4R50A

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with li+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
KEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
molecule keywords Potassium channel protein
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r50A00
4HZ3A 4CBCA 3OR6C 1S5HC 2DWEC 1KKDA 4X89A 1G4YB 3E8HA 2HVKC 4WFEA 3OR7C 4WFFA 3AG1C 3LDCA 1K4CC 3HPLC 4J9YB 2WLIB 4MVSA 4R6ZA 2AHYA 3SPCA 2QTOA 5IY5C 5CBHA 1P7BA 4MVOA 3STLC 4RO2A 5EBMC 3K08A 4R7CA 4XDJA 2IH1C 2Q68A 5EC1C 2A79B 1R3KC 2R9RB 1V54C 2WLHA 2WLNA 2WLJA 4MVZA 4X88A 5KUMA 2Y69C 1R3IC 4PA7A 3EFFK 3F7VC 4J9ZB 1K4DC 3WG7C 4JTAB 1JVMA 1LNQA 4GX1A 4MTOA 3T4DA 3X2QC 5EK0A 4EKWA 3SYOA 3K0DA 4PA4A 2X6BA 3KG2A 3SPIA 3SYPA 2EIJC 3FB8C 4QE7A 2WLKA 3ZRSA 3SYAA 4MSWC 4QNHB 2A9HA 3IGAC 2JK5C 3ABLC 2DYRC 3AG2C 3SPGA 1J95A 3LNMB 5KUKA 4PA6A 4LBEC 3K06A 2DYSC 3IFXA 3R65A 4ZBMA 2EIMC 4XDLA 4PDLA 3E8GA 4JTCB 2WLLB 4RUFA 4DXWA 2BOCC 4MVUA 4MS2A 3SPHA 5J9PC 2X6CA 3E83A 2ATKC 3ABMC 2HVJC 3OGCC 5EBWC 5B3SC 3LUTB 2H8PC 2HFEC 2Q69A 2NLJC 3AG4C 4H37A 3UKMA 3ABKC 4P9OA 1OCOC 2EIKC 3F7YC 3UM7A 2DWDC 4MVQA 4QE9A 4KFMA 4GX2A 4HYOA 3GB7C 2AHZA 2ITCC 5CBGA 1BL8A 2ZD9A 3TCUA 3SPJA 3K04A 3FB6C 4XDKA 4I9WA 5BZBA 4G27B 1OCCC 2P7TC 2OCCC 2ZXWC 1XL4A 5EBLC 2Q67A 2IH3C 4PA3A 3ASNC 1R3JC 4P9PA 4PDVA 4G28B 1R3LC 4GX5A 5B1BC 5E1AC 3RVYA 3PJSK 5B1AC 3LDEA 3RBZA 4WFGA 3SYCA 3SYQA 4PA9A 3JYCA 3K0GA 4R8CA 4R50A 4WFHA 2WLIA 3RVZA 4UUJC 3K03A 4P2ZA 5EC2C 2Q6AA 1OCRC 1ZWIC 3ASOC 4PDRA 2A0LA 1QLEC 4RAIA 4RUEA 1OCZC 3E86A 4MW8A 2K1EA 3STZC 3FB7C 3T1CA 4BW5A 3E8BA 2KB1A 4MW3A 3SJQC 3E8FA 3TETA 3T4ZA 2QKSA 4JTDB 2YEVA 3BEHA 3RW0A 2BOBC 4MVRA 4MVMA 3LDDA 4PDMA 3VOUA 3ZJZA 2HJFC 4F4LA 2EINC 3AG3C 1M56C 4LCUC 4MTGA 4OXSA 4X8AA 1XL6A 3FB5C 3OUSA 1M57C 1ORQC 3F5WC 2ITDC 4LP8A 3E89A 2EILC 4TWKA 4MTFA 4P30A 3OUFA 2W0FC 4H33A 2HG5C 3T2MA 2WLLA 2WLMA 1V55C 4GX0A 2X6AA 5CBFA
chains in the Genus database with same CATH superfamily
4JYAB 2QR4A 4CBCA 1KKDA 2CDYA 3W7UA 4YY3O 5KMGA 2QA4V 3L72H 4DV4O 1VF6A 3DXRB 3LSSA 4K0KB 3UCSC 1Y4MA 3OMNB 3JAKA 2K9PA 4DV4B 4RQEA 4O4LA 2QWRB 3ZMVA 1Y67A 4B3MB 2LP7A 1NZ6A 3HR0A 2GBOA 4DR5B 3ZBHA 1JFFA 1VP7A 4KHPO 3JSLA 1GH6A 3ABLC 1J95A 2V1DA 4FZ0A 5IYZB 3T1YB 2N74A 3CHXA 2EILB 4KUMA 3E83A 1OCZB 1TA8A 2H8PC 3CC2V 4H0LB 1N36B 1OCOC 2ZIMA 1JJOA 4KFMA 4LNUA 4CC5A 1GN6A 5EZYA 5JH7A 4X1KB 3UT5A 2ITCC 4JYBA 3TCUA 3AG3B 4YJ3B 4CS2A 2YICA 4YIOA 3QO7A 2QWNB 4YIPA 3BFRA 1DGSA 5IJ0B 2AZ2A 4G28B 1S0VA 1HR0B 5KMGB 1MABG 4DO2A 1NJIW 1Q6UA 5EC2C 3VQYA 1OCRC 3CS5A 4GZRB 4RAIA 3H1JH 2YXHA 4NR1A 1Q8IA 4EB6A 1K34A 2CK3G 4DV6B 1N8RW 2CH7B 4PDMA 2Y69B 2HJFC 4AHCA 2NR5A 5C8YB 4AILC 4I5SA 4O4HB 4P30A 4BAYA 5CBFA 4DR3O 1S5HC 3E8HA 3ZMZA 3AG1C 1VQLV 2ZM6B 4NXMO 5A2QN 4D7SA 2Q73A 1F4MA 3OTOO 2PZSA 2KKWA 5KAIZ 1QQCA 4JI8B 3BRCA 4J11A 3OT7A 2QWQB 3EFFK 4GKKB 2EZOA 2ZNJA 2XAHA 1Y74A 2A7WA 2YC0A 3SYPA 3FB8C 2WLKA 3IGAC 1US6A 1S5JA 1BGYH 2Q7HA 4IHJA 4XDLA 4KP4A 4Q6GA 4JV5O 4JTCB 3AEIA 3CCSV 1SQXH 3MHHC 3RYHA 3I55V 5LHIA 3EXAA 2P06A 4F6EA 2F66C 1S72V 1EZVH 1NTZH 2ADQB 2E3CA 1VIBA 1QBZA 1BQZA 1S76D 5JJJB 5IE9A 2LGQA 4TT3G 5C93A 2UXDB 5JQGB 3IC9A 4GX5A 1YITV 1WP7A 4TV8B 2XNDG 3OD4A 4U3FH 1SA0A 2OT5A 2Z5UA 4JI4B 1TVKA 1SQBH 2DW4A 3MHSC 4GT1A 1YF2A 4F6RA 2Y48A 1OCZC 2DOSA 1SRYA 1AJPA 4LF9O 3RW0A 4I9QA 2IJHA 2BOBC 4FIPC 1FYJA 2XASA 4I50A 4YJ2B 1KC8W 4DV3O 2LQTA 3AG3C 2XAQA 4JGSA 2BTOA 3F5WC 2PGGA 2EIJB 2P67A 1M93A 2X7RB 2F23A 4I0XA 5LP6B 4JI2O 5L3BA 3ZHRA 2PTMA 5GTIZ 1WB7A 2H3OA 2YXYA 2ZIOA 2PI5A 2H94A 2IM9A 2ARHA 3AG4B 3OM3B 4JI2B 1GO3F 2RN9A 2EIKB 2WLNA 4MVZA 2XAFA 2Y69C 2GDSA 1P7GA 4NKGB 4QE7A 1GM8A 5FLXN 3D36A 1K97A 3LNMB 4LBEC 2IJKA 5B1AB 5HFLA 4FJCC 1BE3H 4MS2A 1YTFD 1AVMA 1BZKA 2BSKA 2B5UA 1PPJH 1XOUA 3K9AA 4JI3O 2DN9A 5KHKA 4N23A 1YJWV 3BAAA 1QCEA 2B1IA 1FKAO 2PYLA 1B04A 4DW1A 1MMMA 1M57B 3FKSG 1XL4A 2UXCB 4PDVA 4UB8Z 1IBMO 1N0JA 5L3CA 1K92A 1QR8A 2OIGA 2JJ2G 1ZL8B 3K5MA 1ZX3A 4MW8A 1FXKB 2JS3A 4B7KA 3T1HB 2KB1A 3RGBA 3KCXA 4HNAB 2Y0PA 1Y76A 2Q4PA 2JGDB 2YI9A 1P4RA 1AILA 1VQOV 5CA1A 3JD3A 5ITZA 4QIWF 3TXSA 5LHHA 4LF6B 2WA4A 1KKCA 2N04A 1XI1A 1XNQB 4UCRA 2UXXA 3FFQA 2ZE7A 1HP8A 2PY5A 4X89A 2F95B 1G4YB 2HVKC 2E76B 2A06H 2JS5A 5B1BB 1I94B 1NU1H 4O4IA 3AK1A 3WB2A 1DF5A 3L75H 4B3TB 3K58A 2A79B 1R3KC 4AQYO 2R72A 3JSNA 1LNQA 4GX1A 3RWRD 5EK0A 3CSXA 3HKDA 5IYCO 3QO5A 2EIJC 1RSOB 4QNHB 5D5PA 2Z3YA 1VF5B 3K06A 3JALA 4I4TB 2AZ0A 5IT9N 3SPHA 4CH6A 5EBWC 1NKDA 2HFEC 5L3GA 3AG4C 4P9OA 3BA8A 2EIKC 3F7YC 1THZA 4ICGA 1XMOB 1XHXA 1Q43A 4W4KA 3FYEB 4I9WA 3KKYA 2OCHA 1HNXB 2QM4A 1R73A 5KA6A 1XMQB 1KECA 4DUZO 3HKEB 5B1AC 2OYQA 4J7KA 4B3RO 2WLIA 3H9VA 3RVZA 4QJFB 4P2ZA 2RCVA 1K5SA 4J80A 3F5TA 3B8NA 1CPYA 4PV1B 4ZI7B 5LXTA 1K73W 1NTMH 2WSSG 3QF7A 2D3OW 1GAXA 4GKJB 3BEHA 1PNMA 4MVRA 4LWSA 1SS3A 5D5QA 4F4LA 1GM7A 4DUYB 3FD9A 4WFAV 3OMIB 3X2QB 2DJVA 4LC1A 1M57C 1ORQC 2UXBO 4UV9A 4LF7O 3CJHB 2W0FC 3AG2B 2R9IA 1OZ0A 2CGNA 2QM8A 3G71V 2KQXA 2Y4UA 1VQ4V 5K1XA 1FJGB 4LFCO 1JA8A 1FXVA 3H1LH 2NN4A 1FXKC 3SPCA 3ABKB 1I5YA 5EIBC 1IX9A 2RNBA 1TUEB 1N33O 3RYCA 3G4SV 3F7VC 1XUQA 3AG7A 3ZCCA 4TQDA 2DE0X 4JAUA 2OCCB 5FPOA 3L70H 1IURA 1ZUQA 3ASNB 1YI2V 4PA6A 1KB9F 1VARA 4I7ZB 5JVDA 4LFAO 1OHHG 2VQFB 3QNEA 4RUFA 5IYBO 2ZT9B 4DXWA 2X0LA 2EX3A 1QLEB 3ZMUA 4QPJA 2Q69A 1Q86W 2LGWA 4DRXA 3G6BA 5B1NA 3KCYA 1Q7YW 3E2EA 1PL0A 3FB6C 4X1IA 3BY6A 1RPOA 1GRJA 1WNSA 2IH3C 4P9PA 3W7XA 4LF4B 3PJSK 3LDEA 3DXRA 3P3NA 3K3WA 4R50A 3C90A 4DV2O 4PDRA 3ETDA 4CH5A 4ZKIA 3STZC 1ZSPA 4BR6A 1MNGA 4YXWG 1N32O 4JI7B 2GTSA 5LOVB 2F4VB 3A8TA 3L74H 4LH6A 4B08A 1M90W 2Z0AA 1X4TA 5B1OA 4UVCA 1GK9A 1XL6A 1KQSU 3ZN1A 5IYZA 3UO2A 1IBLO 5H5NA 1HNZB 1H2MA 5H6QA 4IL6Z 1N4CA 1AROP 4X64O 4BIUA 5JWPA 5LMNO 1SQGA 2RQ6A 1XREA 1JQ0A 2EJ7A 1QVFU 1VQPV 4D7TA 1K4DC 3DGEA 4JI5B 2ZKOA 4LF5O 2R9AA 3X2QC 5H6RA 3KG2A 5IJ0A 1MZEA 3ZRSA 2HHHO 3QVNA 3AG2C 1N34B 1GM9A 5DEDA 4LF5B 3ZIAG 1JR9A 2P6JA 3HB3B 4YY3B 4H44B 4FMTA 1W0KG 2NLJC 2CH7A 3ABKC 4O4JB 1L8DA 4K35A 1WN7A 3ZRWB 2FYUH 2AHZA 5CBGA 3JCZA 4ABMA 5C8YA 4O4HA 4FM2A 1Q6IA 1W59A 2OCCC 1H2GA 5GW7A 5B66Z 1Q82W 3N2KB 1SC5B 3ASNC 4KHPB 5JCOA 3ETQA 3RBZA 3BHPA 4LFBO 4DR7O 1XDCA 4GUNA 2YIBD 3EVKA 3K03A 5KX5B 1E1QG 1QLEC 2ZQMA 4RQFA 3TK1A 1E1RG 4Z1MG 1W2BU 3M99B 2B1GA 3K79A 4UCTA 1YIJV 4K8XA 2L6LA 4PD4F 3RFRA 3C3TA 3OUSA 3P3PA 1I5XA 1HNWO 1GN4A 3OE7G 1YTFB 1AJQA 4FM0A 3OMAB 4HZ3A 2E74B 1F51A 4DR6O 3P30A 4WFFA 1LUWA 2LJ2A 3OR7C 1U97A 1WJZA 4FLUA 1SETA 3WFVA 2WLJA 3TXQA 1AB3A 2Q0AA 3HKCB 3CCEV 4IIJB 4X9QA 4EKWA 2X6BA 5JQGA 1OCCB 3N27A 3SYAA 3CWBH 3IAYA 4TV8A 3GWKC 1URFA 4E2LA 4FLWA 2KG7B 4TV9B 2WLLB 3K9SA 4DR3B 2UUAO 5J9PC 3VQVA 4NXMB 3JD0A 2EBOA 1VQ7V 3OTOB 4YJ2A 4QE9A 1JJ2U 1AI7A 4FLVA 4DV5O 3CEIA 5LL6Y 1NS1A 3SDLA 5BXZA 3ZEDA 3BCCH 1Z5WA 2QSAA 5LP6A 2QEXV 2P5OA 4FK5C 4UCSA 3G67A 3JCUZ 3GWOA 1FPOA 4JV5B 1AR5A 3CC4V 4U3JB 1FAFA 4PHZA 4RUEA 3T1CA 1RFYA 1JCHA 3ABMB 3APOA 1V54B 1SZTA 3D3IA 1NI8A 1M9NA 4OXSA 3I5DA 5CMUA 4GCZA 3A0BZ 1YEWA 1SF9A 4NYKA 4J41A 2EILC 1H2NA 1NR7A 1XQ8A 3VQWA 1H38A 3P32A 1XILA 1NT2B 2GHYA 1WPBA 3JD1A 2LFRA 3THOA 4CS4A 3VBBA 1P7BA 4GYCB 1CP9A 2LW7A 5EC1C 4ZOLA 2EULA 4LF9B 5DN6G 2UU9O 2YXLA 1NH2D 2PYJA 1YZBA 4DV3B 3CRMA 2EZPA 2V4DA 4TOIA 3QTCA 4MTXA 2UU9B 3DSQA 3CCQV 3W7SA 1ZLZA 2BCCH 4ZBMA 1NBMG 3FAVB 1ZL8A 4JYYA 4UVBA 3WB1A 2IW5A 1FXKA 3L9DA 4JAVA 1I7FA 3N2GB 4HNAA 3FX7A 4X1YB 2JGDA 1V9PA 4TSFG 2DWDC 4MVQA 3EHBB 3OW2U 2N05A 1SZXA 4B7EA 2P4VA 4X66O 1BL8A 4I55B 4UB6Z 4DYLA 3K04A 4G27B 1OCCC 4DV7O 1WB8A 2B9ZA 5JCOC 1R3JC 1TUBB 5BMVB 3HKBB 1V55B 4PA9A 4JI6O 4MT8A 3K0GA 4DV7B 5J2UB 1JX9A 1ZWIC 4K3AA 2HKOA 3E86A 2K1EA 4JI6B 4BW5A 1BCCH 4ZOLB 3AK3A 4JI3B 5KHGA 4LF8O 1ROPA 1N0NA 1RSOA 5A9GA 4BIOA 1YCIA 3BA9A 1GN2A 4DV0O 1I0HA 5LGUA 5LGNA 2HG5C 5FL7G 4I4TA 3K5OA 3ETEA 4CH3A 3JARB 4JI0O 4GX0A 2EIMB 1IBMB 2ADPA 4L87A 5BY1A 4DR2O 3CRQA 2JIZG 2CTPA 1E79G 3LDCA 2Y4TA 4J9YB 1IDSA 1R6KA 3ICXA 2OTJV 2HLDG 1H8EG 2XT9A 2ZDIC 1BHBA 2FKXA 4RO2A 3K08A 2IH1C 2Q68A 4DR2B 5KUMA 1V54C 2DMXA 2F43G 1NVPD 2CUGA 4JTAB 4DR4O 2IU3A 5KHIA 3S3WA 4JI1O 2BE3A 5LMUO 3HKEA 4MSWC 2A9HA 3J7AU 2JDIG 1M56B 4CS3A 4CZZA 1AI5A 5KHHA 3J81N 2JGUA 4FVMA 4PDLA 1GMGA 4ZI7A 2KSDA 3ASOB 1SKVA 4UXNA 2W6IG 2ATKC 3OGCC 4JZGA 2ZR2A 1D5NA 2XOKG 2M6YA 1S77D 5LYJA 3CCJV 4AQYB 1FXHA 5K1PA 1COWG 3CJHA 1G8MA 3PN1A 5LP6C 5CB4A 4HBNA 1UJWB 3ABUA 5E79Z 3VQXA 4WFGA 3SYQA 3JYCA 5LHGA 2WA3A 1SESA 3O9OA 1PKXA 1WLEA 3TETA 2QKSA 1MSWD 3CCUV 5IJ9B 3JASB 1RM1B 3ZHTA 3RYIB 3B09A 4TUYB 3JD4A 2Q7GA 3OUFA 2YIDA 4DR1O 1V55C 3ZS8C 4DUZB 5KAFZ 1Q5OA 4OPAA 2IJJA 4B3RB 3CCRV 4MVSA 4DR1B 5B3SB 2QTOA 5FNVB 1PNKA 3ZMTA 1NQTA 2Y0IA 5LYJB 2R9RB 1AR4A 3WB0A 3CE2A 1R3IC 2VRZA 1VQ6V 4WBNB 3K5LA 2IBZH 3SYOA 1M5IA 2ZXWB 5CB4B 2E5LO 1VQNV 2W6JG 5EYPA 4ZHQB 4FLXA 2UXBB 4LF7B 3OGIB 3IFXA 4UCOA 2EIMC 2V7QG 3SJAC 5JJNB 4PJ0Z 4LFCB 1ZAUA 2VQEO 2OTLV 4J10A 4KL1A 5LOVA 1I08A 1O9HA 2BTQB 4J7JA 1N33B 2ZR3A 1KU9A 2EINB 4O2BB 1HDJA 2GUZB 1DTOA 1HWYA 5DECA 1YDXA 1VQMV 4WCEV 4JYCA 4DV1O 1L0LH 5B1BC 4JPRA 4UUJC 4LFAB 3ASOC 4OPHA 1D2DA 4DV1B 3IJ4A 3U10A 3ZMSA 1VQ5V 4MW3A 1PL4A 3SJQC 3CD6V 3A2FA 1XBLA 3CXHF 1K9MW 1CXZB 2IJIA 3TGUH 2G38A 3FB5C 5TISZ 1Y66A 3AK2A 3L73H 5FPRA 2AGAA 1K33A 1F23A 4WF9V 5EYPB 1BMFG 1H2SB 1P49A 4MTFA 4H33A 3T2MA 2UUBO 1NTKH 2WLMA 1WA8B 2Q0OC 4WFEA 3CRRA 1OJHA 4O4JA 4DV2B 2EJRA 3ZRWA 2LFSA 1N32B 4J9ZB 2ZE5A 4ASUG 1AJNA 4MTOA 3LSQA 1RM1C 1VQKV 3K0DA 3N2KA 4PA4A 2VWJA 1EFRG 2UUCO 3CYOA 2YI8A 2QM7A 1IBLB 3JATB 5KX5A 1B6QA 2D2CB 4PELA 2FTKA 2QWPB 1WAZA 4MVUA 1VQ9V 1EZJA 1Q81W 3B8MA 5B3SC 3OAAG 4O2AB 3J80N 1EN6A 4X64B 1MSDA 1OV9A 5LMNB 2QKAA 2WAMA 4FFBB 2JVDA 1Q3EA 2ZXWC 1R6NA 1RP3B 3KZIZ 2ETNA 4JAAA 3RYFA 4OX9O 2VS0A 4PI0A 4JYAO 2HHHB 2XAGA 3SYCA 2ZINA 4WFHA 3WU2Z 1KMIZ 4K0KO 4UVAA 1H8HG 2A0LA 1FFXB 3NXSA 3FB7C 1NH2B 3CRCA 3DC6A 3HKCA 1F7YA 4GLXA 4IIJA 4B3MO 4L8JA 1IXBA 2EINC 3SR2C 4DR5O 1L0NH 4EFBA 3TJTA 2HR3A 3DC5A 4E4EA 3OEHG 2ZE8A 5CA0B 4Z1VA 2KG7A 5GONB 3T1YO 2DYRB 4QPKA 4TV9A 5LA6B 2WLLA 4H13B 2PI4A 1YXBA 1KYOF 1QLNA 4LFBB 2XTAA 1Y6XA 4DR7B 1YJ9V 1N36O 3OFNG 1GKFA 1S5LZ 1YHQV 4YHHO 3DTUB 4ZIBA 2CE4A 3APQA 4U7OA 1X59A 2P90A 3CCMV 1KP2A 3SGIA 3CCLV 4YHHB 4X20A 1SERA 3E22B 3RYFB 4JASA 3O65A 3BPZA 5KUKA 1SQQH 1HR0O 1HNWB 4FM1A 4U3JA 4BW9A 5KA5A 4NTWA 2ZDIA 4UV8A 4DR6B 4XBFA 2X6CA 5LGTA 1XNRO 4IYIA 5LBQA 4IYHA 3UKMA 4DV6O 4GX2A 3JAKB 4HYOA 1CEZA 1XNRB 3ZRVA 1SQPH 4O4LB 3SJBC 3MAQA 3M7MX 5BZBA 2F1MA 3CCVV 2HP8A 3D3QA 2XUMA 5L3FA 2FL4A 1JFFB 1WPXA 4B3SO 2ZM6O 1AI6A 4Z2WA 3B40A 5IYDO 2CTRA 2UUAB 4JI8O 1Q90D 1NVPB 2OWOA 5IY5B 5H2FZ 4B3SB 3T4ZA 4JTDB 4GKKO 3CP1A 3NR7A 1FFTB 3ZJZA 3OTFA 2RMKB 4LNUB 5EZYB 2ZE6A 4MTGA 4X8AA 3UT5B 5JH7B 4X20B 3ML0A 4DV5B 4DK1A 2A3QA 1BHAA 2AW9A 2P22C 2JRIA 5L3EA 3FAVA 4LH7A 3D8CA 2WPDG 3N2GA 3G80A 4X1YA 1K4CC 3HPLC 4OGQB 4R6ZA 2CTWA 2DQ3A 5CBHA 3QG5A 4QGPA 2O57A 3JAWA 4I55A 1QNMA 4RWUA 4J42A 5JJEB 5L3DA 4EB6B 3K57A 3RN4A 2OIEA 1P84F 1MA1A 1RPRA 2XAJA 3CB2A 2UXDO 1AP6A 4HAMA 1TUBA 4J7ZA 1SQFA 3CC7V 5BMVA 3HKBA 2JK5C 2DYRC 1PNLA 3C3SA 5J2UA 4JI4O 4A5UB 3H1IH 4C7UA 3CPWU 1EN4A 2CGOA 1JMKC 3ZHSA 1O9GA 1T5EA 3LUTB 2E75B 3ZHUA 4CC6A 1M1KW 2HJDA 2MW2B 3E35A 4DK0A 1PD3A 4N21A 3LSUA 2YDEA 4NB5A 3FYIB 4G2KA 3M8AA 2C2AA 4TQFA 2P7TC 5EBLC 1Y74B 1NR1A 3JARA 1TAEA 4K8ZA 2PUSA 2RJZA 1BS3A 1R3LC 4JF3A 5E1AC 2ZCEA 2FB5A 1GN3A 4IHJB 1QHTA 1EBOA 3BABA 5IDJA 1VF6C 2YSUB 3Q4HA 3E8BA 1IBKO 4FPPA 3JAWB 2YEVA 3RYHB 3VOUA 2M7WA 1PM9A 4LCUC 4X66B 1IBKB 3MDSA 2W0XA 1R6TA 1J5EO 2DYSB 3ZRXA 3GVMA 2PF4E 1B06A 1Z5VA 3A0RA 3CRAA 1SA0B 4BWAA 3CXCU 1J5EB 1TVKB 3ZX6A 5IY5C 4F6RB 2VWKA 2QE7G 5EBMC 2XHBA 3IC7A 5F2VO 4X88A 1L1FA 3OEEG 4PA7A 2DQ0A 4LF8B 1JVMA 1R1BA 4KXRA 4I50B 1SQVH 2UXCO 3SPIA 4DV0B 4NXNO 1D5AA 3JD2A 3SPGA 2ODMA 2Q9LA 4BIZA 2P4KA 1DF4A 3E8GA 4JI0B 2RDCA 2QTSA 1QVGU 2BOCC 4NXNB 4I0XB 3T1HO 3Q4HB 3ABMC 1KBHA 4H37A 3ETGA 3CMEV 5IJ9A 2YEVB 3JASA 2F93B 1PV0A 3RYIA 5B5EZ 2QJ1A 4TUYA 4FZ1A 3SJCC 1VMGA 4LF6O 4DR4B 1H2KA 4PI2A 1PP9H 4JI1B 3UQ8A 2QDOA 1BT8A 5LMUB 3A0HZ 3W7WA 1XNQO 3CX5F 3RVYA 1YJNV 1I94O 2ZNIA 5FNVA 1FD9A 4B3TO 2AXTZ 1Q6HA 1G1XB 3UO3A 2BSKB 2JEXA 4NTYA 3E8FA 4WBNA 3H1KH 3LDDA 3I56V 1ENVA 3WG7B 1VQ8V 2YIBA 1K3EA 4ZHQA 3B2EE 1H2LA 3R66A 2JJ1G 4FLYA 3ZN0A 1FS0G 4CH4A 2LW1A 1DK1A 3MD0A 5DM6V 3U0ZA 2BTQA 4U7NA 5IWAO 4MVOA 3STLC 4R7CA 1XMOO 4O2BA 1HW7A 2GUZA 4UCUA 1UPGA 5IWAB 3T4DA 1Y76B 1HNXO 5AG2A 4D6TH 3ZHQA 2FMLA 1XEQA 1XMQO 1G6UA 5CA1B 5ITZB 3QO8A 1MOFA 2DYSC 2CTQA 3U11A 1ZTEA 1XHZA 2GV9A 1AR1B 3JAMN 2HVJC 4GKJO 5KLVH 4DW0A 1KUQA 4O4IB 1KD1W 4DUYO 2YUAA 4AI8A 3K5NA 3S3XA 2ZD9A 3SPJA 4XDKA 4EFEA 2L35A 2MK3A 3HKDB 1IXMA 1WA8A 1VEWA 2QKCA 2E5LB 2QWOB 1FJGO 1K5QA 4R8CA 5J2TA 1BSMA 2Q5ZA 1Z2GA 3JALB 5KHJA 1K7DA 2ILMA 1JOYA 2VQEB 5BR8O 2JEUA 4X65O 1VF7A 3LNNA 3BVOA 1LUVA 4MVMA 4FLTA 1YSCA 1DLBA 2IU0A 5BR8B 4NVPA 1M56C 1TGOA 4FLZA 1LR1A 3B77A 4LR3A 4X65B 2ITDC 3CMAV 4TWKA 2CAZC 3ABLB 3JATA 4IT5A 4W4LA 2VQFO 3D36C 2X6AA 1F4NA 1U96A 2Q7EA 1WP8A 1AP5A 4UFZA 5H9CA 3OR6C 2DWEC 3RT3C 3G6EV 2GSMB 4O2AA 1W0JG 4WFBV 2WLIB 2AHYA 1A32A 3H01A 1M4UA 1OCOB 4JZ2A 3L71H 4XDJA 5LXTB 2WLHA 4FFBA 1MZFA 2LO1A 1YVWA 2GTAA 3WG7C 4LWSB 5CN0A 2HEPA 1KP3A 5EIBD 1EM1A 4LF4O 1S3JA 1UFIA 3R65A 5J2TB 3ABTA 4UCVA 2UUBB 1FFXA 5GTHZ 1IZ3A 1OCRB 2YS8A 3K59A 1BQ0A 3W7TA 4JI7O 2YIAA 3UM7A 2UXNA 2F4VO 3GB7C 3RYCB 5CA0A 1QR9A 5GONA 1IVSA 5LA6A 2Q67A 1EN5A 2Q8VA 2UUCB 4PA3A 5HFMA 4EEQA 1HNZO 2QGNA 3B4SA 5JVDB 2WWWA 2Q6AA 3AG1B 2R70A 4X62O 4Q20A 2NNUA 1B3QA 1GTOA 1JPXA 4IGGA 5CA3A 4NTXA 1AI4A 4FFKA 4JI5O 3H1HH 1QU7A 4X1KA 4DRXB 4X62B 3E22A 4YJ3A 3ZHVA 1MG1A 3E89A 4LP8A 1N34O 4X1IB 4OX9B 1K8AW
chains in the Genus database with same CATH topology
4CBCA 2WPDG 3W7UA 1KKDA 2QA4V 4L87A 1VQ4V 2JIZG 1E79G 1FXVA 3LDCA 3LSSA 1K4CC 3HPLC 4J9YB 1R6KA 4R6ZA 2OTJV 1FXKC 2HLDG 1H8EG 1Y4MA 3SPCA 2ZDIC 1BHBA 2DQ3A 3OMNB 5CBHA 3ABKB 4RO2A 1I5YA 3K08A 2IH1C 2Q68A 4RQEA 5KUMA 1TUEB 1V54C 2F43G 3ZMVA 3G4SV 3F7VC 5L3DA 1NVPD 4JTAB 2LP7A 2IU3A 3ZCCA 1RPRA 2XAJA 4JAUA 4HAMA 2OCCB 3CC7V 4MSWC 2A9HA 2JDIG 2JK5C 3ABLC 1M56B 2DYRC 3ASNB 1J95A 1YI2V 1PNLA 2V1DA 4PA6A 4CZZA 1AI5A 1OHHG 4PDLA 1GMGA 2EILB 3QNEA 3CPWU 4RUFA 5IYBO 4DXWA 4KUMA 3ASOB 4UXNA 2X0LA 3E83A 2W6IG 2ATKC 1QLEB 3ZMUA 3OGCC 1OCZB 3LUTB 4QPJA 2H8PC 2Q69A 3CC2V 1Q86W 1OCOC 2ZR2A 1M1KW 2XOKG 1S77D 4KFMA 5B1NA 3E35A 1PD3A 4N21A 2ITCC 3CCJV 4JYBA 1FXHA 1Q7YW 3E2EA 3TCUA 1PL0A 3AG3B 1COWG 3FB6C 3BY6A 1RPOA 3FYIB 4G2KA 1G8MA 2C2AA 3QO7A 2P7TC 5EBLC 1NR1A 2IH3C 4P9PA 1UJWB 3ABUA 1R3LC 4G28B 4JF3A 5E1AC 3W7XA 3PJSK 3LDEA 1S0VA 4WFGA 3SYQA 3JYCA 5LHGA 1MABG 3K3WA 4R50A 4DO2A 1NJIW 5EC2C 1OCRC 1SESA 4PDRA 3ETDA 1EBOA 4RAIA 1PKXA 5IDJA 2YSUB 4ZKIA 3STZC 1WLEA 3E8BA 4FPPA 4YXWG 3TETA 2QKSA 2YEVA 1K34A 2CK3G 3CCUV 1N8RW 1MSWD 3VOUA 4PDMA 2Y69B 2HJFC 2M7WA 1M90W 5B1OA 4LCUC 1RM1B 4UVCA 1GK9A 1XL6A 1KQSU 3ZN1A 4I5SA 3JD4A 4P30A 3OUFA 4BAYA 2DYSB 1V55C 3ZRXA 5CBFA 1S5HC 5H6QA 3E8HA 2IJJA 3ZMZA 3AG1C 3A0RA 1VQLV 3CCRV 3CXCU 1F4MA 4MVSA 1AROP 2QTOA 5B3SB 5IY5C 1PNKA 3ZMTA 5EBMC 2QE7G 4BIUA 1NQTA 3IC7A 2R9RB 4X88A 1L1FA 1JQ0A 1QVFU 3OEEG 1R3IC 1VQPV 4PA7A 2DQ0A 3EFFK 1VQ6V 1K4DC 3DGEA 2EZOA 4GX0A 1JVMA 2XAHA 3X2QC 3SYOA 5H6RA 3KG2A 3SPIA 3SYPA 3FB8C 2ZXWB 2WLKA 3ZRSA 3IGAC 1VQNV 2W6JG 3AG2C 3JD2A 3SPGA 1GM9A 4BIZA 1DF4A 3IFXA 2EIMC 4XDLA 4KP4A 3E8GA 4JTCB 3ZIAG 2V7QG 1QVGU 3AEIA 2BOCC 2P6JA 3HB3B 3CCSV 3ABMC 2OTLV 4FMTA 3MHHC 1W0KG 2NLJC 4H37A 3ETGA 3CMEV 3ABKC 3I55V 5LHIA 2YEVB 3ZRWB 1S72V 2AHZA 5CBGA 2ZR3A 3JCZA 2EINB 1QBZA 1DTOA 1S76D 1HWYA 2OCCC 1H2GA 4TT3G 5GW7A 5C93A 1Q82W 1VQMV 4WCEV 3ASNC 3W7WA 4JYCA 4GX5A 5B1BC 3RVYA 1YITV 1YJNV 4JPRA 3RBZA 2XNDG 2OT5A 2Z5UA 4UUJC 3K03A 2DW4A 3ASOC 3MHSC 4GT1A 1E1QG 2Y48A 1QLEC 2ZQMA 1OCZC 4RQFA 3ZMSA 3TK1A 1E1RG 1SRYA 2JEXA 4MW3A 4Z1MG 1VQ5V 3SJQC 1AJPA 3E8FA 3CD6V 1W2BU 3M99B 2B1GA 3RW0A 2IJHA 2BOBC 4FIPC 3LDDA 2XASA 3K79A 1YIJV 1KC8W 1K9MW 3I56V 1ENVA 3AG3C 3WG7B 2IJIA 2XAQA 4JGSA 1VQ8V 1K3EA 3FB5C 3OUSA 1Y66A 3F5WC 2EIJB 1K33A 1F23A 1I5XA 2P67A 4WF9V 1BMFG 2JJ1G 4MTFA 3OE7G 4H33A 1YTFB 1AJQA 3T2MA 2WLMA 3ZN0A 2X7RB 3OMAB 1FS0G 4HZ3A 1F51A 5L3BA 4WFEA 3P30A 4WFFA 3OR7C 3MD0A 5DM6V 2PI5A 2EJRA 3ZRWA 2H94A 4U7NA 1SETA 3AG4B 3OM3B 4MVOA 3STLC 1GO3F 2EIKB 4R7CA 2WLNA 2LFSA 3WFVA 2WLJA 4MVZA 2XAFA 2Y69C 4J9ZB 3CCEV 4ASUG 1AJNA 4MTOA 3LSQA 3T4DA 1VQKV 1RM1C 4EKWA 3K0DA 4PA4A 2X6BA 1EFRG 1OCCB 3CYOA 4QE7A 1GM8A 3SYAA 3D36A 1K97A 2QM7A 3QO8A 3LNMB 1MOFA 4LBEC 4E2LA 2DYSC 2IJKA 5B1AB 5HFLA 1B6QA 4PELA 4FJCC 2FTKA 2WLLB 4MVUA 4MS2A 1YTFD 5J9PC 2B5UA 1AR1B 1VQ9V 1EZJA 1Q81W 3B8MA 2HVJC 3JD0A 5B3SC 3K9AA 2EBOA 3OAAG 1VQ7V 4N23A 4QE9A 1YJWV 1JJ2U 1AI7A 1KD1W 1QCEA 2ZD9A 2B1IA 3SPJA 2WAMA 4XDKA 1M57B 3FKSG 2MK3A 2ZXWC 1R6NA 1XL4A 1IXMA 2QEXV 4PDVA 4FK5C 2XAGA 5L3CA 3SYCA 1K5QA 4R8CA 4WFHA 3GWOA 1K92A 1QR8A 4UVAA 1H8HG 2JJ2G 2A0LA 3CC4V 1K7DA 3NXSA 4RUEA 4MW8A 1FXKB 1JOYA 3FB7C 3T1CA 1NH2B 2KB1A 2JEUA 1JCHA 3ABMB 1V54B 1SZTA 4MVMA 3D3IA 1P4RA 1YSCA 1DLBA 2EINC 2IU0A 1VQOV 2HR3A 1M56C 1M9NA 4OXSA 5CMUA 3B77A 4GCZA 3JD3A 2ITDC 4QIWF 3CMAV 3OEHG 5LHHA 2EILC 4TWKA 1NR7A 3ABLB 2DYRB 4QPKA 1H38A 2WLLA 3P32A 2PI4A 2X6AA 2UXXA 1F4NA 3OR6C 5H9CA 2DWEC 2GHYA 4X89A 1G4YB 3G6EV 2HVKC 1QLNA 2GSMB 5B1BB 3JD1A 2LFRA 1W0JG 4WFBV 1YJ9V 2WLIB 2AHYA 1DF5A 3OFNG 3H01A 1GKFA 3VBBA 1P7BA 1YHQV 1OCOB 3DTUB 1CP9A 4XDJA 5EC1C 2A79B 1R3KC 2WLHA 4U7OA 5DN6G 2P90A 3CCMV 3WG7C 1NH2D 1LNQA 4GX1A 1KP2A 5EK0A 3CCLV 5CN0A 5IYCO 1KP3A 3QO5A 2EZPA 2EIJC 1SERA 4QNHB 4MTXA 4JASA 3CCQV 1S3JA 3W7SA 2Z3YA 5KUKA 3K06A 3R65A 4ZBMA 1NBMG 3ABTA 5KA5A 4UVBA 2IW5A 1FXKA 1OCRB 2ZDIA 4UV8A 3SPHA 4XBFA 2X6CA 4JAVA 5LGTA 5EBWC 1NKDA 2HFEC 5L3GA 3AG4C 3W7TA 5LBQA 3UKMA 4P9OA 2EIKC 3UM7A 3F7YC 4TSFG 1THZA 2DWDC 4MVQA 2UXNA 3EHBB 3OW2U 4GX2A 4HYOA 3GB7C 1CEZA 1BL8A 3ZRVA 3K04A 3FYEB 4I9WA 5BZBA 1QR9A 4G27B 3CCVV 1OCCC 3G71V 2Q67A 5L3FA 4PA3A 5HFMA 1R73A 1R3JC 5KA6A 1KECA 5B1AC 1WPXA 1V55B 4PA9A 4MT8A 3K0GA 2WLIA 3RVZA 1AI6A 2WWWA 4QJFB 4P2ZA 1JX9A 2Q6AA 1ZWIC 1K5SA 3AG1B 2HKOA 3B8NA 5IYDO 1CPYA 3E86A 1K73W 2K1EA 4Q20A 1NVPB 5IY5B 2NNUA 4BW5A 2WSSG 1GTOA 1JPXA 3T4ZA 2D3OW 4JTDB 5CA3A 3BEHA 1AI4A 3CP1A 1FFTB 1PNMA 4MVRA 3ZJZA 1ROPA 4F4LA 1GM7A 4WFAV 3OMIB 4MTGA 4X8AA 3X2QB 4LC1A 3ML0A 1M57C 1ORQC 1BHAA 1MG1A 3E89A 4LP8A 4UV9A 5LGUA 5L3EA 2W0FC 5LGNA 3AG2B 2HG5C 5FL7G 2R9IA 1OZ0A 3ETEA 2QM8A 2EIMB 1K8AW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZ3 A;  4CBC A;  3OR6 C;  1S5H C;  2DWE C;  1KKD A;  4X89 A;  1G4Y B;  3E8H A;  2HVK C;  4WFE A;  3OR7 C;  4WFF A;  3AG1 C;  3LDC A;  1K4C C;  3HPL C;  4J9Y B;  2WLI B;  4MVS A;  4R6Z A;  2AHY A;  3SPC A;  2QTO A;  5IY5 C;  5CBH A;  1P7B A;  4MVO A;  3STL C;  4RO2 A;  5EBM C;  3K08 A;  4R7C A;  4XDJ A;  2IH1 C;  2Q68 A;  5EC1 C;  2A79 B;  1R3K C;  2R9R B;  1V54 C;  2WLH A;  2WLN A;  2WLJ A;  4MVZ A;  4X88 A;  5KUM A;  2Y69 C;  1R3I C;  4PA7 A;  3EFF K;  3F7V C;  4J9Z B;  1K4D C;  3WG7 C;  4JTA B;  1JVM A;  1LNQ A;  4GX1 A;  4MTO A;  3T4D A;  3X2Q C;  5EK0 A;  4EKW A;  3SYO A;  3K0D A;  4PA4 A;  2X6B A;  3KG2 A;  3SPI A;  3SYP A;  2EIJ C;  3FB8 C;  4QE7 A;  2WLK A;  3ZRS A;  3SYA A;  4MSW C;  4QNH B;  2A9H A;  3IGA C;  2JK5 C;  3ABL C;  2DYR C;  3AG2 C;  3SPG A;  1J95 A;  3LNM B;  5KUK A;  4PA6 A;  4LBE C;  3K06 A;  2DYS C;  3IFX A;  3R65 A;  4ZBM A;  2EIM C;  4XDL A;  4PDL A;  3E8G A;  4JTC B;  2WLL B;  4RUF A;  4DXW A;  2BOC C;  4MVU A;  4MS2 A;  3SPH A;  5J9P C;  2X6C A;  3E83 A;  2ATK C;  3ABM C;  2HVJ C;  3OGC C;  5EBW C;  5B3S C;  3LUT B;  2H8P C;  2HFE C;  2Q69 A;  2NLJ C;  3AG4 C;  4H37 A;  3UKM A;  3ABK C;  4P9O A;  1OCO C;  2EIK C;  3F7Y C;  3UM7 A;  2DWD C;  4MVQ A;  4QE9 A;  4KFM A;  4GX2 A;  4HYO A;  3GB7 C;  2AHZ A;  2ITC C;  5CBG A;  1BL8 A;  2ZD9 A;  3TCU A;  3SPJ A;  3K04 A;  3FB6 C;  4XDK A;  4I9W A;  5BZB A;  4G27 B;  1OCC C;  2P7T C;  2OCC C;  2ZXW C;  1XL4 A;  5EBL C;  2Q67 A;  2IH3 C;  4PA3 A;  3ASN C;  1R3J C;  4P9P A;  4PDV A;  4G28 B;  1R3L C;  4GX5 A;  5B1B C;  5E1A C;  3RVY A;  3PJS K;  5B1A C;  3LDE A;  3RBZ A;  4WFG A;  3SYC A;  3SYQ A;  4PA9 A;  3JYC A;  3K0G A;  4R8C A;  4R50 A;  4WFH A;  2WLI A;  3RVZ A;  4UUJ C;  3K03 A;  4P2Z A;  5EC2 C;  2Q6A A;  1OCR C;  1ZWI C;  3ASO C;  4PDR A;  2A0L A;  1QLE C;  4RAI A;  4RUE A;  1OCZ C;  3E86 A;  4MW8 A;  2K1E A;  3STZ C;  3FB7 C;  3T1C A;  4BW5 A;  3E8B A;  2KB1 A;  4MW3 A;  3SJQ C;  3E8F A;  3TET A;  3T4Z A;  2QKS A;  4JTD B;  2YEV A;  3BEH A;  3RW0 A;  2BOB C;  4MVR A;  4MVM A;  3LDD A;  4PDM A;  3VOU A;  3ZJZ A;  2HJF C;  4F4L A;  2EIN C;  3AG3 C;  1M56 C;  4LCU C;  4MTG A;  4OXS A;  4X8A A;  1XL6 A;  3FB5 C;  3OUS A;  1M57 C;  1ORQ C;  3F5W C;  2ITD C;  4LP8 A;  3E89 A;  2EIL C;  4TWK A;  4MTF A;  4P30 A;  3OUF A;  2W0F C;  4H33 A;  2HG5 C;  3T2M A;  2WLL A;  2WLM A;  1V55 C;  4GX0 A;  2X6A A;  5CBF A; 
#chains in the Genus database with same CATH topology
 4JYA B;  2QR4 A;  4CBC A;  1KKD A;  2CDY A;  3W7U A;  4YY3 O;  5KMG A;  2QA4 V;  3L72 H;  4DV4 O;  1VF6 A;  3DXR B;  3LSS A;  4K0K B;  3UCS C;  1Y4M A;  3OMN B;  3JAK A;  2K9P A;  4DV4 B;  4RQE A;  4O4L A;  2QWR B;  3ZMV A;  1Y67 A;  4B3M B;  2LP7 A;  1NZ6 A;  3HR0 A;  2GBO A;  4DR5 B;  3ZBH A;  1JFF A;  1VP7 A;  4KHP O;  3JSL A;  1GH6 A;  3ABL C;  1J95 A;  2V1D A;  4FZ0 A;  5IYZ B;  3T1Y B;  2N74 A;  3CHX A;  2EIL B;  4KUM A;  3E83 A;  1OCZ B;  1TA8 A;  2H8P C;  3CC2 V;  4H0L B;  1N36 B;  1OCO C;  2ZIM A;  1JJO A;  4KFM A;  4LNU A;  4CC5 A;  1GN6 A;  5EZY A;  5JH7 A;  4X1K B;  3UT5 A;  2ITC C;  4JYB A;  3TCU A;  3AG3 B;  4YJ3 B;  4CS2 A;  2YIC A;  4YIO A;  3QO7 A;  2QWN B;  4YIP A;  3BFR A;  1DGS A;  5IJ0 B;  2AZ2 A;  4G28 B;  1S0V A;  1HR0 B;  5KMG B;  1MAB G;  4DO2 A;  1NJI W;  1Q6U A;  5EC2 C;  3VQY A;  1OCR C;  3CS5 A;  4GZR B;  4RAI A;  3H1J H;  2YXH A;  4NR1 A;  1Q8I A;  4EB6 A;  1K34 A;  2CK3 G;  4DV6 B;  1N8R W;  2CH7 B;  4PDM A;  2Y69 B;  2HJF C;  4AHC A;  2NR5 A;  5C8Y B;  4AIL C;  4I5S A;  4O4H B;  4P30 A;  4BAY A;  5CBF A;  4DR3 O;  1S5H C;  3E8H A;  3ZMZ A;  3AG1 C;  1VQL V;  2ZM6 B;  4NXM O;  5A2Q N;  4D7S A;  2Q73 A;  1F4M A;  3OTO O;  2PZS A;  2KKW A;  5KAI Z;  1QQC A;  4JI8 B;  3BRC A;  4J11 A;  3OT7 A;  2QWQ B;  3EFF K;  4GKK B;  2EZO A;  2ZNJ A;  2XAH A;  1Y74 A;  2A7W A;  2YC0 A;  3SYP A;  3FB8 C;  2WLK A;  3IGA C;  1US6 A;  1S5J A;  1BGY H;  2Q7H A;  4IHJ A;  4XDL A;  4KP4 A;  4Q6G A;  4JV5 O;  4JTC B;  3AEI A;  3CCS V;  1SQX H;  3MHH C;  3RYH A;  3I55 V;  5LHI A;  3EXA A;  2P06 A;  4F6E A;  2F66 C;  1S72 V;  1EZV H;  1NTZ H;  2ADQ B;  2E3C A;  1VIB A;  1QBZ A;  1BQZ A;  1S76 D;  5JJJ B;  5IE9 A;  2LGQ A;  4TT3 G;  5C93 A;  2UXD B;  5JQG B;  3IC9 A;  4GX5 A;  1YIT V;  1WP7 A;  4TV8 B;  2XND G;  3OD4 A;  4U3F H;  1SA0 A;  2OT5 A;  2Z5U A;  4JI4 B;  1TVK A;  1SQB H;  2DW4 A;  3MHS C;  4GT1 A;  1YF2 A;  4F6R A;  2Y48 A;  1OCZ C;  2DOS A;  1SRY A;  1AJP A;  4LF9 O;  3RW0 A;  4I9Q A;  2IJH A;  2BOB C;  4FIP C;  1FYJ A;  2XAS A;  4I50 A;  4YJ2 B;  1KC8 W;  4DV3 O;  2LQT A;  3AG3 C;  2XAQ A;  4JGS A;  2BTO A;  3F5W C;  2PGG A;  2EIJ B;  2P67 A;  1M93 A;  2X7R B;  2F23 A;  4I0X A;  5LP6 B;  4JI2 O;  5L3B A;  3ZHR A;  2PTM A;  5GTI Z;  1WB7 A;  2H3O A;  2YXY A;  2ZIO A;  2PI5 A;  2H94 A;  2IM9 A;  2ARH A;  3AG4 B;  3OM3 B;  4JI2 B;  1GO3 F;  2RN9 A;  2EIK B;  2WLN A;  4MVZ A;  2XAF A;  2Y69 C;  2GDS A;  1P7G A;  4NKG B;  4QE7 A;  1GM8 A;  5FLX N;  3D36 A;  1K97 A;  3LNM B;  4LBE C;  2IJK A;  5B1A B;  5HFL A;  4FJC C;  1BE3 H;  4MS2 A;  1YTF D;  1AVM A;  1BZK A;  2BSK A;  2B5U A;  1PPJ H;  1XOU A;  3K9A A;  4JI3 O;  2DN9 A;  5KHK A;  4N23 A;  1YJW V;  3BAA A;  1QCE A;  2B1I A;  1FKA O;  2PYL A;  1B04 A;  4DW1 A;  1MMM A;  1M57 B;  3FKS G;  1XL4 A;  2UXC B;  4PDV A;  4UB8 Z;  1IBM O;  1N0J A;  5L3C A;  1K92 A;  1QR8 A;  2OIG A;  2JJ2 G;  1ZL8 B;  3K5M A;  1ZX3 A;  4MW8 A;  1FXK B;  2JS3 A;  4B7K A;  3T1H B;  2KB1 A;  3RGB A;  3KCX A;  4HNA B;  2Y0P A;  1Y76 A;  2Q4P A;  2JGD B;  2YI9 A;  1P4R A;  1AIL A;  1VQO V;  5CA1 A;  3JD3 A;  5ITZ A;  4QIW F;  3TXS A;  5LHH A;  4LF6 B;  2WA4 A;  1KKC A;  2N04 A;  1XI1 A;  1XNQ B;  4UCR A;  2UXX A;  3FFQ A;  2ZE7 A;  1HP8 A;  2PY5 A;  4X89 A;  2F95 B;  1G4Y B;  2HVK C;  2E76 B;  2A06 H;  2JS5 A;  5B1B B;  1I94 B;  1NU1 H;  4O4I A;  3AK1 A;  3WB2 A;  1DF5 A;  3L75 H;  4B3T B;  3K58 A;  2A79 B;  1R3K C;  4AQY O;  2R72 A;  3JSN A;  1LNQ A;  4GX1 A;  3RWR D;  5EK0 A;  3CSX A;  3HKD A;  5IYC O;  3QO5 A;  2EIJ C;  1RSO B;  4QNH B;  5D5P A;  2Z3Y A;  1VF5 B;  3K06 A;  3JAL A;  4I4T B;  2AZ0 A;  5IT9 N;  3SPH A;  4CH6 A;  5EBW C;  1NKD A;  2HFE C;  5L3G A;  3AG4 C;  4P9O A;  3BA8 A;  2EIK C;  3F7Y C;  1THZ A;  4ICG A;  1XMO B;  1XHX A;  1Q43 A;  4W4K A;  3FYE B;  4I9W A;  3KKY A;  2OCH A;  1HNX B;  2QM4 A;  1R73 A;  5KA6 A;  1XMQ B;  1KEC A;  4DUZ O;  3HKE B;  5B1A C;  2OYQ A;  4J7K A;  4B3R O;  2WLI A;  3H9V A;  3RVZ A;  4QJF B;  4P2Z A;  2RCV A;  1K5S A;  4J80 A;  3F5T A;  3B8N A;  1CPY A;  4PV1 B;  4ZI7 B;  5LXT A;  1K73 W;  1NTM H;  2WSS G;  3QF7 A;  2D3O W;  1GAX A;  4GKJ B;  3BEH A;  1PNM A;  4MVR A;  4LWS A;  1SS3 A;  5D5Q A;  4F4L A;  1GM7 A;  4DUY B;  3FD9 A;  4WFA V;  3OMI B;  3X2Q B;  2DJV A;  4LC1 A;  1M57 C;  1ORQ C;  2UXB O;  4UV9 A;  4LF7 O;  3CJH B;  2W0F C;  3AG2 B;  2R9I A;  1OZ0 A;  2CGN A;  2QM8 A;  3G71 V;  2KQX A;  2Y4U A;  1VQ4 V;  5K1X A;  1FJG B;  4LFC O;  1JA8 A;  1FXV A;  3H1L H;  2NN4 A;  1FXK C;  3SPC A;  3ABK B;  1I5Y A;  5EIB C;  1IX9 A;  2RNB A;  1TUE B;  1N33 O;  3RYC A;  3G4S V;  3F7V C;  1XUQ A;  3AG7 A;  3ZCC A;  4TQD A;  2DE0 X;  4JAU A;  2OCC B;  5FPO A;  3L70 H;  1IUR A;  1ZUQ A;  3ASN B;  1YI2 V;  4PA6 A;  1KB9 F;  1VAR A;  4I7Z B;  5JVD A;  4LFA O;  1OHH G;  2VQF B;  3QNE A;  4RUF A;  5IYB O;  2ZT9 B;  4DXW A;  2X0L A;  2EX3 A;  1QLE B;  3ZMU A;  4QPJ A;  2Q69 A;  1Q86 W;  2LGW A;  4DRX A;  3G6B A;  5B1N A;  3KCY A;  1Q7Y W;  3E2E A;  1PL0 A;  3FB6 C;  4X1I A;  3BY6 A;  1RPO A;  1GRJ A;  1WNS A;  2IH3 C;  4P9P A;  3W7X A;  4LF4 B;  3PJS K;  3LDE A;  3DXR A;  3P3N A;  3K3W A;  4R50 A;  3C90 A;  4DV2 O;  4PDR A;  3ETD A;  4CH5 A;  4ZKI A;  3STZ C;  1ZSP A;  4BR6 A;  1MNG A;  4YXW G;  1N32 O;  4JI7 B;  2GTS A;  5LOV B;  2F4V B;  3A8T A;  3L74 H;  4LH6 A;  4B08 A;  1M90 W;  2Z0A A;  1X4T A;  5B1O A;  4UVC A;  1GK9 A;  1XL6 A;  1KQS U;  3ZN1 A;  5IYZ A;  3UO2 A;  1IBL O;  5H5N A;  1HNZ B;  1H2M A;  5H6Q A;  4IL6 Z;  1N4C A;  1ARO P;  4X64 O;  4BIU A;  5JWP A;  5LMN O;  1SQG A;  2RQ6 A;  1XRE A;  1JQ0 A;  2EJ7 A;  1QVF U;  1VQP V;  4D7T A;  1K4D C;  3DGE A;  4JI5 B;  2ZKO A;  4LF5 O;  2R9A A;  3X2Q C;  5H6R A;  3KG2 A;  5IJ0 A;  1MZE A;  3ZRS A;  2HHH O;  3QVN A;  3AG2 C;  1N34 B;  1GM9 A;  5DED A;  4LF5 B;  3ZIA G;  1JR9 A;  2P6J A;  3HB3 B;  4YY3 B;  4H44 B;  4FMT A;  1W0K G;  2NLJ C;  2CH7 A;  3ABK C;  4O4J B;  1L8D A;  4K35 A;  1WN7 A;  3ZRW B;  2FYU H;  2AHZ A;  5CBG A;  3JCZ A;  4ABM A;  5C8Y A;  4O4H A;  4FM2 A;  1Q6I A;  1W59 A;  2OCC C;  1H2G A;  5GW7 A;  5B66 Z;  1Q82 W;  3N2K B;  1SC5 B;  3ASN C;  4KHP B;  5JCO A;  3ETQ A;  3RBZ A;  3BHP A;  4LFB O;  4DR7 O;  1XDC A;  4GUN A;  2YIB D;  3EVK A;  3K03 A;  5KX5 B;  1E1Q G;  1QLE C;  2ZQM A;  4RQF A;  3TK1 A;  1E1R G;  4Z1M G;  1W2B U;  3M99 B;  2B1G A;  3K79 A;  4UCT A;  1YIJ V;  4K8X A;  2L6L A;  4PD4 F;  3RFR A;  3C3T A;  3OUS A;  3P3P A;  1I5X A;  1HNW O;  1GN4 A;  3OE7 G;  1YTF B;  1AJQ A;  4FM0 A;  3OMA B;  4HZ3 A;  2E74 B;  1F51 A;  4DR6 O;  3P30 A;  4WFF A;  1LUW A;  2LJ2 A;  3OR7 C;  1U97 A;  1WJZ A;  4FLU A;  1SET A;  3WFV A;  2WLJ A;  3TXQ A;  1AB3 A;  2Q0A A;  3HKC B;  3CCE V;  4IIJ B;  4X9Q A;  4EKW A;  2X6B A;  5JQG A;  1OCC B;  3N27 A;  3SYA A;  3CWB H;  3IAY A;  4TV8 A;  3GWK C;  1URF A;  4E2L A;  4FLW A;  2KG7 B;  4TV9 B;  2WLL B;  3K9S A;  4DR3 B;  2UUA O;  5J9P C;  3VQV A;  4NXM B;  3JD0 A;  2EBO A;  1VQ7 V;  3OTO B;  4YJ2 A;  4QE9 A;  1JJ2 U;  1AI7 A;  4FLV A;  4DV5 O;  3CEI A;  5LL6 Y;  1NS1 A;  3SDL A;  5BXZ A;  3ZED A;  3BCC H;  1Z5W A;  2QSA A;  5LP6 A;  2QEX V;  2P5O A;  4FK5 C;  4UCS A;  3G67 A;  3JCU Z;  3GWO A;  1FPO A;  4JV5 B;  1AR5 A;  3CC4 V;  4U3J B;  1FAF A;  4PHZ A;  4RUE A;  3T1C A;  1RFY A;  1JCH A;  3ABM B;  3APO A;  1V54 B;  1SZT A;  3D3I A;  1NI8 A;  1M9N A;  4OXS A;  3I5D A;  5CMU A;  4GCZ A;  3A0B Z;  1YEW A;  1SF9 A;  4NYK A;  4J41 A;  2EIL C;  1H2N A;  1NR7 A;  1XQ8 A;  3VQW A;  1H38 A;  3P32 A;  1XIL A;  1NT2 B;  2GHY A;  1WPB A;  3JD1 A;  2LFR A;  3THO A;  4CS4 A;  3VBB A;  1P7B A;  4GYC B;  1CP9 A;  2LW7 A;  5EC1 C;  4ZOL A;  2EUL A;  4LF9 B;  5DN6 G;  2UU9 O;  2YXL A;  1NH2 D;  2PYJ A;  1YZB A;  4DV3 B;  3CRM A;  2EZP A;  2V4D A;  4TOI A;  3QTC A;  4MTX A;  2UU9 B;  3DSQ A;  3CCQ V;  3W7S A;  1ZLZ A;  2BCC H;  4ZBM A;  1NBM G;  3FAV B;  1ZL8 A;  4JYY A;  4UVB A;  3WB1 A;  2IW5 A;  1FXK A;  3L9D A;  4JAV A;  1I7F A;  3N2G B;  4HNA A;  3FX7 A;  4X1Y B;  2JGD A;  1V9P A;  4TSF G;  2DWD C;  4MVQ A;  3EHB B;  3OW2 U;  2N05 A;  1SZX A;  4B7E A;  2P4V A;  4X66 O;  1BL8 A;  4I55 B;  4UB6 Z;  4DYL A;  3K04 A;  4G27 B;  1OCC C;  4DV7 O;  1WB8 A;  2B9Z A;  5JCO C;  1R3J C;  1TUB B;  5BMV B;  3HKB B;  1V55 B;  4PA9 A;  4JI6 O;  4MT8 A;  3K0G A;  4DV7 B;  5J2U B;  1JX9 A;  1ZWI C;  4K3A A;  2HKO A;  3E86 A;  2K1E A;  4JI6 B;  4BW5 A;  1BCC H;  4ZOL B;  3AK3 A;  4JI3 B;  5KHG A;  4LF8 O;  1ROP A;  1N0N A;  1RSO A;  5A9G A;  4BIO A;  1YCI A;  3BA9 A;  1GN2 A;  4DV0 O;  1I0H A;  5LGU A;  5LGN A;  2HG5 C;  5FL7 G;  4I4T A;  3K5O A;  3ETE A;  4CH3 A;  3JAR B;  4JI0 O;  4GX0 A;  2EIM B;  1IBM B;  2ADP A;  4L87 A;  5BY1 A;  4DR2 O;  3CRQ A;  2JIZ G;  2CTP A;  1E79 G;  3LDC A;  2Y4T A;  4J9Y B;  1IDS A;  1R6K A;  3ICX A;  2OTJ V;  2HLD G;  1H8E G;  2XT9 A;  2ZDI C;  1BHB A;  2FKX A;  4RO2 A;  3K08 A;  2IH1 C;  2Q68 A;  4DR2 B;  5KUM A;  1V54 C;  2DMX A;  2F43 G;  1NVP D;  2CUG A;  4JTA B;  4DR4 O;  2IU3 A;  5KHI A;  3S3W A;  4JI1 O;  2BE3 A;  5LMU O;  3HKE A;  4MSW C;  2A9H A;  3J7A U;  2JDI G;  1M56 B;  4CS3 A;  4CZZ A;  1AI5 A;  5KHH A;  3J81 N;  2JGU A;  4FVM A;  4PDL A;  1GMG A;  4ZI7 A;  2KSD A;  3ASO B;  1SKV A;  4UXN A;  2W6I G;  2ATK C;  3OGC C;  4JZG A;  2ZR2 A;  1D5N A;  2XOK G;  2M6Y A;  1S77 D;  5LYJ A;  3CCJ V;  4AQY B;  1FXH A;  5K1P A;  1COW G;  3CJH A;  1G8M A;  3PN1 A;  5LP6 C;  5CB4 A;  4HBN A;  1UJW B;  3ABU A;  5E79 Z;  3VQX A;  4WFG A;  3SYQ A;  3JYC A;  5LHG A;  2WA3 A;  1SES A;  3O9O A;  1PKX A;  1WLE A;  3TET A;  2QKS A;  1MSW D;  3CCU V;  5IJ9 B;  3JAS B;  1RM1 B;  3ZHT A;  3RYI B;  3B09 A;  4TUY B;  3JD4 A;  2Q7G A;  3OUF A;  2YID A;  4DR1 O;  1V55 C;  3ZS8 C;  4DUZ B;  5KAF Z;  1Q5O A;  4OPA A;  2IJJ A;  4B3R B;  3CCR V;  4MVS A;  4DR1 B;  5B3S B;  2QTO A;  5FNV B;  1PNK A;  3ZMT A;  1NQT A;  2Y0I A;  5LYJ B;  2R9R B;  1AR4 A;  3WB0 A;  3CE2 A;  1R3I C;  2VRZ A;  1VQ6 V;  4WBN B;  3K5L A;  2IBZ H;  3SYO A;  1M5I A;  2ZXW B;  5CB4 B;  2E5L O;  1VQN V;  2W6J G;  5EYP A;  4ZHQ B;  4FLX A;  2UXB B;  4LF7 B;  3OGI B;  3IFX A;  4UCO A;  2EIM C;  2V7Q G;  3SJA C;  5JJN B;  4PJ0 Z;  4LFC B;  1ZAU A;  2VQE O;  2OTL V;  4J10 A;  4KL1 A;  5LOV A;  1I08 A;  1O9H A;  2BTQ B;  4J7J A;  1N33 B;  2ZR3 A;  1KU9 A;  2EIN B;  4O2B B;  1HDJ A;  2GUZ B;  1DTO A;  1HWY A;  5DEC A;  1YDX A;  1VQM V;  4WCE V;  4JYC A;  4DV1 O;  1L0L H;  5B1B C;  4JPR A;  4UUJ C;  4LFA B;  3ASO C;  4OPH A;  1D2D A;  4DV1 B;  3IJ4 A;  3U10 A;  3ZMS A;  1VQ5 V;  4MW3 A;  1PL4 A;  3SJQ C;  3CD6 V;  3A2F A;  1XBL A;  3CXH F;  1K9M W;  1CXZ B;  2IJI A;  3TGU H;  2G38 A;  3FB5 C;  5TIS Z;  1Y66 A;  3AK2 A;  3L73 H;  5FPR A;  2AGA A;  1K33 A;  1F23 A;  4WF9 V;  5EYP B;  1BMF G;  1H2S B;  1P49 A;  4MTF A;  4H33 A;  3T2M A;  2UUB O;  1NTK H;  2WLM A;  1WA8 B;  2Q0O C;  4WFE A;  3CRR A;  1OJH A;  4O4J A;  4DV2 B;  2EJR A;  3ZRW A;  2LFS A;  1N32 B;  4J9Z B;  2ZE5 A;  4ASU G;  1AJN A;  4MTO A;  3LSQ A;  1RM1 C;  1VQK V;  3K0D A;  3N2K A;  4PA4 A;  2VWJ A;  1EFR G;  2UUC O;  3CYO A;  2YI8 A;  2QM7 A;  1IBL B;  3JAT B;  5KX5 A;  1B6Q A;  2D2C B;  4PEL A;  2FTK A;  2QWP B;  1WAZ A;  4MVU A;  1VQ9 V;  1EZJ A;  1Q81 W;  3B8M A;  5B3S C;  3OAA G;  4O2A B;  3J80 N;  1EN6 A;  4X64 B;  1MSD A;  1OV9 A;  5LMN B;  2QKA A;  2WAM A;  4FFB B;  2JVD A;  1Q3E A;  2ZXW C;  1R6N A;  1RP3 B;  3KZI Z;  2ETN A;  4JAA A;  3RYF A;  4OX9 O;  2VS0 A;  4PI0 A;  4JYA O;  2HHH B;  2XAG A;  3SYC A;  2ZIN A;  4WFH A;  3WU2 Z;  1KMI Z;  4K0K O;  4UVA A;  1H8H G;  2A0L A;  1FFX B;  3NXS A;  3FB7 C;  1NH2 B;  3CRC A;  3DC6 A;  3HKC A;  1F7Y A;  4GLX A;  4IIJ A;  4B3M O;  4L8J A;  1IXB A;  2EIN C;  3SR2 C;  4DR5 O;  1L0N H;  4EFB A;  3TJT A;  2HR3 A;  3DC5 A;  4E4E A;  3OEH G;  2ZE8 A;  5CA0 B;  4Z1V A;  2KG7 A;  5GON B;  3T1Y O;  2DYR B;  4QPK A;  4TV9 A;  5LA6 B;  2WLL A;  4H13 B;  2PI4 A;  1YXB A;  1KYO F;  1QLN A;  4LFB B;  2XTA A;  1Y6X A;  4DR7 B;  1YJ9 V;  1N36 O;  3OFN G;  1GKF A;  1S5L Z;  1YHQ V;  4YHH O;  3DTU B;  4ZIB A;  2CE4 A;  3APQ A;  4U7O A;  1X59 A;  2P90 A;  3CCM V;  1KP2 A;  3SGI A;  3CCL V;  4YHH B;  4X20 A;  1SER A;  3E22 B;  3RYF B;  4JAS A;  3O65 A;  3BPZ A;  5KUK A;  1SQQ H;  1HR0 O;  1HNW B;  4FM1 A;  4U3J A;  4BW9 A;  5KA5 A;  4NTW A;  2ZDI A;  4UV8 A;  4DR6 B;  4XBF A;  2X6C A;  5LGT A;  1XNR O;  4IYI A;  5LBQ A;  4IYH A;  3UKM A;  4DV6 O;  4GX2 A;  3JAK B;  4HYO A;  1CEZ A;  1XNR B;  3ZRV A;  1SQP H;  4O4L B;  3SJB C;  3MAQ A;  3M7M X;  5BZB A;  2F1M A;  3CCV V;  2HP8 A;  3D3Q A;  2XUM A;  5L3F A;  2FL4 A;  1JFF B;  1WPX A;  4B3S O;  2ZM6 O;  1AI6 A;  4Z2W A;  3B40 A;  5IYD O;  2CTR A;  2UUA B;  4JI8 O;  1Q90 D;  1NVP B;  2OWO A;  5IY5 B;  5H2F Z;  4B3S B;  3T4Z A;  4JTD B;  4GKK O;  3CP1 A;  3NR7 A;  1FFT B;  3ZJZ A;  3OTF A;  2RMK B;  4LNU B;  5EZY B;  2ZE6 A;  4MTG A;  4X8A A;  3UT5 B;  5JH7 B;  4X20 B;  3ML0 A;  4DV5 B;  4DK1 A;  2A3Q A;  1BHA A;  2AW9 A;  2P22 C;  2JRI A;  5L3E A;  3FAV A;  4LH7 A;  3D8C A;  2WPD G;  3N2G A;  3G80 A;  4X1Y A;  1K4C C;  3HPL C;  4OGQ B;  4R6Z A;  2CTW A;  2DQ3 A;  5CBH A;  3QG5 A;  4QGP A;  2O57 A;  3JAW A;  4I55 A;  1QNM A;  4RWU A;  4J42 A;  5JJE B;  5L3D A;  4EB6 B;  3K57 A;  3RN4 A;  2OIE A;  1P84 F;  1MA1 A;  1RPR A;  2XAJ A;  3CB2 A;  2UXD O;  1AP6 A;  4HAM A;  1TUB A;  4J7Z A;  1SQF A;  3CC7 V;  5BMV A;  3HKB A;  2JK5 C;  2DYR C;  1PNL A;  3C3S A;  5J2U A;  4JI4 O;  4A5U B;  3H1I H;  4C7U A;  3CPW U;  1EN4 A;  2CGO A;  1JMK C;  3ZHS A;  1O9G A;  1T5E A;  3LUT B;  2E75 B;  3ZHU A;  4CC6 A;  1M1K W;  2HJD A;  2MW2 B;  3E35 A;  4DK0 A;  1PD3 A;  4N21 A;  3LSU A;  2YDE A;  4NB5 A;  3FYI B;  4G2K A;  3M8A A;  2C2A A;  4TQF A;  2P7T C;  5EBL C;  1Y74 B;  1NR1 A;  3JAR A;  1TAE A;  4K8Z A;  2PUS A;  2RJZ A;  1BS3 A;  1R3L C;  4JF3 A;  5E1A C;  2ZCE A;  2FB5 A;  1GN3 A;  4IHJ B;  1QHT A;  1EBO A;  3BAB A;  5IDJ A;  1VF6 C;  2YSU B;  3Q4H A;  3E8B A;  1IBK O;  4FPP A;  3JAW B;  2YEV A;  3RYH B;  3VOU A;  2M7W A;  1PM9 A;  4LCU C;  4X66 B;  1IBK B;  3MDS A;  2W0X A;  1R6T A;  1J5E O;  2DYS B;  3ZRX A;  3GVM A;  2PF4 E;  1B06 A;  1Z5V A;  3A0R A;  3CRA A;  1SA0 B;  4BWA A;  3CXC U;  1J5E B;  1TVK B;  3ZX6 A;  5IY5 C;  4F6R B;  2VWK A;  2QE7 G;  5EBM C;  2XHB A;  3IC7 A;  5F2V O;  4X88 A;  1L1F A;  3OEE G;  4PA7 A;  2DQ0 A;  4LF8 B;  1JVM A;  1R1B A;  4KXR A;  4I50 B;  1SQV H;  2UXC O;  3SPI A;  4DV0 B;  4NXN O;  1D5A A;  3JD2 A;  3SPG A;  2ODM A;  2Q9L A;  4BIZ A;  2P4K A;  1DF4 A;  3E8G A;  4JI0 B;  2RDC A;  2QTS A;  1QVG U;  2BOC C;  4NXN B;  4I0X B;  3T1H O;  3Q4H B;  3ABM C;  1KBH A;  4H37 A;  3ETG A;  3CME V;  5IJ9 A;  2YEV B;  3JAS A;  2F93 B;  1PV0 A;  3RYI A;  5B5E Z;  2QJ1 A;  4TUY A;  4FZ1 A;  3SJC C;  1VMG A;  4LF6 O;  4DR4 B;  1H2K A;  4PI2 A;  1PP9 H;  4JI1 B;  3UQ8 A;  2QDO A;  1BT8 A;  5LMU B;  3A0H Z;  3W7W A;  1XNQ O;  3CX5 F;  3RVY A;  1YJN V;  1I94 O;  2ZNI A;  5FNV A;  1FD9 A;  4B3T O;  2AXT Z;  1Q6H A;  1G1X B;  3UO3 A;  2BSK B;  2JEX A;  4NTY A;  3E8F A;  4WBN A;  3H1K H;  3LDD A;  3I56 V;  1ENV A;  3WG7 B;  1VQ8 V;  2YIB A;  1K3E A;  4ZHQ A;  3B2E E;  1H2L A;  3R66 A;  2JJ1 G;  4FLY A;  3ZN0 A;  1FS0 G;  4CH4 A;  2LW1 A;  1DK1 A;  3MD0 A;  5DM6 V;  3U0Z A;  2BTQ A;  4U7N A;  5IWA O;  4MVO A;  3STL C;  4R7C A;  1XMO O;  4O2B A;  1HW7 A;  2GUZ A;  4UCU A;  1UPG A;  5IWA B;  3T4D A;  1Y76 B;  1HNX O;  5AG2 A;  4D6T H;  3ZHQ A;  2FML A;  1XEQ A;  1XMQ O;  1G6U A;  5CA1 B;  5ITZ B;  3QO8 A;  1MOF A;  2DYS C;  2CTQ A;  3U11 A;  1ZTE A;  1XHZ A;  2GV9 A;  1AR1 B;  3JAM N;  2HVJ C;  4GKJ O;  5KLV H;  4DW0 A;  1KUQ A;  4O4I B;  1KD1 W;  4DUY O;  2YUA A;  4AI8 A;  3K5N A;  3S3X A;  2ZD9 A;  3SPJ A;  4XDK A;  4EFE A;  2L35 A;  2MK3 A;  3HKD B;  1IXM A;  1WA8 A;  1VEW A;  2QKC A;  2E5L B;  2QWO B;  1FJG O;  1K5Q A;  4R8C A;  5J2T A;  1BSM A;  2Q5Z A;  1Z2G A;  3JAL B;  5KHJ A;  1K7D A;  2ILM A;  1JOY A;  2VQE B;  5BR8 O;  2JEU A;  4X65 O;  1VF7 A;  3LNN A;  3BVO A;  1LUV A;  4MVM A;  4FLT A;  1YSC A;  1DLB A;  2IU0 A;  5BR8 B;  4NVP A;  1M56 C;  1TGO A;  4FLZ A;  1LR1 A;  3B77 A;  4LR3 A;  4X65 B;  2ITD C;  3CMA V;  4TWK A;  2CAZ C;  3ABL B;  3JAT A;  4IT5 A;  4W4L A;  2VQF O;  3D36 C;  2X6A A;  1F4N A;  1U96 A;  2Q7E A;  1WP8 A;  1AP5 A;  4UFZ A;  5H9C A;  3OR6 C;  2DWE C;  3RT3 C;  3G6E V;  2GSM B;  4O2A A;  1W0J G;  4WFB V;  2WLI B;  2AHY A;  1A32 A;  3H01 A;  1M4U A;  1OCO B;  4JZ2 A;  3L71 H;  4XDJ A;  5LXT B;  2WLH A;  4FFB A;  1MZF A;  2LO1 A;  1YVW A;  2GTA A;  3WG7 C;  4LWS B;  5CN0 A;  2HEP A;  1KP3 A;  5EIB D;  1EM1 A;  4LF4 O;  1S3J A;  1UFI A;  3R65 A;  5J2T B;  3ABT A;  4UCV A;  2UUB B;  1FFX A;  5GTH Z;  1IZ3 A;  1OCR B;  2YS8 A;  3K59 A;  1BQ0 A;  3W7T A;  4JI7 O;  2YIA A;  3UM7 A;  2UXN A;  2F4V O;  3GB7 C;  3RYC B;  5CA0 A;  1QR9 A;  5GON A;  1IVS A;  5LA6 A;  2Q67 A;  1EN5 A;  2Q8V A;  2UUC B;  4PA3 A;  5HFM A;  4EEQ A;  1HNZ O;  2QGN A;  3B4S A;  5JVD B;  2WWW A;  2Q6A A;  3AG1 B;  2R70 A;  4X62 O;  4Q20 A;  2NNU A;  1B3Q A;  1GTO A;  1JPX A;  4IGG A;  5CA3 A;  4NTX A;  1AI4 A;  4FFK A;  4JI5 O;  3H1H H;  1QU7 A;  4X1K A;  4DRX B;  4X62 B;  3E22 A;  4YJ3 A;  3ZHV A;  1MG1 A;  3E89 A;  4LP8 A;  1N34 O;  4X1I B;  4OX9 B;  1K8A W; 
#chains in the Genus database with same CATH homology
 4CBC A;  2WPD G;  3W7U A;  1KKD A;  2QA4 V;  4L87 A;  1VQ4 V;  2JIZ G;  1E79 G;  1FXV A;  3LDC A;  3LSS A;  1K4C C;  3HPL C;  4J9Y B;  1R6K A;  4R6Z A;  2OTJ V;  1FXK C;  2HLD G;  1H8E G;  1Y4M A;  3SPC A;  2ZDI C;  1BHB A;  2DQ3 A;  3OMN B;  5CBH A;  3ABK B;  4RO2 A;  1I5Y A;  3K08 A;  2IH1 C;  2Q68 A;  4RQE A;  5KUM A;  1TUE B;  1V54 C;  2F43 G;  3ZMV A;  3G4S V;  3F7V C;  5L3D A;  1NVP D;  4JTA B;  2LP7 A;  2IU3 A;  3ZCC A;  1RPR A;  2XAJ A;  4JAU A;  4HAM A;  2OCC B;  3CC7 V;  4MSW C;  2A9H A;  2JDI G;  2JK5 C;  3ABL C;  1M56 B;  2DYR C;  3ASN B;  1J95 A;  1YI2 V;  1PNL A;  2V1D A;  4PA6 A;  4CZZ A;  1AI5 A;  1OHH G;  4PDL A;  1GMG A;  2EIL B;  3QNE A;  3CPW U;  4RUF A;  5IYB O;  4DXW A;  4KUM A;  3ASO B;  4UXN A;  2X0L A;  3E83 A;  2W6I G;  2ATK C;  1QLE B;  3ZMU A;  3OGC C;  1OCZ B;  3LUT B;  4QPJ A;  2H8P C;  2Q69 A;  3CC2 V;  1Q86 W;  1OCO C;  2ZR2 A;  1M1K W;  2XOK G;  1S77 D;  4KFM A;  5B1N A;  3E35 A;  1PD3 A;  4N21 A;  2ITC C;  3CCJ V;  4JYB A;  1FXH A;  1Q7Y W;  3E2E A;  3TCU A;  1PL0 A;  3AG3 B;  1COW G;  3FB6 C;  3BY6 A;  1RPO A;  3FYI B;  4G2K A;  1G8M A;  2C2A A;  3QO7 A;  2P7T C;  5EBL C;  1NR1 A;  2IH3 C;  4P9P A;  1UJW B;  3ABU A;  1R3L C;  4G28 B;  4JF3 A;  5E1A C;  3W7X A;  3PJS K;  3LDE A;  1S0V A;  4WFG A;  3SYQ A;  3JYC A;  5LHG A;  1MAB G;  3K3W A;  4R50 A;  4DO2 A;  1NJI W;  5EC2 C;  1OCR C;  1SES A;  4PDR A;  3ETD A;  1EBO A;  4RAI A;  1PKX A;  5IDJ A;  2YSU B;  4ZKI A;  3STZ C;  1WLE A;  3E8B A;  4FPP A;  4YXW G;  3TET A;  2QKS A;  2YEV A;  1K34 A;  2CK3 G;  3CCU V;  1N8R W;  1MSW D;  3VOU A;  4PDM A;  2Y69 B;  2HJF C;  2M7W A;  1M90 W;  5B1O A;  4LCU C;  1RM1 B;  4UVC A;  1GK9 A;  1XL6 A;  1KQS U;  3ZN1 A;  4I5S A;  3JD4 A;  4P30 A;  3OUF A;  4BAY A;  2DYS B;  1V55 C;  3ZRX A;  5CBF A;  1S5H C;  5H6Q A;  3E8H A;  2IJJ A;  3ZMZ A;  3AG1 C;  3A0R A;  1VQL V;  3CCR V;  3CXC U;  1F4M A;  4MVS A;  1ARO P;  2QTO A;  5B3S B;  5IY5 C;  1PNK A;  3ZMT A;  5EBM C;  2QE7 G;  4BIU A;  1NQT A;  3IC7 A;  2R9R B;  4X88 A;  1L1F A;  1JQ0 A;  1QVF U;  3OEE G;  1R3I C;  1VQP V;  4PA7 A;  2DQ0 A;  3EFF K;  1VQ6 V;  1K4D C;  3DGE A;  2EZO A;  4GX0 A;  1JVM A;  2XAH A;  3X2Q C;  3SYO A;  5H6R A;  3KG2 A;  3SPI A;  3SYP A;  3FB8 C;  2ZXW B;  2WLK A;  3ZRS A;  3IGA C;  1VQN V;  2W6J G;  3AG2 C;  3JD2 A;  3SPG A;  1GM9 A;  4BIZ A;  1DF4 A;  3IFX A;  2EIM C;  4XDL A;  4KP4 A;  3E8G A;  4JTC B;  3ZIA G;  2V7Q G;  1QVG U;  3AEI A;  2BOC C;  2P6J A;  3HB3 B;  3CCS V;  3ABM C;  2OTL V;  4FMT A;  3MHH C;  1W0K G;  2NLJ C;  4H37 A;  3ETG A;  3CME V;  3ABK C;  3I55 V;  5LHI A;  2YEV B;  3ZRW B;  1S72 V;  2AHZ A;  5CBG A;  2ZR3 A;  3JCZ A;  2EIN B;  1QBZ A;  1DTO A;  1S76 D;  1HWY A;  2OCC C;  1H2G A;  4TT3 G;  5GW7 A;  5C93 A;  1Q82 W;  1VQM V;  4WCE V;  3ASN C;  3W7W A;  4JYC A;  4GX5 A;  5B1B C;  3RVY A;  1YIT V;  1YJN V;  4JPR A;  3RBZ A;  2XND G;  2OT5 A;  2Z5U A;  4UUJ C;  3K03 A;  2DW4 A;  3ASO C;  3MHS C;  4GT1 A;  1E1Q G;  2Y48 A;  1QLE C;  2ZQM A;  1OCZ C;  4RQF A;  3ZMS A;  3TK1 A;  1E1R G;  1SRY A;  2JEX A;  4MW3 A;  4Z1M G;  1VQ5 V;  3SJQ C;  1AJP A;  3E8F A;  3CD6 V;  1W2B U;  3M99 B;  2B1G A;  3RW0 A;  2IJH A;  2BOB C;  4FIP C;  3LDD A;  2XAS A;  3K79 A;  1YIJ V;  1KC8 W;  1K9M W;  3I56 V;  1ENV A;  3AG3 C;  3WG7 B;  2IJI A;  2XAQ A;  4JGS A;  1VQ8 V;  1K3E A;  3FB5 C;  3OUS A;  1Y66 A;  3F5W C;  2EIJ B;  1K33 A;  1F23 A;  1I5X A;  2P67 A;  4WF9 V;  1BMF G;  2JJ1 G;  4MTF A;  3OE7 G;  4H33 A;  1YTF B;  1AJQ A;  3T2M A;  2WLM A;  3ZN0 A;  2X7R B;  3OMA B;  1FS0 G;  4HZ3 A;  1F51 A;  5L3B A;  4WFE A;  3P30 A;  4WFF A;  3OR7 C;  3MD0 A;  5DM6 V;  2PI5 A;  2EJR A;  3ZRW A;  2H94 A;  4U7N A;  1SET A;  3AG4 B;  3OM3 B;  4MVO A;  3STL C;  1GO3 F;  2EIK B;  4R7C A;  2WLN A;  2LFS A;  3WFV A;  2WLJ A;  4MVZ A;  2XAF A;  2Y69 C;  4J9Z B;  3CCE V;  4ASU G;  1AJN A;  4MTO A;  3LSQ A;  3T4D A;  1VQK V;  1RM1 C;  4EKW A;  3K0D A;  4PA4 A;  2X6B A;  1EFR G;  1OCC B;  3CYO A;  4QE7 A;  1GM8 A;  3SYA A;  3D36 A;  1K97 A;  2QM7 A;  3QO8 A;  3LNM B;  1MOF A;  4LBE C;  4E2L A;  2DYS C;  2IJK A;  5B1A B;  5HFL A;  1B6Q A;  4PEL A;  4FJC C;  2FTK A;  2WLL B;  4MVU A;  4MS2 A;  1YTF D;  5J9P C;  2B5U A;  1AR1 B;  1VQ9 V;  1EZJ A;  1Q81 W;  3B8M A;  2HVJ C;  3JD0 A;  5B3S C;  3K9A A;  2EBO A;  3OAA G;  1VQ7 V;  4N23 A;  4QE9 A;  1YJW V;  1JJ2 U;  1AI7 A;  1KD1 W;  1QCE A;  2ZD9 A;  2B1I A;  3SPJ A;  2WAM A;  4XDK A;  1M57 B;  3FKS G;  2MK3 A;  2ZXW C;  1R6N A;  1XL4 A;  1IXM A;  2QEX V;  4PDV A;  4FK5 C;  2XAG A;  5L3C A;  3SYC A;  1K5Q A;  4R8C A;  4WFH A;  3GWO A;  1K92 A;  1QR8 A;  4UVA A;  1H8H G;  2JJ2 G;  2A0L A;  3CC4 V;  1K7D A;  3NXS A;  4RUE A;  4MW8 A;  1FXK B;  1JOY A;  3FB7 C;  3T1C A;  1NH2 B;  2KB1 A;  2JEU A;  1JCH A;  3ABM B;  1V54 B;  1SZT A;  4MVM A;  3D3I A;  1P4R A;  1YSC A;  1DLB A;  2EIN C;  2IU0 A;  1VQO V;  2HR3 A;  1M56 C;  1M9N A;  4OXS A;  5CMU A;  3B77 A;  4GCZ A;  3JD3 A;  2ITD C;  4QIW F;  3CMA V;  3OEH G;  5LHH A;  2EIL C;  4TWK A;  1NR7 A;  3ABL B;  2DYR B;  4QPK A;  1H38 A;  2WLL A;  3P32 A;  2PI4 A;  2X6A A;  2UXX A;  1F4N A;  3OR6 C;  5H9C A;  2DWE C;  2GHY A;  4X89 A;  1G4Y B;  3G6E V;  2HVK C;  1QLN A;  2GSM B;  5B1B B;  3JD1 A;  2LFR A;  1W0J G;  4WFB V;  1YJ9 V;  2WLI B;  2AHY A;  1DF5 A;  3OFN G;  3H01 A;  1GKF A;  3VBB A;  1P7B A;  1YHQ V;  1OCO B;  3DTU B;  1CP9 A;  4XDJ A;  5EC1 C;  2A79 B;  1R3K C;  2WLH A;  4U7O A;  5DN6 G;  2P90 A;  3CCM V;  3WG7 C;  1NH2 D;  1LNQ A;  4GX1 A;  1KP2 A;  5EK0 A;  3CCL V;  5CN0 A;  5IYC O;  1KP3 A;  3QO5 A;  2EZP A;  2EIJ C;  1SER A;  4QNH B;  4MTX A;  4JAS A;  3CCQ V;  1S3J A;  3W7S A;  2Z3Y A;  5KUK A;  3K06 A;  3R65 A;  4ZBM A;  1NBM G;  3ABT A;  5KA5 A;  4UVB A;  2IW5 A;  1FXK A;  1OCR B;  2ZDI A;  4UV8 A;  3SPH A;  4XBF A;  2X6C A;  4JAV A;  5LGT A;  5EBW C;  1NKD A;  2HFE C;  5L3G A;  3AG4 C;  3W7T A;  5LBQ A;  3UKM A;  4P9O A;  2EIK C;  3UM7 A;  3F7Y C;  4TSF G;  1THZ A;  2DWD C;  4MVQ A;  2UXN A;  3EHB B;  3OW2 U;  4GX2 A;  4HYO A;  3GB7 C;  1CEZ A;  1BL8 A;  3ZRV A;  3K04 A;  3FYE B;  4I9W A;  5BZB A;  1QR9 A;  4G27 B;  3CCV V;  1OCC C;  3G71 V;  2Q67 A;  5L3F A;  4PA3 A;  5HFM A;  1R73 A;  1R3J C;  5KA6 A;  1KEC A;  5B1A C;  1WPX A;  1V55 B;  4PA9 A;  4MT8 A;  3K0G A;  2WLI A;  3RVZ A;  1AI6 A;  2WWW A;  4QJF B;  4P2Z A;  1JX9 A;  2Q6A A;  1ZWI C;  1K5S A;  3AG1 B;  2HKO A;  3B8N A;  5IYD O;  1CPY A;  3E86 A;  1K73 W;  2K1E A;  4Q20 A;  1NVP B;  5IY5 B;  2NNU A;  4BW5 A;  2WSS G;  1GTO A;  1JPX A;  3T4Z A;  2D3O W;  4JTD B;  5CA3 A;  3BEH A;  1AI4 A;  3CP1 A;  1FFT B;  1PNM A;  4MVR A;  3ZJZ A;  1ROP A;  4F4L A;  1GM7 A;  4WFA V;  3OMI B;  4MTG A;  4X8A A;  3X2Q B;  4LC1 A;  3ML0 A;  1M57 C;  1ORQ C;  1BHA A;  1MG1 A;  3E89 A;  4LP8 A;  4UV9 A;  5LGU A;  5L3E A;  2W0F C;  5LGN A;  3AG2 B;  2HG5 C;  5FL7 G;  2R9I A;  1OZ0 A;  3ETE A;  2QM8 A;  2EIM B;  1K8A W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...