4R5YA

The complex structure of braf v600e kinase domain with a novel braf inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
272
structure length
253
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title BGB-283, a Novel RAF Kinase and EGFR Inhibitor, Displays Potent Antitumor Activity in BRAF-Mutated Colorectal Cancers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 74
structure length 253
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4r5yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r5yA01
2CCIA 5EH0A 2IW9A 5IKWA 4X3FA 3VUKA 3I6WA 5IA5A 2ZVAA 4MF0A 4X3FB 3P86A 4CFMA 4S31A 5LMBA 5ICPA 3LIJA 1WBVA 3B8RA 3R8ZA 3VRZA 3UYTA 1UV5A 4BCOA 2GPHA 4GV1A 1G3NA 3MY1A 4X6QC 4YJOA 2R7BA 3C0HA 3UNZA 3IW5A 4FK6A 2XJ1A 3H9OA 4GS6A 4ITIA 4FT0A 3VIDA 3QRTA 4I20A 4HVSA 2UZBA 3E64A 4OGRA 4JRNA 5CS6A 1E1VA 2ZDTA 4ZZNA 3CIKA 4Z16A 3FMKA 2DWBA 3V04A 4EK5A 4IW0A 4KAOA 3R9DA 3PXQA 1A48A 3EFJA 4OTFA 2XNEA 3VBTA 1UWHA 3R8VA 3U6JA 1IAJA 4NIFA 3BEGA 4MXAA 4GT3A 5FP5A 4O7NA 1H24A 3TACA 1H0VA 4MVFA 3UNJA 3LMHA 2OBJA 3RKBA 3IO7A 5HBJA 2FSMX 1YI6A 1F3MC 3Q9ZA 4ZTHA 4FUYA 2VRXA 4J95A 4JT3A 1YWRA 3D83A 3TM0A 3MFTA 4BI1A 2WB8A 3QTUA 4R5SA 3JR1A 3PG1A 4XBRA 2GQSA 3M2WA 4XG7A 5D10A 3F5GA 4PL3A 2KULA 3BHTA 4KSPA 1IG1A 4J7BA 1KUTA 2CGVA 1ZY4A 3QX2A 5TE0A 3G0FA 3R8PA 5BVFA 2ETMA 3L8SA 4RX9A 1F5QA 4YJPA 4JXFA 5I9UA 2P2HA 4DAWA 4AW1A 5A4CA 4JBQA 1J1CA 4MNEA 4LFIA 4JBPA 3QL8A 3LW0A 4F08A 3Q3BA 3R1NA 4M0ZA 5CU2A 3FSFA 3NNWA 4FTOA 3TKIA 2X8DA 4TXCA 3CCNA 5EW8A 4BCMA 4TYIA 3F5PA 2X8EA 2JC6A 4U3YA 4DT9A 2J0LA 3CBLA 4HJOA 5E7RA 5AFVA 4FTUA 2JKMA 3C5IA 1EH4A 4V0GB 4DFBA 2XA4A 3QQGA 4RBLA 5M07A 5IDPA 5GJDA 2G2FA 2W05A 2X81A 4A4LA 4WNPA 3W2RA 3WOWA 2OLCA 2E9VA 1Q4LA 2CSNA 2WEIA 3AD4A 4G9CA 3UPXA 1XO2B 3KXNA 2YIWA 3OEFX 4II5A 1H00A 3KRWA 3LCTA 4JR3A 3KF7A 5A4EA 5M08A 5BYZA 1OI9A 1U59A 2XK6A 3HGKA 4IADA 4RVKA 4AOJA 1FQ1B 3R1SA 3IPHA 3EZRA 4FR4A 4WA9A 1GY3A 3IW7A 2GQGA 3RNYA 3ATSA 5IH4A 3BZ3A 3GFWA 3UP2A 4FKOA 5CVFA 4NW5A 2OH4A 3BGPA 4QYFA 3AD5A 4XG2A 3BV2A 4P2KA 3KMMA 4IMYA 3R8MA 5DYJA 2Q0BA 2P2IA 3PPZA 4FNXA 4C4GA 3ZLYA 3WF7A 2XVDA 1O6KA 2HY0A 2V55A 2W96B 2PMLX 4GUEA 4IQ6A 5TT7A 4CYJA 2QNJA 4QQTA 2NP8A 3EQFA 3NIZA 3QLGA 4DFYA 1DAYA 1PJKA 4C2VA 3DBCA 3DFCB 1CMKE 4Z9LA 2J51A 1U5QA 4PPAA 2IZRA 1VJYA 4QP6A 3PG3A 4ZXTA 3BBTB 5HEZA 3OUKA 4UMRA 1Y8GA 2PVMA 5HTIA 3KFAA 5CSWA 4FZ7A 3VVHA 2O2UA 2PZRA 5JQ8A 1B6CB 2R3HA 3GCVA 5HGIA 4EZ5A 2IWIA 1FINA 3MSSA 3O8UA 4LQMA 5DOSA 1BYGA 4FODA 3VC4A 3V5PA 2XEZA 4YJQA 5C01A 4F65A 5BNJA 2WQBA 1H1SA 5A3XA 2ZB0A 2XUUA 3QD3A 4WNKA 3UIBA 5AV4A 4I21A 3HMNA 4F0FA 4O0RA 4IM3A 5HTCA 2HY81 3F2NA 2VTJA 4YJRA 2C6EA 4BZOA 1XQZA 4B4LA 4YLLA 4HVDA 1WMKA 4AA0A 4BWKA 4FTIA 3AQVA 4PTEA 1Q3DA 3NR9A 3W10A 3R7UA 5LMKC 3CY2A 3EQCA 3G5DA 3O71A 5CF5A 1W7HA 5FWKK 5CU0A 3ODYX 4RC4A 5C9CA 2XM9A 3AT3A 3HRBA 3RAWA 3QTSA 4M69B 4O0YA 1OB3A 4FL1A 4UYNA 5LCJA 1OKYA 4IFGA 4BYJA 3RWQA 1ERKA 2HYYA 3MFUA 4R7HA 4ANSA 1S9JA 3M1SA 2WGJA 3ZO2A 3SG8A 3CEKA 3ETAA 1WBOA 2OJFE 3ZO3A 3F61A 5JFVA 2Z7SA 4AN9A 4QMPA 4FG8A 3NW5A 4O22A 4FKWA 5CNNA 5JFXA 3P5KA 3HP5A 3FI8A 3DBQA 2FYSA 2WMWA 3DXQA 3CSVA 5GIOE 3BRBA 1K9AA 4OUCA 1M14A 2OIQA 1VYZA 2OW3A 4MXXA 2C5NA 5DI1A 5T6KA 3TCPA 2OU7A 5L4QA 4XX9A 2YIXA 4GKHA 2GTMA 1OKVA 3LPBA 2RF9A 4IHPA 1R0EA 4MEDA 5JKGA 4YHFA 5DR9A 3S1HA 4KA3A 1WBWA 3H10A 4R6VA 4IZ5A 5L2WA 4F4PA 1BL6A 2CGUA 3IK3A 5BUJA 3OW4A 3U87A 2YAAA 5J1VA 4F9CA 4QMWA 3BV3A 3NRMA 3VULA 4FIEA 3OT8A 5FP6A 2F7ZE 3NPCA 3NUYA 1OPLA 3GXLA 4BC6A 1Y6AA 3Q4ZA 3PSBA 4MXZA 2JFLA 2R0IA 3I4BA 4YJTA 2LAVA 3R1QA 3R83A 1Q8TA 3GC9A 3QGWA 3P79A 5J8IA 5M56A 3GI3A 2LGCA 4M84A 3UVRA 4H58A 3POZA 1P4FA 5HX8A 4QD6A 4M3QA 4DEHA 1YI3A 3KMWA 4AW2A 2JEDA 2ITPA 3S0OA 3OWJA 2XBJA 3MB6A 4V04A 4YSMA 4BDIA 2YM5A 3FBVA 5E8XA 4C35A 4C02A 2PVHA 5TF9A 2GNFA 4DGMA 2QKRA 4LOPA 2VGOA 2W5HA 3FQSA 5D7AA 4Y83A 4BCGA 2PUIA 3IW8A 2C0TA 3G15A 3W33A 4PL5A 4I94A 4DH5A 4RWIA 4ASDA 5KO1A 3R21A 1J7IA 2XIXA 4HPTE 5C03A 3R00A 2UUEA 4CMOA 1ZMVA 4EQCA 4NFNA 3U8WA 2W1CA 3NZ0A 2DUVA 1M7QA 5C4LA 3QKKA 4DEDA 3ZDUA 2ZB1A 3E62A 4EH8A 3A7HA 3OWKA 3R2BA 4FSUA 3PA4A 3BELA 5ETAA 2BRHA 3SD0A 3ZO4A 4L3LA 5ANGA 1JKTA 2VTPA 4YP8A 3W2SA 3SOCA 4JDJA 2NRUA 4G2FA 2A4LA 2AUHA 3QCQA 4YTIA 4O91A 1BL7A 5I3RA 2F2UA 4N6YA 3TG1A 3UOHA 3PJ3A 3IQ7A 3IECA 1M2RA 2EWAA 4QP4A 5IQCA 4DLIA 4IANA 4LG4A 5KNJA 5HQ0A 5HHWA 5E92A 3UZTA 2XCKA 3VUMA 4RJ7A 5AR2A 3WE4A 4FICA 3RAKA 3D5VA 4BDDA 4AT5A 1YOLA 2VTRA 3UIXA 3UG1A 4DFZE 3UPZA 5JFSA 4F6SA 3S4QA 4GVAA 5AUZA 2ZV7A 2OWBA 4USFA 2YIYA 4I5MA 4U8ZA 2B52A 2IN6A 5EYKA 4B8LA 4DTBA 4HNIA 3WIKA 2Z60A 3UG2A 3ZMMA 4GIIA 5DEYA 5IQAA 1PRYA 1G8SA 3E3PA 3KRLA 2CKEA 3RP9A 4E8AA 5F1ZA 5JSMA 4HCVA 1JWHA 1O9UA 4FKUA 3OT3A 1YI4A 3DAKA 4N4SA 1TQPA 2AC5A 3PTGA 4P5ZA 2OXYA 2VX3A 5I3OA 4R1VA 4M8TA 4QMXA 4W4VA 4EKKA 3ZBXA 5HG7A 3UGCA 3AOXA 3QU0A 3W2OA 2QURA 1BX6A 4IM0A 4OTQA 3TNIA 2DS1A 1JPAA 2NPQA 4RIXB 4FL2A 1ZOEA 4O0WA 3PVUA 1H1QA 3NUUA 4ITHA 4O27B 4QTAA 5KMMA 4YZNA 5J87A 3QRJA 4J1RA 4L6QA 3V5JA 5F9EA 4S33A 4C4IA 3LCOA 4U9AA 4FTKA 3FMNA 5C8MA 3VUTA 1JBPE 3LOKA 3R02A 4YO4A 3QALE 3RTPA 3LCKA 3WE8A 4E6AA 4F0IA 4FBXA 4KKGA 1FVVA 3QUDA 2VO7A 4PQNA 3D0EA 4GK2A 3SDJA 2QHMA 2WELA 2PMIA 2VWXA 2DYLA 2BMCA 2V5QA 3U54A 1DAWA 3TZ7A 2UZNA 4YC6A 3MN3A 4BDGA 4R3PA 5CSXA 1ZXEA 4FE2A 1QPJA 4KIPA 2UW3A 4E4XA 4DGNA 2BDJA 3F5UA 3RM6A 4G3FA 3IDPA 1O6YA 3FHIA 4LUEA 4FG7A 2OF4A 4JX3A 2ZM4A 1PYEA 2I0HA 5E8VA 4PV0A 3L1SA 4U79A 5HE1A 4EOIA 2B9JA 3CQEA 2ONLA 4FKJA 2FSTX 3FAAA 3KXXA 4RX8A 5JGBA 1JSTA 4XRLA 3R9OA 3LFSA 2BKZA 4AT4A 3UOLA 5KMIA 3SHEA 3CXWA 3PP1A 4JDIA 5AM7A 2YM3A 4IIRA 3JVSA 2VWZA 3M11A 3VN9A 3MJ1A 4ZTNA 4F70A 2YCRA 3NUPA 4M97A 2YLEA 2HWOA 4EOPA 4UYAA 3ZLWA 3OROA 2YWVA 4H3BA 2XJ2A 5EHLA 4RVTA 2X4FA 3ZDIA 4NFMA 1FOTA 2GHLA 2YM8A 5JGAA 4IJPA 4J53A 3HMIA 2ITZA 4FV1A 4C4EA 3AGMA 4ZY4A 4ZS4A 4NEUA 4RJ6A 3CD3A 4KBCA 4A4OA 3MH3A 3CGOA 2C1AA 4XOZA 4MWHA 3NUNA 3WYYA 3NLBA 3FKNA 3PXZA 3CTQA 4AGCA 3ZSIA 1PXIA 3AC8A 5AAEA 4C61A 3Q9WA 3A8XA 3MA3A 4UMQA 5HCZA 4BICA 2WQOA 4IFCA 3MBLA 2X7GA 3OWPA 3JYAA 4U7ZA 4FKVA 3QC9A 3FMEA 5LVNA 5M09A 4RC2A 4MBIA 3Q6UA 4X7QA 4IAAA 1K3AA 1OIRA 4CT1A 4EJNA 4O86A 5M44A 4TKSA 2JKQA 3UOJA 5IMEA 1GZNA 3NMUF 4L7SA 2ZV9A 4JL9A 3TJCA 3TKUA 3UO6A 1SNUA 1UNLA 3ZRKA 3MI9A 4XV2A 4DFXE 2GFCA 5KMNA 1ZZ2A 4CRLA 3AT2A 3AXWA 1CKJA 2Z7LA 3CD8A 3BBWA 4OW8A 4QP9A 4U3ZA 4H39A 4G3GA 5E90A 3BKBA 5AEPA 5CAQA 4XS2A 1Q97A 2H96A 2ERKA 5EI8A 4LGGA 4L42A 3V6RA 3ORXA 3C4CA 2P3GX 5CAUA 4TRLA 2WU7A 5JZJA 4J96A 1DM2A 3A7JA 4X2FA 4D1SA 3EL8A 4O81A 4WBBB 3T3VA 4YZBA 1GOLA 4WUNA 3P23A 2I0VA 2EU9A 3KB7A 4D5HA 1I09A 5BMMA 4I22A 4C2WA 5A6NA 2HW6A 1WVWA 5TKDA 2EXMA 4GFMA 4XH6A 4ZY6A 2ACXA 3BPRA 3A60A 3KMUA 1FBNA 5JK3A 2VTNA 3I79A 3KULB 4I0RA 1OZ1A 3EQDA 1V0BA 2WTKB 2HZ4A 4WKQA 4DLJA 1DS5A 2X7FA 2ITTA 3DK6A 4JG7A 4M68A 4PNIA 5EM8A 3ZLSA 5L8KA 1PMVA 4FIFA 1GZ8A 3PWYA 2VWBA 5E9EA 3QTXA 5AR4A 4JS8A 3R7EA 3U4WA 3EJ1A 4U97A 3NUXA 4EBWA 1R39A 4K33A 2GS6A 4QMLA 4APCA 5EQYA 5D7VA 2JAMA 3ZO1A 4EEVA 2BAJA 4PMSA 2PYWA 2I0EA 2CN5A 1PKGA 5AMNA 2EB3A 3W2CA 2QOLA 2WMAA 4A9RA 2XK4A 3KL8A 2WZJA 1P2AA 3MDYA 4F09A 5EG3A 4NT4A 3HV6A 4NH1A 5ITAA 5IDNA 4X6RA 4QMTA 4MYGA 4ZSEA 2YM4A 4NCTC 3RAIA 4WD5A 4XLIA 4IM2A 4HVHA 3F2RA 4ALWA 3DS6A 2FGIA 3OBGA 3GNIB 4FA2A 1URWA 3K5VA 5JMSA 4NTTA 5AP2A 3OG7A 2VNYA 3IGOA 5DWRA 3ZLXA 4QP3A 2XNOA 4KWPA 4CCBA 4BY9E 5HBEA 2X9FA 3HMOA 5IEXA 2A2AA 3IGGA 3QCYA 4DBXA 3I5ZA 1KE9A 2JD5A 4I1ZA 2ITOA 4XV1A 3VAPA 3L8XA 3UP7A 4AOTA 3B8QA 1RDQE 5JH6A 3I5NA 3PJ8A 2J90A 2JGZA 5BVKA 4BRXA 4XJ0A 4ZTLA 3NYVA 4EOQA 3O7LD 3QF9A 4FTNA 3NNVA 5L3AA 4O7VA 1ZOHA 3QTWA 3MH0A 3Q9XA 4YU2A 1QCFA 4GUBA 3LJ0A 2O8YA 5CX9A 4AZEA 4CFXA 5C8KA 1OPJA 5CF4A 4BDFA 5IA4A 2IZSA 2W1IA 3O23A 5FTQA 4RMZA 3ZC6A 4AT3A 1A9UA 1H08A 4IX6A 2I7QA 4NTSA 3E8NA 3SRVB 2WTJA 4AGDA 4I6FA 3BEAA 4MWIA 3DCVA 2W17A 5H8EA 2ZV2A 5DR2A 4RVLA 2E9PA 4O0SA 4MD9E 3GCQA 3BHUA 4QOXA 3ZEWA 1QPDA 2OFUA 5EK7A 3MV5A 4JLCA 2C6KA 4EQMA 4GIHA 2ZOQA 4L00A 5HO8A 2VX1A 4XOYA 5KMLA 3CKWA 4IB3A 1R1WA 2R3MA 4TYEA 3BU3A 3F82A 4Z7HA 5M4CA 2HXQA 3FHRA 3HV5A 5IEYA 2OJGA 3NWWA 3PWDA 3Q5ZA 3BE2A 4I92A 4RIWB 3NUAA 4PP9A 2YJRA 2VWVA 4IB0A 4DH3A 2XBAA 3FLSA 2X4ZA 3OOGA 4G31A 4G6LA 4IC8A 5DLSA 4AAAA 3VS0A 4BDBA 4EH4A 4K0YA 1SZMA 3E8CA 4QP2A 5E4HA 4O2PA 4EOMA 2GSFA 1Q8UA 4AA4A 5DRBA 2BAQA 4U80A 2R3GA 1OL6A 4L8MA 4FSNA 2HCKA 5CSVA 3MVMA 4XP0A 4ZEGA 4F9BA 4QP8A 4AW0A 4DGOA 4C0TA 4CMTA 5HI2A 2OZAB 3EB0A 4YBKA 5K4IA 4IB5A 1J91A 5AWMA 2PVLA 4IEBA 4FKQA 4B8MA 3PPKA 5IA0A 1TKIA 3QUEA 3F6XA 4HZSA 3UQCA 3Q32A 5L8LA 3PRIA 3U55A 4Q9ZA 4APPA 2ESMA 3CPCA 3OCBA 1FVTA 2C0IA 3VUIA 1NT2A 2REIA 3I0OA 4EQUA 1XBAA 2FO0A 1J7UA 4L7FA 1W83A 3EWHA 1KE5A 4OAVB 2KTYA 4K1BA 2R3NA 2X9EA 1NA7A 1XH6A 5CZHA 3TNQB 3C5UA 4FKPA 3F7WA 4DTAA 4DH7A 3WZDA 2XM8A 3FZ1A 3SGCA 4L3JA 3POOA 4BCHA 3ZZWA 3KRXA 4IVBA 3DPKA 4EC8A 3DBDA 4J71A 2PSQA 4DINA 3QZGA 3OW3A 2EB2A 5HX6A 3DKOA 3U51A 1BMKA 3DXNA 2B7AA 3KQ7A 3OVVA 1WAKA 4I24A 4U43A 5BPYA 1OUYA 1IR3A 1SM2A 3ZRLA 5IQDA 3VNTA 2PHKA 5C26A 1LPUA 4JJRA 2Y9QA 3ORIA 2UVXA 3H0ZA 2Z7RA 3F3UA 4FTCA 2PE1A 3UJGA 3VUGA 3L9PA 1OKZA 3E8EA 5A4TA 3WI6A 3PIZA 2FUMA 1AGWA 2CGXA 2J0MB 4BFMA 4WRGA 5HCXA 4CQEA 2WMXA 4O6LA 1OL2A 3RPVA 4FMQA 3FYJX 1W82A 3ZU7A 3MVJA 3RHXA 3P7AA 2C5YA 4EORA 3A7FA 1YXXA 2ITUA 4TWNA 3CLYA 3LFDA 2ZYBA 3FQEA 3C4ZA 3MH1A 4I6HA 2W1HA 4NJDA 4CFNA 4EHZA 2CDZA 3IS5A 5E8YA 4FZAB 3IOKA 4DN5A 4QMUA 3EKNA 1PYXA 4OTRA 5J79A 1URCA 5AIRA 4PMMA 5KMOA 2WMVA 2W7XA 3FE3A 4LL0A 4IWOA 1Q62A 3VHKA 4CD0A 5E8WA 3RHKA 1T46A 1SMHA 2VTIA 3TZMA 4UV0A 5FM3A 3V5TA 5E1SA 1RJBA 5J9ZA 3SOAA 4R7IA 1KV2A 3FI3A 4AE9A 4EK6A 1VEBA 4GYIA 2WU6A 3EQRA 1H4LA 2JAVA 3DV3A 3ZFYA 5IA2A 3MVHA 2BCJA 4E5AX 1NW1A 3ZHPC 3FY0A 1ZMUA 5CEQA 2HXLA 4FOBA 1PXNA 4GK3A 4U45A 1U5RA 5J95A 2QOCA 4PDYA 2O63A 4GW8A 5G1XA 5KKRC 5A9UA 5LVPA 3LM0A 4G6NA 5A46A 5B2KA 4AXAA 2QLQA 2VWUA 5AA8A 3JUHA 5AP0A 4LRMA 1OECA 2YABA 1XHAA 1ZZLA 4UMTA 5CALA 2OFVA 4C7TA 2ITNA 5BQ0A 1JLUE 2WOTA 4Q2AA 3SLSA 4BBEA 3QA8A 2B9IA 3VS7A 4L67A 4CV9A 4D55A 4O7SA 3KEXA 4EH2A 3BCEA 3H3CA 3V6SA 2C5OA 1GAGA 4FNWA 3KCFA 4J52A 4O7WA 5IQIA 3QFVA 4C34A 4XG6A 3PIXA 2XJ0A 3PIYA 5KHWA 1H0WA 1WBPA 4YJSA 3V5QA 2C4GA 2X6DA 4XMOA 4ZZOA 2O65A 2OZAA 3LE6A 1JKKA 4HYUA 2YDKA 3UVPA 4RA5A 3SXSA 4E93A 3R7YA 3I7CA 1ZARA 2A0CX 2OJIA 3EMGA 3FPMA 3Q60A 3VBVA 4BCIA 4QMQA 5IQGA 2AYPA 1XH4A 1YWVA 4QP1A 4ZOGA 1Y57A 3JY0A 2E9UA 4M66A 4EH7A 4DHFA 4KKEA 5CF6A 4C3FA 2J4ZA 3N51A 3CP9A 1WBTA 4ZAUA 2FH9A 2VWYA 3C7QA 3UIUA 1KE8A 4AE6A 1VYWA 1ZLTA 4HCUA 4LYNA 4M7IA 3VRYA 1U46A 2UZEA 4O7TA 4ZTSA 5FEEA 2PWLA 3IW6A 4E4LA 4DG3E 5FTOA 3RAHA 5JEBA 2W1DA 3QZFA 4IWQA 3RVGA 5HIEA 4CG9A 4YZ9A 2B4SB 3ALOA 3VF8A 4G34A 1SVEA 1ZYCA 3SW7A 1OKWA 3I60A 1OVEA 3HAMA 3EZVA 1CKIA 2WMQA 4FG9A 2RL5A 4E6QA 1BI8A 2WTIA 4FVQA 3C4FA 4LOOA 1GZKA 2G1TA 1RW8A 2PE0A 2PMNX 3OXZA 3V51A 3VQUA 4C57A 4D4YA 3MPTA 4I93A 4IWDA 4H05A 5C4KA 3DKFA 3OC1A 3HUBA 4CVAA 3QC4A 5GJFA 4L45A 3C1XA 4IC7A 2P55A 2XEYA 3CTJA 4YZCA 4ZZMA 5TOZA 4KIKB 4ZLZA 5B7VA 4DF3A 3C0IA 4F0GA 3LZBA 3VS4A 3KK8A 5FQDC 3IONA 3EKKA 1R3CA 4M14A 5BVWA 3G51A 4E3CA 1GNGA 1GIJA 5AV2A 2P0CA 3EFWA 3LFCA 2B9HA 3MYGA 4MBLA 5D11A 1XH7A 2UW5A 2R4BA 3FMJA 3G9LX 3PE2A 4KD1A 2PVFA 2VNWA 4GEOA 4FIJA 4BL1A 5J7BA 3F5XA 3RGFA 4FIHA 4FT3A 3CGFA 1H1WA 4F6WA 2CNQA 4R1YA 5M06A 1XH5A 3GOPA 2OXXA 2X2KA 2E9NA 3QCSA 4J98A 4O21A 5D12A 3FWQA 4YPDA 4RPVA 3BYUA 5BVEA 3ZC5A 3VS3A 4DEEA 3GCSA 5AP1A 3E92A 3P7CA 3VBYA 4PDOA 1R78A 2YDJA 1OBDA 1YW2A 3I7BA 4OTIA 1Q99A 2B54A 4TN6A 4RLKA 5IZFA 2QOHA 2GHMA 5KCVA 4YC3A 2YA9A 3WBLA 2G2HA 4O96A 1YXTA 4ASZA 3D94A 3H9RA 4UN0C 5HG9A 4ARKA 4K8AA 4L3PA 1XH8A 2ZDUA 2UVYA 4JG6A 3G90X 2VTTA 3AC2A 4ORKA 3A4OX 2BZHB 2CCHA 5I4NA 3B2TA 4CYIA 2C6MA 4D4SA 5KHXA 4I6QA 1XBCA 4L68A 3S2PA 4NZWB 4MBJA 4BWXA 5KMJA 1J1BA 5CWZA 5M55A 4BCFA 5IA3A 4NKSA 3TTIA 4GFGA 3FQHA 3QYWA 3ZYAA 4BIBA 4N6ZA 3OOMA 2F9GA 1PXOA 4U6RA 3QZHA 2C6IA 5FDPA 2BZJA 2G15A 4LGDA 5CEPA 1UVRA 1XWSA 3PVGA 3QTZA 3ORNA 4M12A 3OD6X 4QMYA 4ANQA 3DA6A 4UWBA 5KZIA 3REPA 3UTOA 2C30A 3COMA 4DBNA 3O8TA 5EHOA 2PVYA 4EONA 4PRJA 3L8VA 3QXOA 3V5WA 3EL7A 1ZWSA 5DT0A 3ORLA 4FV0A 1U54B 4JQEA 2YN8A 3NIEA 4EI4A 4M13A 3RALA 1SYKA 2GNIA 5DGZA 1Q8YA 3LFEA 5IQBA 4H3QA 3NS9A 1B39A 3I81A 4N0SA 1ZYLA 3OXIA 3GGFA 1WFCA 1GZOA 3E93A 3G6GA 2HZNA 4MQ1A 4R8QA 4RIWA 5LMAA 3D5UA 3UBDA 3MWUA 2QHNA 4Y5QA 5A14A 5JFWA 4YGAA 3TIZA 2QD9A 3V5LA 3HZTA 1P14A 3D2KA 4OTDA 3VJOA 5LMKA 2J5EA 2W5BA 3WIGA 1OL7A 4CFUA 4K11A 2XKFA 3Q53A 2YDIA 3O7LB 5IISA 2QO9A 4QQ5A 2J2IB 2QCSA 2VN9A 2W5AA 1XH9A 3GC0A 3NNUA 3OHTA 3FZOA 3R8UA 4H36A 4BF2A 5E91A 4NJ3A 2QU5A 3AMBA 3DLSA 4JBVA 4QO9A 5I9WA 1PXJA 1O6LA 4ALUA 2VTAA 5KBQA 5IH6A 5DT3A 2OO8X 1FGIA 4IJ9A 3DGKA 4BDHA 2JIIA 4KABA 4IZ7A 4LRKA 2IW8A 5M4FA 3ZRMA 3GCUA 1REJA 1AQ1A 2I0YA 4FKIA 1ZY5A 3T8OA 3LXPA 4YJVA 1Y91A 3Q6WA 4F63A 2W1FA 4IVDA 4NM0A 3N4UA 4ONAA 5EQPA 3KA0A 2Z2WA 3OBJA 5DT4A 4JBOA 5HLNA 2QOIA 3QQLA 1YXUA 4FV2A 4IZAA 4RIXA 3ORMA 3OEZA 3WYXA 3TZ9A 4D4VA 4D2SA 2Y4IC 3I1AA 4FKGA 3C51A 4ZP5A 3R73A 5IUIA 1REKA 4RJ8A 1ZYJA 3MIYA 4FKSA 4P5QA 4Z7GA 2OXDA 3KCKA 4K77A 2RG6A 4FZDB 2I1MA 3EFKA 4ITJA 3TT0A 4U42A 3FY2A 5EOLA 4FC0A 5HVKA 5ETIA 2PUNA 3R2YA 4WUAA 2F2CB 2IVVA 4QNAA 5FLFA 5HO6A 4P90A 4JQ7A 2IZTA 3U6HA 4WRSA 4WG4A 1XR1A 5KX8A 3RINA 4HVIA 4EZ7A 2IJMA 3O96A 3CJFA 2CMWA 4HNFA 3ROYA 2F57A 3HKOA 4FF8A 4IACA 3GT8A 4MH7A 4IX4A 5AUXA 3W2QA 4FTTA 4FEWA 4NIFB 3F66A 2BZKB 2BAKA 1P4OA 2QR7A 5F20A 1KE7A 4KRDA 4RJ3A 5H9BA 3WZJA 5EI2A 5FRIA 3MY5A 2HAKA 4UALA 3VS5A 2C5VA 4PY1A 4NM3A 5IMXA 3TNWA 4UMUA 2E2BA 2FSLX 3A8WA 5T68A 2BRNA 2VUWA 5J1WA 4Y73A 3GC8A 3DB8A 4GG7A 4GG5A 1PKDA 1SVGA 5HESA 2R3QA 2P4IA 3F69A 3OCSA 4TWPA 3UQGA 5J9LA 3UO4A 2RFSA 2XNMA 2XZSA 4PMTA 3H0YA 2R5TA 3QCXA 3GU8A 1IEPA 4K2RA 5AM6A 1LR4A 2QOFA 2CPKE 4MCVA 5EM6A 4XG4A 5CLPA 2WQEA 4AUAA 1PMUA 4RQKA 3ZSHA 4BIEA 3OXTA 4RIYA 4BTKA 4CTBA 4K9YA 2R3JA 5EHYA 4FEQA 5IU2A 3LKMA 2JLDA 2OKRA 2O64A 4I5PA 4KIQA 4EUUA 4E5BA 3KF4A 3L9MA 3ODZX 2JDRA 3FMHA 3I6UA 4J97A 4D5KA 3NDMA 4ZJJA 3JPVA 2W4JA 4FTRA 4E6DA 3JS2A 1SNXA 3HP2A 1FMKA 2QOBA 3HMMA 3LFFA 3OP5A 4RLLA 4HGTA 4HPUE 4PX6A 4UXLA 3PSCA 5KKRB 4LUDA 3HLLA 5HTBA 2X6EA 3D4QA 1JVPP 5HG5A 5LQFA 1KE6A 3Q2JA 2J5FA 3FDNA 5EYDA 3FMMA 2PL0A 4BTMA 3PLAE 3QTRA 4FTJA 3RK9A 2HENA 3SV0A 2XIYA 5E8UA 2CN8A 3E8DA 3PSDA 4TTHB 4WT6A 1K2PA 3NCZA 3HEGA 1KOBA 1OIYA 1OUKA 2YWPA 2CJMA 4E5WA 4X0MA 2GFSA 4USEA 2RFDA 2JDVA 2ZAZA 1W0XC 4UZDA 4ZSGA 2B53A 3PXFA 3QQKA 4IB1A 2G2IA 3SXRA 3N4VA 5CQWA 5B2MA 1ND4A 1GIIA 3H30A 4LRJA 5E8ZA 4YBJA 3ZS5A 5J5TA 4JDKA 4MNFA 3DU8A 3D5XA 2Y4PA 4Y95A 4YO6A 5KBRA 3C0GA 4DEGA 4EWQA 3AC5A 4QPMA 4WG5A 5AUVA 1OBGA 5ANEA 3FI4A 4OBPA 3GU6A 3QYZA 4C8BA 3F3VA 3GENA 4IAIA 4BCPA 4ZSAA 4AZWA 4C4JA 3EN6A 4BYIA 4RSSA 4CT2A 4YUQA 3D2IA 3SW4A 4FUXA 5L2IA 3FUPA 3R04A 5GZ9A 1UKIA 3FLZA 3KN5A 4DG0E 5M4IA 3HNGA 2F49A 3WARA 2UW9A 3PXYA 4ANOA 3DOGA 4RWLA 2QU6A 4G17A 4AX8A 1NVRA 2JKKA 3FXZA 3ZFMA 3MS9A 2FSOX 3MA6A 4GT5A 5D41A 5BYLA 2A19B 3PZHA 4GT4A 4IVCA 1MUOA 4O0TA 4XUFA 5EW3A 3U4UA 3W32A 1WVYA 2QG5A 1HCKA 4TPTA 2IVTA 4ZJVA 1OIQA 2ZM3A 4YC8A 4YNOA 2OSCA 3D14A 3LLTA 3EHAA 3Q9YA 4QYYA 3B2WA 3IDBA 4ZTRA 4D2TA 2J50A 2Q83A 4FI1A 2CHLA 3UVQA 1IASA 3FC2A 2QR8A 1UKHA 3FMDA 4RFYA 4MF1A 4L43A 3SXFA 3RZFA 2EVAA 4NW6A 2PVNA 3PYYA 3CTHA 1CDKA 3DT1A 5LJJA 3UO5A 4O38A 2YCSA 3CJGA 2PE2A 3E7VA 3FLQA 2W9ZB 4GRBA 4ID7A 4JG8A 2XNGA 4UY9A 5AR3A 3FPQA 1QL6A 2XK8A 4MQ2A 3W16A 4FTAA 5CY3A 3QWKA 3RJCA 3V3VA 4BHNA 1Q24A 4CTCA 5HZNA 5FEDA 3H4JA 1KOAA 2C3KA 5GZ8A 4GH2A 1OGUA 2Y8OA 3WZKA 3K3IA 3RPSA 1AD5A 3BU5A 2QOQA 3DJ6A 5CU4A 1H07A 4IDVA 5DPVA 1FVRA 1MQ4A 3NYXA 3TI1A 1JKSA 4ZS0A 3VF9A 3BWJA 4EOLA 3SA0A 5FBNC 4DTKA 4GJ3A 1W84A 2Y6MA 3W18A 1OL5A 4O7LA 4OTWA 4GKIA 4XCUA 3VBWA 4FEVA 3JXWA 2F4JA 5HU3A 4FSWA 2WTKC 4FV3A 1JNKA 4JX7A 2OJJA 3TWJA 3TEIA 2UW4A 2J9MA 2YZLA 4XEYA 5CVHA 4ALVA 3E3BX 5BX0A 2WIHA 2C3JA 3AG9A 2VX0A 2X7OA 1YQJA 2V7AA 4RG0A 4XRJA 3CE3A 3QRUA 4YLKA 5F95A 4C38A 5CAVA 2J7TA 4WNOA 4DH8A 1S9IA 3P9JA 5IF1A 5M53A 1OM1A 4X2GA 2YITA 4XG8A 2VU3A 3ELJA 3MPMA 4EOKA 5AX9A 1PXPA 4YHJA 3E7OA 5AP3A 3EQGA 5HKMA 4V05A 3RBWA 4OT5A 5LVOA 4RWKA 4MXOA 3EIDA 4QYEA 4L9IA 3DLZA 3HV7A 4QMOA 4W4WA 4Y46A 5ACKA 3NYOA 3T9TA 3UZRA 3T9IA 3GVUA 5HO7A 2BFYA 3PFQA 4IX5A 4F7SA 4QMVA 4Y72A 4FV7A 2I40A 4A9YA 3NCGA 2UW8A 1BUHA 4PPCA 3LMGA 3ENMA 3UIMA 3BLHA 4R3RA 3TXOA 4M0YA 2R9SA 5L8JA 1E9HA 2WTDA 4TNBA 5DVRA 2GNHA 1UU8A 3N9XA 2RIOA 5L2SA 3DB6A 4ASEA 3QKMA 2YEXA 4S2ZA 3VUHA 1IRKA 2BTRA 2GNGA 2R3OA 3GOKA 3BGZA 3N4TA 5F94A 4CKIA 4BGQA 3O17A 2W1EA 3ORPA 3ZH8A 5L6OA 1Q8ZA 2AC3A 3TUCA 3OUNB 2BILB 4TYGA 4TZRA 5DA3A 5I9ZA 3TV6A 2XRUA 3VS2A 3QBNA 3ZCLA 3GP0A 3L8PA 4QRCA 4YMJA 3FL5A 2VWWA 4N57A 3R30A 1ZYDA 4I0SA 4QQJA 2GS7A 4NYEA 1YKRA 4I0TA 2BZIB 3R71A 3SKCA 5DHJA 1NXKA 3PJ1A 1LEZA 3RPYA 2OF2A 3MFRA 3R1YA 4FK3A 4RRVA 2XIRA 3LXKA 4GYGA 4CG8A 1LP4A 5IQHA 3C13A 2DQ7X 2W0JA 5EYMA 1KWPA 2E9OA 2CLQA 3VQHA 4ACGA 2GHGA 1B38A 3QGYA 5G6VA 3UMWA 2YFXA 2VWIA 4F1OA 5J5SA 4BDEA 4BIDA 2UW0A 1PF8A 3O0GA 5LXMA 4KS7A 5DN3A 4FX3A 1W98A 2WAJA 5EI6A 3CKXA 5LCKA 3W1FA 4ZLYA 5DMZA 4CFVA 3BE9A 2YACA 5CASA 3II5A 1BI7A 5DE2A 2CNVA 2ERZE 2YM7A 4IH8A 4DC2A 4OLIA 5ANDA 3QWJA 1UA2A 5HG8A 4LV8A 3DTWA 4LGHA 4PNKA 2C6DA 3EOCA 2QOOA 2QKWB 5DNRA 5JZNA 3TUBA 4R7BA 4W4XA 4FIIA 1UNHA 4U44A 2C6LA 3TJDA 3LXLA 3QTQA 1YHWA 5AUYA 2VO3A 2C6TA 1Y6BA 2QI8A 4FT7A 3FL4A 4HYHA 4AOIA 3LQ5A 4HYSA 4EK8A 4DT8A 4ZMFA 1OITA 3EN4A 3MPAA 2QLUA 5AX3A 3DNDA 4DCAA 2QODA 4IXPA 4DGLC 3RI1A 1PXLA 3W55A 2EXEA 4OBQA 5EOBA 2WQMA 4RJ4A 4BI2A 1FGKA 4W9WA 4WIHA 4K6ZA 2CNUA 3QQUA 4NCTA 4NKAA 3TDVA 4TYHA 3NNXA 1OL1A 2BHHA 4RC3A 1H01A 4TT7A 1Y8YA 3DKCA 4FTLA 1E1XA 2FB8A 3BHHA 4O1PA 4D28A 3DNEA 2NRYA 4FYNA 5LVLA 3T3UA 2IW6A 5AUUA 4F7NA 4ZY5A 5FTGA 3IDCA 2OI4X 2H8HA 3BQRA 4GFOA 2UZDA 4RJ5A 2R3KA 3EH9A 5DR6A 4EHGA 2J0KA 4FNYA 3FSKA 4NWMA 3ANQA 2PZIA 4FV4A 2CKOA 3NX8A 5DFPA 2XH5A 4FGBA 4V01A 2IZUA 3R01A 1YOMA 2ITQA 3E87A 4EL9A 4RA4A 5CYIA 4AZFA 5CF8A 3WILA 4FV9A 5A4QA 5B2LA 5BYYA 3A99A 5HU9A 3QQJA 3CR0A 3UE4A 2C3IB 1L8TA 2P33A 4ACHA 1Q8WA 3GU4A 4JDHA 4U81A 1SVHA 4MNEB 4ZMEA 4QTBA 1YDSE 4E7WA 4L53A 4R3CA 3TDWA 5CEMA 2X8IA 3A61A 3Q4CA 3G9NA 3VHEA 1M2QA 4AGWA 4RZWA 4FSTA 4HGLA 4RIYB 1Q41A 2IO6A 3OS3A 2BDWA 2I6LA 3EYGA 3OWLA 2BHEA 4BDAA 1NVQA 4FGRA 2JITA 1ZYSA 5DIAA 4A06A 5HLPA 4EUTA 3C9WA 4G3EA 4JRVA 3R9HA 2OG8A 3Q2MA 1YXSA 3LM5A 4TY1A 3DJ7A 3VWAA 3NW7A 5A54A 3HX4A 4X2KA 3G33A 2C1BA 2O0UA 5K4JA 4D2WA 3A7IA 2XRWA 4QMZA 3V8SA 4IBMA 4L46A 4QYHA 4DGGA 4QMSA 4O82A 2UZUE 2PU8A 4LM5A 4YURA 3R0TA 4QPAA 5C1QB 2QG7A 3LQ8A 1WCCA 4QTCA 4YPSA 4NSTA 3FKOA 3MW1A 2ZMCA 3ZXZA 1ZMWA 2PY3A 4S32A 3D7TB 4EBVA 2BIKB 4EC9A 3PVWA 4XG3A 3JVRA 2XNPA 3HA8A 4ERWA 3PJ2A 4FZ6A 3NVMB 4MX9A 4BCJA 1L3RE 4F64A 3MGYA 5KMKA 3ZEPA 4BVUA 2UW6A 5DG5A 4HOKA 5DH3A 3THBA 4AN3A 2NNWB 4TWOA 4PUZA 5AIKA 3BYOA 3PXKA 4F6UA 1MRYA 4OTPA 4B99A 3KXZA 4IAKA 4A4XA 1HCLA 4UZHA 5CEKA 4X3FC 1M52A 2C3LA 4FNZA 1IA9A 3RNIA 4ERKA 1YVJA 3FLYA 1MQBA 3FZTA 4OR5A 3TL8A 4QPSA 3EN5A 3W8LA 3KXGA 3HL7A 3QXPA 4O0XA 2W1ZA 3LXNA 4QQCA 4GU6A 3KRJA 3MY0A 3TV7A 4WSYA 4EOJA 3ZSGA 2XKDA 4WBOA 4DEBA 4J99A 1PHKA 4B7TA 4OT6A 4LMUA 5FDXA 2VZ6A 3WF8A 3HDNA 4DITA 2B55A 2EUFB 4BZNA 3EN7A 4MD7E 2Q0NA 4OTHA 4E20A 2QQ7A 3FZSA 4GCJA 1OIUA 4C37A 2X39A 4RT7A 5CNOA 3QD0A 3UZPA 3WZEA 4S34A 4AQCA 4GJ2A 3COKA 2BRGA 2XP2A 3A62A 3ZTXA 4EOOA 1G8AA 2R3FA 4C36A 3UC4A 3UODA 4E1ZA 4B6LA 4OBOA 4JAJA 3Q52A 4FL3A 5CT0A 2VGPA 4FSQA 4N70A 2X2LA 3D7ZA 3LFAA 4HCTA 4QTDA 5TR6A 5CAOA 1QMZA 4G5PA 5AP6A 3PRFA 2UZVA 5HNIX 4ASXA 4FV8A 2WKMA 4J8NA 4TL0A 2NO3A 4EYMA 5KZ0A 1DI9A 5JRQA 3H9FA 4FTMA 5ANJA 4R78A 3LAUA 2XNNA 1UNGA 3A4PA 4I4EA 4KB8A 3PP0A 4FVPA 4C33A 2WMRA 2C6OA 4CLIA 4I3ZA 5AR5A 4HGSA 3KK9A 4YSJA 4XG9A 3K3JA 3VS1A 5IPJA 1RE8A 4FVRA 5BMSA 3SVVA 4Z55A 3PJCA 3BGQA 1BKXA 1XJDA 2RSVA 4G5JA 4JOAA 3OMVA 3QHRA 2WD1A 2R3LA 4PDPA 4YTHA 2PTKA 3VBQA 4B9DA 4FSYA 3QRKA 4KBAA 2QO2A 3TUDA 2PVJA 3FXXA 2HELA 3AGLA 5EM7A 1YWNA 2VO0A 3PXRA 3AT4A 4XP2A 3HA6A 4W4YA 4RVMA 3HAVA 3VUDA 4MD8E 4D0WA 5FXQA 4QMNA 4E4NA 4ANLA 4BHZA 1J3HA 4IVAA 4ZK5A 3ZZEA 3QAME 3MJ2A 4RGJA 4AW5A 2R0UA 2XMYA 5HE2A 3ORZA 2A27A 1ZAOA 2BRBA 5IUGA 3Q04A 5AR8A 4AP7A 3BYMA 1UWJA 4O7RA 4CGAA 3VW6A 2C47A 1PW2A 2Y7JA 1T45A 4KIOA 4KSQA 5BVDA 2RFNA 4BTFA 3R28A 3VBXA 2QO7A 5I9XA 1KSWA 3FMLA 3BQCA 4FKLA 5AA9A 4EHEA 3NGAA 2G01A 4FKTA 1TVOA 2OIBA 4JQ8A 4BDJA 5K0KA 4LL5A 4JVGA 1PXKA 5HOAA 4TYJA 5JN2A 3D7TA 2BDFA 2BFXA 3IW4A 4CCUA 3NVKI 4U5JA 4AWIA 4UX9A 3MIAA 4WG3A 1LUFA 2JDSA 3DKGA 3BI6A 3Q4UA 4EHVA 1PXMA 4CKJA 2GU8A 4ZSJA 5FBOA 5HE3A 5IQEA 2G9XA 4CQGA 3LCSA 3AMYA 4KNBA 4DFNA 4XHKB 4XYFA 3EN9A 3ULIA 2WMBA 5ETFA 3KN6A 4FSMA 4LOQA 5AV3A 3ZM4A 4WOVA 3ACJA 3BYVA 2WHBA 3LFNA 4CZUA 4YR8A 3GB2A 3NSZA 4M67A 5AAFA 3U9NA 4DEIA 4E6CA 3NUSA 4NL0A 2ITWA 3LJ2A 4BZDA 3MTFA 4IX3A 2VV9A 5I5ZA 5L2TA 1J7LA 4RX7A 5CU6A 5GZAA 2YHVA 2XIZA 1Q61A 4WSQA 3RCDA 3OCTA 4UWYA 5EYCA 1YRPA 3RK7A 5LWMA 2WTVA 4U40A 1JKLA 5K5XA 3FZRA 3HYHA 3KULA 3HRFA 2Z8CA 1IA8A 5HNBA 4X3JA 3R8LA 4IAZA 1BLXA 2OIDA 2XS0A 5EDRA 5ACBC 4Z3VA 3GU5A 5GHVA 3F9NA 2WTWA 4QT1A 5BVOA 3LHJA 3HRCA 2ZM1A 3FXWA 4ZTMA 3FI2A 2W06A 2YISA 3GUBA 4GVJA 4DG2E 3WF6A 2WO6A 2IPXA 3U9CA 5HD7A 5JGDA 3NAYA 4MHAA 5EDPA 2HOGA 3SC1A 3WZUA 3DZQA 1W8CA 3P1AA 3TNPC 2CLXA 3P4KA 1H8FA 4MTAA 3PY0A 2V0DA 4RQVA 2ITVA 4BN1A 2PUPA 3DY7A 4DE4A 4ANBA 1X8BA 3LLAA 2Z7QA 3OTUA 4FYOA 4G16A 2X2MA 4CFFA 1YXVA 1JQHA 1MRVA 3EQHA 4D2VA 4PPBA 1Q5KA 3FLNC 1PY5A 2VTHA 5AV1A 2GCDA 4TYHB 3AC3A 3P08A 2GNJA 3KU2A 4WHZA 2PUUA 4CEGA 3BLRA 3LFQA 5TO8A 2WNTA 1Z57A 2UZTA 4UWCA 4AF3A 4PMPA 1XKKA 4XLVA 2JDOA 4CFWA 3DDQA 3QA0A 1CKPA 2O5KA 4EYJA 4PL4A 3VW8A 3K5UA 4A07A 4F9WA 2PZPA 1NVSA 3FZPA 3QHWA 3KGAA 5LARA 3LCDA 4AU8A 3COIA 3QZIA 4A9TA 2JDTA 5I9VA 3AC1A 3DK7A 5EDQA 3R7IA 5AP5A 3ZXTA 4JNWA 3MH2A 2R3RA 4H1JA 2WXVA 4I6BA 5AJQA 4RFMA 3Q5IA 4OAUC 2YIQA 4YLJA 2XKCA 5ANOA 4BI0A 3PDTA 3C50A 3PY1A 3EFLA 4NUSA 5LOHA 3FKLA 3GQIA 1VZOA 3R7GA 4F7LA 3GCPA 2W9FB 2ZJWA 5GNKA 4I5CA 2XF0A 1M17A 2Y4IB 1YDTE 4EZ3A 2BRMA 2XK7A 4W8DA 4WO5A 3C4WA 3K54A 3MVLA 4AFJA 5EKNA 4FZFB 4G9RA 2WPAA 2UZLA 1V0OA 3NYNA 5CEIA 1YDRE 4JI9A 4C59A 1R0PA 3KRRA 4EH6A 2JKOA 4O2ZA 3PUPA 4ENXA 5JQ5A 2GS2A 1P5EA 2V62A 4NM7A 5GINE 3ROCA 3P7BA 3ORTA 5B0XA 4USDA 5BVNA 4BB4A 5I0BA 2VD5A 4QMMA 5AUWA 3ANRA 2WMTA 3UNKA 1IAHA 4JIKA 4FOCA 4MAOA 3DFAA 4UEUA 1KV1A 4XP3A 4AFEA 4FTQA 1TQIA 4D2PA 3LMIA 3IKAA 2BUJA 2WOUA 3GEQA 4D4RA 4CKRA 3KVXA 3G0EA 5CSHA 3KY2A 4LI5A 5H3QA 5HIBA 5CSPA 4UBAA 3FV8A 3A2CA 2PK9A 1JSUA 3KVWA 1YHVA 4PP7A 3GFEA 1CSNA 5HICA 1Q3WA 4CXAA 3P0MA 4BGGA 1WBSA 2CKPA 5EQEA 2ITYA 5CXHA 4C62A 4ZSLA 2WIPA 2XK9A 3R7OA 3VS6A 5M4UA 4MKCA 4KS8A 5CT7A 2BVAA 4DH1A 3F2AA 4YJNA 5ANKA 5AR7A 4DFLA 5HD4A 2YIRA 4PWNA 3ULZA 2C68A 5BUEA 5L6WL 5FUTA 4HVGA 3BU6A 3L9LA 5CVGA 2OZOA 2VTOA 4D9UA 2J0IA 1H26A 5IUHA 5CXZA 5AUTA 5LWNA 4FIGA 3D5WA 3ZFXA 5HORA 4F99A 1ZRZA 3CY3A 3GU7A 4C4HA 2ZV8A 3R22A 3OZ6A 1WZYA 4O0VA 5KUPA 4MXYA 3CQUA 4XV9A 4EOSA 5KE0A 4ZIMA 4MK0A 3S95A 3SX9A 4IAFA 3C4XA 2YCFA 5AP4A 3RMFA 2BKKA 2EXCX 4FT9A 1PMNA 1G5SA 3GQLA 4I4FA 4G1WA 2UVZA 5CAPA 3U6IA 5L6PA 4CZYB 4CZTA 3QTIA 4AN2A 4F1TA 4R5YA 5DEWA 3SQQA 1ATPE 4H3PA 4YJUA 1ZOGA 4HYIA 4PTCA 4CSVA 3ID6C 4KBKA 5T3QA 3AD6A 3SG9A 3ALNA 4JR7A 4UXQA 2C0OA 5AP7A 2QOKA 3HVCA 4ANNA 1FPUA 2UW7A 1V0PA 4HZRA 4B0GA 3DBFA 2PVRA 2RKUA 3F3TA 3PPJA 4L01A 4ACDA 3PA3A 2PMOX 3AMAA 2VAGA 4BCNA 3LVPA 2VTQA 3HV4A 3ENHA 4JIAA 4M69A 2WMUA 4U41A 4PDSA 3UYSA 2IVUA 4EJ7A 2H34A 4RX5A 4BDCA 4CLJA 4DFUA 5EW9A 4O83A 2JFMA 2R64A 4W9XA 3NW6A 4IE9A 5IEVA 4AZVA 4O7ZA 2XK3A 4JAIA 3UC3A 4F7JA 5FM2A 4BCQA 4I41A 5IG1A 5ANIA 3DK3A 3MFSA 3QX4A 4Q5HA 4YZMA 4WNMA 3O8PA 5D1JA 4W8EA 4FV6A 3CS9A 4FSRA 4YHTA 3L9NA 5CZIA 2YZAA 3ZUTA 4D0XA 5ETCA 3RZBA 1H1PA 5HVJA 2Z02A 4D1XA 2JIVA 4KKHA 1A06A 1TQMA 2OGVA 3TN8A 2HWPA 3TV4A 4O7YA 4EH9A 2HZ0A 2C69A 3BIZA 2WTCA 4XBUA 5E8SA 4DEAA 3HMPA 5D9HA 2J6MA 4DCEA 3BYSA 3DQWA 3JY9A 1HOWA 4DA5A 4EK3A 5F4NA 2BR1A 5L2QA 2OJ9A 4EK4A 1H27A 4QP7A 1MP8A 2PPQA 4EH5A 5E1EA 5IA1A 3ET7A 3R7VA 2WFYA 4LV5A 3NAXA 3QRIA 4QNYA 1OPKA 4EH3A 2GTNA 1YOJA 4U0IA 4AG8A 2WQNA 2BALA 3F7ZA 3AC4A 3FLWA 4CNHA 5A6OA 4AA5A 5GJGA 4F9AA 4P4CA 4BBFA 5AAGA 5HLWA 3MB7A 4Q5EA 1F0QA 3SAYA 3EQIA 2Y0AA 2XNBA 4BGHA 2XB7A 4V0GA 2ITXA 3KXHA 2F7XE 2VTMA 4E4MA 3KREA 3DBEA 3NEWA 3OY1A 1UU7A 4ENYA 4A7CA 3TKHA 5H8BA 4D1ZA 3S00A 4L44A 3D9VA 3ACKA 4O84A 4FEXA 1Z5MA 4EWHA 4KUJA 2HW7A 1YHSA 3E63A 5AADA 3G6HA 5H2UA 5K5NA 1QPCA 4HW7A 4BBMA 4TNDA 1UU3A 4F1MA 4CMUA 4AACA 5CI7A 2PZYA 2F7EE 2XCHA 2HIWA 2YM6A 2XYUA 4X21A 2YLFA 5BUIA 3HECA 3LJ1A 5LVMA 2ETKA 2IVSA 4O1OA 2GQRA 5AV0A 4IAYA 2BTSA 3TIYA 2FVDA 3V01A 5JT2A 4S30A 4RWJA 4AZTA 3R9NA 3BWFA 3RPRA 2W99B 2PZ5A 5A4LA 3ZUUA 3OY3A 3V8TA 2GDOA 4BKYA 4PTGA 3KKVA 2RGPA 3V8WA 3PLSA 1M2PA 2UZWE 5CU3A 3F3ZA 3MTLA 4AGUA 4E73A 5IQFA 4HGEA 3UQFA 3F88A 4DYMA 1JAMA 3QQHA 2O3PA 4XV3A 5CEOA 3PA5A 2FA2A 3K2LA 2C5XA 2YJSA 3GC7A 4FSZA 4O6EA 4C4FA 5HCYA 3C4EA 2BROA 2QONA 3DAEA 3PE1A 2R7IA 2ETRA 4GU9A 4ACMA 3FJQE 3TZ8A 4C58A 1JSVA 4Q9SA 3I0QA 3FYKX 3OTVA 4Y5HA 2YAKA 4YZDA 3BHYA 3QKLA 4Y85A 3E5AA 3EQBA 5HE0A 4C3RA 4KIKA 5K0XA 2CKQA 4QYGA 4IWPA 5K3YA 4L52A 4NU1A 4ANMA 2W4OA 2ONLC 2QC6A 2YERA 3O50A 1STCE 3OCGA 5FXSA 5EFQA 4X2JA 4A9SA 4OTGA 3LQ3A 1UU9A 3P78A 1OMWA 5C27A 1RQQA 4MXCA 2BPMA 2JBPA 3FC1X 5IH5A 2VTSA 3D15A 4TWCA 3TNHA 2RG5A 2IG7A 3QD2B 4EKLA 4RZVA 3W2PA 4YTCA 4H1MA 1WVXA 1V1KA 2OH0E 2W1GA 5HNGA 2PULA 3ITZA 3O2MA 2VTLA 2R3IA 3TTJA 5CI6A 4E26A 2JIUA 1CTPE 3G2FA 3UMXA 2GNLA 2B9FA 2HK5A 4I5HA 3ZM9A 3FEGA 2XIKA 2J0JA 2R2PA 2B1PA 4UMPA 3ZONA 5E8TA 5C8NA 3CQWA 2XYNA 3BLQA 4C3PA 5DBXA 1WBNA 2OK1A 3PY3A 3ATTA 3VO3A 4IZYA 3EYHA 1FMOE 4AS0A 1GIHA 4BTJA 3QD4A 3ZBFA 2X0GA 2GMXA 3E88A 3EQPA 4R77A 2Y6OA 4PF4A 4NM5A 4RFZA 5FGKA 3COHA 2VO6A 3QLFA 4BKJA 1GJOA 1PMEA 4D9TA 4UB7A 5J7HA 2H6DA 4KINA 3ZUVA 2R3PA 5CTPA 1H1RA 2RFEA 5M57A 2SRCA 3LFBA 3IOPA 1QPEA 4BWPA 1DI8A 5EKOA 3UDBA 3WF5A 2V7OA 4ZJIA 2A1AB 4LMNA 3RWPA 3HDMA 1U4DA 1CM8A 2PVKA 2W4KA 2JBOA 3O51A 5DRDA 2ZMDA 3QUPA 4FEUA 3R9RA 2HZIA 4K18A 4FT5A 3ZOSA 5FG8A 5HBHA 4F9YA 1JOWB 5K9IA 2WMSA 3Q4TA 3W8QA 1Z9XA 1U54A 3PVBA 4GSBA 3S3IA 3RPOA 3DAJA 4CRSA 1XBBA 3DTCA 3BX5A 4IDTA 3OF0A 4ACCA 3SRVA 2X1NA 3CC6A 1H28A 3ERKA 2BIYA 3KXMA 4RIOA 4D58A 5CANA 1VR2A 3RCJA 2XKEA 4BDKA 4YTFA 2QVSE 3ORKA 4G3DA 5HVYA 2CGWA 4ZTQA 3RM7A 4GMYA 2B0QA 4GL9A 5J9YA 2YCQA 4O0UA 4FV5A 3DDPA 5JRSA 5FD2A 3A7GA 4ZLOA 4YNEA 4QTEA 3IG7A 3R6XA 4NK9A 4XNEA 5CENA 4KRCA 4D2RA 3BHVA 1LEWA 4J8MA 5M51A 3Q96A 5FEQA 1NY3A 3R63A 4X2NA 3HV3A 2WEVA 5FXRA 2OICA 2V22A 3OFMA 4G6OA 3MESA 3DXPA 4P7EA 5I9YA 4FKRA 1MRUA 3DQXA 4BCKA 3DJ5A 5HIDA 4A9UA 4BKZA 1M7NA 3RK5A 3DZOA 3KC3A 1I44A 3CPBA 3UOKA 4GK4A 5CQUA 1APME 3WF9A 1H25A 3HUCA 4CV8A 5GIPE 3QQFA 4G3CA 3VJNA 5EM5A 4M15A 4BR3A 2H9VA 3F3WA 3M42A 3GBZA 3PZEA 2UZOA 4I23A 2UV2A 4TW9A 5H8GA 4AZSA 4Y8DA
chains in the Genus database with same CATH superfamily
2CCIA 5EH0A 2IW9A 5IKWA 4X3FA 3VUKA 3I6WA 5IA5A 2ZVAA 4MF0A 4X3FB 3P86A 4CFMA 4S31A 5LMBA 5ICPA 3LIJA 1WBVA 3B8RA 3R8ZA 3VRZA 3UYTA 1UV5A 4BCOA 2GPHA 4GV1A 1G3NA 3MY1A 4X6QC 4YJOA 2R7BA 3C0HA 3UNZA 3IW5A 4FK6A 2XJ1A 3H9OA 4GS6A 4ITIA 4FT0A 3VIDA 3QRTA 4I20A 4HVSA 2UZBA 3E64A 4OGRA 4JRNA 5CS6A 1E1VA 2ZDTA 4ZZNA 3CIKA 4Z16A 3FMKA 2DWBA 3V04A 4EK5A 4IW0A 4KAOA 3R9DA 3PXQA 1A48A 3EFJA 4OTFA 2XNEA 3VBTA 1UWHA 3R8VA 3U6JA 1IAJA 4NIFA 3BEGA 4MXAA 4GT3A 5FP5A 4O7NA 1H24A 3TACA 1H0VA 4MVFA 3UNJA 3LMHA 2OBJA 3RKBA 3IO7A 5HBJA 2FSMX 1YI6A 2XAMA 1F3MC 3Q9ZA 4ZTHA 4FUYA 2VRXA 4J95A 4JT3A 1YWRA 3D83A 3TM0A 3MFTA 4BI1A 2WB8A 3QTUA 4R5SA 3JR1A 3PG1A 4XBRA 2GQSA 3M2WA 4XG7A 5D10A 3F5GA 4PL3A 2KULA 3BHTA 4KSPA 1IG1A 4J7BA 1KUTA 2CGVA 1ZY4A 3QX2A 5TE0A 3G0FA 3R8PA 5BVFA 2ETMA 3L8SA 4RX9A 3BL9A 1F5QA 4YJPA 4JXFA 5I9UA 2P2HA 4DAWA 4AW1A 5A4CA 4JBQA 1J1CA 4MNEA 4LFIA 4JBPA 3QL8A 3LW0A 4F08A 3Q3BA 3R1NA 4M0ZA 5CU2A 3FSFA 3NNWA 4FTOA 3TKIA 2X8DA 4TXCA 3CCNA 5EW8A 3W0NA 4BCMA 4TYIA 3F5PA 2X8EA 3UDZA 2JC6A 4U3YA 4DT9A 2J0LA 3CBLA 4HJOA 5E7RA 5AFVA 4FTUA 2JKMA 3C5IA 1EH4A 4V0GB 4DFBA 2XA4A 3QQGA 4RBLA 5M07A 5IDPA 5GJDA 2G2FA 2W05A 2X81A 4A4LA 3NFGB 4WNPA 3W2RA 4O4DA 3WOWA 2OLCA 2E9VA 1Q4LA 2CSNA 2WEIA 3AD4A 4G9CA 3UPXA 1XO2B 3KXNA 2YIWA 3OEFX 4II5A 1H00A 3KRWA 3LCTA 4JR3A 3KF7A 5A4EA 5M08A 5BYZA 1OI9A 1U59A 2XK6A 3HGKA 4IADA 4RVKA 4AOJA 1FQ1B 3R1SA 3IPHA 3EZRA 4FR4A 4WA9A 1GY3A 3IW7A 2GQGA 3RNYA 3ATSA 5IH4A 3BZ3A 3GFWA 3UP2A 4FKOA 5CVFA 4NW5A 2OH4A 3BGPA 4QYFA 3AD5A 4XG2A 3BV2A 4P2KA 3KMMA 4IMYA 3R8MA 5DYJA 2Q0BA 2P2IA 3PPZA 4FNXA 4C4GA 3ZLYA 3WF7A 2XVDA 1O6KA 2HY0A 2V55A 2W96B 2PMLX 4GUEA 4IQ6A 5TT7A 4CYJA 2QNJA 4QQTA 2NP8A 3EQFA 3NIZA 3QLGA 4DFYA 1DAYA 1PJKA 4C2VA 3DBCA 3DFCB 1CMKE 4Z9LA 2J51A 1U5QA 4PPAA 2IZRA 1VJYA 4QP6A 3PG3A 4ZXTA 3BBTB 5HEZA 3OUKA 4UMRA 1Y8GA 2PVMA 5HTIA 3KFAA 5CSWA 4FZ7A 3VVHA 2O2UA 2PZRA 5JQ8A 1B6CB 2R3HA 3GCVA 5HGIA 4EZ5A 2IWIA 1FINA 3MSSA 3O8UA 4LQMA 5DOSA 1BYGA 4FODA 3VC4A 3V5PA 2XEZA 4YJQA 5C01A 4F65A 5BNJA 2WQBA 1H1SA 5A3XA 2ZB0A 2XUUA 3QD3A 4WNKA 3UIBA 5AV4A 4I21A 3HMNA 4F0FA 4O0RA 4IM3A 5HTCA 2HY81 3F2NA 2VTJA 4YJRA 2C6EA 4BZOA 1XQZA 4B4LA 4YLLA 4HVDA 1WMKA 4AA0A 4BWKA 4FTIA 2X0PA 3AQVA 4PTEA 1Q3DA 3NR9A 3W10A 3R7UA 5LMKC 3CY2A 3EQCA 3G5DA 3O71A 5CF5A 1W7HA 5FWKK 5CU0A 3ODYX 4RC4A 5C9CA 2XM9A 3AT3A 3HRBA 3RAWA 3QTSA 4M69B 4O0YA 1OB3A 4FL1A 4UYNA 5LCJA 1OKYA 4IFGA 4BYJA 3RWQA 1ERKA 2HYYA 3MFUA 4R7HA 4ANSA 1S9JA 3M1SA 2WGJA 3ZO2A 3SG8A 3CEKA 3ETAA 3BL7A 1WBOA 3AKJA 2OJFE 3ZO3A 3F61A 5JFVA 2Z7SA 4AN9A 4QMPA 4FG8A 3NW5A 4O22A 4FKWA 5CNNA 5JFXA 3P5KA 3HP5A 3FI8A 3DBQA 2FYSA 2WMWA 3DXQA 3CSVA 5GIOE 3BRBA 1K9AA 4OUCA 1M14A 2OIQA 1VYZA 2OW3A 4MXXA 2C5NA 5DI1A 5T6KA 3TCPA 2OU7A 5L4QA 4XX9A 2YIXA 4GKHA 2GTMA 1OKVA 3LPBA 2RF9A 4IHPA 1R0EA 4MEDA 5JKGA 4YHFA 5DR9A 3S1HA 4KA3A 1WBWA 3H10A 4R6VA 4IZ5A 5L2WA 4F4PA 1BL6A 2CGUA 3IK3A 5BUJA 3OW4A 3U87A 2YAAA 5J1VA 4F9CA 4QMWA 3BV3A 3NRMA 3VULA 4FIEA 3OT8A 5FP6A 2F7ZE 3NPCA 3NUYA 1OPLA 3GXLA 4BC6A 1Y6AA 3Q4ZA 3PSBA 4MXZA 2JFLA 2R0IA 3I4BA 4YJTA 2LAVA 3R1QA 3R83A 1Q8TA 3GC9A 3QGWA 3P79A 5J8IA 5M56A 3GI3A 2LGCA 4M84A 3UVRA 4H58A 3POZA 1P4FA 5HX8A 4QD6A 4M3QA 4DEHA 1YI3A 3KMWA 4AW2A 2JEDA 2ITPA 3S0OA 3OWJA 2XBJA 3MB6A 4V04A 4YSMA 4BDIA 2YM5A 3FBVA 5E8XA 4C35A 4C02A 2PVHA 5TF9A 2GNFA 4DGMA 2QKRA 4LOPA 2VGOA 2W5HA 3FQSA 5D7AA 4Y83A 4BCGA 2PUIA 3IW8A 2C0TA 3G15A 3W33A 4PL5A 4I94A 4DH5A 4RWIA 4ASDA 5KO1A 3R21A 1J7IA 2XIXA 4HPTE 5C03A 3R00A 2UUEA 4CMOA 1ZMVA 4EQCA 4NFNA 3U8WA 2W1CA 3NZ0A 2DUVA 1M7QA 5C4LA 3QKKA 4DEDA 3ZDUA 2ZB1A 3E62A 4EH8A 3A7HA 3OWKA 3R2BA 4FSUA 3PA4A 3BELA 5ETAA 2BRHA 3SD0A 3ZO4A 4L3LA 5ANGA 1JKTA 2VTPA 3NFFB 4YP8A 3W2SA 3W0PA 3SOCA 4JDJA 2NRUA 4G2FA 2A4LA 2AUHA 3QCQA 4YTIA 4O91A 1BL7A 5I3RA 2F2UA 4N6YA 3TG1A 3UOHA 3PJ3A 3IQ7A 3IECA 1M2RA 2EWAA 4QP4A 5IQCA 4DLIA 4IANA 4LG4A 5KNJA 5HQ0A 5HHWA 5E92A 3UZTA 2XCKA 3VUMA 4RJ7A 5AR2A 3WE4A 4FICA 3RAKA 3D5VA 4BDDA 4AT5A 1YOLA 2VTRA 3UIXA 3UG1A 4DFZE 3UPZA 5JFSA 4F6SA 3S4QA 4GVAA 5AUZA 2ZV7A 2OWBA 4USFA 2YIYA 4I5MA 4U8ZA 2B52A 2IN6A 5EYKA 4B8LA 4DTBA 4HNIA 3WIKA 2Z60A 3UG2A 3ZMMA 4GIIA 5DEYA 5IQAA 1PRYA 1G8SA 3E3PA 3KRLA 2CKEA 3RP9A 4E8AA 5F1ZA 5JSMA 4HCVA 1JWHA 1O9UA 4FKUA 3OT3A 1YI4A 3DAKA 4N4SA 1TQPA 2AC5A 3PTGA 4P5ZA 2OXYA 2VX3A 5I3OA 4R1VA 4M8TA 4QMXA 4W4VA 4EKKA 3ZBXA 3TYKA 5HG7A 3UGCA 3AOXA 3QU0A 3W2OA 2QURA 1BX6A 4IM0A 4OTQA 3TNIA 2DS1A 1JPAA 2NPQA 4RIXB 4FL2A 1ZOEA 4O0WA 1ST4A 3PVUA 1H1QA 3NUUA 4ITHA 4O27B 4QTAA 5KMMA 4YZNA 5J87A 3QRJA 4J1RA 4L6QA 3V5JA 5F9EA 4S33A 4C4IA 3LCOA 4U9AA 4FTKA 3FMNA 5C8MA 3VUTA 1JBPE 3LOKA 3R02A 4YO4A 3QALE 3RTPA 3LCKA 3WE8A 4E6AA 4F0IA 2AEGA 4FBXA 4KKGA 1FVVA 3QUDA 2VO7A 4PQNA 3D0EA 4GK2A 3SDJA 2QHMA 2WELA 2PMIA 2VWXA 2DYLA 2BMCA 2V5QA 3U54A 1DAWA 3TZ7A 2UZNA 4YC6A 3MN3A 4BDGA 4R3PA 5CSXA 1ZXEA 4FE2A 1QPJA 4KIPA 2UW3A 4E4XA 4DGNA 2BDJA 3F5UA 3RM6A 4G3FA 3IDPA 1O6YA 3FHIA 4LUEA 4FG7A 2OF4A 4JX3A 2ZM4A 1PYEA 2I0HA 4AXFA 5E8VA 4PV0A 3L1SA 4U79A 5HE1A 4EOIA 2B9JA 3CQEA 2ONLA 4FKJA 2FSTX 3FAAA 3KXXA 4RX8A 5JGBA 1JSTA 4XRLA 3R9OA 3LFSA 2BKZA 4AT4A 3UOLA 5KMIA 3SHEA 3CXWA 3PP1A 4JDIA 5AM7A 2YM3A 4IIRA 3JVSA 2VWZA 3M11A 3VN9A 3MJ1A 4ZTNA 4F70A 2YCRA 3NUPA 4M97A 2YLEA 2HWOA 4EOPA 4UYAA 3ZLWA 3OROA 2YWVA 4H3BA 2XJ2A 5EHLA 4RVTA 2X4FA 3ZDIA 4NFMA 1FOTA 2GHLA 2YM8A 5JGAA 4IJPA 4J53A 3HMIA 2ITZA 4FV1A 4C4EA 3AGMA 4ZY4A 4ZS4A 4NEUA 4RJ6A 3CD3A 4KBCA 4A4OA 3MH3A 3CGOA 2C1AA 4XOZA 4MWHA 3NUNA 1XMMA 3WYYA 3NLBA 3FKNA 3PXZA 3CTQA 4AGCA 3ZSIA 1PXIA 3AC8A 5AAEA 4C61A 3Q9WA 3A8XA 3MA3A 4UMQA 5HCZA 4BICA 2WQOA 4IFCA 3MBLA 2X7GA 3OWPA 3JYAA 4U7ZA 4FKVA 3QC9A 3FMEA 5LVNA 5M09A 4RC2A 4MBIA 3Q6UA 4X7QA 4IAAA 1K3AA 1OIRA 4CT1A 4EJNA 4O86A 5M44A 4TKSA 2JKQA 3UOJA 5IMEA 1GZNA 3NMUF 4L7SA 2ZV9A 4JL9A 2ZFYA 3TJCA 3TKUA 3UO6A 1SNUA 1UNLA 3ZRKA 3MI9A 4XV2A 4DFXE 2GFCA 5KMNA 1ZZ2A 4CRLA 3AT2A 3AXWA 1CKJA 2Z7LA 3CD8A 3BBWA 4OW8A 4QP9A 4U3ZA 4H39A 4G3GA 5E90A 3BKBA 5AEPA 5CAQA 4XS2A 1Q97A 2H96A 2ERKA 5EI8A 4LGGA 4L42A 3V6RA 3ORXA 3C4CA 2P3GX 5CAUA 4TRLA 2WU7A 5JZJA 4J96A 1DM2A 3A7JA 4X2FA 4D1SA 3EL8A 4O81A 4WBBB 3T3VA 4YZBA 1GOLA 4WUNA 3P23A 2I0VA 2EU9A 3KB7A 4D5HA 1I09A 5BMMA 4I22A 4C2WA 5A6NA 2HW6A 1WVWA 5TKDA 2EXMA 4GFMA 4XH6A 4ZY6A 2ACXA 3BPRA 3A60A 3KMUA 1FBNA 5JK3A 2VTNA 2IEWA 3I79A 3KULB 4I0RA 1OZ1A 3EQDA 1V0BA 2WTKB 2HZ4A 4WKQA 4DLJA 1DS5A 2X7FA 2ITTA 3DK6A 4JG7A 4M68A 4PNIA 5EM8A 3ZLSA 5L8KA 1PMVA 4FIFA 1GZ8A 3PWYA 2VWBA 5E9EA 3QTXA 5AR4A 4JS8A 3R7EA 3U4WA 3EJ1A 4U97A 3NUXA 4EBWA 1R39A 4K33A 2GS6A 4QMLA 4APCA 5EQYA 5D7VA 2JAMA 3ZO1A 4EEVA 2BAJA 4PMSA 2PYWA 2I0EA 2CN5A 1PKGA 5AMNA 4QEBA 2EB3A 3W2CA 2QOLA 2WMAA 4A9RA 2XK4A 3KL8A 2WZJA 1P2AA 3MDYA 4F09A 5EG3A 4NT4A 3HV6A 4NH1A 5ITAA 5IDNA 4X6RA 4QMTA 4MYGA 4ZSEA 2YM4A 4NCTC 3RAIA 4WD5A 4XLIA 4IM2A 4HVHA 3F2RA 4ALWA 3DS6A 2FGIA 3OBGA 3GNIB 4FA2A 1URWA 3K5VA 5JMSA 3VONA 4NTTA 5AP2A 3OG7A 2VNYA 3IGOA 5DWRA 3ZLXA 4QP3A 2XNOA 4KWPA 4CCBA 4BY9E 5HBEA 2X9FA 3HMOA 5IEXA 2A2AA 3IGGA 3QCYA 4DBXA 3I5ZA 1KE9A 2JD5A 4I1ZA 2ITOA 4XV1A 3VAPA 3L8XA 3UP7A 4AOTA 3B8QA 1RDQE 5JH6A 3I5NA 3PJ8A 2J90A 2JGZA 5BVKA 4BRXA 4XJ0A 4ZTLA 3NYVA 4EOQA 3O7LD 3QF9A 4FTNA 3NNVA 5L3AA 4O7VA 1ZOHA 3QTWA 3MH0A 3Q9XA 4YU2A 1QCFA 4GUBA 3LJ0A 2O8YA 5CX9A 4AZEA 4CFXA 5C8KA 1OPJA 5CF4A 4BDFA 5IA4A 2IZSA 2W1IA 3O23A 3ML1A 5FTQA 4RMZA 3ZC6A 4AT3A 1A9UA 1H08A 4IX6A 4BJJA 2I7QA 4NTSA 3E8NA 3SRVB 2WTJA 4AGDA 4I6FA 3BEAA 4MWIA 3DCVA 2W17A 5H8EA 2ZV2A 5DR2A 4RVLA 2E9PA 4O0SA 1XMLA 4MD9E 3GCQA 3BHUA 4QOXA 3ZEWA 1QPDA 2OFUA 5EK7A 3MV5A 4JLCA 2C6KA 4EQMA 4GIHA 2ZOQA 4L00A 5HO8A 2VX1A 4XOYA 5KMLA 3CKWA 4IB3A 1R1WA 2R3MA 4TYEA 3BU3A 3F82A 4Z7HA 5M4CA 2HXQA 3FHRA 3HV5A 5IEYA 2OJGA 3NWWA 3PWDA 3Q5ZA 3BE2A 4I92A 4RIWB 3NUAA 4PP9A 2YJRA 2VWVA 4IB0A 4DH3A 2XBAA 3FLSA 2X4ZA 3OOGA 4G31A 4G6LA 4IC8A 5DLSA 4AAAA 3VS0A 4BDBA 4EH4A 4K0YA 1SZMA 3E8CA 4QP2A 5E4HA 4O2PA 4EOMA 2GSFA 1Q8UA 4AA4A 5DRBA 2BAQA 4U80A 2R3GA 1OL6A 4L8MA 4FSNA 2HCKA 5CSVA 3MVMA 4XP0A 4ZEGA 4F9BA 4QP8A 4AW0A 4DGOA 4C0TA 4CMTA 5HI2A 2OZAB 3EB0A 4YBKA 5K4IA 4IB5A 1J91A 5AWMA 2PVLA 4IEBA 4FKQA 4B8MA 3PPKA 5IA0A 1TKIA 2XALA 3QUEA 3F6XA 4HZSA 3UQCA 3Q32A 5L8LA 3PRIA 3U55A 4Q9ZA 4APPA 2ESMA 3CPCA 3OCBA 1FVTA 2C0IA 3VUIA 1NT2A 2REIA 3I0OA 4EQUA 1XBAA 2FO0A 1J7UA 4L7FA 1W83A 3EWHA 4MUQA 4DHZA 1KE5A 4OAVB 2KTYA 4K1BA 2R3NA 2X9EA 4DDGA 1NA7A 3BLAA 1XH6A 5CZHA 3TNQB 3C5UA 4FKPA 3F7WA 4DTAA 4DH7A 3WZDA 2XM8A 3FZ1A 3SGCA 4L3JA 3POOA 4BCHA 3ZZWA 3KRXA 4IVBA 3DPKA 4EC8A 3DBDA 4J71A 2PSQA 4DINA 3QZGA 3OW3A 2EB2A 5HX6A 3DKOA 3U51A 3DXNA 1BMKA 2B7AA 3KQ7A 3OVVA 4DDIA 1WAKA 4I24A 4U43A 5BPYA 1OUYA 1IR3A 1SM2A 3ZRLA 5IQDA 3VNTA 2PHKA 5C26A 1LPUA 4JJRA 2Y9QA 3ORIA 2UVXA 1OGYA 3H0ZA 2Z7RA 3F3UA 4FTCA 2PE1A 3UJGA 3VUGA 3L9PA 1OKZA 3E8EA 5A4TA 3WI6A 3PIZA 2FUMA 1AGWA 2CGXA 2J0MB 4BFMA 4WRGA 5HCXA 4CQEA 2WMXA 4O6LA 1OL2A 3RPVA 4FMQA 3FYJX 1W82A 3ZU7A 3MVJA 3RHXA 3P7AA 2C5YA 4EORA 3A7FA 1YXXA 2ITUA 4TWNA 3CLYA 3LFDA 2ZYBA 3FQEA 3C4ZA 3MH1A 4I6HA 2W1HA 4NJDA 4CFNA 4EHZA 2CDZA 3IS5A 5E8YA 4FZAB 3IOKA 4DN5A 4QMUA 3EKNA 1PYXA 4OTRA 5J79A 1URCA 5AIRA 4PMMA 5KMOA 2WMVA 2W7XA 3FE3A 4LL0A 4IWOA 1Q62A 3VHKA 4CD0A 5E8WA 3RHKA 1T46A 1SMHA 2VTIA 3TZMA 4UV0A 5FM3A 3V5TA 5E1SA 1RJBA 5J9ZA 3SOAA 4R7IA 1KV2A 3FI3A 4AE9A 4EK6A 1VEBA 4GYIA 2WU6A 3EQRA 1H4LA 2JAVA 3DV3A 3ZFYA 5IA2A 3MVHA 1W2CA 2BCJA 4E5AX 1NW1A 3ZHPC 3FY0A 1ZMUA 5CEQA 2HXLA 4FOBA 1PXNA 4GK3A 4U45A 1U5RA 5J95A 2QOCA 4PDYA 2O63A 4GW8A 5G1XA 5KKRC 5A9UA 5LVPA 3LM0A 4G6NA 5A46A 5B2KA 4AXAA 2QLQA 2VWUA 5AA8A 3JUHA 5AP0A 4LRMA 1OECA 2YABA 1XHAA 1ZZLA 4UMTA 5CALA 2OFVA 4O4EA 4C7TA 2ITNA 5BQ0A 1JLUE 2WOTA 4Q2AA 3SLSA 4BBEA 3QA8A 2B9IA 3VS7A 4L67A 4CV9A 4D55A 4O7SA 3KEXA 4EH2A 3BCEA 3H3CA 3V6SA 2C5OA 1GAGA 3KIOC 4FNWA 3KCFA 4J52A 4O7WA 5IQIA 3QFVA 4C34A 4XG6A 3PIXA 2XJ0A 3PIYA 5KHWA 1H0WA 1WBPA 4YJSA 3V5QA 2C4GA 2X6DA 4XMOA 4ZZOA 2O65A 2OZAA 3LE6A 1JKKA 4HYUA 2YDKA 3UVPA 4RA5A 3SXSA 4E93A 3R7YA 3I7CA 1ZARA 2A0CX 2OJIA 3EMGA 3FPMA 3Q60A 3VBVA 4BCIA 4QMQA 5IQGA 2AYPA 1XH4A 1YWVA 4QP1A 4ZOGA 1Y57A 3AKLA 3JY0A 2E9UA 4M66A 4EH7A 4DHFA 4KKEA 5CF6A 4C3FA 2J4ZA 3N51A 3CP9A 1WBTA 4ZAUA 2FH9A 2VWYA 3C7QA 3UIUA 1KE8A 4AE6A 1VYWA 1ZLTA 4HCUA 4LYNA 4M7IA 1TFFA 3VRYA 1U46A 2UZEA 4O7TA 4ZTSA 5FEEA 2PWLA 3IW6A 4E4LA 4DG3E 5FTOA 3RAHA 5JEBA 2W1DA 3QZFA 4IWQA 3RVGA 5HIEA 4CG9A 4YZ9A 2B4SB 3ALOA 3VF8A 4G34A 1SVEA 1ZYCA 3SW7A 1OKWA 3I60A 1OVEA 3HAMA 3EZVA 1CKIA 2WMQA 4FG9A 2RL5A 4E6QA 1BI8A 2WTIA 4FVQA 3C4FA 4LOOA 1GZKA 2G1TA 1RW8A 2PE0A 2PMNX 3OXZA 3V51A 3VQUA 4C57A 4D4YA 3MPTA 4I93A 4DHJA 4IWDA 4H05A 5C4KA 3DKFA 3OC1A 3HUBA 4CVAA 3QC4A 5GJFA 3PFYA 4L45A 3C1XA 4IC7A 2P55A 2XEYA 3CTJA 4YZCA 4ZZMA 5TOZA 4KIKB 4ZLZA 5B7VA 4DF3A 3C0IA 4F0GA 3LZBA 3VS4A 3KK8A 5FQDC 3IONA 3EKKA 1R3CA 4M14A 5BVWA 3G51A 4E3CA 1GNGA 1GIJA 5AV2A 2P0CA 3EFWA 3LFCA 2B9HA 3MYGA 4MBLA 5D11A 1XH7A 2UW5A 2R4BA 3FMJA 3G9LX 3PE2A 4KD1A 2PVFA 2VNWA 4GEOA 4FIJA 4BL1A 5J7BA 3F5XA 3RGFA 4FIHA 4FT3A 3CGFA 1H1WA 4F6WA 2CNQA 4R1YA 5M06A 1XH5A 3GOPA 2OXXA 2X2KA 2E9NA 3QCSA 4J98A 4O21A 5D12A 3FWQA 4YPDA 4RPVA 3BYUA 5BVEA 3ZC5A 3VS3A 4DEEA 3GCSA 5AP1A 4FJVA 3E92A 3P7CA 3VBYA 4PDOA 1R78A 2YDJA 1OBDA 1YW2A 3I7BA 4OTIA 1Q99A 2B54A 4TN6A 4RLKA 5IZFA 2QOHA 2GHMA 5KCVA 4YC3A 2YA9A 3WBLA 2G2HA 4O96A 1YXTA 4ASZA 3D94A 3H9RA 4UN0C 1G8KA 5HG9A 4ARKA 4K8AA 4L3PA 1XH8A 2ZDUA 2UVYA 4JG6A 3G90X 2VTTA 3AC2A 4ORKA 3A4OX 2BZHB 2CCHA 5I4NA 3B2TA 4CYIA 4LDTA 2C6MA 4O4BB 4D4SA 5KHXA 4I6QA 4AXDA 1XBCA 4L68A 3S2PA 4NZWB 4MBJA 4BWXA 5KMJA 1J1BA 5CWZA 5M55A 4BCFA 5IA3A 4NKSA 3TTIA 4GFGA 3FQHA 3QYWA 3ZYAA 4BIBA 4N6ZA 3OOMA 2F9GA 1PXOA 4U6RA 3PUFC 3QZHA 2C6IA 5FDPA 4BJJB 2BZJA 2G15A 4LGDA 5CEPA 1UVRA 1XWSA 3PVGA 3QTZA 3ORNA 4M12A 3OD6X 4QMYA 4ANQA 3DA6A 4UWBA 5KZIA 3REPA 3UTOA 2C30A 3COMA 4DBNA 3O8TA 5EHOA 2PVYA 4EONA 4PRJA 3L8VA 3QXOA 3V5WA 3EL7A 1ZWSA 5DT0A 3ORLA 4FV0A 1U54B 4JQEA 2YN8A 3NIEA 4EI4A 4M13A 3RALA 1SYKA 2GNIA 5DGZA 1Q8YA 3LFEA 5IQBA 4H3QA 3NS9A 1B39A 3I81A 4N0SA 1ZYLA 3OXIA 3GGFA 1WFCA 1GZOA 3E93A 3G6GA 2HZNA 4MQ1A 4R8QA 4RIWA 5LMAA 3D5UA 3UBDA 3MWUA 2QHNA 4Y5QA 5A14A 5JFWA 4YGAA 3TIZA 2QD9A 3V5LA 3HZTA 1P14A 3D2KA 4OTDA 3VJOA 5LMKA 2J5EA 2W5BA 3WIGA 1OL7A 4CFUA 4K11A 2XKFA 3Q53A 2YDIA 3O7LB 5IISA 2QO9A 4QQ5A 2J2IB 2QCSA 2VN9A 2W5AA 1XH9A 3GC0A 3NNUA 3OHTA 3FZOA 3R8UA 4H36A 4BF2A 5E91A 4NJ3A 2QU5A 3AMBA 3DLSA 4JBVA 4QO9A 5I9WA 1PXJA 1O6LA 4ALUA 2VTAA 5KBQA 5IH6A 5DT3A 2OO8X 1FGIA 4IJ9A 3DGKA 4BDHA 2JIIA 4KABA 4IZ7A 4LRKA 2IW8A 5M4FA 3ZRMA 3GCUA 1REJA 1AQ1A 2I0YA 4FKIA 1ZY5A 3T8OA 3LXPA 4YJVA 1Y91A 3Q6WA 4F63A 2W1FA 4IVDA 4NM0A 3N4UA 4ONAA 5EQPA 3KA0A 2Z2WA 3OBJA 5DT4A 4JBOA 5HLNA 2QOIA 3QQLA 1YXUA 4FV2A 4IZAA 4RIXA 3ORMA 3OEZA 3WYXA 3TZ9A 4D4VA 4D2SA 2Y4IC 3I1AA 4FKGA 3C51A 4ZP5A 3R73A 5IUIA 1REKA 4RJ8A 1ZYJA 3MIYA 4FKSA 4P5QA 4Z7GA 2OXDA 3KCKA 4K77A 2RG6A 4FZDB 2I1MA 3EFKA 4ITJA 3TT0A 4U42A 3FY2A 5EOLA 4FC0A 5HVKA 5ETIA 2PUNA 3R2YA 4WUAA 2F2CB 2IVVA 4QNAA 5FLFA 5HO6A 4P90A 4JQ7A 2IZTA 3U6HA 4WRSA 4WG4A 1XR1A 5KX8A 3RINA 4HVIA 4AAYA 4EZ7A 2IJMA 3O96A 3CJFA 2CMWA 4HNFA 3ROYA 2F57A 3HKOA 4FF8A 4IACA 3GT8A 4MH7A 4IX4A 5AUXA 3W2QA 4FTTA 4FEWA 4NIFB 3F66A 2BZKB 2BAKA 1P4OA 2QR7A 5F20A 1KE7A 4KRDA 4RJ3A 5H9BA 3WZJA 5EI2A 5FRIA 3MY5A 2HAKA 4UALA 3VS5A 2C5VA 4PY1A 4NM3A 5IMXA 3TNWA 4UMUA 2E2BA 2FSLX 3A8WA 5T68A 2BRNA 2VUWA 5J1WA 4Y73A 3GC8A 3DB8A 4GG7A 4GG5A 1PKDA 1SVGA 5HESA 2R3QA 2P4IA 3F69A 3OCSA 4TWPA 3UQGA 5J9LA 3UO4A 2RFSA 2XNMA 2XZSA 4PMTA 3H0YA 2R5TA 3QCXA 3GU8A 1IEPA 4K2RA 5AM6A 1LR4A 2QOFA 2CPKE 4MCVA 5EM6A 4XG4A 5CLPA 2WQEA 4AUAA 1PMUA 4RQKA 3ZSHA 4BIEA 3OXTA 4RIYA 4BTKA 4CTBA 4K9YA 2R3JA 5EHYA 4FEQA 5IU2A 3LKMA 2JLDA 2OKRA 2O64A 4I5PA 4KIQA 4EUUA 4E5BA 3KF4A 3L9MA 3ODZX