4R5IA

Crystal structure of the dnak c-terminus with the substrate peptide nrllltg
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
222
structure length
222
Chain Sequence
HIEGRVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 70
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5iA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5iA01
3H0XA 2OP6A 4R5KA 2BPRA 4HYBA 1DG4A 4HY9A 7HSCA 4R5IA 4JWCA 4JWIA 3DPOA 5TKYA 4EZTA 2V7YA 1U00A 4EZPA 1YUWA 4EZNA 2WINM 3L3OM 4EZZA 4EZXA 3DQGA 4WV5A 4R5LA 4EZQA 4H6HA 3D2EA 4EZSA 2KHOA 4JWEA 3T49A 4EZRA 3DPPA 4R5JA 4H6IA 4E81A 1BPRA 3DPQA 4EZUA 3N8EA 4EZVA 4F01A 1DKXA 5E84A 4EZYA 3C7NB 3D2FA 4PO2A 3C7NA 3T4AG 1Q5LA 4R5GA 4B9QA 4FL9A 4WV7A 4F00A 1DKZA 2QFFA 2QXLA 4JN4A 4JWDA 3T48A 3T46A 3OHXM 3QNJA 4JNFA 4EZWA 3DOBA 1CKRA 4EZOA 4JNEA 3T47A 1DKYA
chains in the Genus database with same CATH superfamily
2X3XA 2C08A 2F1BA 3DYTA 3ZEDA 2YL8A 4AZBA 3DX2A 1O7DB 3L3OM 3D4ZA 4EZSA 1SU6A 3BUPA 2YL6A 4KIKA 2Z8YA 2QKWA 4ILIA 2D4CA 2PY6A 3SBTB 3KDRA 2F7QA 2RT6A 1I4TA 4EZPA 5C5BB 1SU8A 2WINM 1HTYA 3LMFA 1O7DC 4EZQA 2OBMA 4G6QA 3CZSA 4DCNC 2ALWA 3D2FA 4PO2A 2YLLA 3F7WA 3DX0A 3DDFA 4EZWA 3QE6A 3QA8A 1SU7A 2Z0NA 4ILGA 4JLCA 2OO2A 1U00A 4IM3A 4R5LA 4H6HA 5KBPA 3T49A 3UITA 4R5JA 3N8EA 2EFLA 4IWOA 3D50A 4EZYA 3C7NB 4R5GA 4B9QA 3CAZA 2WYIA 2O0I1 3B51X 1DKYA 3HAIA 2RAIA 4EZTA 2RAKA 3VKHA 3CKDA 2JNKA 1UPXA 2GAFD 3QWEA 3ER9B 2WYHA 1E1DA 4F00A 4WPEA 3T48A 4IWQA 3KAWA 3EJTA 4JWCA 1OA0A 3BVXA 3PLTA 2YIAA 4AZCB 4IM2A 4D8JA 3BVWA 3I39X 1LQ7A 4JWEA 4HR1A 3SOGA 2YKTA 1ZYLA 4JN4A 3T46A 4H8SA 3CV5A 3DX4A 4HYBA 1DG4A 2F18A 2YI8A 3OWGA 3BUQA 3VEBA 3M3WA 1DKZA 2GA9D 2ND1A 2JNSA 2D1LA 3BUDA 4HY9A 1R33A 1YUWA 4AZ6A 3D2EA 3DPPA 4EZVA 3BVUA 3L3PA 4WV7A 4AZIA 2QXLA 2EX3B 2YIVX 3BVTA 4IM0A 2EFKA 1TQSA 5C5BA 4ILHB 1E2UA 2YI9A 2YL9A 1W9MA 2FYVA 3O3OB 3VEAA 3B52X 4E3CA 2Q12A 3BUIA 3B53X 3HAHA 1GNLA 3ERCC 1YWMA 4AZ7A 3QNIA 3HAJA 2YL5A 2OW6A 4EZXA 4IW0A 2F1AA 3SBSA 4FZSA 2ELBA 3C7NA 3Q84A 1Q5LA 2X5CA 2YIBA 3RPMA 3RV0A 1QWUA 2NCZA 3H0XA 1Y2OA 3OK8A 3O3NB 1JQKA 4MQDA 2ZXQA 3D52A 1QX1A 1SUFA 4FM3A 3D4YA 4F01A 1X04A 3ZEFA 1TQTA 3DOBA 3ER8C 4EZOA 4NSWA 2ND0A 4R5KA 2BPRA 7HSCA 4AZHA 4R5IA 3Q0KA 2YLAA 2F7OA 1I49A 3EJQA 4AZCA 4WV5A 4JL9A 4KIKB 4E81A 1DKXA 4DYLA 3CZNA 1GN9A 1OA1A 4AVMA 4AZGA 3DX3A 2OZNB 3BVVA 1GNTA 3OHXM 3LLLA 1E9VA 1OAOA 2GF4A 1WDZA 3DPOA 4ATMA 2V0OA 1TQVA 4FZOA 3EJUA 3I01A 2F7PA 2LM0A 1HXKA 4FL9A 4NPHA 4UDXX 1URUA 3QNJA 1CKRA 2PMRA 1MJGA 3LVTA 3DDGA 4JWIA 5TKYA 1PS3A 3ABHA 1ZWWA 2X3WA 5E84A 3T4AG 1TQWA 3D51A 3A98A 4M0MA 2OP6A 2LXYA 2Q13A 2OBLA 4NQIA 1HWWA 1I4LA 1R34A 3I04A 3CVRA 2KHOA 1BPRA 4EZUA 2X3VA 3BLBA 2Z0VA 1QWNA 2RAJA 2OW7A 3ACOA 4AKVA 2FICA 4AZ5A 2V7YA 3KAVA 4EZNA 3DQGA 4EZZA 4IWPA 4HR1B 4EZRA 3SYVA 2N3KA 3FD9A 3DX1A 3DPQA 3GI7A 3O3MB 3EJPA 5FIGA 4JNEA 3T47A 1TQUA 3RV1A 3I2WA 4UDYX 3G9GA 2EWFA 4WPCA 3EJSA 1X03A 5FLEX 4BNEA 2F7RA 4H6IA 3BUBA 2MI7A 1R5EA 3EJRA 4I1QA 2Z0OA 4FZPA 1I4DA 2QFFA 4I43A 4JWDA 4JNFA
chains in the Genus database with same CATH topology
3KAWA 3ZEDA 1MJGA 4JWCA 4JWIA 1OA0A 5TKYA 2YIAA 4IM2A 3L3OM 4D8JA 4EZXA 3I39X 4EZSA 4JWEA 4IW0A 1SU6A 4HR1A 3SBSA 4KIKA 2Z8YA 5E84A 4ILIA 3C7NA 3T4AG 1Q5LA 2PY6A 2X5CA 3SBTB 1ZYLA 2YIBA 3KDRA 4JN4A 3T46A 3RV0A 2RT6A 3A98A 4M0MA 4EZPA 2NCZA 3H0XA 2OP6A 4HYBA 1CKRA 1DG4A 2OBLA 3O3NB 2YI8A 3OWGA 1SU8A 2WINM 1JQKA 3LMFA 4MQDA 3I04A 3VEBA 4EZQA 2OBMA 2KHOA 4G6QA 1SUFA 1BPRA 4FM3A 4EZUA 4F01A 3D2FA 4PO2A 3ZEFA 3F7WA 1DKZA 2GA9D 2ND1A 3DOBA 4EZWA 3ER8C 4EZOA 2JNSA 2ND0A 3QA8A 4R5KA 1SU7A 2BPRA 4HY9A 7HSCA 4R5IA 4ILGA 4JLCA 2V7YA 1U00A 3KAVA 4IM3A 4EZNA 1YUWA 3DQGA 4EZZA 4IWPA 4WV5A 4R5LA 4JL9A 1GNLA 3D2EA 4H6HA 4HR1B 3T49A 3UITA 3DPPA 2N3KA 4KIKB 3FD9A 4R5JA 3DPQA 4E81A 4IWOA 4EZRA 3N8EA 4EZVA 1DKXA 4EZYA 3C7NB 1GN9A 1OA1A 4R5GA 4B9QA 4WV7A 3GI7A 2QXLA 2EX3B 3O3MB 1GNTA 2YIVX 3OHXM 3B51X 5FIGA 4JNEA 3T47A 1DKYA 1E9VA 3RV1A 1OAOA 4IM0A 4UDYX 2EWFA 4ILHB 1E2UA 3DPOA 2YI9A 5FLEX 4EZTA 3VKHA 1W9MA 3O3OB 4H6IA 3VEAA 1UPXA 3I01A 2GAFD 3ER9B 2LM0A 4FL9A 1E1DA 3B52X 4NPHA 4UDXX 2QFFA 4F00A 4I43A 4E3CA 4JWDA 3T48A 3QNJA 4JNFA 3B53X 3ERCC 4IWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0X A;  2OP6 A;  4R5K A;  2BPR A;  4HYB A;  1DG4 A;  4HY9 A;  7HSC A;  4R5I A;  4JWC A;  4JWI A;  3DPO A;  5TKY A;  4EZT A;  2V7Y A;  1U00 A;  4EZP A;  1YUW A;  4EZN A;  2WIN M;  3L3O M;  4EZZ A;  4EZX A;  3DQG A;  4WV5 A;  4R5L A;  4EZQ A;  4H6H A;  3D2E A;  4EZS A;  2KHO A;  4JWE A;  3T49 A;  4EZR A;  3DPP A;  4R5J A;  4H6I A;  4E81 A;  1BPR A;  3DPQ A;  4EZU A;  3N8E A;  4EZV A;  4F01 A;  1DKX A;  5E84 A;  4EZY A;  3C7N B;  3D2F A;  4PO2 A;  3C7N A;  3T4A G;  1Q5L A;  4R5G A;  4B9Q A;  4FL9 A;  4WV7 A;  4F00 A;  1DKZ A;  2QFF A;  2QXL A;  4JN4 A;  4JWD A;  3T48 A;  3T46 A;  3OHX M;  3QNJ A;  4JNF A;  4EZW A;  3DOB A;  1CKR A;  4EZO A;  4JNE A;  3T47 A;  1DKY A; 
#chains in the Genus database with same CATH topology
 2X3X A;  2C08 A;  2F1B A;  3DYT A;  3ZED A;  2YL8 A;  4AZB A;  3DX2 A;  1O7D B;  3L3O M;  3D4Z A;  4EZS A;  1SU6 A;  3BUP A;  2YL6 A;  4KIK A;  2Z8Y A;  2QKW A;  4ILI A;  2D4C A;  2PY6 A;  3SBT B;  3KDR A;  2F7Q A;  2RT6 A;  1I4T A;  4EZP A;  5C5B B;  1SU8 A;  2WIN M;  1HTY A;  3LMF A;  1O7D C;  4EZQ A;  2OBM A;  4G6Q A;  3CZS A;  4DCN C;  2ALW A;  3D2F A;  4PO2 A;  2YLL A;  3F7W A;  3DX0 A;  3DDF A;  4EZW A;  3QE6 A;  3QA8 A;  1SU7 A;  2Z0N A;  4ILG A;  4JLC A;  2OO2 A;  1U00 A;  4IM3 A;  4R5L A;  4H6H A;  5KBP A;  3T49 A;  3UIT A;  4R5J A;  3N8E A;  2EFL A;  4IWO A;  3D50 A;  4EZY A;  3C7N B;  4R5G A;  4B9Q A;  3CAZ A;  2WYI A;  2O0I 1;  3B51 X;  1DKY A;  3HAI A;  2RAI A;  4EZT A;  2RAK A;  3VKH A;  3CKD A;  2JNK A;  1UPX A;  2GAF D;  3QWE A;  3ER9 B;  2WYH A;  1E1D A;  4F00 A;  4WPE A;  3T48 A;  4IWQ A;  3KAW A;  3EJT A;  4JWC A;  1OA0 A;  3BVX A;  3PLT A;  2YIA A;  4AZC B;  4IM2 A;  4D8J A;  3BVW A;  3I39 X;  1LQ7 A;  4JWE A;  4HR1 A;  3SOG A;  2YKT A;  1ZYL A;  4JN4 A;  3T46 A;  4H8S A;  3CV5 A;  3DX4 A;  4HYB A;  1DG4 A;  2F18 A;  2YI8 A;  3OWG A;  3BUQ A;  3VEB A;  3M3W A;  1DKZ A;  2GA9 D;  2ND1 A;  2JNS A;  2D1L A;  3BUD A;  4HY9 A;  1R33 A;  1YUW A;  4AZ6 A;  3D2E A;  3DPP A;  4EZV A;  3BVU A;  3L3P A;  4WV7 A;  4AZI A;  2QXL A;  2EX3 B;  2YIV X;  3BVT A;  4IM0 A;  2EFK A;  1TQS A;  5C5B A;  4ILH B;  1E2U A;  2YI9 A;  2YL9 A;  1W9M A;  2FYV A;  3O3O B;  3VEA A;  3B52 X;  4E3C A;  2Q12 A;  3BUI A;  3B53 X;  3HAH A;  1GNL A;  3ERC C;  1YWM A;  4AZ7 A;  3QNI A;  3HAJ A;  2YL5 A;  2OW6 A;  4EZX A;  4IW0 A;  2F1A A;  3SBS A;  4FZS A;  2ELB A;  3C7N A;  3Q84 A;  1Q5L A;  2X5C A;  2YIB A;  3RPM A;  3RV0 A;  1QWU A;  2NCZ A;  3H0X A;  1Y2O A;  3OK8 A;  3O3N B;  1JQK A;  4MQD A;  2ZXQ A;  3D52 A;  1QX1 A;  1SUF A;  4FM3 A;  3D4Y A;  4F01 A;  1X04 A;  3ZEF A;  1TQT A;  3DOB A;  3ER8 C;  4EZO A;  4NSW A;  2ND0 A;  4R5K A;  2BPR A;  7HSC A;  4AZH A;  4R5I A;  3Q0K A;  2YLA A;  2F7O A;  1I49 A;  3EJQ A;  4AZC A;  4WV5 A;  4JL9 A;  4KIK B;  4E81 A;  1DKX A;  4DYL A;  3CZN A;  1GN9 A;  1OA1 A;  4AVM A;  4AZG A;  3DX3 A;  2OZN B;  3BVV A;  1GNT A;  3OHX M;  3LLL A;  1E9V A;  1OAO A;  2GF4 A;  1WDZ A;  3DPO A;  4ATM A;  2V0O A;  1TQV A;  4FZO A;  3EJU A;  3I01 A;  2F7P A;  2LM0 A;  1HXK A;  4FL9 A;  4NPH A;  4UDX X;  1URU A;  3QNJ A;  1CKR A;  2PMR A;  1MJG A;  3LVT A;  3DDG A;  4JWI A;  5TKY A;  1PS3 A;  3ABH A;  1ZWW A;  2X3W A;  5E84 A;  3T4A G;  1TQW A;  3D51 A;  3A98 A;  4M0M A;  2OP6 A;  2LXY A;  2Q13 A;  2OBL A;  4NQI A;  1HWW A;  1I4L A;  1R34 A;  3I04 A;  3CVR A;  2KHO A;  1BPR A;  4EZU A;  2X3V A;  3BLB A;  2Z0V A;  1QWN A;  2RAJ A;  2OW7 A;  3ACO A;  4AKV A;  2FIC A;  4AZ5 A;  2V7Y A;  3KAV A;  4EZN A;  3DQG A;  4EZZ A;  4IWP A;  4HR1 B;  4EZR A;  3SYV A;  2N3K A;  3FD9 A;  3DX1 A;  3DPQ A;  3GI7 A;  3O3M B;  3EJP A;  5FIG A;  4JNE A;  3T47 A;  1TQU A;  3RV1 A;  3I2W A;  4UDY X;  3G9G A;  2EWF A;  4WPC A;  3EJS A;  1X03 A;  5FLE X;  4BNE A;  2F7R A;  4H6I A;  3BUB A;  2MI7 A;  1R5E A;  3EJR A;  4I1Q A;  2Z0O A;  4FZP A;  1I4D A;  2QFF A;  4I43 A;  4JWD A;  4JNF A; 
#chains in the Genus database with same CATH homology
 3KAW A;  3ZED A;  1MJG A;  4JWC A;  4JWI A;  1OA0 A;  5TKY A;  2YIA A;  4IM2 A;  3L3O M;  4D8J A;  4EZX A;  3I39 X;  4EZS A;  4JWE A;  4IW0 A;  1SU6 A;  4HR1 A;  3SBS A;  4KIK A;  2Z8Y A;  5E84 A;  4ILI A;  3C7N A;  3T4A G;  1Q5L A;  2PY6 A;  2X5C A;  3SBT B;  1ZYL A;  2YIB A;  3KDR A;  4JN4 A;  3T46 A;  3RV0 A;  2RT6 A;  3A98 A;  4M0M A;  4EZP A;  2NCZ A;  3H0X A;  2OP6 A;  4HYB A;  1CKR A;  1DG4 A;  2OBL A;  3O3N B;  2YI8 A;  3OWG A;  1SU8 A;  2WIN M;  1JQK A;  3LMF A;  4MQD A;  3I04 A;  3VEB A;  4EZQ A;  2OBM A;  2KHO A;  4G6Q A;  1SUF A;  1BPR A;  4FM3 A;  4EZU A;  4F01 A;  3D2F A;  4PO2 A;  3ZEF A;  3F7W A;  1DKZ A;  2GA9 D;  2ND1 A;  3DOB A;  4EZW A;  3ER8 C;  4EZO A;  2JNS A;  2ND0 A;  3QA8 A;  4R5K A;  1SU7 A;  2BPR A;  4HY9 A;  7HSC A;  4R5I A;  4ILG A;  4JLC A;  2V7Y A;  1U00 A;  3KAV A;  4IM3 A;  4EZN A;  1YUW A;  3DQG A;  4EZZ A;  4IWP A;  4WV5 A;  4R5L A;  4JL9 A;  1GNL A;  3D2E A;  4H6H A;  4HR1 B;  3T49 A;  3UIT A;  3DPP A;  2N3K A;  4KIK B;  3FD9 A;  4R5J A;  3DPQ A;  4E81 A;  4IWO A;  4EZR A;  3N8E A;  4EZV A;  1DKX A;  4EZY A;  3C7N B;  1GN9 A;  1OA1 A;  4R5G A;  4B9Q A;  4WV7 A;  3GI7 A;  2QXL A;  2EX3 B;  3O3M B;  1GNT A;  2YIV X;  3OHX M;  3B51 X;  5FIG A;  4JNE A;  3T47 A;  1DKY A;  1E9V A;  3RV1 A;  1OAO A;  4IM0 A;  4UDY X;  2EWF A;  4ILH B;  1E2U A;  3DPO A;  2YI9 A;  5FLE X;  4EZT A;  3VKH A;  1W9M A;  3O3O B;  4H6I A;  3VEA A;  1UPX A;  3I01 A;  2GAF D;  3ER9 B;  2LM0 A;  4FL9 A;  1E1D A;  3B52 X;  4NPH A;  4UDX X;  2QFF A;  4F00 A;  4I43 A;  4E3C A;  4JWD A;  3T48 A;  3QNJ A;  4JNF A;  3B53 X;  3ERC C;  4IWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...