4R5IA

Crystal structure of the dnak c-terminus with the substrate peptide nrllltg
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
222
structure length
222
Chain Sequence
HIEGRVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Basis for the Inhibition of HSP70 and DnaK Chaperones by Small-Molecule Targeting of a C-Terminal Allosteric Pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 70
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4r5iA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4r5iA01
3OHXM 3T4AG 4JWCA 4E81A 3DPOA 3C7NA 4JWIA 4H6IA 5TKYA 4EZVA 4EZXA 1YUWA 4WV5A 3DPQA 4HY9A 3N8EA 2QXLA 1DKZA 4JN4A 4WV7A 3T49A 5E84A 4H6HA 4EZZA 2QFFA 3L3OM 4R5IA 2WINM 4EZUA 4JWDA 1CKRA 4EZTA 4R5KA 1DG4A 4B9QA 4EZOA 3T46A 3T48A 4EZYA 4EZSA 1Q5LA 4R5GA 2V7YA 3QNJA 4FL9A 4EZPA 4JNFA 2BPRA 3DPPA 4HYBA 4JNEA 4JWEA 1BPRA 3DQGA 3T47A 2KHOA 4R5JA 4EZWA 4EZQA 3DOBA 3H0XA 4EZNA 1DKXA 3D2EA 4R5LA 4F00A 4PO2A 1DKYA 4EZRA 1U00A 3D2FA 4F01A 2OP6A 7HSCA 3C7NB
chains in the Genus database with same CATH superfamily
3L3PA 4H6IA 3B52X 4AZIA 4M0MA 1OA0A 3DPQA 3LLLA 5E84A 3BUDA 4DCNC 4JL9A 2GA9D 3ER9B 3DX4A 4AVMA 4EZYA 3CVRA 4JNFA 3SYVA 1MJGA 1SU8A 1HTYA 4NSWA 4PO2A 2WYIA 3C7NB 3T4AG 2YLAA 3HAIA 2F7RA 2F18A 4IM2A 2RAJA 1UPXA 4EZTA 1JQKA 3FD9A 1TQSA 3CZSA 4FZOA 4ILGA 4EZWA 2KHOA 1TQUA 1I4LA 1LQ7A 3BVUA 3VKHA 2OO2A 4I1QA 4JLCA 2YLLA 1DKZA 3D52A 3F7WA 3L3OM 1TQVA 3T48A 3D4YA 2X5CA 3QWEA 4FL9A 3QNJA 3SOGA 4JWEA 2Z0OA 4FZPA 4IWOA 3Q84A 1QWNA 5FIGA 1GNTA 1YUWA 1Y2OA 3PLTA 4EZZA 1R5EA 3D4ZA 4BNEA 3RPMA 3BUPA 1Q5LA 3ABHA 4AZGA 3DQGA 1OA1A 1E1DA 3DX3A 5FLEX 1I49A 2F1AA 1PS3A 4AZ6A 3BUQA 2ELBA 4H6HA 3QNIA 2EFKA 3UITA 3EJPA 4ATMA 4IWPA 2Z0NA 3DPOA 1ZYLA 2OZNB 3D50A 3A98A 1TQTA 4EZUA 2MI7A 2EWFA 3EJUA 1HXKA 2ND1A 4IM0A 2Z0VA 3LVTA 2OW7A 3DPPA 2GAFD 3I01A 3T47A 3BVWA 4AKVA 4R5LA 4F01A 2V0OA 3C7NA 1R34A 4WPCA 2F7OA 1I4TA 4R5GA 3ACOA 4R5JA 3D2FA 4UDYX 2Q13A 1X03A 1O7DB 3B51X 1GN9A 2F7QA 4R5IA 3OWGA 4EZOA 2V7YA 2JNKA 4AZ7A 4JNEA 1QWUA 3DOBA 2F1BA 2X3XA 3D2EA 1ZWWA 2OBLA 4E81A 4JWIA 2YL6A 3BVXA 3HAJA 4WV5A 3T49A 3DX0A 3I2WA 3DX1A 4KIKB 3T46A 1URUA 2X3VA 2F7PA 3CAZA 1DKXA 4ILHB 1TQWA 4EZVA 4WPEA 1O7DC 4NQIA 4AZ5A 4AZCB 2YIBA 1SUFA 3I39X 3I04A 3KDRA 2O0I1 4H8SA 2YIVX 1DG4A 3B53X 3KAWA 4DYLA 4HR1B 4FM3A 2D4CA 2LM0A 4HR1A 1E9VA 4G6QA 2YL5A 3M3WA 4EZNA 4D8JA 2OP6A 4FZSA 4EZXA 3EJTA 4IM3A 4E3CA 3CKDA 5C5BB 1SU6A 5C5BA 4MQDA 5KBPA 2WYHA 2WINM 3KAVA 2PMRA 2NCZA 2D1LA 1GNLA 3LMFA 1YWMA 3EJSA 2N3KA 3DYTA 5TKYA 1R33A 2C08A 3ZEFA 3N8EA 3BVTA 3O3NB 3O3OB 3VEBA 2LXYA 2FICA 3D51A 4UDXX 1BPRA 3CV5A 1QX1A 7HSCA 2X3WA 4I43A 3RV0A 1WDZA 1X04A 2OBMA 4HY9A 2QFFA 2EFLA 2Z8YA 2RAKA 4AZBA 2RT6A 1CKRA 3G9GA 4B9QA 3ZEDA 1W9MA 1OAOA 3GI7A 1HWWA 3CZNA 3EJRA 2GF4A 4EZRA 3OK8A 2YL9A 3HAHA 3QE6A 2JNSA 2QXLA 3QA8A 3DX2A 1SU7A 2EX3B 3DDGA 4R5KA 3ERCC 3RV1A 2QKWA 4AZHA 4KIKA 4EZPA 2BPRA 3SBSA 4HYBA 2FYVA 2YL8A 4F00A 2OW6A 3OHXM 4IWQA 2PY6A 4ILIA 4WV7A 2YI8A 4AZCA 3EJQA 3Q0KA 4JWDA 2ALWA 3BUIA 4EZQA 3ER8C 1DKYA 3BLBA 4JWCA 3SBTB 2ND0A 4IW0A 2Q12A 2YKTA 3BUBA 4JN4A 1E2UA 2ZXQA 3VEAA 4EZSA 3BVVA 2YIAA 1I4DA 2YI9A 3H0XA 3DDFA 3O3MB 4NPHA 1U00A 2RAIA
chains in the Genus database with same CATH topology
4E81A 4JWIA 4H6IA 2OBMA 3B52X 4WV5A 4M0MA 1OA0A 3DPQA 4HY9A 3T49A 5E84A 4H6HA 2QFFA 2Z8YA 2RT6A 3UITA 1CKRA 4JL9A 2GA9D 3ER9B 4KIKB 4B9QA 3T46A 4EZYA 3ZEDA 1W9MA 4JNFA 1OAOA 3GI7A 1MJGA 1SU8A 4PO2A 1DKXA 4EZRA 3C7NB 4IWPA 4ILHB 3T4AG 3DPOA 1ZYLA 4EZVA 3A98A 2JNSA 2QXLA 3QA8A 4IM2A 2YIBA 1SUFA 1SU7A 3I39X 3I04A 3KDRA 1UPXA 2EX3B 4EZUA 2YIVX 4EZTA 4R5KA 1DG4A 1JQKA 3B53X 3ERCC 3RV1A 3KAWA 2EWFA 4KIKA 4EZPA 3FD9A 2ND1A 4FM3A 4HR1B 4IM0A 2BPRA 3SBSA 2LM0A 4HR1A 3DPPA 2GAFD 4HYBA 1E9VA 3I01A 3T47A 2KHOA 4G6QA 4EZWA 4ILGA 4EZNA 4R5LA 4F00A 4D8JA 2OP6A 4F01A 3OHXM 4IWQA 3VKHA 2PY6A 4JLCA 3C7NA 4EZXA 4IM3A 4E3CA 1DKZA 4ILIA 4WV7A 1SU6A 3F7WA 2YI8A 3L3OM 4MQDA 2WINM 4JWDA 3KAVA 3T48A 4FL9A 2X5CA 4R5GA 3QNJA 2NCZA 4JWEA 4R5JA 4EZQA 1GNLA 3ER8C 3LMFA 1DKYA 3D2FA 4IWOA 4UDYX 2N3KA 4JWCA 2ND0A 3SBTB 5FIGA 4IW0A 5TKYA 1GNTA 1YUWA 3ZEFA 3B51X 3N8EA 4JN4A 1E2UA 1GN9A 4EZZA 3O3NB 3O3OB 4R5IA 3VEBA 3OWGA 3VEAA 4EZSA 4EZOA 1Q5LA 2V7YA 4UDXX 2YIAA 4JNEA 2YI9A 1BPRA 3DQGA 1OA1A 3H0XA 1E1DA 3DOBA 3O3MB 3D2EA 5FLEX 4NPHA 7HSCA 4I43A 1U00A 2OBLA 3RV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHX M;  3T4A G;  4JWC A;  4E81 A;  3DPO A;  3C7N A;  4JWI A;  4H6I A;  5TKY A;  4EZV A;  4EZX A;  1YUW A;  4WV5 A;  3DPQ A;  4HY9 A;  3N8E A;  2QXL A;  1DKZ A;  4JN4 A;  4WV7 A;  3T49 A;  5E84 A;  4H6H A;  4EZZ A;  2QFF A;  3L3O M;  4R5I A;  2WIN M;  4EZU A;  4JWD A;  1CKR A;  4EZT A;  4R5K A;  1DG4 A;  4B9Q A;  4EZO A;  3T46 A;  3T48 A;  4EZY A;  4EZS A;  1Q5L A;  4R5G A;  2V7Y A;  3QNJ A;  4FL9 A;  4EZP A;  4JNF A;  2BPR A;  3DPP A;  4HYB A;  4JNE A;  4JWE A;  1BPR A;  3DQG A;  3T47 A;  2KHO A;  4R5J A;  4EZW A;  4EZQ A;  3DOB A;  3H0X A;  4EZN A;  1DKX A;  3D2E A;  4R5L A;  4F00 A;  4PO2 A;  1DKY A;  4EZR A;  1U00 A;  3D2F A;  4F01 A;  2OP6 A;  7HSC A;  3C7N B; 
#chains in the Genus database with same CATH topology
 3L3P A;  4H6I A;  3B52 X;  4AZI A;  4M0M A;  1OA0 A;  3DPQ A;  3LLL A;  5E84 A;  3BUD A;  4DCN C;  4JL9 A;  2GA9 D;  3ER9 B;  3DX4 A;  4AVM A;  4EZY A;  3CVR A;  4JNF A;  3SYV A;  1MJG A;  1SU8 A;  1HTY A;  4NSW A;  4PO2 A;  2WYI A;  3C7N B;  3T4A G;  2YLA A;  3HAI A;  2F7R A;  2F18 A;  4IM2 A;  2RAJ A;  1UPX A;  4EZT A;  1JQK A;  3FD9 A;  1TQS A;  3CZS A;  4FZO A;  4ILG A;  4EZW A;  2KHO A;  1TQU A;  1I4L A;  1LQ7 A;  3BVU A;  3VKH A;  2OO2 A;  4I1Q A;  4JLC A;  2YLL A;  1DKZ A;  3D52 A;  3F7W A;  3L3O M;  1TQV A;  3T48 A;  3D4Y A;  2X5C A;  3QWE A;  4FL9 A;  3QNJ A;  3SOG A;  4JWE A;  2Z0O A;  4FZP A;  4IWO A;  3Q84 A;  1QWN A;  5FIG A;  1GNT A;  1YUW A;  1Y2O A;  3PLT A;  4EZZ A;  1R5E A;  3D4Z A;  4BNE A;  3RPM A;  3BUP A;  1Q5L A;  3ABH A;  4AZG A;  3DQG A;  1OA1 A;  1E1D A;  3DX3 A;  5FLE X;  1I49 A;  2F1A A;  1PS3 A;  4AZ6 A;  3BUQ A;  2ELB A;  4H6H A;  3QNI A;  2EFK A;  3UIT A;  3EJP A;  4ATM A;  4IWP A;  2Z0N A;  3DPO A;  1ZYL A;  2OZN B;  3D50 A;  3A98 A;  1TQT A;  4EZU A;  2MI7 A;  2EWF A;  3EJU A;  1HXK A;  2ND1 A;  4IM0 A;  2Z0V A;  3LVT A;  2OW7 A;  3DPP A;  2GAF D;  3I01 A;  3T47 A;  3BVW A;  4AKV A;  4R5L A;  4F01 A;  2V0O A;  3C7N A;  1R34 A;  4WPC A;  2F7O A;  1I4T A;  4R5G A;  3ACO A;  4R5J A;  3D2F A;  4UDY X;  2Q13 A;  1X03 A;  1O7D B;  3B51 X;  1GN9 A;  2F7Q A;  4R5I A;  3OWG A;  4EZO A;  2V7Y A;  2JNK A;  4AZ7 A;  4JNE A;  1QWU A;  3DOB A;  2F1B A;  2X3X A;  3D2E A;  1ZWW A;  2OBL A;  4E81 A;  4JWI A;  2YL6 A;  3BVX A;  3HAJ A;  4WV5 A;  3T49 A;  3DX0 A;  3I2W A;  3DX1 A;  4KIK B;  3T46 A;  1URU A;  2X3V A;  2F7P A;  3CAZ A;  1DKX A;  4ILH B;  1TQW A;  4EZV A;  4WPE A;  1O7D C;  4NQI A;  4AZ5 A;  4AZC B;  2YIB A;  1SUF A;  3I39 X;  3I04 A;  3KDR A;  2O0I 1;  4H8S A;  2YIV X;  1DG4 A;  3B53 X;  3KAW A;  4DYL A;  4HR1 B;  4FM3 A;  2D4C A;  2LM0 A;  4HR1 A;  1E9V A;  4G6Q A;  2YL5 A;  3M3W A;  4EZN A;  4D8J A;  2OP6 A;  4FZS A;  4EZX A;  3EJT A;  4IM3 A;  4E3C A;  3CKD A;  5C5B B;  1SU6 A;  5C5B A;  4MQD A;  5KBP A;  2WYH A;  2WIN M;  3KAV A;  2PMR A;  2NCZ A;  2D1L A;  1GNL A;  3LMF A;  1YWM A;  3EJS A;  2N3K A;  3DYT A;  5TKY A;  1R33 A;  2C08 A;  3ZEF A;  3N8E A;  3BVT A;  3O3N B;  3O3O B;  3VEB A;  2LXY A;  2FIC A;  3D51 A;  4UDX X;  1BPR A;  3CV5 A;  1QX1 A;  7HSC A;  2X3W A;  4I43 A;  3RV0 A;  1WDZ A;  1X04 A;  2OBM A;  4HY9 A;  2QFF A;  2EFL A;  2Z8Y A;  2RAK A;  4AZB A;  2RT6 A;  1CKR A;  3G9G A;  4B9Q A;  3ZED A;  1W9M A;  1OAO A;  3GI7 A;  1HWW A;  3CZN A;  3EJR A;  2GF4 A;  4EZR A;  3OK8 A;  2YL9 A;  3HAH A;  3QE6 A;  2JNS A;  2QXL A;  3QA8 A;  3DX2 A;  1SU7 A;  2EX3 B;  3DDG A;  4R5K A;  3ERC C;  3RV1 A;  2QKW A;  4AZH A;  4KIK A;  4EZP A;  2BPR A;  3SBS A;  4HYB A;  2FYV A;  2YL8 A;  4F00 A;  2OW6 A;  3OHX M;  4IWQ A;  2PY6 A;  4ILI A;  4WV7 A;  2YI8 A;  4AZC A;  3EJQ A;  3Q0K A;  4JWD A;  2ALW A;  3BUI A;  4EZQ A;  3ER8 C;  1DKY A;  3BLB A;  4JWC A;  3SBT B;  2ND0 A;  4IW0 A;  2Q12 A;  2YKT A;  3BUB A;  4JN4 A;  1E2U A;  2ZXQ A;  3VEA A;  4EZS A;  3BVV A;  2YIA A;  1I4D A;  2YI9 A;  3H0X A;  3DDF A;  3O3M B;  4NPH A;  1U00 A;  2RAI A; 
#chains in the Genus database with same CATH homology
 4E81 A;  4JWI A;  4H6I A;  2OBM A;  3B52 X;  4WV5 A;  4M0M A;  1OA0 A;  3DPQ A;  4HY9 A;  3T49 A;  5E84 A;  4H6H A;  2QFF A;  2Z8Y A;  2RT6 A;  3UIT A;  1CKR A;  4JL9 A;  2GA9 D;  3ER9 B;  4KIK B;  4B9Q A;  3T46 A;  4EZY A;  3ZED A;  1W9M A;  4JNF A;  1OAO A;  3GI7 A;  1MJG A;  1SU8 A;  4PO2 A;  1DKX A;  4EZR A;  3C7N B;  4IWP A;  4ILH B;  3T4A G;  3DPO A;  1ZYL A;  4EZV A;  3A98 A;  2JNS A;  2QXL A;  3QA8 A;  4IM2 A;  2YIB A;  1SUF A;  1SU7 A;  3I39 X;  3I04 A;  3KDR A;  1UPX A;  2EX3 B;  4EZU A;  2YIV X;  4EZT A;  4R5K A;  1DG4 A;  1JQK A;  3B53 X;  3ERC C;  3RV1 A;  3KAW A;  2EWF A;  4KIK A;  4EZP A;  3FD9 A;  2ND1 A;  4FM3 A;  4HR1 B;  4IM0 A;  2BPR A;  3SBS A;  2LM0 A;  4HR1 A;  3DPP A;  2GAF D;  4HYB A;  1E9V A;  3I01 A;  3T47 A;  2KHO A;  4G6Q A;  4EZW A;  4ILG A;  4EZN A;  4R5L A;  4F00 A;  4D8J A;  2OP6 A;  4F01 A;  3OHX M;  4IWQ A;  3VKH A;  2PY6 A;  4JLC A;  3C7N A;  4EZX A;  4IM3 A;  4E3C A;  1DKZ A;  4ILI A;  4WV7 A;  1SU6 A;  3F7W A;  2YI8 A;  3L3O M;  4MQD A;  2WIN M;  4JWD A;  3KAV A;  3T48 A;  4FL9 A;  2X5C A;  4R5G A;  3QNJ A;  2NCZ A;  4JWE A;  4R5J A;  4EZQ A;  1GNL A;  3ER8 C;  3LMF A;  1DKY A;  3D2F A;  4IWO A;  4UDY X;  2N3K A;  4JWC A;  2ND0 A;  3SBT B;  5FIG A;  4IW0 A;  5TKY A;  1GNT A;  1YUW A;  3ZEF A;  3B51 X;  3N8E A;  4JN4 A;  1E2U A;  1GN9 A;  4EZZ A;  3O3N B;  3O3O B;  4R5I A;  3VEB A;  3OWG A;  3VEA A;  4EZS A;  4EZO A;  1Q5L A;  2V7Y A;  4UDX X;  2YIA A;  4JNE A;  2YI9 A;  1BPR A;  3DQG A;  1OA1 A;  3H0X A;  1E1D A;  3DOB A;  3O3M B;  3D2E A;  5FLE X;  4NPH A;  7HSC A;  4I43 A;  1U00 A;  2OBL A;  3RV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...