4R5CA

Crystal structure of computational designed leucine rich repeats dlrr_e in space group of p212121
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
304
structure length
304
Chain Sequence
b'TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTNLTTLNLSNNQLTSLPQGVFERLTSLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLTSLHTLDLSNNGITDISALKNLDNLETLDLRNNGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine rich repeat protein
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 111
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r5cA00
1SQ0B 4U09A 4R0AA 3BZ5A 3G06A 3PMHG 1M9SA 2XWTC 4FMZA 3GOZA 3OGKB 3RFSA 4LI2A 1OTNA 1H6UA 4LSXC 1H6TA 1OZNA 4K17A 3M18A 4LSXA 4FHOA 4CILA 2P1MB 4ECOA 1QYYA 3WPFA 3RGZA 2BEXA 4AY9X 4MN8B 4XOSA 4ECNA 4CP6A 5AWDA 4QC0A 4M7EC 3UN9A 1GWBA 1PGVA 3WPIA 5GMGA 2O6SA 4CNMA 4J4LA 4PERA 4KXFB 4NKHA 1O6TA 2UZYA 5FTTB 4BV4R 4G8AA 3P72A 1ZIWA 2R9UA 3RJ0A 5GQRK 5LFNA 4LSAA 3W3GA 4Q3IA 4L3AA 4PKIG 3E3ZA 4C2AB 2CA6A 2V70A 2OMVA 1WWLA 3ZYJA 4H09A 2Y5QA 1Z7XW 5GS0A 3WPCA 1M9LA 4RWTC 2O6QA 5B4PA 3WPGA 5IJDA 1XECA 4V2EA 3WPEA 1DFJI 3RW7A 4J0MA 1W8AA 4EZGA 2Q4GW 3OGMB 4Z8GA 4R58A 4HQ1A 3C6NB 3SB4A 3JB9j 2V9TB 4Q3GA 5HDHA 4LI1A 2XOTA 4IM6A 2V9SA 4AW4A 4Y61B 3M19A 3ULUA 3O6NA 2O6RA 5D3IA 3E2JA 2OMWA 4P8SA 2Z66A 4PQ8A 3WN4A 4LSCA 5GMFA 4U08A 4Z94G 1OOKG 3CIGA 3TSRE 3E6JA 2Z7XB 3WPDA 1P8VA 1P9AG 1P8TA 4RCAB 5B0NA 3ZYOA 5HZLB 3C6OB 4QXEA 1FQVA 3OJAB 4Z61C 5GS2B 4XSQA 4M7EA 4LXSA 3KJ4A 1OGQA 3UL7A 4Z79A 2BNHA 4QBZA 4FDWA 4V2DA 1O6SA 4FD0A 2Z64A 4Z64C 2ASTB 1FT8A 3C6PB 3CIYA 3G3AA 2WQVA 2P1OB 2P1NB 3OGLB 1U0ND 4KT1A 4NKGA 2FT3A 3REZA 4OQTA 5B0TA 4BSUA 4ARRA 2OMUA 2ASSB 1IO0A 2OMYA 2WQWA 4CC4C 4GLPA 1O6VA 4R09A 3G39A 4V2CA 4R6FA 2JE0A 3FXIA 4C2BB 2P1QB 3VQ1A 2WFHA 5CMNA 1D0BA 3G04C 2Z63A 5GMHA 2A0ZA 4YEBB 2RR6A 1DCEA 3CVRA 4U06A 5IJCA 4U7LA 4PEQB 2Z82A 5CMPA 1K5GC 2ELLA 4WP6A 4B8CD 4BSRA 1M0ZA 5IJBA 5AZ5A 1XCDA 2P1PB 3ZYIA 3UL9A 3RFJA 4R07A 1A4YA 5AWBA 4LXRA 1G9UA 4WYKA 3RIZA 2Z62A 3W3MA 3RGXA 3RFEA 1KOOA 4R6JA 3WPHA 2OMZA 2Z7XA 4CNCA 4KNGA 4FS7A 2UZXA 4XGOA 3UL8A 4R08A 3DZEA 4BSSA 2ID5A 4UFRA 2WQUA 4GT6A 1FO1A 4R6AA 2Z65A 1XKUA 5AWAA 1LTXA 1XEUA 3OJAA 2JQDA 3W3JA 3VQ2A 2Z81A 4R5DA 5AWCA 4RCWA 3ULAA 3W3KA 3E4GA 1YRGA 1KOHA 4MQWX 3W3LA 2OMTA 3WPBA 4P91A 3O53A 4L3FA 4FCGA 1M10B 4I6JB 1DS9A 3A79B 2RA8A 1JL5A 4R5CA 5A5CA 4CC4A 2JE1A 1XWDC 2WQXA 1OTMA 3ULVA 4ARNA 4PSJA 3ZYNA 4TZHA 2IFGA 1FS2A 5IYXC 3G3BA 3W3NA 4R6GA 4Q62A 3RW6A 1OTOA 2OMXA 1A9NA 1K5DC
chains in the Genus database with same CATH superfamily
1SQ0B 4U09A 4R0AA 3BZ5A 3G06A 3PMHG 1M9SA 2XWTC 4FMZA 3GOZA 3OGKB 3RFSA 4LI2A 1OTNA 1H6UA 4LSXC 1H6TA 1OZNA 4K17A 3M18A 4LSXA 4FHOA 4CILA 2P1MB 4ECOA 1QYYA 3WPFA 3RGZA 2BEXA 4AY9X 4NZRM 4MN8B 4XOSA 4ECNA 4CP6A 5AWDA 4QC0A 4M7EC 3UN9A 1GWBA 1PGVA 3WPIA 5GMGA 2O6SA 4CNMA 4J4LA 4PERA 4KXFB 4NKHA 1O6TA 2UZYA 5FTTB 4BV4R 4G8AA 3P72A 1ZIWA 2R9UA 3RJ0A 5GQRK 5LFNA 4LSAA 3W3GA 4Q3IA 4L3AA 4PKIG 3E3ZA 4C2AB 2CA6A 2V70A 2OMVA 1WWLA 3ZYJA 4H09A 2Y5QA 1Z7XW 5GS0A 3WPCA 1M9LA 4RWTC 2O6QA 5B4PA 3WPGA 5IJDA 1XECA 4V2EA 3WPEA 1DFJI 3RW7A 4J0MA 1W8AA 4EZGA 2Q4GW 3OGMB 4Z8GA 4R58A 4HQ1A 3C6NB 3SB4A 3JB9j 2V9TB 4Q3GA 5HDHA 4LI1A 2XOTA 4IM6A 2V9SA 4AW4A 4Y61B 3M19A 3ULUA 3O6NA 2O6RA 5D3IA 3E2JA 2OMWA 4P8SA 2Z66A 4PQ8A 3WN4A 4LSCA 5GMFA 4U08A 4Z94G 1OOKG 3CIGA 3TSRE 3E6JA 2Z7XB 3WPDA 1P8VA 1P9AG 1P8TA 4RCAB 5B0NA 3ZYOA 5HZLB 3C6OB 4QXEA 1FQVA 3OJAB 4Z61C 5GS2B 4XSQA 4M7EA 4LXSA 3KJ4A 1OGQA 3UL7A 4Z79A 2BNHA 4QBZA 4FDWA 4V2DA 1O6SA 4FD0A 2Z64A 4Z64C 2ASTB 1FT8A 3C6PB 3CIYA 3G3AA 2WQVA 4NZTM 2P1OB 2P1NB 3OGLB 1U0ND 4KT1A 4NKGA 2FT3A 3REZA 4OQTA 5B0TA 4BSUA 4ARRA 2OMUA 2ASSB 1IO0A 2OMYA 2WQWA 4CC4C 4GLPA 1O6VA 4R09A 3G39A 4V2CA 4R6FA 2JE0A 3FXIA 4C2BB 2P1QB 3VQ1A 2WFHA 5CMNA 1D0BA 3G04C 2Z63A 5GMHA 2A0ZA 4YEBB 2RR6A 1DCEA 3CVRA 4U06A 5IJCA 4U7LA 4PEQB 2Z82A 5CMPA 1K5GC 2ELLA 4WP6A 4B8CD 4BSRA 1M0ZA 5IJBA 5AZ5A 1XCDA 2P1PB 3ZYIA 3UL9A 3RFJA 4R07A 1A4YA 5AWBA 4LXRA 1G9UA 4WYKA 3RIZA 2Z62A 3W3MA 3RGXA 3RFEA 1KOOA 4R6JA 3WPHA 2OMZA 2Z7XA 4CNCA 4KNGA 4FS7A 2UZXA 4XGOA 3UL8A 4R08A 3DZEA 4BSSA 2ID5A 4UFRA 2WQUA 4GT6A 1FO1A 4R6AA 2Z65A 1XKUA 5AWAA 1LTXA 1XEUA 3OJAA 2JQDA 3W3JA 3VQ2A 2Z81A 4R5DA 5AWCA 4RCWA 3ULAA 3W3KA 3E4GA 1YRGA 1KOHA 4MQWX 3W3LA 2OMTA 3WPBA 4P91A 3O53A 4L3FA 4FCGA 1M10B 4I6JB 1DS9A 3A79B 2RA8A 1JL5A 4R5CA 5A5CA 4CC4A 2JE1A 1XWDC 2WQXA 1OTMA 3ULVA 4ARNA 4PSJA 3ZYNA 4TZHA 2IFGA 1FS2A 5IYXC 3G3BA 3W3NA 4R6GA 4Q62A 3RW6A 1OTOA 2OMXA 1A9NA 1K5DC
chains in the Genus database with same CATH topology
1SQ0B 4U09A 4R0AA 3BZ5A 3G06A 3PMHG 1M9SA 2XWTC 4FMZA 3GOZA 3OGKB 3RFSA 4LI2A 1OTNA 1H6UA 4LSXC 1H6TA 1OZNA 4K17A 3M18A 4LSXA 4FHOA 4CILA 2P1MB 4ECOA 1QYYA 3WPFA 3RGZA 2BEXA 4AY9X 4MN8B 4XOSA 4ECNA 4CP6A 5AWDA 4QC0A 4M7EC 3UN9A 1GWBA 1PGVA 3WPIA 5GMGA 2O6SA 4CNMA 4J4LA 4PERA 4KXFB 4NKHA 1O6TA 2UZYA 5FTTB 4BV4R 4G8AA 3P72A 1ZIWA 2R9UA 3RJ0A 5GQRK 5LFNA 4LSAA 3W3GA 4Q3IA 4L3AA 4PKIG 3E3ZA 4C2AB 2CA6A 2V70A 2OMVA 1WWLA 3ZYJA 4H09A 2Y5QA 1Z7XW 5GS0A 3WPCA 1M9LA 4RWTC 2O6QA 5B4PA 3WPGA 5IJDA 1XECA 4V2EA 3WPEA 1DFJI 3RW7A 4J0MA 1W8AA 4EZGA 2Q4GW 3OGMB 4Z8GA 4R58A 4HQ1A 3C6NB 3SB4A 3JB9j 2V9TB 4Q3GA 5HDHA 4LI1A 2XOTA 4IM6A 2V9SA 4AW4A 4Y61B 3M19A 3ULUA 3O6NA 2O6RA 5D3IA 3E2JA 2OMWA 4P8SA 2Z66A 4PQ8A 3WN4A 4LSCA 5GMFA 4U08A 4Z94G 1OOKG 3CIGA 3TSRE 3E6JA 2Z7XB 3WPDA 1P8VA 1P9AG 1P8TA 4RCAB 5B0NA 3ZYOA 5HZLB 3C6OB 4QXEA 1FQVA 3OJAB 4Z61C 5GS2B 4XSQA 4M7EA 4LXSA 3KJ4A 1OGQA 3UL7A 4Z79A 2BNHA 4QBZA 4FDWA 4V2DA 1O6SA 4FD0A 2Z64A 4Z64C 2ASTB 1FT8A 3C6PB 3CIYA 3G3AA 2WQVA 2P1OB 2P1NB 3OGLB 1U0ND 4KT1A 4NKGA 2FT3A 3REZA 4OQTA 5B0TA 4BSUA 4ARRA 2OMUA 2ASSB 1IO0A 2OMYA 2WQWA 4CC4C 4GLPA 1O6VA 4R09A 3G39A 4V2CA 4R6FA 2JE0A 3FXIA 4C2BB 2P1QB 3VQ1A 2WFHA 5CMNA 1D0BA 3G04C 2Z63A 5GMHA 2A0ZA 4YEBB 2RR6A 1DCEA 3CVRA 4U06A 5IJCA 4U7LA 4PEQB 2Z82A 5CMPA 1K5GC 2ELLA 4WP6A 4B8CD 4BSRA 1M0ZA 5IJBA 5AZ5A 1XCDA 2P1PB 3ZYIA 3UL9A 3RFJA 4R07A 1A4YA 5AWBA 4LXRA 1G9UA 4WYKA 3RIZA 2Z62A 3W3MA 3RGXA 3RFEA 1KOOA 4R6JA 3WPHA 2OMZA 2Z7XA 4CNCA 4KNGA 4FS7A 2UZXA 4XGOA 3UL8A 4R08A 3DZEA 4BSSA 2ID5A 4UFRA 2WQUA 4GT6A 1FO1A 4R6AA 2Z65A 1XKUA 5AWAA 1LTXA 1XEUA 3OJAA 2JQDA 3W3JA 3VQ2A 2Z81A 4R5DA 5AWCA 4RCWA 3ULAA 3W3KA 3E4GA 1YRGA 1KOHA 4MQWX 3W3LA 2OMTA 3WPBA 4P91A 3O53A 4L3FA 4FCGA 1M10B 4I6JB 1DS9A 3A79B 2RA8A 1JL5A 4R5CA 5A5CA 4CC4A 2JE1A 1XWDC 2WQXA 1OTMA 3ULVA 4ARNA 4PSJA 3ZYNA 4TZHA 2IFGA 1FS2A 5IYXC 3G3BA 3W3NA 4R6GA 4Q62A 3RW6A 1OTOA 2OMXA 1A9NA 1K5DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQ0 B;  4U09 A;  4R0A A;  3BZ5 A;  3G06 A;  3PMH G;  1M9S A;  2XWT C;  4FMZ A;  3GOZ A;  3OGK B;  3RFS A;  4LI2 A;  1OTN A;  1H6U A;  4LSX C;  1H6T A;  1OZN A;  4K17 A;  3M18 A;  4LSX A;  4FHO A;  4CIL A;  2P1M B;  4ECO A;  1QYY A;  3WPF A;  3RGZ A;  2BEX A;  4AY9 X;  4MN8 B;  4XOS A;  4ECN A;  4CP6 A;  5AWD A;  4QC0 A;  4M7E C;  3UN9 A;  1GWB A;  1PGV A;  3WPI A;  5GMG A;  2O6S A;  4CNM A;  4J4L A;  4PER A;  4KXF B;  4NKH A;  1O6T A;  2UZY A;  5FTT B;  4BV4 R;  4G8A A;  3P72 A;  1ZIW A;  2R9U A;  3RJ0 A;  5GQR K;  5LFN A;  4LSA A;  3W3G A;  4Q3I A;  4L3A A;  4PKI G;  3E3Z A;  4C2A B;  2CA6 A;  2V70 A;  2OMV A;  1WWL A;  3ZYJ A;  4H09 A;  2Y5Q A;  1Z7X W;  5GS0 A;  3WPC A;  1M9L A;  4RWT C;  2O6Q A;  5B4P A;  3WPG A;  5IJD A;  1XEC A;  4V2E A;  3WPE A;  1DFJ I;  3RW7 A;  4J0M A;  1W8A A;  4EZG A;  2Q4G W;  3OGM B;  4Z8G A;  4R58 A;  4HQ1 A;  3C6N B;  3SB4 A;  3JB9 j;  2V9T B;  4Q3G A;  5HDH A;  4LI1 A;  2XOT A;  4IM6 A;  2V9S A;  4AW4 A;  4Y61 B;  3M19 A;  3ULU A;  3O6N A;  2O6R A;  5D3I A;  3E2J A;  2OMW A;  4P8S A;  2Z66 A;  4PQ8 A;  3WN4 A;  4LSC A;  5GMF A;  4U08 A;  4Z94 G;  1OOK G;  3CIG A;  3TSR E;  3E6J A;  2Z7X B;  3WPD A;  1P8V A;  1P9A G;  1P8T A;  4RCA B;  5B0N A;  3ZYO A;  5HZL B;  3C6O B;  4QXE A;  1FQV A;  3OJA B;  4Z61 C;  5GS2 B;  4XSQ A;  4M7E A;  4LXS A;  3KJ4 A;  1OGQ A;  3UL7 A;  4Z79 A;  2BNH A;  4QBZ A;  4FDW A;  4V2D A;  1O6S A;  4FD0 A;  2Z64 A;  4Z64 C;  2AST B;  1FT8 A;  3C6P B;  3CIY A;  3G3A A;  2WQV A;  2P1O B;  2P1N B;  3OGL B;  1U0N D;  4KT1 A;  4NKG A;  2FT3 A;  3REZ A;  4OQT A;  5B0T A;  4BSU A;  4ARR A;  2OMU A;  2ASS B;  1IO0 A;  2OMY A;  2WQW A;  4CC4 C;  4GLP A;  1O6V A;  4R09 A;  3G39 A;  4V2C A;  4R6F A;  2JE0 A;  3FXI A;  4C2B B;  2P1Q B;  3VQ1 A;  2WFH A;  5CMN A;  1D0B A;  3G04 C;  2Z63 A;  5GMH A;  2A0Z A;  4YEB B;  2RR6 A;  1DCE A;  3CVR A;  4U06 A;  5IJC A;  4U7L A;  4PEQ B;  2Z82 A;  5CMP A;  1K5G C;  2ELL A;  4WP6 A;  4B8C D;  4BSR A;  1M0Z A;  5IJB A;  5AZ5 A;  1XCD A;  2P1P B;  3ZYI A;  3UL9 A;  3RFJ A;  4R07 A;  1A4Y A;  5AWB A;  4LXR A;  1G9U A;  4WYK A;  3RIZ A;  2Z62 A;  3W3M A;  3RGX A;  3RFE A;  1KOO A;  4R6J A;  3WPH A;  2OMZ A;  2Z7X A;  4CNC A;  4KNG A;  4FS7 A;  2UZX A;  4XGO A;  3UL8 A;  4R08 A;  3DZE A;  4BSS A;  2ID5 A;  4UFR A;  2WQU A;  4GT6 A;  1FO1 A;  4R6A A;  2Z65 A;  1XKU A;  5AWA A;  1LTX A;  1XEU A;  3OJA A;  2JQD A;  3W3J A;  3VQ2 A;  2Z81 A;  4R5D A;  5AWC A;  4RCW A;  3ULA A;  3W3K A;  3E4G A;  1YRG A;  1KOH A;  4MQW X;  3W3L A;  2OMT A;  3WPB A;  4P91 A;  3O53 A;  4L3F A;  4FCG A;  1M10 B;  4I6J B;  1DS9 A;  3A79 B;  2RA8 A;  1JL5 A;  4R5C A;  5A5C A;  4CC4 A;  2JE1 A;  1XWD C;  2WQX A;  1OTM A;  3ULV A;  4ARN A;  4PSJ A;  3ZYN A;  4TZH A;  2IFG A;  1FS2 A;  5IYX C;  3G3B A;  3W3N A;  4R6G A;  4Q62 A;  3RW6 A;  1OTO A;  2OMX A;  1A9N A;  1K5D C; 
#chains in the Genus database with same CATH topology
 1SQ0 B;  4U09 A;  4R0A A;  3BZ5 A;  3G06 A;  3PMH G;  1M9S A;  2XWT C;  4FMZ A;  3GOZ A;  3OGK B;  3RFS A;  4LI2 A;  1OTN A;  1H6U A;  4LSX C;  1H6T A;  1OZN A;  4K17 A;  3M18 A;  4LSX A;  4FHO A;  4CIL A;  2P1M B;  4ECO A;  1QYY A;  3WPF A;  3RGZ A;  2BEX A;  4AY9 X;  4NZR M;  4MN8 B;  4XOS A;  4ECN A;  4CP6 A;  5AWD A;  4QC0 A;  4M7E C;  3UN9 A;  1GWB A;  1PGV A;  3WPI A;  5GMG A;  2O6S A;  4CNM A;  4J4L A;  4PER A;  4KXF B;  4NKH A;  1O6T A;  2UZY A;  5FTT B;  4BV4 R;  4G8A A;  3P72 A;  1ZIW A;  2R9U A;  3RJ0 A;  5GQR K;  5LFN A;  4LSA A;  3W3G A;  4Q3I A;  4L3A A;  4PKI G;  3E3Z A;  4C2A B;  2CA6 A;  2V70 A;  2OMV A;  1WWL A;  3ZYJ A;  4H09 A;  2Y5Q A;  1Z7X W;  5GS0 A;  3WPC A;  1M9L A;  4RWT C;  2O6Q A;  5B4P A;  3WPG A;  5IJD A;  1XEC A;  4V2E A;  3WPE A;  1DFJ I;  3RW7 A;  4J0M A;  1W8A A;  4EZG A;  2Q4G W;  3OGM B;  4Z8G A;  4R58 A;  4HQ1 A;  3C6N B;  3SB4 A;  3JB9 j;  2V9T B;  4Q3G A;  5HDH A;  4LI1 A;  2XOT A;  4IM6 A;  2V9S A;  4AW4 A;  4Y61 B;  3M19 A;  3ULU A;  3O6N A;  2O6R A;  5D3I A;  3E2J A;  2OMW A;  4P8S A;  2Z66 A;  4PQ8 A;  3WN4 A;  4LSC A;  5GMF A;  4U08 A;  4Z94 G;  1OOK G;  3CIG A;  3TSR E;  3E6J A;  2Z7X B;  3WPD A;  1P8V A;  1P9A G;  1P8T A;  4RCA B;  5B0N A;  3ZYO A;  5HZL B;  3C6O B;  4QXE A;  1FQV A;  3OJA B;  4Z61 C;  5GS2 B;  4XSQ A;  4M7E A;  4LXS A;  3KJ4 A;  1OGQ A;  3UL7 A;  4Z79 A;  2BNH A;  4QBZ A;  4FDW A;  4V2D A;  1O6S A;  4FD0 A;  2Z64 A;  4Z64 C;  2AST B;  1FT8 A;  3C6P B;  3CIY A;  3G3A A;  2WQV A;  4NZT M;  2P1O B;  2P1N B;  3OGL B;  1U0N D;  4KT1 A;  4NKG A;  2FT3 A;  3REZ A;  4OQT A;  5B0T A;  4BSU A;  4ARR A;  2OMU A;  2ASS B;  1IO0 A;  2OMY A;  2WQW A;  4CC4 C;  4GLP A;  1O6V A;  4R09 A;  3G39 A;  4V2C A;  4R6F A;  2JE0 A;  3FXI A;  4C2B B;  2P1Q B;  3VQ1 A;  2WFH A;  5CMN A;  1D0B A;  3G04 C;  2Z63 A;  5GMH A;  2A0Z A;  4YEB B;  2RR6 A;  1DCE A;  3CVR A;  4U06 A;  5IJC A;  4U7L A;  4PEQ B;  2Z82 A;  5CMP A;  1K5G C;  2ELL A;  4WP6 A;  4B8C D;  4BSR A;  1M0Z A;  5IJB A;  5AZ5 A;  1XCD A;  2P1P B;  3ZYI A;  3UL9 A;  3RFJ A;  4R07 A;  1A4Y A;  5AWB A;  4LXR A;  1G9U A;  4WYK A;  3RIZ A;  2Z62 A;  3W3M A;  3RGX A;  3RFE A;  1KOO A;  4R6J A;  3WPH A;  2OMZ A;  2Z7X A;  4CNC A;  4KNG A;  4FS7 A;  2UZX A;  4XGO A;  3UL8 A;  4R08 A;  3DZE A;  4BSS A;  2ID5 A;  4UFR A;  2WQU A;  4GT6 A;  1FO1 A;  4R6A A;  2Z65 A;  1XKU A;  5AWA A;  1LTX A;  1XEU A;  3OJA A;  2JQD A;  3W3J A;  3VQ2 A;  2Z81 A;  4R5D A;  5AWC A;  4RCW A;  3ULA A;  3W3K A;  3E4G A;  1YRG A;  1KOH A;  4MQW X;  3W3L A;  2OMT A;  3WPB A;  4P91 A;  3O53 A;  4L3F A;  4FCG A;  1M10 B;  4I6J B;  1DS9 A;  3A79 B;  2RA8 A;  1JL5 A;  4R5C A;  5A5C A;  4CC4 A;  2JE1 A;  1XWD C;  2WQX A;  1OTM A;  3ULV A;  4ARN A;  4PSJ A;  3ZYN A;  4TZH A;  2IFG A;  1FS2 A;  5IYX C;  3G3B A;  3W3N A;  4R6G A;  4Q62 A;  3RW6 A;  1OTO A;  2OMX A;  1A9N A;  1K5D C; 
#chains in the Genus database with same CATH homology
 1SQ0 B;  4U09 A;  4R0A A;  3BZ5 A;  3G06 A;  3PMH G;  1M9S A;  2XWT C;  4FMZ A;  3GOZ A;  3OGK B;  3RFS A;  4LI2 A;  1OTN A;  1H6U A;  4LSX C;  1H6T A;  1OZN A;  4K17 A;  3M18 A;  4LSX A;  4FHO A;  4CIL A;  2P1M B;  4ECO A;  1QYY A;  3WPF A;  3RGZ A;  2BEX A;  4AY9 X;  4MN8 B;  4XOS A;  4ECN A;  4CP6 A;  5AWD A;  4QC0 A;  4M7E C;  3UN9 A;  1GWB A;  1PGV A;  3WPI A;  5GMG A;  2O6S A;  4CNM A;  4J4L A;  4PER A;  4KXF B;  4NKH A;  1O6T A;  2UZY A;  5FTT B;  4BV4 R;  4G8A A;  3P72 A;  1ZIW A;  2R9U A;  3RJ0 A;  5GQR K;  5LFN A;  4LSA A;  3W3G A;  4Q3I A;  4L3A A;  4PKI G;  3E3Z A;  4C2A B;  2CA6 A;  2V70 A;  2OMV A;  1WWL A;  3ZYJ A;  4H09 A;  2Y5Q A;  1Z7X W;  5GS0 A;  3WPC A;  1M9L A;  4RWT C;  2O6Q A;  5B4P A;  3WPG A;  5IJD A;  1XEC A;  4V2E A;  3WPE A;  1DFJ I;  3RW7 A;  4J0M A;  1W8A A;  4EZG A;  2Q4G W;  3OGM B;  4Z8G A;  4R58 A;  4HQ1 A;  3C6N B;  3SB4 A;  3JB9 j;  2V9T B;  4Q3G A;  5HDH A;  4LI1 A;  2XOT A;  4IM6 A;  2V9S A;  4AW4 A;  4Y61 B;  3M19 A;  3ULU A;  3O6N A;  2O6R A;  5D3I A;  3E2J A;  2OMW A;  4P8S A;  2Z66 A;  4PQ8 A;  3WN4 A;  4LSC A;  5GMF A;  4U08 A;  4Z94 G;  1OOK G;  3CIG A;  3TSR E;  3E6J A;  2Z7X B;  3WPD A;  1P8V A;  1P9A G;  1P8T A;  4RCA B;  5B0N A;  3ZYO A;  5HZL B;  3C6O B;  4QXE A;  1FQV A;  3OJA B;  4Z61 C;  5GS2 B;  4XSQ A;  4M7E A;  4LXS A;  3KJ4 A;  1OGQ A;  3UL7 A;  4Z79 A;  2BNH A;  4QBZ A;  4FDW A;  4V2D A;  1O6S A;  4FD0 A;  2Z64 A;  4Z64 C;  2AST B;  1FT8 A;  3C6P B;  3CIY A;  3G3A A;  2WQV A;  2P1O B;  2P1N B;  3OGL B;  1U0N D;  4KT1 A;  4NKG A;  2FT3 A;  3REZ A;  4OQT A;  5B0T A;  4BSU A;  4ARR A;  2OMU A;  2ASS B;  1IO0 A;  2OMY A;  2WQW A;  4CC4 C;  4GLP A;  1O6V A;  4R09 A;  3G39 A;  4V2C A;  4R6F A;  2JE0 A;  3FXI A;  4C2B B;  2P1Q B;  3VQ1 A;  2WFH A;  5CMN A;  1D0B A;  3G04 C;  2Z63 A;  5GMH A;  2A0Z A;  4YEB B;  2RR6 A;  1DCE A;  3CVR A;  4U06 A;  5IJC A;  4U7L A;  4PEQ B;  2Z82 A;  5CMP A;  1K5G C;  2ELL A;  4WP6 A;  4B8C D;  4BSR A;  1M0Z A;  5IJB A;  5AZ5 A;  1XCD A;  2P1P B;  3ZYI A;  3UL9 A;  3RFJ A;  4R07 A;  1A4Y A;  5AWB A;  4LXR A;  1G9U A;  4WYK A;  3RIZ A;  2Z62 A;  3W3M A;  3RGX A;  3RFE A;  1KOO A;  4R6J A;  3WPH A;  2OMZ A;  2Z7X A;  4CNC A;  4KNG A;  4FS7 A;  2UZX A;  4XGO A;  3UL8 A;  4R08 A;  3DZE A;  4BSS A;  2ID5 A;  4UFR A;  2WQU A;  4GT6 A;  1FO1 A;  4R6A A;  2Z65 A;  1XKU A;  5AWA A;  1LTX A;  1XEU A;  3OJA A;  2JQD A;  3W3J A;  3VQ2 A;  2Z81 A;  4R5D A;  5AWC A;  4RCW A;  3ULA A;  3W3K A;  3E4G A;  1YRG A;  1KOH A;  4MQW X;  3W3L A;  2OMT A;  3WPB A;  4P91 A;  3O53 A;  4L3F A;  4FCG A;  1M10 B;  4I6J B;  1DS9 A;  3A79 B;  2RA8 A;  1JL5 A;  4R5C A;  5A5C A;  4CC4 A;  2JE1 A;  1XWD C;  2WQX A;  1OTM A;  3ULV A;  4ARN A;  4PSJ A;  3ZYN A;  4TZH A;  2IFG A;  1FS2 A;  5IYX C;  3G3B A;  3W3N A;  4R6G A;  4Q62 A;  3RW6 A;  1OTO A;  2OMX A;  1A9N A;  1K5D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...