORQ C;  4NTY A;  4JI0 B;  2IU0 A;  2P6J A;  4LCU C;  1WA8 A;  3JD2 A;  1Q86 W;  5B1O A;  3QO8 A;  4JAU A;  1G4Y B;  3K0D A;  1I08 A;  1M9N A;  5IY5 B;  3SDL A;  3JAW A;  2ZNI A;  4X8A A;  5KUM A;  4I9W A;  1VMG A;  4JI7 O;  4D7S A;  1JQ0 A;  1R3K C;  5BR8 O;  1FKA O;  3H01 A;  4I0X B;  3LSQ A;  2YDE A;  2H94 A;  3FD9 A;  3ASO B;  5FPO A;  3CEI A;  5EZY A;  1R6N A;  5IYC O;  1S0V A;  1IXM A;  2QR4 A;  4DR7 B;  4X1K A;  1NH2 B;  2B9Z A;  3G67 A;  3BVO A;  5EIB C;  2HKO A;  4DR3 O;  3QF7 A;  1HNX B;  5FNV A;  3ABL B;  4MVO A;  5H2F Z;  2A9H A;  4FLY A;  1BL8 A;  4O2A B;  1Q3E A;  1XUQ A;  3QTC A;  2FYU H;  4JI8 O;  1SER A;  3CJH A;  3OR7 C;  4GX1 A;  3UT5 B;  2HHH O;  3N2K B;  3HKD A;  1FXV A;  1SZT A;  4U3J A;  4J80 A;  5JH7 A;  5CB4 A;  5BXZ A;  1WP7 A;  1XNR O;  1VQM V;  1Y66 A;  4GZR B;  5KMG B;  5J2U B;  5DED A;  4HNA A;  4DO2 A;  3OD4 A;  4TT3 G;  4NXM O;  4BWA A;  1DGS A;  3E86 A;  2Q69 A;  4X20 A;  1FXK A;  4DV2 B;  4EB6 B;  1H2K A;  1Q43 A;  5LA6 B;  4YY3 B;  3DXR A;  4MT8 A;  4QJF B;  4CH6 A;  2WA4 A;  1BQ0 A;  1MNG A;  2FTK A;  1VQP V;  1Q82 W;  5IJ9 B;  5BZB A;  5KX5 A;  1BE3 H;  2YXH A;  2AZ0 A;  1WN7 A;  3FB5 C;  1KKC A;  3J80 N;  2X0L A;  4GKK B;  1KQS U;  1YCI A;  4JYY A;  2XAQ A;  3GVM A;  3ABT A;  1GO3 F;  1EN5 A;  5B1N A;  1K73 W;  4K3A A;  4JTD B;  2KG7 B;  1MAB G;  1K9M W;  3WG7 B;  3ZHS A;  4X65 O;  5H6R A;  1UFI A;  3ETE A;  3CRA A;  1WPB A;  3AG7 A;  2IH3 C;  5GON A;  4NTX A;  4X64 B;  3HKE A;  1US6 A;  1XHX A;  4WFF A;  1Q7Y W;  4LC1 A;  4WBN B;  2VQE B;  4KXR A;  4N21 A;  1FFX A;  2VRZ A;  5IWA O;  1M57 B;  2BSK A;  2DWD C;  2OTJ V;  3QO7 A;  1IX9 A;  4K8X A;  2UXD O;  4ZI7 A;  4X62 O;  1Y4M A;  3WFV A;  3WB0 A;  4J7J A;  2AZ2 A;  3QVN A;  2KSD A;  1IBL O;  2D2C B;  4K35 A;  1MZE A;  1RM1 B;  3C3T A;  1TAE A;  3ASN B;  2ZR3 A;  2OCC C;  5D5P A;  3CRC A;  1S76 D;  3OUF A;  2UXB O;  1NBM G;  3RYI B;  5ITZ B;  4B3M O;  2P67 A;  3AK1 A;  1F4M A;  3UM7 A;  4O4J B;  4H33 A;  3LSU A;  1R73 A;  3WU2 Z;  2ZM6 B;  5B5E Z;  4FK5 C;  1QVF U;  2CTR A;  1OV9 A;  5LYJ A;  1HP8 A;  1I0H A;  3TK1 A;  4LF8 B;  3JAK B;  1GM9 A;  2Z5U A;  4TV9 B;  1HR0 O;  5A9G A;  1XDC A;  1J5E B;  4BW5 A;  1K97 A;  3B8N A;  1YIT V;  4DV4 B;  3BAB A;  2N04 A;  1WA8 B;  4DYL A;  4DV6 O;  1WP8 A;  5KA6 A;  1YTF B;  4FLU A;  1FPO A;  4O4L B;  3ZHQ A;  2G38 A;  2WLM A;  3NXS A;  1N0N A;  3THO A;  2HJF C;  2HVK C;  4AI8 A;  5GTI Z;  4F6E A;  3CMA V;  4LFB O;  3K5O A;  4E4E A;  5EK0 A;  5C93 A;  4CH3 A;  2UUC O;  1XRE A;  5CA1 A;  3W7T A;  3SPJ A;  4LFC O;  3CB2 A;  4BAY A;  2EIJ B;  4UUJ C;  4XDL A;  2Q8V A;  3FX7 A;  4R50 A;  4U3F H;  3ETG A;  2CGO A;  4X1K B;  1QU7 A;  5LHG A;  4MVM A;  2LP7 A;  1GAX A;  3T4Z A;  1EZV H;  5EC2 C;  3ZJZ A;  4BIO A;  3DGE A;  2QSA A;  1S5L Z;  1KP2 A;  1Q6I A;  5FNV B;  1H8H G;  2UU9 O;  4KP4 A;  2IJI A;  4DW0 A;  4FLT A;  4MVZ A;  3CJH B;  3AK3 A;  3T1H O;  4MVQ A;  3RYH A;  4Q20 A;  1ZWI C;  4ASU G;  3HR0 A;  1N36 B;  2ARH A;  2Q73 A;  1HNW B;  3E83 A;  4X66 O;  1AJN A;  5CB4 B;  1COW G;  3CPW U;  3S3X A;  1FFT B;  4FVM A;  3ZMU A;  2ZKO A;  3SYP A;  4HNA B;  2RDC A;  2Y4U A;  4F4L A;  3AG1 B;  2XHB A;  1Q6U A;  4DXW A;  3DTU B;  4GUN A;  4X20 B;  1FXK B;  2F43 G;  3Q4H A;  2DYS C;  3AG3 C;  4UCT A;  3LUT B;  3OMI B;  2Y48 A;  3DXR B;  1M1K W;  4I5S A;  3I55 V;  4I55 B;  4PA6 A;  4LF4 B;  3K5M A;  1VQO V;  4JGS A;  2YIC A;  3IC7 A;  2OIE A;  1LR1 A;  3VOU A;  3I56 V;  1FJG O;  1TVK A;  2OT5 A;  2WLJ A;  3E8B A;  4NVP A;  4LFA B;  1K4D C;  4JI4 B;  3U0Z A;  3JD3 A;  3X2Q C;  1FXH A;  3ZRX A;  1SQB H;  3SYQ A;  1W0K G;  4R8C A;  1F23 A;  1H2N A;  2EIL B;  2ZT9 B;  4JTA B;  1GK9 A;  4DR5 B;  3BAA A;  5LP6 C;  2RJZ A;  3OTF A;  2ITD C;  5GON B;  1ENV A;  1AI4 A;  1IBK B;  2R9A A;  1N32 B;  1HW7 A;  1JCH A;  2M6Y A;  1Y76 B;  2RCV A;  3CXC U;  2Q7E A;  1IBM B;  3ZMT A;  1OCR B;  3LDE A;  4TSF G;  3G80 A;  5B3S C;  5JJN B;  4AQY B;  4JYA O;  3RT3 C;  1CP9 A;  2BTQ A;  2XAG A;  4DK1 A;  3K3W A;  1HWY A;  3IC9 A;  2LGQ A;  4CZZ A;  1QR9 A;  3L74 H;  1DTO A;  4B3R O;  4J41 A;  3M7M X;  3K04 A;  2UXC B;  3O9O A;  3KKY A;  3K06 A;  5KAI Z;  1JOY A;  3FYE B;  2W6J G;  2CTQ A;  1SQG A;  1EBO A;  1UPG A;  3UT5 A;  5LMU O;  3C90 A;  3N2K A;  5GTH Z;  2WLK A;  4A5U B;  2F4V O;  2CK3 G;  3E8G A;  5E79 Z;  4DV3 O;  2WA3 A;  1MG1 A;  4DR1 O;  3IGA C;  4FLW A;  1QLE C;  4J42 A;  2UUA B;  4N23 A;  2AXT Z;  4MS2 A;  5D5Q A;  1OCC C;  4PDM A;  4H44 B;  1E79 G;  5FL7 G;  1V54 B;  1JMK C;  1ZSP A;  3ZMV A;  5LA6 A;  1WNS A;  5FPR A;  1SQP H;  4RQE A;  2YS8 A;  4LF7 O;  2NLJ C;  4DUY O;  2CH7 A;  1HNZ O;  3AG2 B;  5CA1 B;  1KU9 A;  1BGY H;  3F5T A;  1YJN V;  2Q9L A;  4Z1M G;  1URF A;  4MTX A;  2LJ2 A;  2ZNJ A;  3A0B Z;  4JV5 B;  4JI0 O;  4XDJ A;  4P2Z A;  1QQC A;  4KUM A;  3TGU H;  2F23 A;  4WCE V;  2QGN A;  1BQZ A;  2KG7 A;  2UXN A;  1M90 W;  5IYB O;  2ZDI C;  3STL C;  3BA8 A;  2QKA A;  1N33 B;  3BRC A;  3LSS A;  3SPI A;  1I5Y A;  3EVK A;  3QG5 A;  3U11 A;  5C8Y B;  2IW5 A;  3F5W C;  1VQL V;  1M56 C;  4TWK A;  2M7W A;  4HZ3 A;  3ZS8 C;  1SF9 A;  1GH6 A;  1YEW A;  1ZL8 B;  2N05 A;  2BOB C;  4DR7 O;  2E74 B;  5K1P A;  4WFH A;  2ITC C;  3Q4H B;  3RW0 A;  1GMG A;  2NR5 A;  2Y69 C;  1HNX O;  1THZ A;  2F66 C;  3O65 A;  3CCS V;  3CRR A;  4LP8 A;  2PY5 A;  1B06 A;  3M8A A;  2ZIO A;  4O4J A;  4R6Z A;  2EZO A;  4EFB A;  1SQQ H;  2IH1 C;  2P5O A;  1WAZ A;  3ZRW B;  4QPJ A;  1BT8 A;  4GLX A;  4FM1 A;  3JAK A;  3J81 N;  1BHA A;  1K5S A;  5DN6 G;  4DV1 B;  3ZN1 A;  4X1Y A;  5L3F A;  2ZD9 A;  4PDL A;  3RYF A;  1E1R G;  5K1X A;  4J7Z A;  4O4H A;  4K0K B;  1LNQ A;  1NH2 D;  5IDJ A;  3AG4 C;  1AIL A;  4BIZ A;  1SET A;  4DV0 B;  4YY3 O;  3K58 A;  4O4L A;  3OEH G;  4Q6G A;  1XMQ B;  1E1Q G;  2EJ7 A;  2B1I A;  4CS3 A;  1K3E A;  4XBF A;  4UCO A;  2K9P A;  1U96 A;  3G4S V;  3IFX A;  1WPX A;  1XL6 A;  2QEX V;  4GKK O;  1K33 A;  1GN6 A;  1GN2 A;  1PD3 A;  3W7W A;  1KC8 W;  4DRX A;  1NQT A;  2BTQ B;  2ADP A;  1W0J G;  1M4U A;  5JWP A;  1T5E A;  1YXB A;  3VQX A;  4JI2 B;  2AGA A;  3B77 A;  5LMN B;  4D7T A;  2WPD G;  1AP5 A;  4B3S B;  3A0R A;  5LXT B;  3A2F A;  1S3J A;  4KL1 A;  5E1A C;  1QVG U;  2GHY A;  4FMT A;  2VQE O;  3ZN0 A;  3WB1 A;  3VBB A;  1Q90 D;  2DJV A;  3UQ8 A;  2L6L A;  1XMO O;  3OTO O;  2PF4 E;  3RFR A;  3ML0 A;  5IE9 A;  4P30 A;  2KQX A;  2QTS A;  2F95 B;  2XOK G;  5AG2 A;  4UB8 Z;  5KLV H;  2ILM A;  4E2L A;  1XEQ A;  4X88 A;  3BCC H;  1FAF A;  2ZM6 O;  4J9Z B;  4NR1 A;  4I55 A;  2IBZ H;  3OUS A;  1NI8 A;  4DW1 A;  2R9R B;  2ZE5 A;  3H1L H;  1JA8 A;  2CH7 B;  4ZBM A;  4LF8 O;  1FYJ A;  2YUA A;  2YSU B;  3P30 A;  4PA7 A;  5LP6 A;  4IHJ A;  1Y67 A;  3SJQ C;  4ABM A;  1J5E O;  3ETQ A;  4HYO A;  2PI4 A;  1PP9 H;  1VF6 A;  4DR2 B;  3ABU A;  5B1B C;  1TGO A;  1RFY A;  2XND G;  3H9V A;  2IM9 A;  2XUM A;  5IT9 N;  3LNM B;  3IJ4 A;  2QE7 G;  4JPR A;  1AI6 A;  1ARO P;  2WLN A;  4BW9 A;  4GT1 A;  1DLB A;  3KZI Z;  4YJ2 B;  1Z5W A;  3OGI B;  1P7G A;  3OM3 B;  2P7T C;  2YIB D;  4P9O A;  2OCC B;  4U7N A;  1Y76 A;  4D6T H;  5IJ0 A;  2YI8 A;  3SR2 C;  3SJA C;  2E5L B;  4MTO A;  2F93 B;  4LR3 A;  4UVA A;  3CC4 V;  2W6I G;  3H1I H;  1F7Y A;  2RNB A;  2JS3 A;  5EYP B;  4DR3 B;  1XBL A;  4X9Q A;  1G1X B;  5J2T A;  2ATK C;  4JI8 B;  1YTF D;  4DV5 B;  2HHH B;  4JI1 B;  2GUZ B;  3HKB B;  3SPH A;  4DR4 O;  4JI5 B;  3CD6 V;  1DF4 A;  5GW7 A;  3MDS A;  1AB3 A;  1NT2 B;  1N36 O;  4FJC C;  1RPR A;  3D8C A;  1HNW O;  3KCX A;  5H9C A;  2JGD A;  2C2A A;  2JIZ G;  2EIK C;  2ZXW C;  3E89 A;  3FB6 C;  2PGG A;  1QHT A;  2PTM A;  4IYI A;  1QNM A;  4X1Y B;  1SC5 B;  2FKX A;  2JRI A;  2XTA A;  5FLX N;  1B3Q A;  4WFG A;  3RYF B;  4O4H B;  1SZX A;  2EX3 A;  1SS3 A;  2LFS A;  4TOI A;  3LDD A;  2QDO A;  2BE3 A;  4MW3 A;  1FS0 G;  5B1A C;  2QA4 V;  1RM1 C;  5BMV A;  2CTP A;  3H1K H;  3B40 A;  2A0L A;  2NNU A;  4ZHQ B;  1EN6 A;  3N2G B;  4DRX B;  4LFA O;  1MA1 A;  5H5N A;  1SA0 A;  3K59 A;  4JI4 O;  1D5N A;  5JQG A;  1MZF A;  2D3O W;  2JEU A;  4UFZ A;  3VQY A;  1CPY A;  2YXL A;  1Y6X A;  4RQF A;  2HLD G;  3CC7 V;  3B2E E;  3W7U A;  4GX0 A;  4DR5 O;  5B66 Z;  4MSW C;  2YI9 A;  3TXQ A;  2XAJ A;  1IBK O;  4GYC B;  4JI6 B;  1Y74 B;  2CE4 A;  4R7C A;  4B08 A;  1N32 O;  3CS5 A;  3HKC A;  1F51 A;  4MTF A;  1IBM O;  2DYS B;  5KHI A;  1CXZ B;  3AG3 B;  5LHH A;  4JF3 A;  4AQY O;  5C8Y A;  2L35 A;  4DV7 B;  2GBO A;  3A0H Z;  1R6K A;  2CUG A;  3OMA B;  3L72 H;  5IYZ B;  2Q0A A;  4B3M B;  2A3Q A;  2QWR B;  3KCY A;  1ZL8 A;  5KUK A;  3QNE A;  4L8J A;  1W2B U;  2UXC O;  4NB5 A;  3ZHR A;  4PD4 F;  1GM8 A;  1O9G A;  1TUB B;  3X2Q B;  1BCC H;  3D3I A;  1YJW V;  2HVJ C;  4I4T A;  3K9A A;  2R9I A;  3K0G A;  2YIA A;  1K34 A;  4IHJ B;  5LP6 B;  3ZRW A;  2OTL V;  3K03 A;  4LF9 O;  5LOV A;  2QKS A;  4I50 A;  2P4K A;  2UUA O;  2EUL A;  3FAV B;  2JJ2 G;  5B3S B;  1NTK H;  2HR3 A;  1M93 A;  3AG1 C;  1KKD A;  3EHB B;  3CC2 V;  1OCZ C;  4W4L A;  2UUC B;  4DR6 B;  1I94 B;  1VQ6 V;  3ABK C;  2DW4 A;  5CA0 B;  4C7U A;  1Q8I A;  2E3C A;  3N27 A;  4EFE A;  2JEX A;  4GKJ B;  4K8Z A;  5IJ0 B;  1WLE A;  2XAH A;  5F2V O;  1K4C C;  2EZP A;  2UUB B;  1V55 C;  3L73 H;  1VQ5 V;  2YID A;  4PI2 A;  3T1Y B;  4DK0 A;  3CYO A;  3MAQ A;  4JV5 O;  3K79 A;  2UU9 B;  3R65 A;  5J2T B;  2LGW A;  5DEC A;  3ZRS A;  4B7K A;  4YHH B;  2WAM A;  5LXT A;  1S5J A;  3K08 A;  2LQT A;  3E8F A;  1YVW A;  5IYD O;  5EBM C;  1N33 O;  1QLE B;  1QLN A;  1N8R W;  3W7X A;  4JYC A;  3CSX A;  1I5X A;  1JVM A;  2JGD B;  2NN4 A;  1OCC B;  4G27 B;  1JJO A;  3DC5 A;  5J9P C;  1V9P A;  1KMI Z;  1A32 A;  1W59 A;  3CCJ V;  4O2B B;  1N34 O;  2Y0P A;  4G28 B;  4QIW F;  1OCO C;  3JD1 A;  2Z0A A;  4IT5 A;  3K9S A;  3B4S A;  1ZUQ A;  2E76 B;  1QBZ A;  3JAR B;  1GN3 A;  2WWW A;  5JVD A;  1LUV A;  3OE7 G;  3AEI A;  1BZK A;  1DF5 A;  1FJG B;  5BMV B;  1TA8 A;  2KKW A;  1TUE B;  4IIJ B;  3RBZ A;  3ZRV A;  2CDY A;  1PV0 A;  2QJ1 A;  1N4C A;  3S3W A;  3G71 V;  2GSM B;  2DWE C;  4PHZ A;  1XOU A;  1SA0 B;  1PNL A;  2VWK A;  4RUE A;  4DV1 O;  1YF2 A;  4YIP A;  1XNQ B;  5JQG B;  2W0F C;  5L3G A;  5LHI A;  3JSL A;  4IL6 Z;  4K0K O;  1PPJ H;  4UB6 Z;  3L75 H;  2JDI G;  1OJH A;  3HPL C;  1OHH G;  3ETD A;  1M56 B;  4DUZ B;  3IAY A;  2PUS A;  3C3S A;  3ZCC A;  1XMQ O;  2H8P C;  1MSD A;  3A8T A;  4LH6 A;  1RPO A;  4J11 A;  5KAF Z;  4RAI A;  3HKC B;  4JAA A;  2R72 A;  1JX9 A;  5CBF A;  4YJ2 A;  3MHS C;  1NJI W;  3JAL A;  4NXN B;  2Y69 B;  1PL0 A;  1SKV A;  3ZBH A;  4B3R B;  1NTZ H;  1WB7 A;  1Z5V A;  4JI2 O;  3QO5 A;  5LMN O;  4GCZ A;  5KHJ A;  2DN9 A;  1NR1 A;  1MMM A;  2XAS A;  4UCU A;  3TJT A;  5EYP A;  2DYR C;  2UXX A;  1D5A A;  1GKF A;  1JPX A;  3LDC A;  1QR8 A;  3T1C A;  3M99 B;  3SPG A;  3CCQ V;  3CP1 A;  3UCS C;  4NYK A;  4FLX A;  2GUZ A;  1EFR G;  3HKB A;  3FB7 C;  4I4T B;  3AG4 B;  3SPC A;  4DV3 B;  2PYJ A;  5EIB D;  2WLH A;  5TIS Z;  4DR1 B;  3B8M A;  3T4D A;  1P49 A;  1B6Q A;  3MHH C;  2B5U A;  2X6C A;  4H37 A;  2ETN A;  3E8H A;  4B7E A;  5A2Q N;  4J10 A;  5LOV B;  4BR6 A;  3KG2 A;  4I50 B;  1RSO A;  3F7Y C;  5BY1 A;  4ZIB A;  3RGB A;  5EBW C;  2JJ1 G;  4LWS B;  5L3E A;  4MTG A;  1VF5 B;  4CC6 A;  3SYO A;  4DV2 O;  4DUY B;  2EJR A;  3RVY A;  4OX9 B;  4LF5 B;  1SQX H;  4QE7 A;  3CWB H;  1EZJ A;  4PJ0 Z;  4LF6 B;  2EIM C;  2QKC A;  3MD0 A;  2ZQM A;  4XDK A;  3STZ C;  3E2E A;  1PKX A;  3BHP A;  3CCV V;  4YXW G;  1SRY A;  2BOC C;  2AHY A;  2WLI B;  1QCE A;  4ZHQ A;  3N2G A;  1JFF A;  2P4V A;  1VEW A;  1VIB A;  3JAS A;  4PI0 A;  2VQF B;  4DR2 O;  4X89 A;  2KB1 A;  4UVB A;  5EBL C;  1H2S B;  3BFR A;  3ZX6 A;  2EIN C;  1VQN V;  5CA3 A;  3ABM C;  4WF9 V;  4MVS A;  1VQK V;  2LW7 A;  4UCV A;  1SQV H;  4CC5 A;  2VS0 A;  3RVZ A;  4HBN A;  1NVP B;  4ZOL B;  4X64 O;  3APQ A;  2WLL A;  1NTM H;  1Y74 A;  2PYL A;  3GWK C;  3DSQ A;  3E22 B;  5IY5 C;  1O9H A;  1P4R A;  1AJQ A;  4FLZ A;  2E5L O;  3OAA G;  2HFE C;  4EEQ A;  4KHP B;  1YJ9 V;  2AW9 A;  1XL4 A;  4FPP A;  4X1I B;  5IYZ A;  1H38 A;  4UV8 A;  4JI3 B;  4B3T B;  5JVD B;  3L9D A;  4DV5 O; 
#chains in the Genus database with same CATH homology
 3ASO C;  1FS0 G;  4QNH B;  5B1A C;  2QA4 V;  1ENV A;  1AI4 A;  4GX2 A;  1RM1 C;  1JJ2 U;  4GX5 A;  5CMU A;  1JCH A;  4LBE C;  4MVU A;  4KFM A;  3CXC U;  5B1B B;  2A0L A;  3JD0 A;  2NNU A;  2WSS G;  4EKW A;  1Q81 W;  3ZMT A;  1S77 D;  1OCR B;  3CCL V;  5LGT A;  3LDE A;  4PDV A;  4TSF G;  5B3S C;  2B1G A;  3ABL C;  4UVC A;  1CP9 A;  2XAG A;  2XAF A;  3K3W A;  1HWY A;  2QTO A;  3CCE V;  4PA4 A;  4CZZ A;  2D3O W;  1QR9 A;  1DTO A;  3UKM A;  2JEU A;  2EIM B;  4P9P A;  2PI5 A;  2IJH A;  1CPY A;  3OW2 U;  3K04 A;  4RQF A;  1H8E G;  2HLD G;  3CC7 V;  1UJW B;  3W7U A;  2X6A A;  4GX0 A;  5CBH A;  3TCU A;  5LBQ A;  1P7B A;  3K06 A;  4MSW C;  2IJK A;  4WFE A;  1JOY A;  1AI5 A;  3F7V C;  2XAJ A;  3FB8 C;  4RO2 A;  4WFB V;  3FYE B;  4R7C A;  2Q67 A;  2W6J G;  1VQ4 V;  2V1D A;  4UV9 A;  4PDR A;  4PA3 A;  1NVP D;  2AHZ A;  1EBO A;  1F51 A;  4MTF A;  2DYS B;  3AG3 B;  2EIN B;  4PA9 A;  3ABM B;  5LHH A;  2WLK A;  4JF3 A;  1MSW D;  2CK3 G;  3E8G A;  3TET A;  5CBG A;  4WFA V;  2P90 A;  3CME V;  1NR7 A;  1MG1 A;  1R6K A;  2YEV B;  3IGA C;  1ORQ C;  1QLE C;  3OMA B;  2IU0 A;  2P6J A;  4LCU C;  3JD2 A;  4N23 A;  1Q86 W;  5B1O A;  4MS2 A;  1OCC C;  3QO8 A;  4JAU A;  1G4Y B;  2EIK B;  2ZXW B;  3K0D A;  4PDM A;  5KUK A;  3QNE A;  1E79 G;  5FL7 G;  1V54 B;  4CBC A;  1M9N A;  1W2B U;  3ZMV A;  1PNM A;  5IY5 B;  1GM8 A;  3X2Q B;  1AJP A;  1BMF G;  2QM8 A;  4X8A A;  3D3I A;  5KUM A;  4I9W A;  1K5Q A;  1YJW V;  5L3C A;  1JQ0 A;  3OEE G;  1R3K C;  4RQE A;  2NLJ C;  3WG7 C;  2HVJ C;  3K9A A;  3AG2 B;  3H01 A;  2R9I A;  3K0G A;  3ZMZ A;  3LSQ A;  1YJN V;  1K34 A;  2H94 A;  4Z1M G;  3ZRW A;  3ASO B;  4MTX A;  2OTL V;  5B1A B;  1R6N A;  5IYC O;  3FYI B;  3K03 A;  1S0V A;  1IXM A;  3EFF K;  1NH2 B;  2QKS A;  4XDJ A;  2DQ0 A;  4P2Z A;  4KUM A;  2HKO A;  1M57 C;  3OMN B;  4WCE V;  1H2G A;  2JJ2 G;  2UXN A;  4JAS A;  5B3S B;  1M90 W;  3ABL B;  5IYB O;  4MVO A;  2HR3 A;  1F4N A;  2ZDI C;  2A9H A;  3AG1 C;  3JCZ A;  3STL C;  1KKD A;  1BL8 A;  3EHB B;  1SER A;  3OR7 C;  3CC2 V;  1OCZ C;  4GX1 A;  3LSS A;  3SYA A;  1K7D A;  1VQ6 V;  3SPI A;  1I5Y A;  3ABK C;  1FXV A;  1SZT A;  2DW4 A;  1J95 A;  3SYC A;  3ASN C;  3OFN G;  2JEX A;  1GM7 A;  2IW5 A;  3F5W C;  1WLE A;  1VQL V;  1M56 C;  1VQM V;  1AR1 B;  1Y66 A;  4TWK A;  2XAH A;  2M7W A;  4HZ3 A;  1K4C C;  3GWO A;  2EZP A;  1SES A;  1KD1 W;  1V55 C;  1VQ5 V;  4MW8 A;  4DO2 A;  2ZDI A;  2BOB C;  3CYO A;  3K79 A;  4TT3 G;  1YIJ V;  4J9Y B;  3R65 A;  4WFH A;  2ITC C;  3E86 A;  2Q69 A;  1FXK A;  3RW0 A;  3ZRS A;  1GMG A;  4QJF B;  4MT8 A;  2Y69 C;  1THZ A;  3CCS V;  2WAM A;  3K08 A;  2FTK A;  3E8F A;  4LP8 A;  1VQP V;  5IYD O;  1Q82 W;  4G2K A;  1ROP A;  5BZB A;  5EBM C;  1QLE B;  1QLN A;  4R6Z A;  1N8R W;  2EZO A;  3FB5 C;  3W7X A;  4JYC A;  2WLL B;  1I5X A;  1JVM A;  2IH1 C;  2X0L A;  1OCC B;  4G27 B;  3ZRW B;  1KQS U;  4QPJ A;  5J9P C;  5HFM A;  1CEZ A;  2IJJ A;  3CCM V;  1BHA A;  3P32 A;  1K5S A;  4QPK A;  5DN6 G;  3ZN1 A;  2Q68 A;  3CCJ V;  2XAQ A;  5L3F A;  2ZD9 A;  4PDL A;  3JD4 A;  3ABT A;  1E1R G;  1GO3 F;  5B1N A;  1K73 W;  1KEC A;  4G28 B;  4L87 A;  4JTD B;  4QIW F;  1MAB G;  1OCO C;  3JD1 A;  3T2M A;  1LNQ A;  3WG7 B;  1K9M W;  1NH2 D;  5H6R A;  4JYB A;  5IDJ A;  3AG4 C;  3G6E V;  4BIZ A;  1QBZ A;  1SET A;  3ETE A;  2WWW A;  2IH3 C;  3OEH G;  3OE7 G;  3AEI A;  2K1E A;  1E1Q G;  2EIJ C;  1DF5 A;  2B1I A;  4WFF A;  1K3E A;  4XBF A;  1Q7Y W;  4LC1 A;  5KA5 A;  2HG5 C;  1VQ8 V;  1TUE B;  3RBZ A;  3G4S V;  4N21 A;  3ZRV A;  2X7R B;  3IFX A;  1WPX A;  1M57 B;  1XL6 A;  2ZR2 A;  2X6B A;  2QEX V;  1K33 A;  1PD3 A;  2DWD C;  2OTJ V;  3G71 V;  3QO7 A;  3W7W A;  2GSM B;  2DWE C;  3BY6 A;  1KC8 W;  1Y4M A;  1NQT A;  3WFV A;  1PNL A;  1W0J G;  4RUE A;  5CN0 A;  3B77 A;  1OCZ B;  2W0F C;  5L3G A;  2WPD G;  5LHI A;  5L3B A;  1R3J C;  3ABK B;  4JAV A;  1RM1 B;  3ASN B;  2JDI G;  2ZR3 A;  3A0R A;  2OCC C;  1S76 D;  3OUF A;  1NBM G;  4QE9 A;  3HPL C;  1OHH G;  1S3J A;  1M56 B;  2P67 A;  3ETD A;  1F4M A;  3BEH A;  3UM7 A;  5E1A C;  4H33 A;  1QVG U;  1R73 A;  1BHB A;  2GHY A;  1V55 B;  5L3D A;  3ZCC A;  2H8P C;  4MVR A;  4FK5 C;  4FMT A;  1QVF U;  3W7S A;  1RPO A;  4U7O A;  3ZN0 A;  4FIP C;  1L1F A;  3TK1 A;  4PEL A;  4RAI A;  1GM9 A;  3VBB A;  1FXK C;  1JX9 A;  2Z5U A;  5CBF A;  3MHS C;  1NKD A;  1NJI W;  2Z3Y A;  2Y69 B;  1PL0 A;  3ML0 A;  4BW5 A;  1K97 A;  3B8N A;  3CCR V;  4P30 A;  1YIT V;  3QO5 A;  2WLI A;  4GCZ A;  3ZIA G;  2A79 B;  1GTO A;  4HAM A;  1NR1 A;  5KA6 A;  1K92 A;  1YTF B;  2XOK G;  2XAS A;  2DYR C;  2WLM A;  2UXX A;  3NXS A;  1GKF A;  2HJF C;  4E2L A;  1JPX A;  3LDC A;  1QR8 A;  2HVK C;  4X88 A;  3T1C A;  3M99 B;  1VQ9 V;  4J9Z B;  3SPG A;  3CMA V;  3CP1 A;  3CCQ V;  3OUS A;  2R9R B;  1EFR G;  1OZ0 A;  1OCO B;  3FB7 C;  5EK0 A;  2EIL C;  4ZBM A;  5C93 A;  3AG4 B;  3SPC A;  3W7T A;  3SPJ A;  2WLH A;  2YSU B;  3B8M A;  3P30 A;  3T4D A;  4PA7 A;  1B6Q A;  4BAY A;  1R3L C;  3MHH C;  3SJQ C;  2B5U A;  2X6C A;  4H37 A;  2EIJ B;  1KP3 A;  4HYO A;  4UUJ C;  2PI4 A;  1S72 V;  4XDL A;  3E8H A;  2DQ3 A;  4R50 A;  3OGC C;  3ETG A;  2EBO A;  1YSC A;  5LHG A;  4MVM A;  2LP7 A;  3KG2 A;  3T4Z A;  3ABU A;  5B1B C;  5LGU A;  2XND G;  3F7Y C;  5EC2 C;  3ZJZ A;  1OCR C;  3DGE A;  1KP2 A;  3LNM B;  1H8H G;  2QE7 G;  4JPR A;  1AI6 A;  5EBW C;  2JJ1 G;  5L3E A;  4KP4 A;  1ARO P;  4MTG A;  2IJI A;  2WLN A;  3SYO A;  5EC1 C;  4GT1 A;  4MVZ A;  2EJR A;  3RVY A;  1DLB A;  4MVQ A;  2MK3 A;  4QE7 A;  4Q20 A;  1ZWI C;  4ASU G;  1EZJ A;  5HFL A;  2EIM C;  3E83 A;  3OM3 B;  2P7T C;  4P9O A;  2OCC B;  4U7N A;  2IU3 A;  1AJN A;  3MD0 A;  1COW G;  2ZQM A;  4XDK A;  3STZ C;  4RUF A;  1YHQ V;  1YI2 V;  3E2E A;  3CPW U;  1PKX A;  3CCV V;  4YXW G;  1SRY A;  2BOC C;  2AHY A;  4JTC B;  2WLI B;  1FFT B;  1QCE A;  3OR6 C;  4MTO A;  3HB3 B;  3ZMU A;  4UVA A;  3SYP A;  3CC4 V;  2W6I G;  4F4L A;  3AG1 B;  3GB7 C;  4OXS A;  4DXW A;  3DTU B;  2Q6A A;  4X89 A;  2KB1 A;  1VQ7 V;  4UXN A;  4UVB A;  5EBL C;  1FXK B;  2F43 G;  2ATK C;  2DYS C;  3AG3 C;  2EIN C;  3D36 A;  1VQN V;  1YTF D;  3LUT B;  3ABM C;  3OMI B;  5CA3 A;  2Y48 A;  5LGN A;  4WF9 V;  1M1K W;  4I5S A;  4MVS A;  1VQK V;  3I55 V;  3SPH A;  4PA6 A;  3RVZ A;  1VQO V;  4JGS A;  3CD6 V;  1DF4 A;  3IC7 A;  5GW7 A;  1NVP B;  3VOU A;  3I56 V;  4FJC C;  1S5H C;  4ZKI A;  2WLL A;  1MOF A;  1RPR A;  3FKS G;  2JIZ G;  2C2A A;  2OT5 A;  2WLJ A;  2LFR A;  5H9C A;  3ZMS A;  2EIK C;  2ZXW C;  3E8B A;  3E89 A;  3FB6 C;  1V54 C;  5H6Q A;  1K8A W;  2DYR B;  1K4D C;  5IY5 C;  1P4R A;  2V7Q G;  1AJQ A;  3OAA G;  1PNK A;  3JD3 A;  3PJS K;  3X2Q C;  3JYC A;  1FXH A;  3ZRX A;  2HFE C;  4WFG A;  1AI7 A;  3SYQ A;  1W0K G;  4R8C A;  1G8M A;  1F23 A;  4BIU A;  1YJ9 V;  2YEV A;  2EIL B;  3CCU V;  3AG2 C;  1XL4 A;  2LFS A;  3E35 A;  4FPP A;  4JTA B;  3LDD A;  5DM6 V;  1GK9 A;  2QM7 A;  1H38 A;  4UV8 A;  1R3I C;  4MW3 A;  2ITD C;  2JK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...