4R5CA

Crystal structure of computational designed leucine rich repeats dlrr_e in space group of p212121
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
304
structure length
304
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTSLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLTSLHTLDLSNNGITDISALKNLDNLETLDLRNNGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine rich repeat protein
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 111
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r5cA00
1OTOA 3W3JA 1A9NA 2OMYA 5D3IA 2FT3A 3G3BA 3RW6A 1DCEA 1O6TA 3RGXA 5GS0A 2O6SA 2V9TB 4LXRA 5IYXC 4NKGA 2WQWA 3O6NA 4HQ1A 2Z81A 2RR6A 3RFEA 1QYYA 3ULVA 4ECNA 3WPGA 3W3MA 3E3ZA 1YRGA 4CP6A 1DFJI 3CIYA 4AW4A 4V2EA 4Y61B 2WFHA 2UZYA 3REZA 4PQ8A 3KJ4A 4RCAB 1U0ND 4K17A 1FS2A 3OGLB 3W3KA 3WPIA 1W8AA 1OOKG 5GMGA 3C6NB 3SB4A 1OZNA 4C2AB 1XKUA 4CC4A 2Z62A 1A4YA 4Z64C 1OGQA 3C6PB 5GS2B 2OMVA 3UL7A 4P91A 2ASSB 4P8SA 2R9UA 3ZYNA 4M7EC 2WQVA 2JE0A 5IJBA 4KT1A 2BEXA 1OTNA 1FO1A 3FXIA 2JQDA 4CNMA 2P1NB 1XCDA 5AWCA 3WPDA 4QBZA 4V2DA 1K5GC 3W3GA 5IJCA 4XGOA 4FCGA 4LSXC 1LTXA 3UN9A 3ZYJA 4MQWX 4QXEA 1ZIWA 4R08A 2Z7XB 3RFSA 4Z61C 1SQ0B 2P1MB 4BSRA 2IFGA 4R07A 4J0MA 5AWAA 4Q62A 2P1QB 4GLPA 4R58A 3RFJA 4Z8GA 2O6QA 1P8TA 3WPBA 4R6AA 3RJ0A 2V9SA 5CMNA 2XWTC 1M10B 4RWTC 5HDHA 3WN4A 2V70A 3G39A 4L3AA 4QC0A 3C6OB 1O6SA 1K5DC 4BSUA 2CA6A 3UL8A 4C2BB 3TSRE 4FMZA 4RCWA 4PEQB 1H6UA 5AWBA 2OMWA 1OTMA 4KXFB 1FT8A 2Z64A 2RA8A 3OJAB 4TZHA 2P1OB 2XOTA 1H6TA 2OMTA 5HZLB 2JE1A 4R5DA 1KOOA 1PGVA 3VQ2A 4BSSA 4CC4C 4U09A 3DZEA 4FDWA 5B0NA 5LFNA 2UZXA 3WPEA 4I6JB 3CVRA 4LSXA 4CNCA 4PKIG 4LI2A 3UL9A 5AZ5A 3OGKB 3BZ5A 4KNGA 3P72A 4XSQA 2OMZA 4U08A 4LI1A 2Z82A 3RIZA 2P1PB 2Z7XA 3W3LA 4MN8B 4H09A 3E4GA 2OMXA 1P9AG 1IO0A 1FQVA 4UFRA 3WPHA 2Z65A 3E2JA 4R5CA 1M9LA 4LXSA 5FTTB 3PMHG 4BV4R 4YEBB 4Q3IA 3M19A 3WPCA 3M18A 3ZYOA 1Z7XW 3OGMB 4R0AA 4OQTA 1XEUA 4NKHA 1GWBA 4L3FA 1G9UA 5IJDA 3W3NA 2WQUA 2Z66A 4Q3GA 2Z63A 5GMHA 4FS7A 4U06A 4U7LA 2OMUA 3O53A 5B0TA 3RGZA 4EZGA 4R6GA 4LSCA 4WP6A 2O6RA 5B4PA 1DS9A 3ULUA 4G8AA 1JL5A 4PSJA 4M7EA 1XECA 4PERA 3CIGA 3VQ1A 3OJAA 2Q4GW 4FD0A 2BNHA 1D0BA 1P8VA 4R09A 4V2CA 1KOHA 4B8CD 3RW7A 3E6JA 3WPFA 5CMPA 5GMFA 2ID5A 1M9SA 4ARRA 4R6FA 1O6VA 4WYKA 3G04C 5A5CA 3GOZA 2Y5QA 2WQXA 4ARNA 4IM6A 4Z94G 3A79B 3G3AA 4XOSA 4FHOA 5AWDA 4CILA 3ZYIA 4LSAA 4J4LA 1M0ZA 4R6JA 1WWLA 4Z79A 5GQRK 4GT6A 2ASTB 1XWDC 2ELLA 4AY9X 3G06A 2A0ZA 3JB9j 4ECOA 3ULAA
chains in the Genus database with same CATH superfamily
1OTOA 3W3JA 1A9NA 2OMYA 5D3IA 2FT3A 3G3BA 3RW6A 1DCEA 1O6TA 3RGXA 5GS0A 2O6SA 2V9TB 4LXRA 5IYXC 4NKGA 2WQWA 3O6NA 4HQ1A 2Z81A 2RR6A 3RFEA 1QYYA 3ULVA 4ECNA 3WPGA 3W3MA 3E3ZA 1YRGA 4CP6A 1DFJI 3CIYA 4AW4A 4V2EA 4Y61B 2WFHA 2UZYA 3REZA 4PQ8A 3KJ4A 4RCAB 1U0ND 4K17A 1FS2A 3OGLB 3W3KA 3WPIA 1W8AA 1OOKG 5GMGA 3C6NB 3SB4A 1OZNA 4C2AB 1XKUA 4CC4A 2Z62A 1A4YA 4Z64C 1OGQA 3C6PB 5GS2B 2OMVA 3UL7A 4P91A 2ASSB 4P8SA 2R9UA 3ZYNA 4M7EC 2WQVA 2JE0A 5IJBA 4KT1A 2BEXA 1OTNA 1FO1A 3FXIA 2JQDA 4CNMA 2P1NB 1XCDA 5AWCA 3WPDA 4QBZA 4V2DA 1K5GC 3W3GA 5IJCA 4XGOA 4FCGA 4LSXC 1LTXA 3UN9A 3ZYJA 4MQWX 4QXEA 1ZIWA 4R08A 2Z7XB 3RFSA 4Z61C 1SQ0B 2P1MB 4BSRA 2IFGA 4R07A 4J0MA 5AWAA 4Q62A 2P1QB 4GLPA 4R58A 3RFJA 4Z8GA 2O6QA 1P8TA 3WPBA 4R6AA 3RJ0A 2V9SA 5CMNA 2XWTC 1M10B 4RWTC 5HDHA 3WN4A 2V70A 3G39A 4L3AA 4QC0A 3C6OB 1O6SA 1K5DC 4BSUA 2CA6A 3UL8A 4C2BB 3TSRE 4FMZA 4RCWA 4PEQB 1H6UA 5AWBA 2OMWA 1OTMA 4KXFB 1FT8A 2Z64A 2RA8A 3OJAB 4TZHA 2P1OB 2XOTA 1H6TA 2OMTA 5HZLB 2JE1A 4R5DA 1KOOA 1PGVA 3VQ2A 4BSSA 4CC4C 4U09A 3DZEA 4FDWA 5B0NA 5LFNA 2UZXA 3WPEA 4I6JB 3CVRA 4LSXA 4CNCA 4PKIG 4LI2A 3UL9A 5AZ5A 3OGKB 3BZ5A 4KNGA 3P72A 4XSQA 2OMZA 4U08A 4LI1A 2Z82A 3RIZA 2P1PB 2Z7XA 3W3LA 4MN8B 4H09A 3E4GA 2OMXA 1P9AG 1IO0A 1FQVA 4UFRA 3WPHA 2Z65A 3E2JA 4R5CA 1M9LA 4LXSA 5FTTB 4NZTM 3PMHG 4BV4R 4YEBB 4Q3IA 3M19A 3WPCA 3M18A 3ZYOA 1Z7XW 3OGMB 4R0AA 4OQTA 1XEUA 4NKHA 1GWBA 4L3FA 1G9UA 5IJDA 3W3NA 2WQUA 2Z66A 4Q3GA 2Z63A 5GMHA 4FS7A 4U06A 4U7LA 2OMUA 3O53A 5B0TA 3RGZA 4EZGA 4R6GA 4LSCA 4WP6A 2O6RA 5B4PA 1DS9A 3ULUA 4G8AA 1JL5A 4PSJA 4M7EA 1XECA 4PERA 3CIGA 3VQ1A 3OJAA 2Q4GW 4FD0A 2BNHA 1D0BA 1P8VA 4R09A 4V2CA 1KOHA 4B8CD 3RW7A 3E6JA 3WPFA 5CMPA 5GMFA 2ID5A 1M9SA 4ARRA 4R6FA 1O6VA 4WYKA 3G04C 5A5CA 3GOZA 2Y5QA 2WQXA 4ARNA 4IM6A 4Z94G 3A79B 3G3AA 4XOSA 4FHOA 5AWDA 4NZRM 4CILA 3ZYIA 4LSAA 4J4LA 1M0ZA 4R6JA 1WWLA 4Z79A 5GQRK 4GT6A 2ASTB 1XWDC 2ELLA 4AY9X 3G06A 2A0ZA 3JB9j 4ECOA 3ULAA
chains in the Genus database with same CATH topology
1OTOA 3W3JA 1A9NA 2OMYA 5D3IA 2FT3A 3G3BA 3RW6A 1DCEA 1O6TA 3RGXA 5GS0A 2O6SA 2V9TB 4LXRA 5IYXC 4NKGA 2WQWA 3O6NA 4HQ1A 2Z81A 2RR6A 3RFEA 1QYYA 3ULVA 4ECNA 3WPGA 3W3MA 3E3ZA 1YRGA 4CP6A 1DFJI 3CIYA 4AW4A 4V2EA 4Y61B 2WFHA 2UZYA 3REZA 4PQ8A 3KJ4A 4RCAB 1U0ND 4K17A 1FS2A 3OGLB 3W3KA 3WPIA 1W8AA 1OOKG 5GMGA 3C6NB 3SB4A 1OZNA 4C2AB 1XKUA 4CC4A 2Z62A 1A4YA 4Z64C 1OGQA 3C6PB 5GS2B 2OMVA 3UL7A 4P91A 2ASSB 4P8SA 2R9UA 3ZYNA 4M7EC 2WQVA 2JE0A 5IJBA 4KT1A 2BEXA 1OTNA 1FO1A 3FXIA 2JQDA 4CNMA 2P1NB 1XCDA 5AWCA 3WPDA 4QBZA 4V2DA 1K5GC 3W3GA 5IJCA 4XGOA 4FCGA 4LSXC 1LTXA 3UN9A 3ZYJA 4MQWX 4QXEA 1ZIWA 4R08A 2Z7XB 3RFSA 4Z61C 1SQ0B 2P1MB 4BSRA 2IFGA 4R07A 4J0MA 5AWAA 4Q62A 2P1QB 4GLPA 4R58A 3RFJA 4Z8GA 2O6QA 1P8TA 3WPBA 4R6AA 3RJ0A 2V9SA 5CMNA 2XWTC 1M10B 4RWTC 5HDHA 3WN4A 2V70A 3G39A 4L3AA 4QC0A 3C6OB 1O6SA 1K5DC 4BSUA 2CA6A 3UL8A 4C2BB 3TSRE 4FMZA 4RCWA 4PEQB 1H6UA 5AWBA 2OMWA 1OTMA 4KXFB 1FT8A 2Z64A 2RA8A 3OJAB 4TZHA 2P1OB 2XOTA 1H6TA 2OMTA 5HZLB 2JE1A 4R5DA 1KOOA 1PGVA 3VQ2A 4BSSA 4CC4C 4U09A 3DZEA 4FDWA 5B0NA 5LFNA 2UZXA 3WPEA 4I6JB 3CVRA 4LSXA 4CNCA 4PKIG 4LI2A 3UL9A 5AZ5A 3OGKB 3BZ5A 4KNGA 3P72A 4XSQA 2OMZA 4U08A 4LI1A 2Z82A 3RIZA 2P1PB 2Z7XA 3W3LA 4MN8B 4H09A 3E4GA 2OMXA 1P9AG 1IO0A 1FQVA 4UFRA 3WPHA 2Z65A 3E2JA 4R5CA 1M9LA 4LXSA 5FTTB 3PMHG 4BV4R 4YEBB 4Q3IA 3M19A 3WPCA 3M18A 3ZYOA 1Z7XW 3OGMB 4R0AA 4OQTA 1XEUA 4NKHA 1GWBA 4L3FA 1G9UA 5IJDA 3W3NA 2WQUA 2Z66A 4Q3GA 2Z63A 5GMHA 4FS7A 4U06A 4U7LA 2OMUA 3O53A 5B0TA 3RGZA 4EZGA 4R6GA 4LSCA 4WP6A 2O6RA 5B4PA 1DS9A 3ULUA 4G8AA 1JL5A 4PSJA 4M7EA 1XECA 4PERA 3CIGA 3VQ1A 3OJAA 2Q4GW 4FD0A 2BNHA 1D0BA 1P8VA 4R09A 4V2CA 1KOHA 4B8CD 3RW7A 3E6JA 3WPFA 5CMPA 5GMFA 2ID5A 1M9SA 4ARRA 4R6FA 1O6VA 4WYKA 3G04C 5A5CA 3GOZA 2Y5QA 2WQXA 4ARNA 4IM6A 4Z94G 3A79B 3G3AA 4XOSA 4FHOA 5AWDA 4CILA 3ZYIA 4LSAA 4J4LA 1M0ZA 4R6JA 1WWLA 4Z79A 5GQRK 4GT6A 2ASTB 1XWDC 2ELLA 4AY9X 3G06A 2A0ZA 3JB9j 4ECOA 3ULAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTO A;  3W3J A;  1A9N A;  2OMY A;  5D3I A;  2FT3 A;  3G3B A;  3RW6 A;  1DCE A;  1O6T A;  3RGX A;  5GS0 A;  2O6S A;  2V9T B;  4LXR A;  5IYX C;  4NKG A;  2WQW A;  3O6N A;  4HQ1 A;  2Z81 A;  2RR6 A;  3RFE A;  1QYY A;  3ULV A;  4ECN A;  3WPG A;  3W3M A;  3E3Z A;  1YRG A;  4CP6 A;  1DFJ I;  3CIY A;  4AW4 A;  4V2E A;  4Y61 B;  2WFH A;  2UZY A;  3REZ A;  4PQ8 A;  3KJ4 A;  4RCA B;  1U0N D;  4K17 A;  1FS2 A;  3OGL B;  3W3K A;  3WPI A;  1W8A A;  1OOK G;  5GMG A;  3C6N B;  3SB4 A;  1OZN A;  4C2A B;  1XKU A;  4CC4 A;  2Z62 A;  1A4Y A;  4Z64 C;  1OGQ A;  3C6P B;  5GS2 B;  2OMV A;  3UL7 A;  4P91 A;  2ASS B;  4P8S A;  2R9U A;  3ZYN A;  4M7E C;  2WQV A;  2JE0 A;  5IJB A;  4KT1 A;  2BEX A;  1OTN A;  1FO1 A;  3FXI A;  2JQD A;  4CNM A;  2P1N B;  1XCD A;  5AWC A;  3WPD A;  4QBZ A;  4V2D A;  1K5G C;  3W3G A;  5IJC A;  4XGO A;  4FCG A;  4LSX C;  1LTX A;  3UN9 A;  3ZYJ A;  4MQW X;  4QXE A;  1ZIW A;  4R08 A;  2Z7X B;  3RFS A;  4Z61 C;  1SQ0 B;  2P1M B;  4BSR A;  2IFG A;  4R07 A;  4J0M A;  5AWA A;  4Q62 A;  2P1Q B;  4GLP A;  4R58 A;  3RFJ A;  4Z8G A;  2O6Q A;  1P8T A;  3WPB A;  4R6A A;  3RJ0 A;  2V9S A;  5CMN A;  2XWT C;  1M10 B;  4RWT C;  5HDH A;  3WN4 A;  2V70 A;  3G39 A;  4L3A A;  4QC0 A;  3C6O B;  1O6S A;  1K5D C;  4BSU A;  2CA6 A;  3UL8 A;  4C2B B;  3TSR E;  4FMZ A;  4RCW A;  4PEQ B;  1H6U A;  5AWB A;  2OMW A;  1OTM A;  4KXF B;  1FT8 A;  2Z64 A;  2RA8 A;  3OJA B;  4TZH A;  2P1O B;  2XOT A;  1H6T A;  2OMT A;  5HZL B;  2JE1 A;  4R5D A;  1KOO A;  1PGV A;  3VQ2 A;  4BSS A;  4CC4 C;  4U09 A;  3DZE A;  4FDW A;  5B0N A;  5LFN A;  2UZX A;  3WPE A;  4I6J B;  3CVR A;  4LSX A;  4CNC A;  4PKI G;  4LI2 A;  3UL9 A;  5AZ5 A;  3OGK B;  3BZ5 A;  4KNG A;  3P72 A;  4XSQ A;  2OMZ A;  4U08 A;  4LI1 A;  2Z82 A;  3RIZ A;  2P1P B;  2Z7X A;  3W3L A;  4MN8 B;  4H09 A;  3E4G A;  2OMX A;  1P9A G;  1IO0 A;  1FQV A;  4UFR A;  3WPH A;  2Z65 A;  3E2J A;  4R5C A;  1M9L A;  4LXS A;  5FTT B;  3PMH G;  4BV4 R;  4YEB B;  4Q3I A;  3M19 A;  3WPC A;  3M18 A;  3ZYO A;  1Z7X W;  3OGM B;  4R0A A;  4OQT A;  1XEU A;  4NKH A;  1GWB A;  4L3F A;  1G9U A;  5IJD A;  3W3N A;  2WQU A;  2Z66 A;  4Q3G A;  2Z63 A;  5GMH A;  4FS7 A;  4U06 A;  4U7L A;  2OMU A;  3O53 A;  5B0T A;  3RGZ A;  4EZG A;  4R6G A;  4LSC A;  4WP6 A;  2O6R A;  5B4P A;  1DS9 A;  3ULU A;  4G8A A;  1JL5 A;  4PSJ A;  4M7E A;  1XEC A;  4PER A;  3CIG A;  3VQ1 A;  3OJA A;  2Q4G W;  4FD0 A;  2BNH A;  1D0B A;  1P8V A;  4R09 A;  4V2C A;  1KOH A;  4B8C D;  3RW7 A;  3E6J A;  3WPF A;  5CMP A;  5GMF A;  2ID5 A;  1M9S A;  4ARR A;  4R6F A;  1O6V A;  4WYK A;  3G04 C;  5A5C A;  3GOZ A;  2Y5Q A;  2WQX A;  4ARN A;  4IM6 A;  4Z94 G;  3A79 B;  3G3A A;  4XOS A;  4FHO A;  5AWD A;  4CIL A;  3ZYI A;  4LSA A;  4J4L A;  1M0Z A;  4R6J A;  1WWL A;  4Z79 A;  5GQR K;  4GT6 A;  2AST B;  1XWD C;  2ELL A;  4AY9 X;  3G06 A;  2A0Z A;  3JB9 j;  4ECO A;  3ULA A; 
#chains in the Genus database with same CATH topology
 1OTO A;  3W3J A;  1A9N A;  2OMY A;  5D3I A;  2FT3 A;  3G3B A;  3RW6 A;  1DCE A;  1O6T A;  3RGX A;  5GS0 A;  2O6S A;  2V9T B;  4LXR A;  5IYX C;  4NKG A;  2WQW A;  3O6N A;  4HQ1 A;  2Z81 A;  2RR6 A;  3RFE A;  1QYY A;  3ULV A;  4ECN A;  3WPG A;  3W3M A;  3E3Z A;  1YRG A;  4CP6 A;  1DFJ I;  3CIY A;  4AW4 A;  4V2E A;  4Y61 B;  2WFH A;  2UZY A;  3REZ A;  4PQ8 A;  3KJ4 A;  4RCA B;  1U0N D;  4K17 A;  1FS2 A;  3OGL B;  3W3K A;  3WPI A;  1W8A A;  1OOK G;  5GMG A;  3C6N B;  3SB4 A;  1OZN A;  4C2A B;  1XKU A;  4CC4 A;  2Z62 A;  1A4Y A;  4Z64 C;  1OGQ A;  3C6P B;  5GS2 B;  2OMV A;  3UL7 A;  4P91 A;  2ASS B;  4P8S A;  2R9U A;  3ZYN A;  4M7E C;  2WQV A;  2JE0 A;  5IJB A;  4KT1 A;  2BEX A;  1OTN A;  1FO1 A;  3FXI A;  2JQD A;  4CNM A;  2P1N B;  1XCD A;  5AWC A;  3WPD A;  4QBZ A;  4V2D A;  1K5G C;  3W3G A;  5IJC A;  4XGO A;  4FCG A;  4LSX C;  1LTX A;  3UN9 A;  3ZYJ A;  4MQW X;  4QXE A;  1ZIW A;  4R08 A;  2Z7X B;  3RFS A;  4Z61 C;  1SQ0 B;  2P1M B;  4BSR A;  2IFG A;  4R07 A;  4J0M A;  5AWA A;  4Q62 A;  2P1Q B;  4GLP A;  4R58 A;  3RFJ A;  4Z8G A;  2O6Q A;  1P8T A;  3WPB A;  4R6A A;  3RJ0 A;  2V9S A;  5CMN A;  2XWT C;  1M10 B;  4RWT C;  5HDH A;  3WN4 A;  2V70 A;  3G39 A;  4L3A A;  4QC0 A;  3C6O B;  1O6S A;  1K5D C;  4BSU A;  2CA6 A;  3UL8 A;  4C2B B;  3TSR E;  4FMZ A;  4RCW A;  4PEQ B;  1H6U A;  5AWB A;  2OMW A;  1OTM A;  4KXF B;  1FT8 A;  2Z64 A;  2RA8 A;  3OJA B;  4TZH A;  2P1O B;  2XOT A;  1H6T A;  2OMT A;  5HZL B;  2JE1 A;  4R5D A;  1KOO A;  1PGV A;  3VQ2 A;  4BSS A;  4CC4 C;  4U09 A;  3DZE A;  4FDW A;  5B0N A;  5LFN A;  2UZX A;  3WPE A;  4I6J B;  3CVR A;  4LSX A;  4CNC A;  4PKI G;  4LI2 A;  3UL9 A;  5AZ5 A;  3OGK B;  3BZ5 A;  4KNG A;  3P72 A;  4XSQ A;  2OMZ A;  4U08 A;  4LI1 A;  2Z82 A;  3RIZ A;  2P1P B;  2Z7X A;  3W3L A;  4MN8 B;  4H09 A;  3E4G A;  2OMX A;  1P9A G;  1IO0 A;  1FQV A;  4UFR A;  3WPH A;  2Z65 A;  3E2J A;  4R5C A;  1M9L A;  4LXS A;  5FTT B;  4NZT M;  3PMH G;  4BV4 R;  4YEB B;  4Q3I A;  3M19 A;  3WPC A;  3M18 A;  3ZYO A;  1Z7X W;  3OGM B;  4R0A A;  4OQT A;  1XEU A;  4NKH A;  1GWB A;  4L3F A;  1G9U A;  5IJD A;  3W3N A;  2WQU A;  2Z66 A;  4Q3G A;  2Z63 A;  5GMH A;  4FS7 A;  4U06 A;  4U7L A;  2OMU A;  3O53 A;  5B0T A;  3RGZ A;  4EZG A;  4R6G A;  4LSC A;  4WP6 A;  2O6R A;  5B4P A;  1DS9 A;  3ULU A;  4G8A A;  1JL5 A;  4PSJ A;  4M7E A;  1XEC A;  4PER A;  3CIG A;  3VQ1 A;  3OJA A;  2Q4G W;  4FD0 A;  2BNH A;  1D0B A;  1P8V A;  4R09 A;  4V2C A;  1KOH A;  4B8C D;  3RW7 A;  3E6J A;  3WPF A;  5CMP A;  5GMF A;  2ID5 A;  1M9S A;  4ARR A;  4R6F A;  1O6V A;  4WYK A;  3G04 C;  5A5C A;  3GOZ A;  2Y5Q A;  2WQX A;  4ARN A;  4IM6 A;  4Z94 G;  3A79 B;  3G3A A;  4XOS A;  4FHO A;  5AWD A;  4NZR M;  4CIL A;  3ZYI A;  4LSA A;  4J4L A;  1M0Z A;  4R6J A;  1WWL A;  4Z79 A;  5GQR K;  4GT6 A;  2AST B;  1XWD C;  2ELL A;  4AY9 X;  3G06 A;  2A0Z A;  3JB9 j;  4ECO A;  3ULA A; 
#chains in the Genus database with same CATH homology
 1OTO A;  3W3J A;  1A9N A;  2OMY A;  5D3I A;  2FT3 A;  3G3B A;  3RW6 A;  1DCE A;  1O6T A;  3RGX A;  5GS0 A;  2O6S A;  2V9T B;  4LXR A;  5IYX C;  4NKG A;  2WQW A;  3O6N A;  4HQ1 A;  2Z81 A;  2RR6 A;  3RFE A;  1QYY A;  3ULV A;  4ECN A;  3WPG A;  3W3M A;  3E3Z A;  1YRG A;  4CP6 A;  1DFJ I;  3CIY A;  4AW4 A;  4V2E A;  4Y61 B;  2WFH A;  2UZY A;  3REZ A;  4PQ8 A;  3KJ4 A;  4RCA B;  1U0N D;  4K17 A;  1FS2 A;  3OGL B;  3W3K A;  3WPI A;  1W8A A;  1OOK G;  5GMG A;  3C6N B;  3SB4 A;  1OZN A;  4C2A B;  1XKU A;  4CC4 A;  2Z62 A;  1A4Y A;  4Z64 C;  1OGQ A;  3C6P B;  5GS2 B;  2OMV A;  3UL7 A;  4P91 A;  2ASS B;  4P8S A;  2R9U A;  3ZYN A;  4M7E C;  2WQV A;  2JE0 A;  5IJB A;  4KT1 A;  2BEX A;  1OTN A;  1FO1 A;  3FXI A;  2JQD A;  4CNM A;  2P1N B;  1XCD A;  5AWC A;  3WPD A;  4QBZ A;  4V2D A;  1K5G C;  3W3G A;  5IJC A;  4XGO A;  4FCG A;  4LSX C;  1LTX A;  3UN9 A;  3ZYJ A;  4MQW X;  4QXE A;  1ZIW A;  4R08 A;  2Z7X B;  3RFS A;  4Z61 C;  1SQ0 B;  2P1M B;  4BSR A;  2IFG A;  4R07 A;  4J0M A;  5AWA A;  4Q62 A;  2P1Q B;  4GLP A;  4R58 A;  3RFJ A;  4Z8G A;  2O6Q A;  1P8T A;  3WPB A;  4R6A A;  3RJ0 A;  2V9S A;  5CMN A;  2XWT C;  1M10 B;  4RWT C;  5HDH A;  3WN4 A;  2V70 A;  3G39 A;  4L3A A;  4QC0 A;  3C6O B;  1O6S A;  1K5D C;  4BSU A;  2CA6 A;  3UL8 A;  4C2B B;  3TSR E;  4FMZ A;  4RCW A;  4PEQ B;  1H6U A;  5AWB A;  2OMW A;  1OTM A;  4KXF B;  1FT8 A;  2Z64 A;  2RA8 A;  3OJA B;  4TZH A;  2P1O B;  2XOT A;  1H6T A;  2OMT A;  5HZL B;  2JE1 A;  4R5D A;  1KOO A;  1PGV A;  3VQ2 A;  4BSS A;  4CC4 C;  4U09 A;  3DZE A;  4FDW A;  5B0N A;  5LFN A;  2UZX A;  3WPE A;  4I6J B;  3CVR A;  4LSX A;  4CNC A;  4PKI G;  4LI2 A;  3UL9 A;  5AZ5 A;  3OGK B;  3BZ5 A;  4KNG A;  3P72 A;  4XSQ A;  2OMZ A;  4U08 A;  4LI1 A;  2Z82 A;  3RIZ A;  2P1P B;  2Z7X A;  3W3L A;  4MN8 B;  4H09 A;  3E4G A;  2OMX A;  1P9A G;  1IO0 A;  1FQV A;  4UFR A;  3WPH A;  2Z65 A;  3E2J A;  4R5C A;  1M9L A;  4LXS A;  5FTT B;  3PMH G;  4BV4 R;  4YEB B;  4Q3I A;  3M19 A;  3WPC A;  3M18 A;  3ZYO A;  1Z7X W;  3OGM B;  4R0A A;  4OQT A;  1XEU A;  4NKH A;  1GWB A;  4L3F A;  1G9U A;  5IJD A;  3W3N A;  2WQU A;  2Z66 A;  4Q3G A;  2Z63 A;  5GMH A;  4FS7 A;  4U06 A;  4U7L A;  2OMU A;  3O53 A;  5B0T A;  3RGZ A;  4EZG A;  4R6G A;  4LSC A;  4WP6 A;  2O6R A;  5B4P A;  1DS9 A;  3ULU A;  4G8A A;  1JL5 A;  4PSJ A;  4M7E A;  1XEC A;  4PER A;  3CIG A;  3VQ1 A;  3OJA A;  2Q4G W;  4FD0 A;  2BNH A;  1D0B A;  1P8V A;  4R09 A;  4V2C A;  1KOH A;  4B8C D;  3RW7 A;  3E6J A;  3WPF A;  5CMP A;  5GMF A;  2ID5 A;  1M9S A;  4ARR A;  4R6F A;  1O6V A;  4WYK A;  3G04 C;  5A5C A;  3GOZ A;  2Y5Q A;  2WQX A;  4ARN A;  4IM6 A;  4Z94 G;  3A79 B;  3G3A A;  4XOS A;  4FHO A;  5AWD A;  4CIL A;  3ZYI A;  4LSA A;  4J4L A;  1M0Z A;  4R6J A;  1WWL A;  4Z79 A;  5GQR K;  4GT6 A;  2AST B;  1XWD C;  2ELL A;  4AY9 X;  3G06 A;  2A0Z A;  3JB9 j;  4ECO A;  3ULA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...