4R50A

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with li+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
b'KEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
molecule tags Transport protein
source organism Bacillus cereus atcc 14579
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r50A00
3SPIA 4PDMA 4HZ3A 5J9PC 4R6ZA 4PA7A 4UUJC 3K0DA 4WFFA 3LDEA 4F4LA 3K06A 2HJFC 4R50A 1JVMA 2ATKC 2DYSC 1K4CC 3AG1C 4PDRA 3AG2C 4WFHA 5IY5C 2IH1C 4PA3A 3FB5C 2A0LA 3E8GA 4GX0A 3AG4C 4MVOA 4LBEC 2ZD9A 1M56C 3T4DA 3FB7C 4RUFA 4QNHB 2WLKA 3RVZA 3SPHA 3OR6C 2ITDC 4R7CA 4MTGA 2X6BA 3TCUA 2Q69A 3SJQC 4P2ZA 4I9WA 4GX5A 3F5WC 4MVQA 4WFGA 3ABLC 4PDVA 2QTOA 4JTAB 3E83A 4MVUA 4WFEA 3RW0A 1R3IC 4P30A 3OUFA 4XDLA 1K4DC 1V55C 2NLJC 3SYPA 4PA9A 4ZBMA 3GB7C 3SPJA 3KG2A 2KB1A 3OR7C 3ZJZA 1ZWIC 2Q67A 4PA4A 2EILC 2Q6AA 3E86A 3F7VC 3SPCA 2WLLA 3ABKC 3ASOC 3FB6C 3STLC 4HYOA 5E1AC 1V54C 4P9PA 3LNMB 2HFEC 4TWKA 1OCOC 2EIMC 3T1CA 4OXSA 2EIKC 3E8BA 3AG3C 2X6AA 4J9YB 2HVKC 3HPLC 3OUSA 2DYRC 2A79B 2AHYA 3ASNC 4X89A 5EBLC 3SPGA 3LDCA 4MVSA 4CBCA 5CBHA 3TETA 3E8FA 4RUEA 5B1AC 1OCCC 3X2QC 2WLIB 3OGCC 4G28B 4P9OA 5B1BC 1XL4A 2X6CA 4EKWA 1BL8A 2DWEC 2P7TC 4PA6A 2HG5C 2OCCC 2ZXWC 3K08A 3SYOA 3E8HA 2H8PC 4QE9A 3RVYA 5KUKA 4X8AA 3F7YC 2JK5C 3IFXA 3UM7A 3RBZA 4XDJA 5BZBA 1QLEC 2BOCC 4MSWC 1P7BA 1R3KC 3UKMA 3ZRSA 2EINC 3K03A 2WLLB 2Q68A 5EBMC 2BOBC 4GX1A 3BEHA 1R3JC 4J9ZB 2WLJA 2A9HA 5EK0A 1J95A 2K1EA 5EC2C 4LP8A 2WLNA 4MS2A 2EIJC 4PDLA 2WLMA 4G27B 4JTCB 2ITCC 5CBGA 1R3LC 2HVJC 4MVMA 1XL6A 2YEVA 3SYCA 3LUTB 2WLHA 4KFMA 3T4ZA 2IH3C 3K04A 5EBWC 3LDDA 1ORQC 4BW5A 1OCZC 1M57C 2AHZA 3ABMC 4X88A 4GX2A 3IGAC 4RO2A 1OCRC 5KUMA 5CBFA 1KKDA 3EFFK 4MVZA 3K0GA 2QKSA 2R9RB 3SYAA 4H33A 1LNQA 4MW8A 3STZC 3WG7C 2W0FC 2Y69C 3VOUA 4LCUC 3FB8C 3PJSK 4R8CA 4RAIA 4MTFA 4MTOA 3R65A 4QE7A 3E89A 4H37A 4DXWA 1S5HC 4JTDB 2WLIA 4MW3A 1G4YB 4XDKA 5EC1C 4MVRA 3T2MA 3JYCA 5B3SC 3SYQA 2DWDC
chains in the Genus database with same CATH superfamily
5J9PC 2ZE7A 1T5EA 2C2AA 2ZT9B 1S3JA 1JVMA 5HFMA 1HNZB 4DV5O 2JGDB 2BSKB 4YHHB 5EYPB 5HFLA 3ZMVA 4JI2O 1H38A 2ZE5A 3ZHQA 1SS3A 4Z2WA 3ABLC 1NTZH 1HW7A 5LBQA 3ML0A 2VQFB 3ZJZA 1W2BU 2ZM6B 3SPCA 3JARA 4KHPB 2IW5A 3FYEB 1Y76B 1XILA 5LMUB 2UXCB 1JOYA 4UCOA 1GN3A 3OE7G 2ZDIA 1PNMA 2EBOA 1AVMA 3TETA 3OT7A 4FM0A 1ZX3A 2E75B 2R9AA 4PI2A 4EKWA 4PA6A 1TUEB 1JQ0A 2YIBA 2OIEA 1IVSA 2PI4A 1XNRO 2WSSG 2Z3YA 2ZE8A 4F6EA 5GW7A 2WLLB 4GX1A 2JEXA 3ZHTA 5EK0A 3JALB 1RSOB 4QPJA 2WLMA 3A2FA 4GT1A 5JQGB 1KP3A 1JFFA 2CH7B 5GONA 3M7MX 1XL6A 4B3SO 1FD9A 1NR1A 3K04A 1S0VA 4EFBA 3ZEDA 1ENVA 1JJOA 2F23A 3AG4B 3K0GA 2XOKG 1PM9A 3CWBH 3UO3A 3J7AU 2BE3A 1RPRA 4MW3A 4X66O 2Q0OC 3UO2A 1G4YB 4DV7B 3RFRA 3J81N 5IWAO 4NVPA 1XMOO 2CK3G 2HEPA 1SQGA 3B77A 4IHJB 1ZUQA 4X65O 4WBNB 4FLTA 5BMVA 5KA5A 2AZ2A 1XHZA 4QNHB 2GTAA 3TCUA 4LWSA 1HR0O 1Y67A 3E83A 4E2LA 1VARA 3JARB 2EX3A 1VQNV 2NLJC 1EFRG 4LF9B 1B6QA 1ZTEA 2LQTA 1N34B 4CS4A 1VQOV 3JSLA 3OD4A 4NB5A 1VQLV 1M90W 3F7VC 1GN4A 3RYFA 4O4LB 3G6BA 2YUAA 2UUBB 3LNMB 2HFEC 3ZRWA 3CXCU 4OXSA 3WB2A 1S77D 4J7ZA 2YI8A 1ZL8A 4NXNB 3SPGA 4NR1A 4CBCA 2V7QG 4DR2B 3EXAA 4RUEA 2P90A 1NTMH 1J5EB 2UXNA 4DR4B 4PI0A 3IFXA 5JJJB 2XAJA 1WA8B 3CEIA 2EJRA 1FXHA 1F7YA 1R3JC 1Q6IA 2P6JA 2A9HA 4IL6Z 3BHPA 3P30A 4LF5B 1N4CA 1Y6XA 3E22A 4BIOA 4DYLA 3JASB 3CYOA 1QNMA 5LGUA 1QVFU 5KUMA 4X62B 4W4KA 3D3IA 1AR1B 2OT5A 4DV3B 5IYCO 1N8RW 1M57B 2EJ7A 4Q20A 4EB6A 2OCHA 4UV8A 4XDKA 3BRCA 2BCCH 2ZQMA 2NNUA 3JD2A 2Y48A 4B3RO 2YIBD 1Q86W 1PV0A 2IJIA 4UUJC 2MK3A 1S5JA 4DV3O 2X0LA 1S5LZ 4NTYA 2ZD9A 2CE4A 2Q7GA 4Z1VA 1K3EA 2QE7G 1WA8A 4P2ZA 1Y76A 3APOA 3ZRXA 3I55V 4CH5A 4DRXA 3CCEV 4K0KO 1V55C 1NBMG 4LFCO 3SPJA 2QDOA 4DV0B 3E86A 4JV5B 2LO1A 3KKYA 1DF5A 3CCSV 3ZN1A 5IWAB 4WFAV 5K1PA 5LYJB 1HP8A 3QTCA 3HPLC 1YDXA 3OUSA 4DR3B 4KL1A 4MTXA 1X59A 2ZR2A 1VF6A 1YCIA 1YJ9V 3AG3B 2Y4UA 3O9OA 5IDJA 2ETNA 5LHGA 4ZOLA 1D2DA 2DQ3A 1Q6UA 3SR2C 2EINC 1QBZA 2HLDG 1BQZA 2Z5UA 2WLNA 4DV6O 1P4RA 3ZCCA 1SZTA 2IH3C 1FXKC 1KKDA 3MHSC 5LHHA 1XQ8A 4PD4F 4JF3A 1BCCH 3W7UA 2RCVA 4R8CA 3BABA 2PYLA 1VIBA 1VP7A 2VS0A 2Q73A 1Z2GA 2GV9A 4UB8Z 1SQVH 2ZNJA 2E76B 1SA0B 1VQ5V 4PDMA 3CRQA 3A0BZ 4LF7O 2OYQA 2BSKA 3OMAB 2KQXA 1R73A 4ZI7B 3LSQA 2EIMB 5D5QA 5IE9A 2H94A 4DV1O 1SZXA 3FD9A 4B3TB 1Q82W 1H2KA 4R7CA 2Q69A 4JASA 4PDVA 1FAFA 1R3IC 4JV5O 3NR7A 1I08A 4LF7B 3JAMN 5KA6A 2UXDO 4X9QA 4ZBMA 1N32B 3KG2A 1HNZO 3OR7C 5LP6C 4PA4A 1URFA 1LR1A 4W4LA 3FAVA 4DR7B 3OGIB 3CJHA 4LF8O 1BHAA 3JCZA 5B1BB 3UT5A 3L74H 3BA8A 3HKEB 2F66C 4G28B 4P9OA 4CS2A 2XNDG 1GKFA 3OMNB 3RYCB 1SA0A 2K9PA 1KU9A 4FJCC 5CB4B 3H1HH 4BR6A 3ABTA 4NTWA 3Q4HB 2DW4A 3ETDA 1SKVA 1SETA 2D2CB 1P84F 1QQCA 1HNXB 2CAZC 4FM2A 1ORQC 3CMEV 2BTQA 1BE3H 2Q7EA 5GONB 3EFFK 2JIZG 3B4SA 5A2QN 4QIWF 1MSWD 4UV9A 4U7OA 2FB5A 3K79A 4FLWA 2W6JG 1KECA 2GHYA 3G71V 4TT3G 1TVKA 3HR0A 1IBKO 1M5IA 2HJDA 2KG7A 5B1NA 4FFBA 1XNQO 2DYSC 1K4CC 4K3AA 3AG2C 4UCUA 3E8GA 4GX0A 3D36C 5FL7G 1CP9A 3SPHA 1RPOA 5CB4A 3K9SA 5IY5B 1F4NA 4WFEA 2Z0AA 1XREA 1YJNV 4YJ2B 2JGDA 4JI0O 3HKDA 2QWNB 3RYFB 3SYPA 4A5UB 5H6RA 4ASUG 4LR3A 1BS3A 3W7TA 5ITZA 1R6TA 1ZL8B 4J7KA 2LFSA 5C8YB 3AG3C 1YXBA 3ASOB 2AZ0A 4UVCA 4UCSA 3WFVA 2AHYA 2Y0IA 1TUBA 1PKXA 4TSFG 2EZPA 1H8HG 1Z5VA 4B7EA 2R9IA 3K3WA 1PNKA 2RDCA 1S76D 3N27A 4QE9A 4X1IA 3EHBB 4DV4O 3K5LA 4LF5O 1IBLB 4DV2O 3RT3C 1G6UA 2CGOA 1H2NA 3ZRSA 1K8AW 1U96A 2Q7HA 2F43G 5BR8B 1I5XA 4MS2A 4TV8B 5JWPA 4I55B 1WN7A 2ZCEA 3IC9A 5H5NA 3LUTB 2WLHA 4OX9O 4FLXA 4RO2A 4O4HB 5KHIA 3K58A 1VQ8V 4H33A 4DR6B 3WG7C 1RSOA 3HKEA 4PV1B 4GZRB 5JJNB 4JAAA 1SRYA 1Q8IA 2FYUH 1TVKB 5J2TB 4FLUA 2YXLA 3JYCA 4DV2B 1Q3EA 2QKCA 5BXZA 3ZN0A 5KMGA 4X1YB 3DXRA 2QM8A 5GTIZ 1IBMB 3THOA 2A0LA 2QWQB 1R1BA 3AG4C 4K0KB 2RN9A 4LBEC 4JYAO 1MG1A 1TAEA 2QSAA 2YSUB 5CA0A 1YEWA 5KX5A 4AQYB 1WP8A 2ZIOA 4I9WA 4UCTA 5IJ0A 3OUFA 3CB2A 1SQBH 5ITZB 3L73H 2KKWA 3N2GA 4LF4B 2GUZA 4EFEA 2Y4TA 4UXNA 4DRXB 3JD4A 1VQ4V 4X66B 3FB6C 4U3JB 1N36B 1JJ2U 1Y66A 4WFBV 1I94B 2CTQA 1GM7A 5CA1B 2YIAA 1YITV 2X6AA 1EN5A 3T1HB 3LDCA 2NR5A 2GSMB 3C3TA 3X2QC 2EULA 4DUYO 1JPXA 4ZOLB 4LF6B 1BSMA 5KUKA 3F7YC 4JI6O 1I7FA 4RQEA 4YHHO 4JI8B 1G8MA 4DV0O 1ROPA 1VQPV 2QA4V 4PJ0Z 2EIJC 5F2VO 1Q43A 4X62O 2ITCC 3QO5A 4MVMA 5H2FZ 4UCVA 4X88A 3IGAC 3B8MA 4FLVA 2QKSA 4UB6Z 1NZ6A 4DW1A 3HKCB 3AK1A 3CCUV 4I9QA 1E1QG 1QCEA 3G67A 5L3GA 2N04A 4YY3O 3ZMZA 4X1IB 3CRCA 5CA1A 2HR3A 2EIJB 3SPIA 3IJ4A 1PL4A 1WAZA 3RGBA 4LFAO 4F4LA 1O9GA 3CX5F 4L87A 2R72A 2IH1C 4PA3A 4OGQB 1OCOB 2IU3A 3D36A 3T4DA 2XAFA 2RNBA 2WLKA 3WG7B 1DK1A 2BTOA 3RYHA 5B66Z 3BFRA 4O4JB 2UUBO 5IJ9B 1SC5B 5J2UB 2JJ2G 4PA9A 1DLBA 2IM9A 4X64B 1MMMA 1ZWIC 4DR2O 2EILC 4D6TH 3ASOC 5JCOA 3ASNB 3STLC 4C7UA 1OCOC 1H2GA 3OW2U 5GTHZ 1FFXA 1IBKB 1RP3B 4X20B 4CZZA 3CPWU 2DN9A 4RQFA 1HNWB 2UUCB 4JI5O 2FKXA 4DR5B 2WLIB 2XAGA 5LOVA 1CXZB 3K08A 3TXSA 3FKSG 3RVYA 3TJTA 4J41A 1I94O 3CE2A 2PI5A 5K1XA 2VQFO 3K5NA 4D7TA 4J11A 1FS0G 3I56V 2QWOB 4NXMO 4J9ZB 3IC7A 1AI5A 4PDLA 2BTQB 4G27B 1EZJA 3TXQA 3G6EV 4KFMA 2IJKA 2XHBA 3LDDA 3K5OA 2P22C 1UFIA 2F4VB 4IIJA 1KQSU 5FNVA 5LXTB 1DGSA 2Q8VA 1SQQH 2Y69C 1EM1A 1OCZB 1D5NA 1QU7A 2Q4PA 5EIBD 1XDCA 1XMQB 2CTRA 1OV9A 3CCVV 3CP1A 3SJAC 1E79G 1Y74A 2QTSA 3LDEA 2JEUA 2XASA 3K06A 1AP5A 2HJFC 3QO8A 5BR8O 1YTFB 5AG2A 4Z1MG 4GKKO 2OWOA 4D7SA 3JAKA 4LFCB 3H1IH 4JI0B 5IJ9A 4KUMA 2WAMA 2X6BA 4O2BB 2LW7A 1TA8A 4DV6B 3EVKA 1GK9A 3GB7C 2XTAA 2FL4A 4DV1B 3G4SV 1Q90D 4X1KB 3SDLA 4JPRA 3BA9A 2EIMC 4FZ0A 2VQEO 4J9YB 2HVKC 3JD3A 4JYCA 1K97A 4MVSA 2ODMA 4N21A 4X64O 3OGCC 1MA1A 2WA3A 2B1GA 3QO7A 2O57A 2CUGA 3SYOA 3W7WA 3E8HA 5LMNO 2JK5C 3RWRD 2YI9A 5LP6B 3S3WA 4NXMB 4BIZA 3M99B 3DGEA 1AROP 1R3KC 4U3FH 1L0NH 2LGWA 4X1KA 4GCZA 4O4IA 4B3MO 5L3CA 5KHKA 3VBBA 1RFYA 1YZBA 4O4HA 3WB1A 5FNVB 3KCYA 3FFQA 5L3EA 3ICXA 4JI6B 4JI3B 3L72H 4CC5A 3E35A 5JH7B 2R9RB 1L0LH 4CC6A 2W0FC 1TGOA 1YSCA 3GWOA 3R65A 4MTOA 1Q6HA 1O9HA 4FLYA 5LHIA 1MSDA 1YI2V 4B3RB 1S72V 3RYHB 3ETQA 3KCXA 1FJGO 3S3XA 2WA4A 4B08A 4CH6A 5J2TA 1VQ7V 4WFFA 5EZYA 2OTLV 4JI4O 3CC4V 4ZIBA 4E4EA 2F4VO 2ZE6A 2D3OW 4LF9O 4PHZA 4IYHA 2EIKB 1M56C 3SJCC 1THZA 5B1AB 4DR7O 1OHHG 3F5WC 2EILB 4JTAB 3CMAV 5FPOA 1AI7A 3RW0A 1NVPB 2IJJA 1K4DC 2JVDA 4O4IB 1N34O 4H44B 2Q67A 4BAYA 3CCMV 4JI2B 1W0JG 1QR8A 2B5UA 2LW1A 4FFKA 4HYOA 4N23A 1YJWV 4NTXA 3E8BA 5IYDO 3LSUA 5LA6A 4DR3O 3H01A 4X89A 5B1OA 5L3FA 1IZ3A 3GVMA 2PZSA 1IBLO 2HP8A 1Q5OA 3H1JH 1KP2A 2QWRB 1OCRB 4XBFA 1AP6A 2PTMA 1W0KG 2P5OA 4TV9B 2ZR3A 5KAFZ 2CTPA 2UXBB 1AR4A 2BOBC 3NXSA 5DEDA 5CMUA 1NJIW 3QG5A 1HR0B 4I5SA 1GTOA 2Y69B 4G2KA 3FAVB 2AHZA 1M1KW 3SJBC 3AG7A 1OCRC 2R70A 4RWUA 4DR5O 2GBOA 4H37A 4DXWA 4J80A 4LNUA 4LF6O 3J80N 1I5YA 4IGGA 5EZYB 3OFNG 5C8YA 3CSXA 5B3SC 1PD3A 3JCUZ 5LP6A 1WLEA 4LH7A 5B5EZ 1NTKH 3Q4HA 2QGNA 4WFHA 2QJ1A 2MW2B 3AK2A 1P7GA 5J2UA 1JA8A 1KD1W 4O4LA 2ZKOA 3CD6V 3MHHC 3FYIB 1HDJA 5CN0A 4GLXA 1QLNA 2JS5A 3C3SA 1H8EG 1HNWO 5CA3A 3U11A 5A9GA 1FFXB 1RM1B 5D5PA 1NH2D 1R6NA 1V9PA 2M7WA 4I0XB 2EIKC 3T1YO 2DYRC 2OIGA 2DE0X 1XHXA 1NU1H 5B1AC 2WWWA 3P32A 2X6CA 1BL8A 3QVNA 2OCCC 5KLVH 3N2KB 3PN1A 4TV9A 3ZHSA 1DF4A 4JI3O 3ZMSA 4H0LB 4K8XA 4J42A 5LOVB 4NXNO 2LP7A 2IJHA 3CRMA 1AI4A 4YJ2A 2E5LB 1IXBA 3KZIZ 4U3JA 1N33O 1J95A 5EC2C 3K59A 1SQXH 3CC7V 1B3QA 4TQDA 1I0HA 1MZEA 4FFBB 4GYCB 4QPKA 5JVDB 1JX9A 1PP9H 1VF5B 4O2AA 5EYPA 1AJQA 4YIOA 5CBFA 4JI7B 1JFFB 1N0NA 2CH7A 4LNUB 4DUZO 3SYAA 4GKJB 1LNQA 3STZC 2GUZB 2P4KA 2ARHA 5DECA 2W0XA 1YTFD 2E5LO 4MTFA 2YXHA 4GUNA 2RJZA 3HKDB 2B9ZA 1KC8W 3T2MA 2DYSB 5FPRA 3U10A 3VQYA 2YS8A 1IURA 1GO3F 5KHHA 3ABKB 2F95B 4DUYB 2JRIA 3AG1C 1V54B 1JCHA 2UXDB 1SESA 4F6RA 1TUBB 2ITDC 4J10A 4U7NA 1AJNA 5KHGA 1K33A 2ZINA 3SJQC 4AQYO 1YF2A 2RMKB 1WB8A 3I5DA 4P30A 3R66A 4LFAB 5B3SB 4LF4O 4DO2A 2N74A 1XBLA 4I0XA 2QR4A 3MDSA 2CGNA 3T1YB 3ZMTA 4I4TB 1AB3A 4TWKA 4AI8A 4DK0A 2UXBO 5LMNB 3WU2Z 3MAQA 1DTOA 1Q81W 2V4DA 3HKCA 1YHQV 1MOFA 1XEQA 1F4MA 4YY3B 5B1BC 4DR1O 2ILMA 2ZXWC 4JI1B 3ZBHA 2UUAO 5LYJA 3UQ8A 4XDJA 5KX5B 4GKJO 3CCQV 1H2SB 1RM1C 4JYAB 2JGUA 4HAMA 3FX7A 3N2GB 4KP4A 3DXRB 4HBNA 3UCSC 3U0ZA 2HHHB 3SGIA 2HKOA 1R3LC 1VMGA 3P3PA 1H2LA 1M57C 3F5TA 1H2MA 2LFRA 1QHTA 4LFBO 2Q9LA 1K5SA 3ZRVA 4JAUA 3PJSK 2E74B 1P49A 3E89A 1Q7YW 1S5HC 3ZMUA 5JH7A 3CC2V 3OEEG 1BZKA 1COWG 3CHXA 4YIPA 2PGGA 5LMUO 2FMLA 3AEIA 3ZS8C 1MNGA 3AK3A 5TISZ 1NVPD 4JI7O 5JQGA 3B09A 3BPZA 1SF9A 3MD0A 1SQPH 2B1IA 4IIJB 1VQKV 4LC1A 1M9NA 5DN6G 1FYJA 1Y74B 1FKAO 3CJHB 4UCRA 5L3BA 4OPAA 4NKGB 1NR7A 4JI5B 4FM1A 1WNSA 5LA6B 4JZ2A 1KKCA 2WPDG 4UVAA 4LWSB 2A3QA 3HKBA 1K7DA 1JMKC 4DW0A 2XT9A 2PF4E 3OEHG 1VQMV 5EBLC 1PL0A 3E8FA 4JYYA 4L8JA 1XMQO 1XL4A 3JAWA 2EINB 3UM7A 1OZ0A 3DC5A 2YEVB 1VQ6V 2BOCC 2AW9A 4TV8A 1BGYH 4I55A 4I7ZB 1WJZA 2WLJA 5LL6Y 4Q6GA 2JS3A 4JTCB 1M93A 4PELA 2HVJC 5EBWC 3E2EA 3G80A 2AGAA 2DJVA 4IYIA 1Z5WA 3JAWB 4MW8A 3VOUA 1QR9A 3DTUB 4AHCA 3E22B 5FLXN 1XNQB 3HB3B 2WLIA 3OTOO 2P67A 4JI1O 4DV7O 5KMGB 3H9VA 2VQEB 1BMFG 1ZAUA 3AG1B 5C93A 2DWDC 3CRRA 1YVWA 5IYZA 2UUCO 4O4JA 4R6ZA 3OM3B 3JD0A 1F51A 3H1LH 3JASA 2ATKC 1N33B 2ZIMA 3FB5C 2W6IG 4MVOA 3ZIAG 3DC6A 2LGQA 1N36O 1HNXO 1K34A 1HWYA 2ZDIC 4JGSA 4EB6B 4X65B 5DM6V 2YXYA 2Q6AA 4FMTA 1NI8A 2WLLA 2GTSA 2VRZA 4P9PA 2DQ0A 5JJEB 1GM9A 4FLZA 2YC0A 2ADQB 5E79Z 1F23A 1M56B 1MABG 1KMIZ 4MT8A 1ZLZA 2GDSA 3W7XA 3GWKC 5IT9N 4GKKB 2A7WA 5LXTA 1R6KA 4WF9V 1IDSA 1N0JA 3RYIB 5BZBA 3X2QB 4OX9B 5H9CA 1JR9A 3W7SA 3DSQA 5EBMC 2JJ1G 3BEHA 3BAAA 4H13B 2K1EA 2Q0AA 1GN6A 1CEZA 4DR4O 1NT2B 3B2EE 4BW5A 2XAHA 1XMOB 2PYJA 1E1RG 1NH2B 4YJ3B 4GX2A 2FTKA 1WP7A 1UPGA 4O2BA 3P3NA 3ABUA 4QE7A 4JTDB 4HNAB 2V1DA 3JAKB 1PPJH 4MVRA 2H3OA 3SYQA 2L35A 1FFTB 4PA7A 4BWAA 1CPYA 4R50A 4PDRA 1EN6A 1GH6A 5IY5C 2UU9B 1XOUA 2IU0A 4YJ3A 3IAYA 1EBOA 3O65A 3OTOB 1U97A 4QGPA 3QNEA 4ICGA 1W59A 3TGUH 2G38A 4X1YA 4WFGA 4DUZB 3ETGA 3APQA 4HNAA 4XDLA 4ZI7A 2XAQA 3A0RA 2P06A 2KB1A 2Q5ZA 3A0HZ 1J5EO 2DMXA 1PNLA 1V55B 4UVBA 3L75H 4X20A 1XNRB 1B04A 3T1CA 4LH6A 1FXVA 2N05A 4ABMA 4FPPA 1IXMA 1VF7A 2M6YA 2A79B 3ASNC 5KHJA 4I50A 2P7TC 1KUQA 2L6LA 2CTWA 3ZHUA 1FJGB 1MZFA 2F1MA 1B06A 3M8AA 3RBZA 3UT5B 1QLEC 3OAAG 2PUSA 3WB0A 3CRAA 2YIDA 3UKMA 4KXRA 3JD1A 3K03A 2Q68A 4FZ1A 2P4VA 1LUVA 3BVOA 3K9AA 4DV5B 4LP8A 4DV4B 3ZHVA 1BQ0A 5CBGA 1WPXA 3SYCA 1M4UA 2KSDA 1KB9F 1XI1A 1YIJV 3ABMC 3L71H 2OCCB 2QEXV 4I50B 2E3CA 1BT8A 1L8DA 1K92A 3N2KA 3FB8C 4CH3A 4RAIA 3ETEA 2QM7A 2NN4A 2UUAB 5EC1C 1KYOF 4O2AB 3RYIA 4HZ3A 4DR6O 3CCLV 4WBNA 3K0DA 4EEQA 3CCJV 3TK1A 4B3MB 2F93B 1GMGA 2DOSA 2X7RB 2YICA 4JI8O 4IHJA 3FB7C 4RUFA 3RVZA 3OR6C 5BY1A 3VQWA 4AILC 1OCCB 4LFBB 2QTOA 4MVUA 4QJFB 4BIUA 1N32O 1WB7A 3ABLB 3ABKC 4CH4A 1US6A 5JCOC 4DR1B 1V54C 4LF8B 4ZKIA 4JYBA 2RQ6A 1SERA 1LUWA 1G1XB 5CBHA 2UU9O 2ZNIA 4FK5C 2QKAA 2UXXA 3D3QA 2QWPB 3RN4A 1FXKB 5L3DA 2HG5C 3BY6A 1WPBA 2H8PC 2ZM6O 4X8AA 3H1KH 3D8CA 1QVGU 4MSWC 3JATA 1P7BA 2HHHO 4K8ZA 2YDEA 2A06H 1IBMO 1K73W 4WCEV 5IYBO 3L70H 3LNNA 4FIPC 3OTFA 4OPHA 1FPOA 3VQXA 2ZXWB 4J7JA 4MVZA 5CA0B 1OJHA 3L9DA 1QLEB 2ADPA 3BCCH 1NS1A 1KBHA 5IJ0B 4K35A 4ZHQA 5IYZB 4BW9A 1GRJA 3C90A 1L1FA 4I4TA 3CCRV 5LGNA 1Y4MA 3CS5A 3RYCA 4B3SB 2XUMA 1X4TA 3ABMB 1GM8A 4CS3A 1SQFA 2UXCO 1D5AA 2PY5A 1ZSPA 4MTGA 3AG2B 4GX5A 4MVQA 3B40A 2CDYA 1VEWA 5EIBC 4ZHQB 1GAXA 1VQ9V 5H6QA 3ZX6A 3JALA 4FVMA 1UJWB 1EZVH 5BMVB 2IBZH 1NKDA 1AI6A 2DYRB 5E1AC 1VF6C 4TUYB 4KHPO 4B7KA 1AR5A 1FXKA 1XUQA 4TQFA 1NQTA 4JAVA 3ZHRA 1OCCC 4JI4B 2DWEC 5KAIZ 2OTJV 2QM4A 3JATB 1EN4A 4NYKA 3A8TA 3CXHF 4IT5A 5JVDA 2AXTZ 2Y0PA 4UFZA 3JSNA 4JZGA 2LJ2A 3K5MA 2VWJA 3B8NA 1AJPA 1A32A 1GN2A 4TOIA 1IX9A 4DK1A 2KG7B 1BHBA 5LGTA 3OMIB 4TUYA 2YEVA 1AILA 3T4ZA 1OCZC 3K57A 4F6RB 1K9MW 3LSSA 2VWKA 4LCUC 1K5QA 2EZOA 3VQVA 4B3TO 3T1HO 4YXWG 2JDIG 3QF7A 3ZRWB 3HKBB
chains in the Genus database with same CATH topology
1KECA 2GHYA 3G71V 4TT3G 5J9PC 4R6ZA 3OM3B 1VQ7V 2OTLV 4WFFA 3JD0A 3CC4V 2C2AA 1F51A 1S3JA 5B1NA 1JVMA 2ATKC 2DYSC 1K4CC 5HFMA 3AG2C 3FB5C 2W6IG 3E8GA 4GX0A 2D3OW 4MVOA 3ZIAG 2EIKB 1M56C 5HFLA 5FL7G 3ZMVA 1H38A 1CP9A 3SPHA 1RPOA 5IY5B 1THZA 5B1AB 1OHHG 3F5WC 2EILB 3ABLC 1F4NA 4JTAB 3CMAV 1K34A 1AI7A 1HWYA 4WFEA 3RW0A 5LBQA 2ZDIC 1YJNV 1NVPB 3ML0A 2IJJA 1K4DC 4JGSA 3SYPA 5DM6V 5H6RA 4ASUG 3ZJZA 2Q67A 4BAYA 3CCMV 1W2BU 2Q6AA 4FMTA 3W7TA 3SPCA 1W0JG 2WLLA 1QR8A 2B5UA 4HYOA 2IW5A 3FYEB 4P9PA 2DQ0A 4N23A 1GM9A 1YJWV 2LFSA 1JOYA 1F23A 1M56B 1MABG 3E8BA 3AG3C 4MT8A 5IYDO 3ASOB 3H01A 4UVCA 3OE7G 3WFVA 2AHYA 2ZDIA 1PNMA 4X89A 2EBOA 5B1OA 5L3FA 1PKXA 4TSFG 2EZPA 1H8HG 3TETA 2R9IA 4EKWA 3K3WA 1KP2A 1R6KA 1TUEB 4PA6A 1PNKA 1JQ0A 1OCRB 4WF9V 1S76D 4QE9A 4XBFA 3EHBB 2PI4A 5BZBA 1W0KG 3X2QB 2WSSG 5H9CA 2Z3YA 3W7SA 3ZRSA 2ZR3A 1K8AW 5GW7A 2WLLB 5EBMC 2JJ1G 2BOBC 4GX1A 2F43G 2JEXA 3BEHA 5EK0A 1I5XA 2K1EA 3NXSA 4MS2A 5CMUA 1CEZA 4QPJA 2WLMA 4GT1A 1NJIW 1KP3A 1XL6A 4I5SA 3LUTB 1GTOA 2WLHA 2Y69B 1NR1A 3K04A 4G2KA 4BW5A 1S0VA 2XAHA 1E1RG 2AHZA 1NH2B 1M1KW 4GX2A 2FTKA 1OCRC 4RO2A 1ENVA 3AG4B 3K0GA 2XOKG 4H33A 1VQ8V 3WG7C 3ABUA 1RPRA 4QE7A 4H37A 4DXWA 4JTDB 1SRYA 2V1DA 4MW3A 1I5YA 1G4YB 3OFNG 4MVRA 3JYCA 5B3SC 3SYQA 1PD3A 3ZN0A 2CK3G 1FFTB 4PA7A 1WLEA 2QM8A 3B77A 1CPYA 4R50A 4PDRA 5IY5C 4WFHA 2A0LA 3AG4C 4LBEC 2IU0A 5KA5A 1EBOA 1MG1A 4QNHB 2YSUB 3QNEA 1KD1W 3TCUA 3CD6V 3MHHC 4I9WA 4WFGA 3FYIB 3ETGA 3E83A 5CN0A 4E2LA 3OUFA 1VQNV 4XDLA 2NLJC 1EFRG 1QLNA 1B6QA 2XAQA 3A0RA 1VQOV 4UXNA 2KB1A 1H8EG 1VQLV 3JD4A 1M90W 3F7VC 5CA3A 1VQ4V 3FB6C 1RM1B 1PNLA 1V55B 4UVBA 1JJ2U 3LNMB 2HFEC 1Y66A 4WFBV 1NH2D 1R6NA 3ZRWA 3T1CA 3CXCU 4OXSA 1GM7A 2M7WA 1FXVA 1S77D 2EIKC 1YITV 2X6AA 4FPPA 1IXMA 2DYRC 2A79B 3ASNC 3SPGA 3LDCA 4CBCA 2V7QG 4RUEA 5B1AC 2GSMB 2WWWA 3P32A 2P90A 3X2QC 2X6CA 1BL8A 1JPXA 2P7TC 2OCCC 2UXNA 5KUKA 1DF4A 3F7YC 3IFXA 3ZMSA 2XAJA 3RBZA 1QLEC 3OAAG 4RQEA 2LP7A 3UKMA 2EJRA 2IJHA 3JD1A 1FXHA 3K03A 2Q68A 1G8MA 1AI4A 1R3JC 1ROPA 2P6JA 2A9HA 3K9AA 1J95A 1VQPV 5EC2C 3P30A 4LP8A 2QA4V 2EIJC 3CC7V 2ITCC 3CYOA 3QO5A 1WPXA 4QPKA 5CBGA 4MVMA 3SYCA 1JX9A 5LGUA 1QVFU 1YIJV 3ABMC 1AJQA 4X88A 5KUMA 3IGAC 2OCCB 3B8MA 5CBFA 2QEXV 3D3IA 2QKSA 3SYAA 1AR1B 1LNQA 3STZC 1K92A 2OT5A 3FB8C 5IYCO 1YTFD 4RAIA 1M57B 3ETEA 4MTFA 1N8RW 2QM7A 3CCUV 1E1QG 1QCEA 4Q20A 4UV8A 5L3GA 4XDKA 5EC1C 1KC8W 3T2MA 2DYSB 2ZQMA 2NNUA 3JD2A 2Y48A 3ZMZA 2HR3A 2EIJB 3SPIA 1Q86W 4HZ3A 3CCLV 1GO3F 2IJIA 4UUJC 3K0DA 2MK3A 3ABKB 3CCJV 4F4LA 3TK1A 4L87A 3AG1C 1V54B 1JCHA 1GMGA 2IH1C 4PA3A 1OCOB 2X7RB 2IU3A 2X0LA 3D36A 3W7XA 1SESA 2ZD9A 2XAFA 3T4DA 3FB7C 4RUFA 2WLKA 3RVZA 3WG7B 3OR6C 2ITDC 1K3EA 2QE7G 4U7NA 1AJNA 1K33A 3SJQC 4P2ZA 1OCCB 3ZRXA 2QTOA 3I55V 4MVUA 4QJFB 4P30A 3CCEV 1V55C 2JJ2G 1NBMG 4PA9A 4BIUA 5B3SB 3SPJA 1DLBA 4DO2A 1ZWIC 2EILC 3ABLB 3E86A 3ABKC 3ASOC 1DF5A 3ASNB 3STLC 3ZMTA 1V54C 3CCSV 4TWKA 3ZN1A 4WFAV 1OCOC 1H2GA 3OW2U 4ZKIA 1DTOA 3HPLC 4JYBA 3OUSA 4CZZA 1Q81W 1SERA 3CPWU 4RQFA 5CBHA 1YHQV 4MTXA 4FK5C 1MOFA 2ZR2A 2UXXA 2WLIB 1F4MA 5B1BC 2XAGA 1YJ9V 1FXKB 3AG3B 5L3DA 2HG5C 2ZXWC 3BY6A 3K08A 3FKSG 2H8PC 3RVYA 4X8AA 5IDJA 4XDJA 5LHGA 1QVGU 2PI5A 2DQ3A 4MSWC 3CCQV 1P7BA 1RM1C 2EINC 1QBZA 4HAMA 1FS0G 2HLDG 3I56V 4J9ZB 3IC7A 4KP4A 2Z5UA 2WLNA 1K73W 1AI5A 1P4RA 5IYBO 4PDLA 4WCEV 4G27B 1EZJA 2HKOA 3ZCCA 3G6EV 4FIPC 1SZTA 1R3LC 4KFMA 2IJKA 2IH3C 3LDDA 1M57C 1FXKC 1KKDA 2LFRA 2ZXWB 3MHSC 5LHHA 4MVZA 1KQSU 4JF3A 2Y69C 1QLEB 1K5SA 3ZRVA 3PJSK 4JAUA 3W7UA 4R8CA 1OCZB 3E89A 1Q7YW 1S5HC 3ZMUA 1L1FA 3CCRV 3CC2V 5LGNA 1Y4MA 3OEEG 1COWG 3CCVV 3CP1A 1VQ5V 4PDMA 1E79G 3AEIA 3LDEA 2JEUA 2XASA 3OMAB 3K06A 1NVPD 2HJFC 1R73A 3QO8A 1YTFB 4Z1MG 3ABMB 3LSQA 2EIMB 1GM8A 3MD0A 2H94A 1Q82W 2B1IA 1VQKV 4R7CA 4KUMA 2WAMA 2X6BA 1M9NA 3AG2B 4LC1A 2Q69A 4MTGA 5DN6G 4GX5A 4MVQA 4JASA 4PDVA 5L3BA 1R3IC 1VQ9V 5H6QA 5KA6A 1GK9A 4ZBMA 3GB7C 1NR7A 1UJWB 3KG2A 3OR7C 4PA4A 1NKDA 1AI6A 2DYRB 3G4SV 5E1AC 4UVAA 2WPDG 4JPRA 2EIMC 1BHAA 3JCZA 5B1BB 1K7DA 4J9YB 2HVKC 3JD3A 3OEHG 1FXKA 1K97A 4JYCA 1VQMV 1NQTA 4JAVA 5EBLC 1PL0A 4MVSA 3E8FA 4N21A 1OCCC 3OGCC 4G28B 4P9OA 1XL4A 2B1GA 3QO7A 2DWEC 2OTJV 3SYOA 3W7WA 2XNDG 3E8HA 1GKFA 3OMNB 2EINB 2JK5C 4FJCC 3UM7A 1OZ0A 2YEVB 1VQ6V 2BOCC 4BIZA 3M99B 3ABTA 3DGEA 1AROP 1R3KC 3B8NA 3ETDA 2DW4A 1AJPA 2WLJA 4GCZA 5L3CA 1SETA 3VBBA 4JTCB 1BHBA 5LGTA 4PELA 3OMIB 2HVJC 2YEVA 3T4ZA 5EBWC 3E2EA 1ORQC 3CMEV 5L3EA 1OCZC 1K9MW 3EFFK 2JIZG 3LSSA 3E35A 4QIWF 2R9RB 1MSWD 4MW8A 4U7OA 4UV9A 2W0FC 3VOUA 4LCUC 1QR9A 3DTUB 1YSCA 1K5QA 3GWOA 3R65A 4MTOA 2EZOA 3K79A 3HB3B 2WLIA 2P67A 4YXWG 2JDIG 5LHIA 3ZRWB 2W6JG 1BMFG 3AG1B 5C93A 1YI2V 1S72V 2DWDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPI A;  4PDM A;  4HZ3 A;  5J9P C;  4R6Z A;  4PA7 A;  4UUJ C;  3K0D A;  4WFF A;  3LDE A;  4F4L A;  3K06 A;  2HJF C;  4R50 A;  1JVM A;  2ATK C;  2DYS C;  1K4C C;  3AG1 C;  4PDR A;  3AG2 C;  4WFH A;  5IY5 C;  2IH1 C;  4PA3 A;  3FB5 C;  2A0L A;  3E8G A;  4GX0 A;  3AG4 C;  4MVO A;  4LBE C;  2ZD9 A;  1M56 C;  3T4D A;  3FB7 C;  4RUF A;  4QNH B;  2WLK A;  3RVZ A;  3SPH A;  3OR6 C;  2ITD C;  4R7C A;  4MTG A;  2X6B A;  3TCU A;  2Q69 A;  3SJQ C;  4P2Z A;  4I9W A;  4GX5 A;  3F5W C;  4MVQ A;  4WFG A;  3ABL C;  4PDV A;  2QTO A;  4JTA B;  3E83 A;  4MVU A;  4WFE A;  3RW0 A;  1R3I C;  4P30 A;  3OUF A;  4XDL A;  1K4D C;  1V55 C;  2NLJ C;  3SYP A;  4PA9 A;  4ZBM A;  3GB7 C;  3SPJ A;  3KG2 A;  2KB1 A;  3OR7 C;  3ZJZ A;  1ZWI C;  2Q67 A;  4PA4 A;  2EIL C;  2Q6A A;  3E86 A;  3F7V C;  3SPC A;  2WLL A;  3ABK C;  3ASO C;  3FB6 C;  3STL C;  4HYO A;  5E1A C;  1V54 C;  4P9P A;  3LNM B;  2HFE C;  4TWK A;  1OCO C;  2EIM C;  3T1C A;  4OXS A;  2EIK C;  3E8B A;  3AG3 C;  2X6A A;  4J9Y B;  2HVK C;  3HPL C;  3OUS A;  2DYR C;  2A79 B;  2AHY A;  3ASN C;  4X89 A;  5EBL C;  3SPG A;  3LDC A;  4MVS A;  4CBC A;  5CBH A;  3TET A;  3E8F A;  4RUE A;  5B1A C;  1OCC C;  3X2Q C;  2WLI B;  3OGC C;  4G28 B;  4P9O A;  5B1B C;  1XL4 A;  2X6C A;  4EKW A;  1BL8 A;  2DWE C;  2P7T C;  4PA6 A;  2HG5 C;  2OCC C;  2ZXW C;  3K08 A;  3SYO A;  3E8H A;  2H8P C;  4QE9 A;  3RVY A;  5KUK A;  4X8A A;  3F7Y C;  2JK5 C;  3IFX A;  3UM7 A;  3RBZ A;  4XDJ A;  5BZB A;  1QLE C;  2BOC C;  4MSW C;  1P7B A;  1R3K C;  3UKM A;  3ZRS A;  2EIN C;  3K03 A;  2WLL B;  2Q68 A;  5EBM C;  2BOB C;  4GX1 A;  3BEH A;  1R3J C;  4J9Z B;  2WLJ A;  2A9H A;  5EK0 A;  1J95 A;  2K1E A;  5EC2 C;  4LP8 A;  2WLN A;  4MS2 A;  2EIJ C;  4PDL A;  2WLM A;  4G27 B;  4JTC B;  2ITC C;  5CBG A;  1R3L C;  2HVJ C;  4MVM A;  1XL6 A;  2YEV A;  3SYC A;  3LUT B;  2WLH A;  4KFM A;  3T4Z A;  2IH3 C;  3K04 A;  5EBW C;  3LDD A;  1ORQ C;  4BW5 A;  1OCZ C;  1M57 C;  2AHZ A;  3ABM C;  4X88 A;  4GX2 A;  3IGA C;  4RO2 A;  1OCR C;  5KUM A;  5CBF A;  1KKD A;  3EFF K;  4MVZ A;  3K0G A;  2QKS A;  2R9R B;  3SYA A;  4H33 A;  1LNQ A;  4MW8 A;  3STZ C;  3WG7 C;  2W0F C;  2Y69 C;  3VOU A;  4LCU C;  3FB8 C;  3PJS K;  4R8C A;  4RAI A;  4MTF A;  4MTO A;  3R65 A;  4QE7 A;  3E89 A;  4H37 A;  4DXW A;  1S5H C;  4JTD B;  2WLI A;  4MW3 A;  1G4Y B;  4XDK A;  5EC1 C;  4MVR A;  3T2M A;  3JYC A;  5B3S C;  3SYQ A;  2DWD C; 
#chains in the Genus database with same CATH topology
 5J9P C;  2ZE7 A;  1T5E A;  2C2A A;  2ZT9 B;  1S3J A;  1JVM A;  5HFM A;  1HNZ B;  4DV5 O;  2JGD B;  2BSK B;  4YHH B;  5EYP B;  5HFL A;  3ZMV A;  4JI2 O;  1H38 A;  2ZE5 A;  3ZHQ A;  1SS3 A;  4Z2W A;  3ABL C;  1NTZ H;  1HW7 A;  5LBQ A;  3ML0 A;  2VQF B;  3ZJZ A;  1W2B U;  2ZM6 B;  3SPC A;  3JAR A;  4KHP B;  2IW5 A;  3FYE B;  1Y76 B;  1XIL A;  5LMU B;  2UXC B;  1JOY A;  4UCO A;  1GN3 A;  3OE7 G;  2ZDI A;  1PNM A;  2EBO A;  1AVM A;  3TET A;  3OT7 A;  4FM0 A;  1ZX3 A;  2E75 B;  2R9A A;  4PI2 A;  4EKW A;  4PA6 A;  1TUE B;  1JQ0 A;  2YIB A;  2OIE A;  1IVS A;  2PI4 A;  1XNR O;  2WSS G;  2Z3Y A;  2ZE8 A;  4F6E A;  5GW7 A;  2WLL B;  4GX1 A;  2JEX A;  3ZHT A;  5EK0 A;  3JAL B;  1RSO B;  4QPJ A;  2WLM A;  3A2F A;  4GT1 A;  5JQG B;  1KP3 A;  1JFF A;  2CH7 B;  5GON A;  3M7M X;  1XL6 A;  4B3S O;  1FD9 A;  1NR1 A;  3K04 A;  1S0V A;  4EFB A;  3ZED A;  1ENV A;  1JJO A;  2F23 A;  3AG4 B;  3K0G A;  2XOK G;  1PM9 A;  3CWB H;  3UO3 A;  3J7A U;  2BE3 A;  1RPR A;  4MW3 A;  4X66 O;  2Q0O C;  3UO2 A;  1G4Y B;  4DV7 B;  3RFR A;  3J81 N;  5IWA O;  4NVP A;  1XMO O;  2CK3 G;  2HEP A;  1SQG A;  3B77 A;  4IHJ B;  1ZUQ A;  4X65 O;  4WBN B;  4FLT A;  5BMV A;  5KA5 A;  2AZ2 A;  1XHZ A;  4QNH B;  2GTA A;  3TCU A;  4LWS A;  1HR0 O;  1Y67 A;  3E83 A;  4E2L A;  1VAR A;  3JAR B;  2EX3 A;  1VQN V;  2NLJ C;  1EFR G;  4LF9 B;  1B6Q A;  1ZTE A;  2LQT A;  1N34 B;  4CS4 A;  1VQO V;  3JSL A;  3OD4 A;  4NB5 A;  1VQL V;  1M90 W;  3F7V C;  1GN4 A;  3RYF A;  4O4L B;  3G6B A;  2YUA A;  2UUB B;  3LNM B;  2HFE C;  3ZRW A;  3CXC U;  4OXS A;  3WB2 A;  1S77 D;  4J7Z A;  2YI8 A;  1ZL8 A;  4NXN B;  3SPG A;  4NR1 A;  4CBC A;  2V7Q G;  4DR2 B;  3EXA A;  4RUE A;  2P90 A;  1NTM H;  1J5E B;  2UXN A;  4DR4 B;  4PI0 A;  3IFX A;  5JJJ B;  2XAJ A;  1WA8 B;  3CEI A;  2EJR A;  1FXH A;  1F7Y A;  1R3J C;  1Q6I A;  2P6J A;  2A9H A;  4IL6 Z;  3BHP A;  3P30 A;  4LF5 B;  1N4C A;  1Y6X A;  3E22 A;  4BIO A;  4DYL A;  3JAS B;  3CYO A;  1QNM A;  5LGU A;  1QVF U;  5KUM A;  4X62 B;  4W4K A;  3D3I A;  1AR1 B;  2OT5 A;  4DV3 B;  5IYC O;  1N8R W;  1M57 B;  2EJ7 A;  4Q20 A;  4EB6 A;  2OCH A;  4UV8 A;  4XDK A;  3BRC A;  2BCC H;  2ZQM A;  2NNU A;  3JD2 A;  2Y48 A;  4B3R O;  2YIB D;  1Q86 W;  1PV0 A;  2IJI A;  4UUJ C;  2MK3 A;  1S5J A;  4DV3 O;  2X0L A;  1S5L Z;  4NTY A;  2ZD9 A;  2CE4 A;  2Q7G A;  4Z1V A;  1K3E A;  2QE7 G;  1WA8 A;  4P2Z A;  1Y76 A;  3APO A;  3ZRX A;  3I55 V;  4CH5 A;  4DRX A;  3CCE V;  4K0K O;  1V55 C;  1NBM G;  4LFC O;  3SPJ A;  2QDO A;  4DV0 B;  3E86 A;  4JV5 B;  2LO1 A;  3KKY A;  1DF5 A;  3CCS V;  3ZN1 A;  5IWA B;  4WFA V;  5K1P A;  5LYJ B;  1HP8 A;  3QTC A;  3HPL C;  1YDX A;  3OUS A;  4DR3 B;  4KL1 A;  4MTX A;  1X59 A;  2ZR2 A;  1VF6 A;  1YCI A;  1YJ9 V;  3AG3 B;  2Y4U A;  3O9O A;  5IDJ A;  2ETN A;  5LHG A;  4ZOL A;  1D2D A;  2DQ3 A;  1Q6U A;  3SR2 C;  2EIN C;  1QBZ A;  2HLD G;  1BQZ A;  2Z5U A;  2WLN A;  4DV6 O;  1P4R A;  3ZCC A;  1SZT A;  2IH3 C;  1FXK C;  1KKD A;  3MHS C;  5LHH A;  1XQ8 A;  4PD4 F;  4JF3 A;  1BCC H;  3W7U A;  2RCV A;  4R8C A;  3BAB A;  2PYL A;  1VIB A;  1VP7 A;  2VS0 A;  2Q73 A;  1Z2G A;  2GV9 A;  4UB8 Z;  1SQV H;  2ZNJ A;  2E76 B;  1SA0 B;  1VQ5 V;  4PDM A;  3CRQ A;  3A0B Z;  4LF7 O;  2OYQ A;  2BSK A;  3OMA B;  2KQX A;  1R73 A;  4ZI7 B;  3LSQ A;  2EIM B;  5D5Q A;  5IE9 A;  2H94 A;  4DV1 O;  1SZX A;  3FD9 A;  4B3T B;  1Q82 W;  1H2K A;  4R7C A;  2Q69 A;  4JAS A;  4PDV A;  1FAF A;  1R3I C;  4JV5 O;  3NR7 A;  1I08 A;  4LF7 B;  3JAM N;  5KA6 A;  2UXD O;  4X9Q A;  4ZBM A;  1N32 B;  3KG2 A;  1HNZ O;  3OR7 C;  5LP6 C;  4PA4 A;  1URF A;  1LR1 A;  4W4L A;  3FAV A;  4DR7 B;  3OGI B;  3CJH A;  4LF8 O;  1BHA A;  3JCZ A;  5B1B B;  3UT5 A;  3L74 H;  3BA8 A;  3HKE B;  2F66 C;  4G28 B;  4P9O A;  4CS2 A;  2XND G;  1GKF A;  3OMN B;  3RYC B;  1SA0 A;  2K9P A;  1KU9 A;  4FJC C;  5CB4 B;  3H1H H;  4BR6 A;  3ABT A;  4NTW A;  3Q4H B;  2DW4 A;  3ETD A;  1SKV A;  1SET A;  2D2C B;  1P84 F;  1QQC A;  1HNX B;  2CAZ C;  4FM2 A;  1ORQ C;  3CME V;  2BTQ A;  1BE3 H;  2Q7E A;  5GON B;  3EFF K;  2JIZ G;  3B4S A;  5A2Q N;  4QIW F;  1MSW D;  4UV9 A;  4U7O A;  2FB5 A;  3K79 A;  4FLW A;  2W6J G;  1KEC A;  2GHY A;  3G71 V;  4TT3 G;  1TVK A;  3HR0 A;  1IBK O;  1M5I A;  2HJD A;  2KG7 A;  5B1N A;  4FFB A;  1XNQ O;  2DYS C;  1K4C C;  4K3A A;  3AG2 C;  4UCU A;  3E8G A;  4GX0 A;  3D36 C;  5FL7 G;  1CP9 A;  3SPH A;  1RPO A;  5CB4 A;  3K9S A;  5IY5 B;  1F4N A;  4WFE A;  2Z0A A;  1XRE A;  1YJN V;  4YJ2 B;  2JGD A;  4JI0 O;  3HKD A;  2QWN B;  3RYF B;  3SYP A;  4A5U B;  5H6R A;  4ASU G;  4LR3 A;  1BS3 A;  3W7T A;  5ITZ A;  1R6T A;  1ZL8 B;  4J7K A;  2LFS A;  5C8Y B;  3AG3 C;  1YXB A;  3ASO B;  2AZ0 A;  4UVC A;  4UCS A;  3WFV A;  2AHY A;  2Y0I A;  1TUB A;  1PKX A;  4TSF G;  2EZP A;  1H8H G;  1Z5V A;  4B7E A;  2R9I A;  3K3W A;  1PNK A;  2RDC A;  1S76 D;  3N27 A;  4QE9 A;  4X1I A;  3EHB B;  4DV4 O;  3K5L A;  4LF5 O;  1IBL B;  4DV2 O;  3RT3 C;  1G6U A;  2CGO A;  1H2N A;  3ZRS A;  1K8A W;  1U96 A;  2Q7H A;  2F43 G;  5BR8 B;  1I5X A;  4MS2 A;  4TV8 B;  5JWP A;  4I55 B;  1WN7 A;  2ZCE A;  3IC9 A;  5H5N A;  3LUT B;  2WLH A;  4OX9 O;  4FLX A;  4RO2 A;  4O4H B;  5KHI A;  3K58 A;  1VQ8 V;  4H33 A;  4DR6 B;  3WG7 C;  1RSO A;  3HKE A;  4PV1 B;  4GZR B;  5JJN B;  4JAA A;  1SRY A;  1Q8I A;  2FYU H;  1TVK B;  5J2T B;  4FLU A;  2YXL A;  3JYC A;  4DV2 B;  1Q3E A;  2QKC A;  5BXZ A;  3ZN0 A;  5KMG A;  4X1Y B;  3DXR A;  2QM8 A;  5GTI Z;  1IBM B;  3THO A;  2A0L A;  2QWQ B;  1R1B A;  3AG4 C;  4K0K B;  2RN9 A;  4LBE C;  4JYA O;  1MG1 A;  1TAE A;  2QSA A;  2YSU B;  5CA0 A;  1YEW A;  5KX5 A;  4AQY B;  1WP8 A;  2ZIO A;  4I9W A;  4UCT A;  5IJ0 A;  3OUF A;  3CB2 A;  1SQB H;  5ITZ B;  3L73 H;  2KKW A;  3N2G A;  4LF4 B;  2GUZ A;  4EFE A;  2Y4T A;  4UXN A;  4DRX B;  3JD4 A;  1VQ4 V;  4X66 B;  3FB6 C;  4U3J B;  1N36 B;  1JJ2 U;  1Y66 A;  4WFB V;  1I94 B;  2CTQ A;  1GM7 A;  5CA1 B;  2YIA A;  1YIT V;  2X6A A;  1EN5 A;  3T1H B;  3LDC A;  2NR5 A;  2GSM B;  3C3T A;  3X2Q C;  2EUL A;  4DUY O;  1JPX A;  4ZOL B;  4LF6 B;  1BSM A;  5KUK A;  3F7Y C;  4JI6 O;  1I7F A;  4RQE A;  4YHH O;  4JI8 B;  1G8M A;  4DV0 O;  1ROP A;  1VQP V;  2QA4 V;  4PJ0 Z;  2EIJ C;  5F2V O;  1Q43 A;  4X62 O;  2ITC C;  3QO5 A;  4MVM A;  5H2F Z;  4UCV A;  4X88 A;  3IGA C;  3B8M A;  4FLV A;  2QKS A;  4UB6 Z;  1NZ6 A;  4DW1 A;  3HKC B;  3AK1 A;  3CCU V;  4I9Q A;  1E1Q G;  1QCE A;  3G67 A;  5L3G A;  2N04 A;  4YY3 O;  3ZMZ A;  4X1I B;  3CRC A;  5CA1 A;  2HR3 A;  2EIJ B;  3SPI A;  3IJ4 A;  1PL4 A;  1WAZ A;  3RGB A;  4LFA O;  4F4L A;  1O9G A;  3CX5 F;  4L87 A;  2R72 A;  2IH1 C;  4PA3 A;  4OGQ B;  1OCO B;  2IU3 A;  3D36 A;  3T4D A;  2XAF A;  2RNB A;  2WLK A;  3WG7 B;  1DK1 A;  2BTO A;  3RYH A;  5B66 Z;  3BFR A;  4O4J B;  2UUB O;  5IJ9 B;  1SC5 B;  5J2U B;  2JJ2 G;  4PA9 A;  1DLB A;  2IM9 A;  4X64 B;  1MMM A;  1ZWI C;  4DR2 O;  2EIL C;  4D6T H;  3ASO C;  5JCO A;  3ASN B;  3STL C;  4C7U A;  1OCO C;  1H2G A;  3OW2 U;  5GTH Z;  1FFX A;  1IBK B;  1RP3 B;  4X20 B;  4CZZ A;  3CPW U;  2DN9 A;  4RQF A;  1HNW B;  2UUC B;  4JI5 O;  2FKX A;  4DR5 B;  2WLI B;  2XAG A;  5LOV A;  1CXZ B;  3K08 A;  3TXS A;  3FKS G;  3RVY A;  3TJT A;  4J41 A;  1I94 O;  3CE2 A;  2PI5 A;  5K1X A;  2VQF O;  3K5N A;  4D7T A;  4J11 A;  1FS0 G;  3I56 V;  2QWO B;  4NXM O;  4J9Z B;  3IC7 A;  1AI5 A;  4PDL A;  2BTQ B;  4G27 B;  1EZJ A;  3TXQ A;  3G6E V;  4KFM A;  2IJK A;  2XHB A;  3LDD A;  3K5O A;  2P22 C;  1UFI A;  2F4V B;  4IIJ A;  1KQS U;  5FNV A;  5LXT B;  1DGS A;  2Q8V A;  1SQQ H;  2Y69 C;  1EM1 A;  1OCZ B;  1D5N A;  1QU7 A;  2Q4P A;  5EIB D;  1XDC A;  1XMQ B;  2CTR A;  1OV9 A;  3CCV V;  3CP1 A;  3SJA C;  1E79 G;  1Y74 A;  2QTS A;  3LDE A;  2JEU A;  2XAS A;  3K06 A;  1AP5 A;  2HJF C;  3QO8 A;  5BR8 O;  1YTF B;  5AG2 A;  4Z1M G;  4GKK O;  2OWO A;  4D7S A;  3JAK A;  4LFC B;  3H1I H;  4JI0 B;  5IJ9 A;  4KUM A;  2WAM A;  2X6B A;  4O2B B;  2LW7 A;  1TA8 A;  4DV6 B;  3EVK A;  1GK9 A;  3GB7 C;  2XTA A;  2FL4 A;  4DV1 B;  3G4S V;  1Q90 D;  4X1K B;  3SDL A;  4JPR A;  3BA9 A;  2EIM C;  4FZ0 A;  2VQE O;  4J9Y B;  2HVK C;  3JD3 A;  4JYC A;  1K97 A;  4MVS A;  2ODM A;  4N21 A;  4X64 O;  3OGC C;  1MA1 A;  2WA3 A;  2B1G A;  3QO7 A;  2O57 A;  2CUG A;  3SYO A;  3W7W A;  3E8H A;  5LMN O;  2JK5 C;  3RWR D;  2YI9 A;  5LP6 B;  3S3W A;  4NXM B;  4BIZ A;  3M99 B;  3DGE A;  1ARO P;  1R3K C;  4U3F H;  1L0N H;  2LGW A;  4X1K A;  4GCZ A;  4O4I A;  4B3M O;  5L3C A;  5KHK A;  3VBB A;  1RFY A;  1YZB A;  4O4H A;  3WB1 A;  5FNV B;  3KCY A;  3FFQ A;  5L3E A;  3ICX A;  4JI6 B;  4JI3 B;  3L72 H;  4CC5 A;  3E35 A;  5JH7 B;  2R9R B;  1L0L H;  4CC6 A;  2W0F C;  1TGO A;  1YSC A;  3GWO A;  3R65 A;  4MTO A;  1Q6H A;  1O9H A;  4FLY A;  5LHI A;  1MSD A;  1YI2 V;  4B3R B;  1S72 V;  3RYH B;  3ETQ A;  3KCX A;  1FJG O;  3S3X A;  2WA4 A;  4B08 A;  4CH6 A;  5J2T A;  1VQ7 V;  4WFF A;  5EZY A;  2OTL V;  4JI4 O;  3CC4 V;  4ZIB A;  4E4E A;  2F4V O;  2ZE6 A;  2D3O W;  4LF9 O;  4PHZ A;  4IYH A;  2EIK B;  1M56 C;  3SJC C;  1THZ A;  5B1A B;  4DR7 O;  1OHH G;  3F5W C;  2EIL B;  4JTA B;  3CMA V;  5FPO A;  1AI7 A;  3RW0 A;  1NVP B;  2IJJ A;  1K4D C;  2JVD A;  4O4I B;  1N34 O;  4H44 B;  2Q67 A;  4BAY A;  3CCM V;  4JI2 B;  1W0J G;  1QR8 A;  2B5U A;  2LW1 A;  4FFK A;  4HYO A;  4N23 A;  1YJW V;  4NTX A;  3E8B A;  5IYD O;  3LSU A;  5LA6 A;  4DR3 O;  3H01 A;  4X89 A;  5B1O A;  5L3F A;  1IZ3 A;  3GVM A;  2PZS A;  1IBL O;  2HP8 A;  1Q5O A;  3H1J H;  1KP2 A;  2QWR B;  1OCR B;  4XBF A;  1AP6 A;  2PTM A;  1W0K G;  2P5O A;  4TV9 B;  2ZR3 A;  5KAF Z;  2CTP A;  2UXB B;  1AR4 A;  2BOB C;  3NXS A;  5DED A;  5CMU A;  1NJI W;  3QG5 A;  1HR0 B;  4I5S A;  1GTO A;  2Y69 B;  4G2K A;  3FAV B;  2AHZ A;  1M1K W;  3SJB C;  3AG7 A;  1OCR C;  2R70 A;  4RWU A;  4DR5 O;  2GBO A;  4H37 A;  4DXW A;  4J80 A;  4LNU A;  4LF6 O;  3J80 N;  1I5Y A;  4IGG A;  5EZY B;  3OFN G;  5C8Y A;  3CSX A;  5B3S C;  1PD3 A;  3JCU Z;  5LP6 A;  1WLE A;  4LH7 A;  5B5E Z;  1NTK H;  3Q4H A;  2QGN A;  4WFH A;  2QJ1 A;  2MW2 B;  3AK2 A;  1P7G A;  5J2U A;  1JA8 A;  1KD1 W;  4O4L A;  2ZKO A;  3CD6 V;  3MHH C;  3FYI B;  1HDJ A;  5CN0 A;  4GLX A;  1QLN A;  2JS5 A;  3C3S A;  1H8E G;  1HNW O;  5CA3 A;  3U11 A;  5A9G A;  1FFX B;  1RM1 B;  5D5P A;  1NH2 D;  1R6N A;  1V9P A;  2M7W A;  4I0X B;  2EIK C;  3T1Y O;  2DYR C;  2OIG A;  2DE0 X;  1XHX A;  1NU1 H;  5B1A C;  2WWW A;  3P32 A;  2X6C A;  1BL8 A;  3QVN A;  2OCC C;  5KLV H;  3N2K B;  3PN1 A;  4TV9 A;  3ZHS A;  1DF4 A;  4JI3 O;  3ZMS A;  4H0L B;  4K8X A;  4J42 A;  5LOV B;  4NXN O;  2LP7 A;  2IJH A;  3CRM A;  1AI4 A;  4YJ2 A;  2E5L B;  1IXB A;  3KZI Z;  4U3J A;  1N33 O;  1J95 A;  5EC2 C;  3K59 A;  1SQX H;  3CC7 V;  1B3Q A;  4TQD A;  1I0H A;  1MZE A;  4FFB B;  4GYC B;  4QPK A;  5JVD B;  1JX9 A;  1PP9 H;  1VF5 B;  4O2A A;  5EYP A;  1AJQ A;  4YIO A;  5CBF A;  4JI7 B;  1JFF B;  1N0N A;  2CH7 A;  4LNU B;  4DUZ O;  3SYA A;  4GKJ B;  1LNQ A;  3STZ C;  2GUZ B;  2P4K A;  2ARH A;  5DEC A;  2W0X A;  1YTF D;  2E5L O;  4MTF A;  2YXH A;  4GUN A;  2RJZ A;  3HKD B;  2B9Z A;  1KC8 W;  3T2M A;  2DYS B;  5FPR A;  3U10 A;  3VQY A;  2YS8 A;  1IUR A;  1GO3 F;  5KHH A;  3ABK B;  2F95 B;  4DUY B;  2JRI A;  3AG1 C;  1V54 B;  1JCH A;  2UXD B;  1SES A;  4F6R A;  1TUB B;  2ITD C;  4J10 A;  4U7N A;  1AJN A;  5KHG A;  1K33 A;  2ZIN A;  3SJQ C;  4AQY O;  1YF2 A;  2RMK B;  1WB8 A;  3I5D A;  4P30 A;  3R66 A;  4LFA B;  5B3S B;  4LF4 O;  4DO2 A;  2N74 A;  1XBL A;  4I0X A;  2QR4 A;  3MDS A;  2CGN A;  3T1Y B;  3ZMT A;  4I4T B;  1AB3 A;  4TWK A;  4AI8 A;  4DK0 A;  2UXB O;  5LMN B;  3WU2 Z;  3MAQ A;  1DTO A;  1Q81 W;  2V4D A;  3HKC A;  1YHQ V;  1MOF A;  1XEQ A;  1F4M A;  4YY3 B;  5B1B C;  4DR1 O;  2ILM A;  2ZXW C;  4JI1 B;  3ZBH A;  2UUA O;  5LYJ A;  3UQ8 A;  4XDJ A;  5KX5 B;  4GKJ O;  3CCQ V;  1H2S B;  1RM1 C;  4JYA B;  2JGU A;  4HAM A;  3FX7 A;  3N2G B;  4KP4 A;  3DXR B;  4HBN A;  3UCS C;  3U0Z A;  2HHH B;  3SGI A;  2HKO A;  1R3L C;  1VMG A;  3P3P A;  1H2L A;  1M57 C;  3F5T A;  1H2M A;  2LFR A;  1QHT A;  4LFB O;  2Q9L A;  1K5S A;  3ZRV A;  4JAU A;  3PJS K;  2E74 B;  1P49 A;  3E89 A;  1Q7Y W;  1S5H C;  3ZMU A;  5JH7 A;  3CC2 V;  3OEE G;  1BZK A;  1COW G;  3CHX A;  4YIP A;  2PGG A;  5LMU O;  2FML A;  3AEI A;  3ZS8 C;  1MNG A;  3AK3 A;  5TIS Z;  1NVP D;  4JI7 O;  5JQG A;  3B09 A;  3BPZ A;  1SF9 A;  3MD0 A;  1SQP H;  2B1I A;  4IIJ B;  1VQK V;  4LC1 A;  1M9N A;  5DN6 G;  1FYJ A;  1Y74 B;  1FKA O;  3CJH B;  4UCR A;  5L3B A;  4OPA A;  4NKG B;  1NR7 A;  4JI5 B;  4FM1 A;  1WNS A;  5LA6 B;  4JZ2 A;  1KKC A;  2WPD G;  4UVA A;  4LWS B;  2A3Q A;  3HKB A;  1K7D A;  1JMK C;  4DW0 A;  2XT9 A;  2PF4 E;  3OEH G;  1VQM V;  5EBL C;  1PL0 A;  3E8F A;  4JYY A;  4L8J A;  1XMQ O;  1XL4 A;  3JAW A;  2EIN B;  3UM7 A;  1OZ0 A;  3DC5 A;  2YEV B;  1VQ6 V;  2BOC C;  2AW9 A;  4TV8 A;  1BGY H;  4I55 A;  4I7Z B;  1WJZ A;  2WLJ A;  5LL6 Y;  4Q6G A;  2JS3 A;  4JTC B;  1M93 A;  4PEL A;  2HVJ C;  5EBW C;  3E2E A;  3G80 A;  2AGA A;  2DJV A;  4IYI A;  1Z5W A;  3JAW B;  4MW8 A;  3VOU A;  1QR9 A;  3DTU B;  4AHC A;  3E22 B;  5FLX N;  1XNQ B;  3HB3 B;  2WLI A;  3OTO O;  2P67 A;  4JI1 O;  4DV7 O;  5KMG B;  3H9V A;  2VQE B;  1BMF G;  1ZAU A;  3AG1 B;  5C93 A;  2DWD C;  3CRR A;  1YVW A;  5IYZ A;  2UUC O;  4O4J A;  4R6Z A;  3OM3 B;  3JD0 A;  1F51 A;  3H1L H;  3JAS A;  2ATK C;  1N33 B;  2ZIM A;  3FB5 C;  2W6I G;  4MVO A;  3ZIA G;  3DC6 A;  2LGQ A;  1N36 O;  1HNX O;  1K34 A;  1HWY A;  2ZDI C;  4JGS A;  4EB6 B;  4X65 B;  5DM6 V;  2YXY A;  2Q6A A;  4FMT A;  1NI8 A;  2WLL A;  2GTS A;  2VRZ A;  4P9P A;  2DQ0 A;  5JJE B;  1GM9 A;  4FLZ A;  2YC0 A;  2ADQ B;  5E79 Z;  1F23 A;  1M56 B;  1MAB G;  1KMI Z;  4MT8 A;  1ZLZ A;  2GDS A;  3W7X A;  3GWK C;  5IT9 N;  4GKK B;  2A7W A;  5LXT A;  1R6K A;  4WF9 V;  1IDS A;  1N0J A;  3RYI B;  5BZB A;  3X2Q B;  4OX9 B;  5H9C A;  1JR9 A;  3W7S A;  3DSQ A;  5EBM C;  2JJ1 G;  3BEH A;  3BAA A;  4H13 B;  2K1E A;  2Q0A A;  1GN6 A;  1CEZ A;  4DR4 O;  1NT2 B;  3B2E E;  4BW5 A;  2XAH A;  1XMO B;  2PYJ A;  1E1R G;  1NH2 B;  4YJ3 B;  4GX2 A;  2FTK A;  1WP7 A;  1UPG A;  4O2B A;  3P3N A;  3ABU A;  4QE7 A;  4JTD B;  4HNA B;  2V1D A;  3JAK B;  1PPJ H;  4MVR A;  2H3O A;  3SYQ A;  2L35 A;  1FFT B;  4PA7 A;  4BWA A;  1CPY A;  4R50 A;  4PDR A;  1EN6 A;  1GH6 A;  5IY5 C;  2UU9 B;  1XOU A;  2IU0 A;  4YJ3 A;  3IAY A;  1EBO A;  3O65 A;  3OTO B;  1U97 A;  4QGP A;  3QNE A;  4ICG A;  1W59 A;  3TGU H;  2G38 A;  4X1Y A;  4WFG A;  4DUZ B;  3ETG A;  3APQ A;  4HNA A;  4XDL A;  4ZI7 A;  2XAQ A;  3A0R A;  2P06 A;  2KB1 A;  2Q5Z A;  3A0H Z;  1J5E O;  2DMX A;  1PNL A;  1V55 B;  4UVB A;  3L75 H;  4X20 A;  1XNR B;  1B04 A;  3T1C A;  4LH6 A;  1FXV A;  2N05 A;  4ABM A;  4FPP A;  1IXM A;  1VF7 A;  2M6Y A;  2A79 B;  3ASN C;  5KHJ A;  4I50 A;  2P7T C;  1KUQ A;  2L6L A;  2CTW A;  3ZHU A;  1FJG B;  1MZF A;  2F1M A;  1B06 A;  3M8A A;  3RBZ A;  3UT5 B;  1QLE C;  3OAA G;  2PUS A;  3WB0 A;  3CRA A;  2YID A;  3UKM A;  4KXR A;  3JD1 A;  3K03 A;  2Q68 A;  4FZ1 A;  2P4V A;  1LUV A;  3BVO A;  3K9A A;  4DV5 B;  4LP8 A;  4DV4 B;  3ZHV A;  1BQ0 A;  5CBG A;  1WPX A;  3SYC A;  1M4U A;  2KSD A;  1KB9 F;  1XI1 A;  1YIJ V;  3ABM C;  3L71 H;  2OCC B;  2QEX V;  4I50 B;  2E3C A;  1BT8 A;  1L8D A;  1K92 A;  3N2K A;  3FB8 C;  4CH3 A;  4RAI A;  3ETE A;  2QM7 A;  2NN4 A;  2UUA B;  5EC1 C;  1KYO F;  4O2A B;  3RYI A;  4HZ3 A;  4DR6 O;  3CCL V;  4WBN A;  3K0D A;  4EEQ A;  3CCJ V;  3TK1 A;  4B3M B;  2F93 B;  1GMG A;  2DOS A;  2X7R B;  2YIC A;  4JI8 O;  4IHJ A;  3FB7 C;  4RUF A;  3RVZ A;  3OR6 C;  5BY1 A;  3VQW A;  4AIL C;  1OCC B;  4LFB B;  2QTO A;  4MVU A;  4QJF B;  4BIU A;  1N32 O;  1WB7 A;  3ABL B;  3ABK C;  4CH4 A;  1US6 A;  5JCO C;  4DR1 B;  1V54 C;  4LF8 B;  4ZKI A;  4JYB A;  2RQ6 A;  1SER A;  1LUW A;  1G1X B;  5CBH A;  2UU9 O;  2ZNI A;  4FK5 C;  2QKA A;  2UXX A;  3D3Q A;  2QWP B;  3RN4 A;  1FXK B;  5L3D A;  2HG5 C;  3BY6 A;  1WPB A;  2H8P C;  2ZM6 O;  4X8A A;  3H1K H;  3D8C A;  1QVG U;  4MSW C;  3JAT A;  1P7B A;  2HHH O;  4K8Z A;  2YDE A;  2A06 H;  1IBM O;  1K73 W;  4WCE V;  5IYB O;  3L70 H;  3LNN A;  4FIP C;  3OTF A;  4OPH A;  1FPO A;  3VQX A;  2ZXW B;  4J7J A;  4MVZ A;  5CA0 B;  1OJH A;  3L9D A;  1QLE B;  2ADP A;  3BCC H;  1NS1 A;  1KBH A;  5IJ0 B;  4K35 A;  4ZHQ A;  5IYZ B;  4BW9 A;  1GRJ A;  3C90 A;  1L1F A;  4I4T A;  3CCR V;  5LGN A;  1Y4M A;  3CS5 A;  3RYC A;  4B3S B;  2XUM A;  1X4T A;  3ABM B;  1GM8 A;  4CS3 A;  1SQF A;  2UXC O;  1D5A A;  2PY5 A;  1ZSP A;  4MTG A;  3AG2 B;  4GX5 A;  4MVQ A;  3B40 A;  2CDY A;  1VEW A;  5EIB C;  4ZHQ B;  1GAX A;  1VQ9 V;  5H6Q A;  3ZX6 A;  3JAL A;  4FVM A;  1UJW B;  1EZV H;  5BMV B;  2IBZ H;  1NKD A;  1AI6 A;  2DYR B;  5E1A C;  1VF6 C;  4TUY B;  4KHP O;  4B7K A;  1AR5 A;  1FXK A;  1XUQ A;  4TQF A;  1NQT A;  4JAV A;  3ZHR A;  1OCC C;  4JI4 B;  2DWE C;  5KAI Z;  2OTJ V;  2QM4 A;  3JAT B;  1EN4 A;  4NYK A;  3A8T A;  3CXH F;  4IT5 A;  5JVD A;  2AXT Z;  2Y0P A;  4UFZ A;  3JSN A;  4JZG A;  2LJ2 A;  3K5M A;  2VWJ A;  3B8N A;  1AJP A;  1A32 A;  1GN2 A;  4TOI A;  1IX9 A;  4DK1 A;  2KG7 B;  1BHB A;  5LGT A;  3OMI B;  4TUY A;  2YEV A;  1AIL A;  3T4Z A;  1OCZ C;  3K57 A;  4F6R B;  1K9M W;  3LSS A;  2VWK A;  4LCU C;  1K5Q A;  2EZO A;  3VQV A;  4B3T O;  3T1H O;  4YXW G;  2JDI G;  3QF7 A;  3ZRW B;  3HKB B; 
#chains in the Genus database with same CATH homology
 1KEC A;  2GHY A;  3G71 V;  4TT3 G;  5J9P C;  4R6Z A;  3OM3 B;  1VQ7 V;  2OTL V;  4WFF A;  3JD0 A;  3CC4 V;  2C2A A;  1F51 A;  1S3J A;  5B1N A;  1JVM A;  2ATK C;  2DYS C;  1K4C C;  5HFM A;  3AG2 C;  3FB5 C;  2W6I G;  3E8G A;  4GX0 A;  2D3O W;  4MVO A;  3ZIA G;  2EIK B;  1M56 C;  5HFL A;  5FL7 G;  3ZMV A;  1H38 A;  1CP9 A;  3SPH A;  1RPO A;  5IY5 B;  1THZ A;  5B1A B;  1OHH G;  3F5W C;  2EIL B;  3ABL C;  1F4N A;  4JTA B;  3CMA V;  1K34 A;  1AI7 A;  1HWY A;  4WFE A;  3RW0 A;  5LBQ A;  2ZDI C;  1YJN V;  1NVP B;  3ML0 A;  2IJJ A;  1K4D C;  4JGS A;  3SYP A;  5DM6 V;  5H6R A;  4ASU G;  3ZJZ A;  2Q67 A;  4BAY A;  3CCM V;  1W2B U;  2Q6A A;  4FMT A;  3W7T A;  3SPC A;  1W0J G;  2WLL A;  1QR8 A;  2B5U A;  4HYO A;  2IW5 A;  3FYE B;  4P9P A;  2DQ0 A;  4N23 A;  1GM9 A;  1YJW V;  2LFS A;  1JOY A;  1F23 A;  1M56 B;  1MAB G;  3E8B A;  3AG3 C;  4MT8 A;  5IYD O;  3ASO B;  3H01 A;  4UVC A;  3OE7 G;  3WFV A;  2AHY A;  2ZDI A;  1PNM A;  4X89 A;  2EBO A;  5B1O A;  5L3F A;  1PKX A;  4TSF G;  2EZP A;  1H8H G;  3TET A;  2R9I A;  4EKW A;  3K3W A;  1KP2 A;  1R6K A;  1TUE B;  4PA6 A;  1PNK A;  1JQ0 A;  1OCR B;  4WF9 V;  1S76 D;  4QE9 A;  4XBF A;  3EHB B;  2PI4 A;  5BZB A;  1W0K G;  3X2Q B;  2WSS G;  5H9C A;  2Z3Y A;  3W7S A;  3ZRS A;  2ZR3 A;  1K8A W;  5GW7 A;  2WLL B;  5EBM C;  2JJ1 G;  2BOB C;  4GX1 A;  2F43 G;  2JEX A;  3BEH A;  5EK0 A;  1I5X A;  2K1E A;  3NXS A;  4MS2 A;  5CMU A;  1CEZ A;  4QPJ A;  2WLM A;  4GT1 A;  1NJI W;  1KP3 A;  1XL6 A;  4I5S A;  3LUT B;  1GTO A;  2WLH A;  2Y69 B;  1NR1 A;  3K04 A;  4G2K A;  4BW5 A;  1S0V A;  2XAH A;  1E1R G;  2AHZ A;  1NH2 B;  1M1K W;  4GX2 A;  2FTK A;  1OCR C;  4RO2 A;  1ENV A;  3AG4 B;  3K0G A;  2XOK G;  4H33 A;  1VQ8 V;  3WG7 C;  3ABU A;  1RPR A;  4QE7 A;  4H37 A;  4DXW A;  4JTD B;  1SRY A;  2V1D A;  4MW3 A;  1I5Y A;  1G4Y B;  3OFN G;  4MVR A;  3JYC A;  5B3S C;  3SYQ A;  1PD3 A;  3ZN0 A;  2CK3 G;  1FFT B;  4PA7 A;  1WLE A;  2QM8 A;  3B77 A;  1CPY A;  4R50 A;  4PDR A;  5IY5 C;  4WFH A;  2A0L A;  3AG4 C;  4LBE C;  2IU0 A;  5KA5 A;  1EBO A;  1MG1 A;  4QNH B;  2YSU B;  3QNE A;  1KD1 W;  3TCU A;  3CD6 V;  3MHH C;  4I9W A;  4WFG A;  3FYI B;  3ETG A;  3E83 A;  5CN0 A;  4E2L A;  3OUF A;  1VQN V;  4XDL A;  2NLJ C;  1EFR G;  1QLN A;  1B6Q A;  2XAQ A;  3A0R A;  1VQO V;  4UXN A;  2KB1 A;  1H8E G;  1VQL V;  3JD4 A;  1M90 W;  3F7V C;  5CA3 A;  1VQ4 V;  3FB6 C;  1RM1 B;  1PNL A;  1V55 B;  4UVB A;  1JJ2 U;  3LNM B;  2HFE C;  1Y66 A;  4WFB V;  1NH2 D;  1R6N A;  3ZRW A;  3T1C A;  3CXC U;  4OXS A;  1GM7 A;  2M7W A;  1FXV A;  1S77 D;  2EIK C;  1YIT V;  2X6A A;  4FPP A;  1IXM A;  2DYR C;  2A79 B;  3ASN C;  3SPG A;  3LDC A;  4CBC A;  2V7Q G;  4RUE A;  5B1A C;  2GSM B;  2WWW A;  3P32 A;  2P90 A;  3X2Q C;  2X6C A;  1BL8 A;  1JPX A;  2P7T C;  2OCC C;  2UXN A;  5KUK A;  1DF4 A;  3F7Y C;  3IFX A;  3ZMS A;  2XAJ A;  3RBZ A;  1QLE C;  3OAA G;  4RQE A;  2LP7 A;  3UKM A;  2EJR A;  2IJH A;  3JD1 A;  1FXH A;  3K03 A;  2Q68 A;  1G8M A;  1AI4 A;  1R3J C;  1ROP A;  2P6J A;  2A9H A;  3K9A A;  1J95 A;  1VQP V;  5EC2 C;  3P30 A;  4LP8 A;  2QA4 V;  2EIJ C;  3CC7 V;  2ITC C;  3CYO A;  3QO5 A;  1WPX A;  4QPK A;  5CBG A;  4MVM A;  3SYC A;  1JX9 A;  5LGU A;  1QVF U;  1YIJ V;  3ABM C;  1AJQ A;  4X88 A;  5KUM A;  3IGA C;  2OCC B;  3B8M A;  5CBF A;  2QEX V;  3D3I A;  2QKS A;  3SYA A;  1AR1 B;  1LNQ A;  3STZ C;  1K92 A;  2OT5 A;  3FB8 C;  5IYC O;  1YTF D;  4RAI A;  1M57 B;  3ETE A;  4MTF A;  1N8R W;  2QM7 A;  3CCU V;  1E1Q G;  1QCE A;  4Q20 A;  4UV8 A;  5L3G A;  4XDK A;  5EC1 C;  1KC8 W;  3T2M A;  2DYS B;  2ZQM A;  2NNU A;  3JD2 A;  2Y48 A;  3ZMZ A;  2HR3 A;  2EIJ B;  3SPI A;  1Q86 W;  4HZ3 A;  3CCL V;  1GO3 F;  2IJI A;  4UUJ C;  3K0D A;  2MK3 A;  3ABK B;  3CCJ V;  4F4L A;  3TK1 A;  4L87 A;  3AG1 C;  1V54 B;  1JCH A;  1GMG A;  2IH1 C;  4PA3 A;  1OCO B;  2X7R B;  2IU3 A;  2X0L A;  3D36 A;  3W7X A;  1SES A;  2ZD9 A;  2XAF A;  3T4D A;  3FB7 C;  4RUF A;  2WLK A;  3RVZ A;  3WG7 B;  3OR6 C;  2ITD C;  1K3E A;  2QE7 G;  4U7N A;  1AJN A;  1K33 A;  3SJQ C;  4P2Z A;  1OCC B;  3ZRX A;  2QTO A;  3I55 V;  4MVU A;  4QJF B;  4P30 A;  3CCE V;  1V55 C;  2JJ2 G;  1NBM G;  4PA9 A;  4BIU A;  5B3S B;  3SPJ A;  1DLB A;  4DO2 A;  1ZWI C;  2EIL C;  3ABL B;  3E86 A;  3ABK C;  3ASO C;  1DF5 A;  3ASN B;  3STL C;  3ZMT A;  1V54 C;  3CCS V;  4TWK A;  3ZN1 A;  4WFA V;  1OCO C;  1H2G A;  3OW2 U;  4ZKI A;  1DTO A;  3HPL C;  4JYB A;  3OUS A;  4CZZ A;  1Q81 W;  1SER A;  3CPW U;  4RQF A;  5CBH A;  1YHQ V;  4MTX A;  4FK5 C;  1MOF A;  2ZR2 A;  2UXX A;  2WLI B;  1F4M A;  5B1B C;  2XAG A;  1YJ9 V;  1FXK B;  3AG3 B;  5L3D A;  2HG5 C;  2ZXW C;  3BY6 A;  3K08 A;  3FKS G;  2H8P C;  3RVY A;  4X8A A;  5IDJ A;  4XDJ A;  5LHG A;  1QVG U;  2PI5 A;  2DQ3 A;  4MSW C;  3CCQ V;  1P7B A;  1RM1 C;  2EIN C;  1QBZ A;  4HAM A;  1FS0 G;  2HLD G;  3I56 V;  4J9Z B;  3IC7 A;  4KP4 A;  2Z5U A;  2WLN A;  1K73 W;  1AI5 A;  1P4R A;  5IYB O;  4PDL A;  4WCE V;  4G27 B;  1EZJ A;  2HKO A;  3ZCC A;  3G6E V;  4FIP C;  1SZT A;  1R3L C;  4KFM A;  2IJK A;  2IH3 C;  3LDD A;  1M57 C;  1FXK C;  1KKD A;  2LFR A;  2ZXW B;  3MHS C;  5LHH A;  4MVZ A;  1KQS U;  4JF3 A;  2Y69 C;  1QLE B;  1K5S A;  3ZRV A;  3PJS K;  4JAU A;  3W7U A;  4R8C A;  1OCZ B;  3E89 A;  1Q7Y W;  1S5H C;  3ZMU A;  1L1F A;  3CCR V;  3CC2 V;  5LGN A;  1Y4M A;  3OEE G;  1COW G;  3CCV V;  3CP1 A;  1VQ5 V;  4PDM A;  1E79 G;  3AEI A;  3LDE A;  2JEU A;  2XAS A;  3OMA B;  3K06 A;  1NVP D;  2HJF C;  1R73 A;  3QO8 A;  1YTF B;  4Z1M G;  3ABM B;  3LSQ A;  2EIM B;  1GM8 A;  3MD0 A;  2H94 A;  1Q82 W;  2B1I A;  1VQK V;  4R7C A;  4KUM A;  2WAM A;  2X6B A;  1M9N A;  3AG2 B;  4LC1 A;  2Q69 A;  4MTG A;  5DN6 G;  4GX5 A;  4MVQ A;  4JAS A;  4PDV A;  5L3B A;  1R3I C;  1VQ9 V;  5H6Q A;  5KA6 A;  1GK9 A;  4ZBM A;  3GB7 C;  1NR7 A;  1UJW B;  3KG2 A;  3OR7 C;  4PA4 A;  1NKD A;  1AI6 A;  2DYR B;  3G4S V;  5E1A C;  4UVA A;  2WPD G;  4JPR A;  2EIM C;  1BHA A;  3JCZ A;  5B1B B;  1K7D A;  4J9Y B;  2HVK C;  3JD3 A;  3OEH G;  1FXK A;  1K97 A;  4JYC A;  1VQM V;  1NQT A;  4JAV A;  5EBL C;  1PL0 A;  4MVS A;  3E8F A;  4N21 A;  1OCC C;  3OGC C;  4G28 B;  4P9O A;  1XL4 A;  2B1G A;  3QO7 A;  2DWE C;  2OTJ V;  3SYO A;  3W7W A;  2XND G;  3E8H A;  1GKF A;  3OMN B;  2EIN B;  2JK5 C;  4FJC C;  3UM7 A;  1OZ0 A;  2YEV B;  1VQ6 V;  2BOC C;  4BIZ A;  3M99 B;  3ABT A;  3DGE A;  1ARO P;  1R3K C;  3B8N A;  3ETD A;  2DW4 A;  1AJP A;  2WLJ A;  4GCZ A;  5L3C A;  1SET A;  3VBB A;  4JTC B;  1BHB A;  5LGT A;  4PEL A;  3OMI B;  2HVJ C;  2YEV A;  3T4Z A;  5EBW C;  3E2E A;  1ORQ C;  3CME V;  5L3E A;  1OCZ C;  1K9M W;  3EFF K;  2JIZ G;  3LSS A;  3E35 A;  4QIW F;  2R9R B;  1MSW D;  4MW8 A;  4U7O A;  4UV9 A;  2W0F C;  3VOU A;  4LCU C;  1QR9 A;  3DTU B;  1YSC A;  1K5Q A;  3GWO A;  3R65 A;  4MTO A;  2EZO A;  3K79 A;  3HB3 B;  2WLI A;  2P67 A;  4YXW G;  2JDI G;  5LHI A;  3ZRW B;  2W6J G;  1BMF G;  3AG1 B;  5C93 A;  1YI2 V;  1S72 V;  2DWD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...