4R63A

Binary complex crystal structure of r258a mutant of dna polymerase beta
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIALIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-induced DNA Polymerase beta Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4r63A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4r63A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4r63A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4r63A03
4QWDA 4I2BA 4DSKA 1V4AA 1UT8A 5IIKA 5DDMA 4E0DA 5DDYA 5J2BA 4I2IA 4IR1A 4O5EA 9ICBA 3G6YA 3RAQA 4F8RA 3HJ1A 2FLLA 3JPSA 3RJIA 3MR6A 4C8KA 2FLPA 2UVUA 4AT7B 1ZQIA 4WC2A 4I2GA 4M9JA 2ZH7A 3N97B 1N48A 4ED2A 8ICYA 3RB3A 5CR0A 1UT5A 3RJGA 3RAXA 4UQGA 1Y88A 2NRZA 1MC8A 3C1ZA 1SL1A 1NOMA 3C66A 4C8NA 4YR2A 5BOMA 3EWAA 1L3VA 9ICEA 1SKSA 3MGHA 2ZUBA 3EPGA 2NRWA 4BXOB 4XQ8A 7ICJA 1RXWA 3H37A 1UA1A 2PBEA 3OJSA 4PHAA 3Q8KA 9ICLA 4YQWA 3ZDCA 3PW4A 1ZQKA 5J0PA 4DFJA 2M2WA 2ZHBA 4KMUA 5HMMA 4DL3A 3IHQB 4O0IA 4UBBA 3FYHA 2ASDA 1L5UA 4MEXA 3RB6A 1Q78A 5HC9A 2PXIA 3RTVA 1TFWA 3GV8B 3ISBA 4IRCA 1ZQQA 3HWTA 4K4IA 1TKDA 5DLFA 2FMQA 4K4HA 3RH4A 4XUSA 4M9HA 2M2UA 4WC0A 5KFFA 3T3FA 1C7YA 1D8LA 4JK1A 2BPFA 4ECXA 4E80A 1XSPA 1UEUA 3C5GA 2DPJA 4ELTA 5DG8A 5J2GA 3EYZA 4DSFA 1XSLA 4FH5A 2ZH5A 3EW9A 3GIKA 8ICIA 1SKWA 3NTUA 2HHVA 5HRHA 4R63A 5KT4A 3H4DA 4JV0A 3PV8A 2JEFA 2BQ3A 4DLGA 1XSNA 9ICGA 4J9NA 1NK4A 5KG1A 1ZQMA 5KFUA 2FPMA 3UPQA 4M5DA 2DR7A 4KITB 2NRXA 1SL0A 4I2HA 2ZH1A 4R66A 1QSYA 1WCNA 4DSJA 1NZPA 3T5JA 4JWMA 4GXJA 4YCXA 4DO9A 1TAQA 4NXZA 4F2SA 3GV5B 1U48A 3ISDA 5HRBA 4QZCA 9ICNA 2FPKA 3MDCA 3FDSA 1ZQHA 4RUCA 4ECTA 5J2KA 1X9WA 2ISPA 4LZGA 3ZDBA 1KRPA 1VJ7A 3C2MA 3RJHA 5KFYA 4UB4A 2IMWP 4I28A 4IRDA 2KFZA 4J9KA 5J2CA 1X2IA 2AU0A 3OVBA 4ED7A 3AQMA 1U45A 2V9WA 5CWRA 2AGQA 2HHTA 4RWPA 2BHNA 2V4RA 2DFLA 1XS9D 5DKWA 2R8IA 1QSLA 5KFOA 3RR8A 4IQUA 1D9DA 7ICUA 2R8GA 5KG2A 4O3RA 4X4QA 3PO4A 9ICVA 4DLEA 1B22A 2UVRA 1TV9A 4PHPA 8ICOA 3OSNA 4B9LA 3TI0A 1KFSA 4J9RA 2WTFA 8ICVA 5D49A 5IINA 1NKBA 1NK9A 1NK6A 4I27A 1MIWA 4I29A 1DGSA 2MUTA 4F92B 3OHAA 4WCWA 4M47A 2ID1A 4EBDA 4XQ7A 3OVAA 9ICRA 4RPYA 1D9FA 3OGUA 7ICSA 2FMPA 2KZMA 4F4WA 4KLJA 5KFNA 2F1HA 5J2HA 2DR8A 3THVA 7ICNA 9ICHA 3JPTA 4RQ7A 3KTQA 4Q43A 4DEZA 3GIIA 5J0XA 4O3OA 4EBKA 4DL5A 5DB8A 3MR3A 2Y1IA 2DPIA 4E7XA 3HP6A 8ICBA 5DBBA 8ICLA 2VA3A 3PW0A 1R89A 2J6TA 9ICTA 3OUYA 1MQ2A 1Z00A 3TFSA 8ICQA 5DGAA 9ICXA 2B21A 2H5XA 1X9SA 2C2DA 3UXOA 3QZ8A 3GIMA 3PR4A 4DFPA 2W9CA 1JQRA 1OU5A 5DEDA 4FBTA 5F2VO 5J2EA 4KLOA 4NKTA 4UAZA 3H39A 4KN4A 2J6SA 1ZQVA 4RQ1A 4EEYA 9ICIA 3T5KA 3PMNA 2RFFA 2IHMA 1MIYA 2BQRA 2AGPA 7ICGA 4J9OA 4X4NA 4FH3A 2BGWA 1KFDA 5KFXA 4DS4A 4X4VA 4RQ3A 3GV7B 3C1YA 1RPLA 4M9LA 5J2DA 4X0BA 5CB1A 4IG8A 1ZQBA 4YN4A 2ATLA 1NO5A 3OVSA 2Q0ZX 2V4QA 2UVWA 4P2HA 1S0MA 2O5AA 5BPCA 4F3OA 4DSIA 2JEGA 2PI4A 4BWMA 9ICJA 4WC1A 1BGXT 8ICAA 2DR5A 3OSPA 3C18A 3LWLA 5KT3A 4IR9A 3L9DA 4MF8A 3JPOA 1S0OA 3G6VA 3KHHA 4UB2A 5HRGA 4AT7A 1R8BA 4F5RA 5D4BA 3MBYA 5F9NA 4I2AA 3LDAA 4ELVA 4J9SA 3C2KA 5KFIA 3UQ0A 4DFMA 4DL7A 9ICFA 4ECQA 2AQ0A 5J0WA 3T5LA 3Q8LA 1QLNA 1SKRA 2BDPA 5J29A 4FS2A 4X4PA 2ZUCA 4KLDA 5IIMA 4X0AA 4ECZA 3BJYA 1BPDA 2ZTEA 4QZ9A 1U49A 4FHWA 3QZ7A 5KG6A 3ISCA 3H40A 5KFLA 3HX0A 4FHXA 1KEJA 5BOLA 4P4PA 3GIJA 5KFVA 4F4ZA 4K4GA 2HHSA 3HIYA 1XWLA 1V9PA 3KHGA 1AROP 5KFCA 3Q8RB 1XO1A 5DLGA 2C28A 7ICHA 5J0SA 4X4OA 5KT2A 2KTQA 9ICUA 4X4SA 5KFBA 5DG7A 5KFWA 5KFDA 4GC6A 5J0QA 1R8AA 1TFYA 4FO6A 4C8LA 3H7IA 7ICFA 3H8SA 4F2RA 5DBCA 4F5PA 1T3NA 3V7LA 2DR9A 4UAWA 4X4UA 4Q8EA 4Z6EA 1IM4A 2W9BB 1S0NA 1ZQSA 3AUOA 4MFFA 3WFSC 2P6RA 5J2AA 2ZH8A 1ZQLA 1TFRA 3UXNA 4EYIB 2M2VA 3OV7A 5J0RA 1Q79A 8ICZA 5HHIA 1KLNA 2HHQA 2HVHA 3ZDDA 4R8UA 2XY6A 3JPPA 4NM2A 2ASJA 1BPBA 4RT2A 4ECUA 4EZ6A 2HHPA 4RQ4A 4WC7A 5KFKA 2XGQA 2I1QA 2ZJAA 3Q8MA 4NLZA 1S77D 1U47A 3OUYB 5L1IA 3PW2A 1ZQXA 3ZD8A 1U9LA 1T8EA 4DOCA 4F5NA 1HUOA 1BPZA 4NLKA 2KFNA 8ICFA 1N56A 3T5HA 2ZH6A 4KLEA 5HRFA 3JPNA 4FHVA 5CA7A 4DQIA 3Q8PB 4JV1A 1COOA 2ASLA 1F5AA 1X9MA 1LV5A 4CCHA 3BQTA 5KFMA 1LB2B 4F91B 3OHBA 9ICOA 3V7KA 4AT9B 3M8RA 2JEJA 1ZQUA 4ED1A 2XY7A 5DECA 4TQRA 3BQ0A 3SV4A 1ZQOA 4XRHA 2MAXA 4YXMA 4UB3A 3KHRA 3TFRA 1KSPA 2PI5A 4YFKA 3JZ0A 1KNYA 5KTQA 4M9NA 3HJ4A 4NLNA 3RBDA 5KFSA 4RUAA 2OWOA 4KLHA 2KZZA 1NK7A 4F5QA 2A1JB 3GDXA 8ICHA 3ZDAA 5HRDA 7ICEA 4ECSA 3RH5A 2ISOA 1UEVA 3KHLA 5IIIA 1QSSA 4M6WB 3LK9A 1ZYQA 5L1JA 3UPSA 3ORYA 4F93B 4TUQA 4YR3A 8ICPA 4G3IA 2DRBA 4R64A 3M9MB 2JZBB 4B9VA 4RQ0A 3UQ2A 5HREA 5CP2A 3PR5B 1RYSA 4Z6DA 4Q44A 4DL2A 1A76A 5D46A 3V6KA 4B9UA 8ICSA 4ELUA 3WFPA 2MUTB 5IIOA 3RJKA 2JEIA 1TK8A 4ED3A 2PFQA 4I2CA 4ED6A 4KTQA 2ZH3A 2ZJ5A 4J9QA 1TVAA 2O1PA 5J0OA 4KN7A 3V6HA 2ALZA 2BPCA 2XCAA 4ED0A 4QW9A 4RQ2A 3BQ2A 3H8WA 5KG7A 3HPOA 2PFOA 1UETA 1ZQYA 1U4BA 1BPXA 3SV3A 4RNOA 4KLIA 3PMLA 1NK0A 4B9TA 5HRKA 4ATBA 4WC4A 2AJQA 4X4RA 3TAQA 4YD2A 2BKEA 4P4OA 4RPXA 4DF4A 3H8JA 3QEAZ 9ICMA 8ICKA 4EBJA 5IIJA 1R8CA 4Z6FA 3RB0A 5HP4A 3TAPA 4O3PA 4O3SA 1JX4A 1MQ3A 5DG9A 4R65A 4DQRA 3OJUA 5KFHA 2FMSA 5KFZA 2IBKA 3RJFA 4DFKA 5F9LA 3PW5A 5DQGA 5J0UA 3QEBZ 1ZQCA 3AQKA 4YMOA 4F50A 3V72A 2HVIA 2C22A 7ICMA 7ICIA 3B0YA 5DQHA 4AT9A 2A1JA 5L1LA 1BPYA 1ZQDA 5IILA 3RB4A 3C5FA 3NGDA 1H38A 3TQ1A 4ED8A 3TANA 5DB9A 2FLNA 1ZQWA 4RZRA 4Q45A 4UBCA 4MFCA 3MR5A 1UA0A 4JV2A 4TUPA 2XO7A 1ZQPA 1NJWA 4DOBA 3PNCA 5EWGA 5DB7A 2I9GA 1PZNA 4B9MA 3AQLA 1KFTA 2GWSA 3E2EA 4QZIA 4O5KA 1RXVA 4FBUA 4YR0A 4BDPA 7ICRA 4O5CA 4O9MA 2W9AA 2NRVA 3GILA 3G6XA 4QZAA 3EZ5A 4DS5A 2BCSA 2VA8A 4DF8A 4YP3A 3MR2A 4DSLA 4KLSA 3C2LA 4J9MA 3QE9Y 4JUZA 5L1KA 1SL2A 1ZQTA 4NLGA 4NM1A 1S76D 9ICAA 2XCPA 2M2TA 5KFTA 5KFGA 1Z3EB 4M04A 4KLUA 4ECWA 4J9LA 4QZGA 4PH5A 1RZTA 4WC3A 3GQCA 5KFAA 9ICWA 2C2EA 4QWBA 4UAYA 2Y1JA 2R8KA 4MEYA 1MSWD 1IXRA 5KFQA 4YMMA 1ZQFA 4YD1A 4TQSA 2NRTA 3MABA 2Q66A 2ZTDA 5EWEA 4DL4A 5KFEA 4RU9A 8ICNA 2ZH2A 2RDIA 2VANA 4RWQA 1FA0A 4QZHA 5J2FA 2XC9A 4HYKA 3RH6A 1K1QA 4R8UB 1L3SA 8ICWA 4DQQA 3PO5A 4QZEA 5EWFA 2M9NA 4MF2A 9ICCA 7ICLA 2DRAA 4O3NA 4C8MA 7ICVA 5CHGA 1JN3A 4WC5A 7ICTA 2ZH4A 3SI8A 1ZQAA 4PPXA 8ICMA 4RWNA 1YLQA 9ICSA 5TZVA 1XU4A 4FS1A 3PX0A 4JWNA 1RYRA 2VA2A 4BXOA 2F1IA 2HW3A 1BNPA 2BPGA 3C21A 4GLXA 4DL6A 4M2YA 4O3QA 4FHYA 4P4MA 1JAJA 1D8YA 2BE3A 4RWOA 4J9PA 5KG0A 4QWEA 1PX5A 5KT7A 4IRKA 3EPIA 4KLFA 4F4YA 1BVSA 1WOTA 4XA5A 2KP7A 5HNKA 1DK3A 5KT6A 4B9NA 3H4BA 4RQ5A 1NKEA 4UB5A 3ZD9A 5DGBA 2AGOA 2BR0A 1XC9A 4EP7A 4RNNA 2XY5A 2W8KA 2PFPA 4KLQA 2ZTCA 1NJXA 5KFPA 4TUSA 4IQTA 1S0VA 3BDPA 2F1JA 9ICQA 1A77A 4LVSA 1CEZA 2NRKA 4YVZA 5J2IA 1T7PA 3AU6A 8ICRA 5HRLA 4DWIA 1B43A 4QWAA 1JIHA 3IM1A 3JPQA 2ZUDA 3PVXA 8ICEA 4NY8A 4I2JA 3M9OB 2W8LA 4YMNA 5J2JA 3RR7A 3BQ1A 1DK2A 4AT8B 3H3AA 1MIVA 4TURA 4ATBB 4UD5A 1KDHA 3K75D 4E8FA 4Q8FA 1KTQA 3PX6A 3RBEA 4WBZA 4RPZA 5KT5A 2BCVA 1HJPA 1SZPA 3GFKB 4F4XA 1VFGA 5KFJA 3SZ2A 2BCQA 5HHHA 3B0XA 1BPEA 1ZQZA 3K4GA 4LZDA 1ZQRA 4KLLA 1NJYA 4IQVA 8ICJA 4UD4A 5HR9A 3WFQE 4EBEA 4I2FA 3LQCB 4BWJA 1ZJMA 2XGPA 4EYHB 7ICQA 2HHXA 2W9MA 3HW8A 3SYZA 4PHEA 4ECYA 3RRGA 2JZBA 8ICGA 1WCLA 3TARA 3UXPA 1L3UA 5HRIA 5HMLA 1ZQEA 4EBCA 3JPRA 4ECVA 4M9GA 4DSEA 1HUZA 4F5OA 1TAUA 2KN7A 2DVIA 5DQIA 4GXIA 1JXLA 2AQ4A 1CUKA 1S10A 4QW8A 2UVVA 4LT6A 1T4GA 2BCRA 4KLTA 4X5VA 2BCUA 4FHPA 4AT8A 3N4MB 4NKUA 1JXEA 4QZ8A 1TK5A 3RRHA 1ZQJA 2IA6A 4UB1A 5CJ7A 2J6UA 5J0TA 4GXKA 4DOAA 2PFNA 8ICXA 7ICPA 2P6UA 2RDJA 5DB6A 4QZFA 4PGXA 5L9XA 7ICKA 1DOQA 5J0YA 4PHDA 2BQUA 4EZ9A 1QTMA 1S9FA 4BGDA 3ZDEA 2ZJ8A 3NYBA 4WBYA 4ECRA 3PX4A 4DQPA 3H38A 4Z6CA 8ICTA 3AQNA 5DBAA 3WFRE 4F4KA 4I2EA 5EOZA 3M8SA 3V6JA 4YXJA 4B9SA 2HHWA 4QZBA 4PGQA 4ZH4A 9ICKA 5JUMA 1TK0A 1K1SA 3HT3A 4M6WA 3MGIA 2IHNA 3C23A 3PY8A 2HHUA 5KG3A 8ICUA 1ZJNA 4RQ8A 3Q8QB 3LWMA 1S97A 3RJJA 4KLGA 4WC6A 1ZQGA 3MFIA 5KG4A 2W9CB 2R8HA 1L3TA 1NJZA 2ZHAA 3MFHA 3M9NB 2P66A 4PGYA 2ZH9A 4RT3A 1Z00B 4QWCA 2KZ3A 2R8JA 8ICCA 5KFRA 4DQSA 2C2RA 1NK5A 1BNOA 2W9BA 2LYHA 4RQ6A 3JYYA 2FPLA 4S3NA 3PW7A 3WFOA 4YG2A 4QZDA 9ICPA 4I2DA 4RNMA 1EXNA 4MFAA 3MDAA 1NK8A 1ZQNA 5C5JA 4KLMA 3V7JA 1JMSA 3ETLA 4GC7A 1ZETA 1NKCA 3RJEA 4IQWA 4M0AA 4X4TA 3Q8SB 5KG5A 3AU2A 4C8OA 7ICOA
chains in the Genus database with same CATH superfamily
5AKYA 2WF6A 1V4AA 3E58A 4IR1A 4E0DA 9ICBA 3T79A 3RAQA 2QB0A 2PMZF 2D3DA 4AT7B 1ZQIA 3N97B 4Y2TA 3RB3A 5AM3A 5CR0A 1N5XA 4O67A 2NRZA 1MC8A 3C1ZA 2CPRA 1NOMA 1L3VA 1SKSA 2K4HA 3EPGA 3Q8KA 9ICLA 1JALA 4DFJA 4CE6A 1Q8KA 4MEXA 1SWVA 3N7RC 3ISBA 5AI8A 1TKDA 5AM0A 5GTIU 4CF3A 3N7SC 4JK1A 2G5HB 2BPFA 2W3SA 3C5GA 3C29A 4ELTA 4DSFA 3GIKA 8ICIA 1SKWA 2JHDA 1J2NA 4R63A 2YMMA 4NXXA 1XSNA 2FPMA 3UPQA 4G9BA 2DR7A 4I2HA 4UAUA 5ALLA 4GXJA 4P0PA 3FDSA 1X9WA 2KVCA 5ALZA 3RJHA 4UB4A 4IRDA 2KFZA 3OVBA 5CWRA 2DFLA 5DKWA 2R8IA 3RR8A 4K99A 2F77X 4X4QA 1TV9A 4PHPA 2OXOA 5IINA 1NK9A 2ODGA 1NK6A 2QB1A 3OHAA 2KMDA 4EBDA 9ICRA 5AKLA 4RPYA 1D9FA 2WHEA 2FMPA 2KZMA 4F4WA 2F1HA 1PK1A 4C7YA 2KEYA 4RQ7A 2LHTA 5J0XA 2GAFD 2HBJA 5DB8A 2HBKA 1R89A 2J6TA 8ICQA 9ICXA 3AEVA 2B21A 1X9SA 3UXOA 4DFPA 3PR4A 5F2VO 3H39A 3T5KA 2EANA 5AKIA 1KFDA 5KFXA 4RQ3A 4IG8A 1NO5A 3OVSA 2Q0ZX 1KQQA 2JEGA 2LYBA 8ICAA 4Y2QA 3LWLA 3SEIA 2HN2A 3C18A 4MF8A 3JPOA 3G6VA 3KHHA 4UB2A 4AT7A 5F9NA 2Q4TA 3UQ0A 4DL7A 3Q8LA 1SKRA 5AK6A 3AL0B 1UCVA 5IIMA 4QZ9A 3QZ7A 5KG6A 5KFLA 4FHXA 3MCRA 2L5YA 4K4GA 1XWLA 1AROP 3I76A 5KFCA 2C28A 2M0NA 4X4OA 4X4SA 4NXVA 4GC6A 1R8AA 2Y9TA 3H8SA 1T3NA 5ALKA 4X4UA 2KJ9A 4Z6EA 1IM4A 2W9BB 1S0NA 2W7PA 3WFSC 1ZQLA 1TFRA 1V97A 2M2VA 1Q79A 2HHQA 2HVHA 2ASJA 2O6KA 2XY6A 2HHPA 4RT2A 4EZ6A 4WC7A 5KFKA 1S77D 5ALOA 3ZD8A 1N60A 1OUQA 4KLEA 5CA7A 2HN1A 4DQIA 4JV1A 1F5AA 1GPJA 3BQTA 5KFMA 5ALJA 1QQ7A 4ED1A 5DECA 1ZQOA 2K8AA 1KNYA 5KTQA 4NLNA 2ZXIA 2KSOA 1NK7A 2A1JB 5AICA 2YN4A 3WKBA 5ALEA 2ESEA 4G3IA 4R64A 3M9MB 3IG5A 2EZZA 5CP2A 1PK3A 2MSNA 5J0OA 4KLOA 2BPCA 4ED0A 4QW9A 3BQ2A 4WQLA 5KG7A 3HPOA 2G07A 1U4BA 1BPXA 5AM5A 4WC4A 3AM9A 2BKEA 4DF4A 2D6FC 5HP4A 1X42A 2HI0A 4DQRA 2D8CA 4R65A 1L7PA 2F8LA 2FMSA 4HX0A 3QEBZ 4YMOA 3V72A 2C22A 3WK6A 5EE0A 4AT9A 3D6JA 5L1LA 5H2FU 4Y2VA 2FLNA 4JV2A 1L7MA 4FZLA 3PNCA 4LEZA 3E2EA 4QZIA 1RXVA 2Y0SC 7ICRA 4O5CA 4K8VA 2W9AA 2NRVA 4QZAA 4LEYA 3RFAA 4DSLA 4J9MA 3QE9Y 5L1KA 1SL2A 4C4RA 2VIXA 2M2TA 4M04A 5KFGA 2KKVA 4QZGA 2Y1JA 1O08A 4TQSA 2NRTA 5EWEA 2QKQA 5KFEA 3F2BA 2ZIVB 3RH6A 4FZMA 4R8UB 2G06A 2M9NA 7ICLA 1MN8A 3SI8A 1ZQAA 4JLZA 4CF5A 4UATA 9ICSA 4FS1A 1KBUA 4BXOA 1X6IA 4GLXA 2RHFA 1D8YA 2CXYA 1Z4NA 4F4YA 4XA5A 2KP7A 1DK3A 5HNKA 1NKEA 4UB5A 1ZD3A 3ZD9A 2AGOA 2FDRA 2IOFK 2XVTA 3AU6A 5AK5A 5HRLA 8ICEA 4QWAA 3IM1A 3PVXA 3CRXA 4NY8A 3M9OB 3NVYA 2W8LA 4C80A 3BQ1A 3H3AA 4ATBB 4UD5A 3PX6A 4P0PB 5B66U 3QXGA 2E5SA 5KFJA 2ZIXA 3SAHA 1BPEA 1ZQRA 2OM6A 4DCCA 4UD4A 5D63A 2ZXHA 2XGPA 5ALFA 1NI3A 4EYHB 2W9MA 5A0LA 3JCFA 2EZYA 3RRGA 8ICGA 4LEVA 3WU2U 3PSIA 4NJ8A 5HMLA 4M9GA 4US9A 4DSEA 5DQIA 1JXLA 1S10A 2UVVA 2BCRA 1VLBA 1JXEA 3RRHA 1ZQJA 4UB1A 4GXKA 4FZNA 3AQEA 3KKAA 4WBYA 3PX4A 4Z6CA 3WK9A 5DBAA 2JH1A 3PZPA 2HHWA 4YXJA 4B9SA 1TK0A 2LM4A 8ICUA 2CRXA 3MFIA 1CI4A 5KG4A 2R8HA 1L3TA 3M9NB 4PGYA 2HBLA 4B6JA 4DQSA 2C2RA 5J8YC 1BNOA 1NK5A 4WQKA 3BQ7A 1SWWA 2YMQA 4PL2A 3WK4A 3MDAA 1EXNA 1NK8A 1ZQNA 4UAVA 3V7JA 4M0AA 4IQWA 5KG5A 2LKYA 4KX5A 7ICOA 4QWDA 4DSKA 5KAFU 4O5EA 5DDYA 4I2IA 2H3ZA 4HAIA 3HJ1A 4F8RA 2FLLA 5EE3A 2FLPA 4ED2A 4IC9A 2LMRA 1SL1A 4C8NA 5BOMA 3MGHA 7ICJA 1RXWA 3PW4A 2AXTU 2ZHBA 2K4PA 1L5UA 3RB6A 3RTVA 3FC4A 3HWTA 3O0FA 3LVVA 3RH4A 4XUSA 4WC0A 4C7ZA 5KFFA 1D8LA 4ECXA 4E80A 3L5KA 4FH5A 1FIQA 2ZH5A 2MA1A 2WF5A 5KT4A 3H4DA 4JV0A 2BQ3A 5KG1A 4AYBC 1WUDA 1ZQMA 2ZH1A 4K9BA 3ICXA 1NZPA 5AKZA 4F71A 4JWMA 4YCXA 4DO9A 4F2SA 3GV5B 1U48A 3ISDA 2FPKA 3MDCA 1LKYA 4LZGA 3C2MA 1S5LU 5KFYA 2W03A 4Y2JA 2YX8A 5J2CA 1X2IA 4J9KA 1U45A 4EX6A 5KFOA 5ALMA 2PMZC 5ALWA 1D9DA 2R8GA 3QYPA 5KG2A 4O3RA 9ICVA 2UVRA 4B9LA 1SB3C 3TI0A 2WB1F 1KFSA 5ALDA 1RDFA 2WF7A 2Y9UA 4BJQA 2ID1A 3OVAA 2F2AB 3OGUA 1QQ5A 5KFNA 7ICNA 3KTQA 3F5EA 4DL5A 5AI6A 2DPIA 3MR3A 3HP6A 3PW0A 9ICTA 1Z00A 4NXTA 1AQ6A 2W9CA 1JQRA 5DEDA 4FBTA 2ZIWA 5J2EA 5AK4A 4UAZA 4UB6U 4KN4A 2J6SA 3SQIA 2BGWA 2H3VA 4DS4A 3C1YA 1RPLA 5J2DA 4X0BA 3KKAC 2V4QA 4Y2RA 2LYAA 5BPCA 4F3OA 2DGZA 1BGXT 3A0HU 3OSPA 2F8KA 5KT3A 4IR9A 3L9DA 1S0OA 2WAQC 5D4BA 4I2AA 4ELVA 9ICFA 2BDPA 1MA7A 5KAIU 5J29A 2ZUCA 4KLDA 1SV0A 4X0AA 2ZTEA 4FHWA 3ISCA 2PKEA 3GIJA 4KM5A 1V9PA 3Q8RB 3A0BU 1ZRNA 2KTQA 5EE1A 9ICUA 5DG7A 5KFDA 1DXSA 1TFYA 5G5HA 5DBCA 4F5PA 1Z19A 3V7LA 5AIBA 4I0UA 4UAWA 1N62A 4RQNA 3AUOA 2P6RA 2KOBA 5TISU 2WFAA 8ICZA 3ZDDA 4NM2A 3CNHA 4ECUA 2DQNB 2I1QA 4NLZA 3HILA 1WYGA 5L1IA 2KFNA 4NLCA 1L8OA 4FHVA 3H0MB 2ASLA 4CCHA 1PVQA 1LB2B 3V7KA 4O3MA 1NNLA 3WK7A 3WKEA 2YY6A 3BQ0A 2MAXA 3KHRA 2KD1A 3JZ0A 2OHFA 3HJ4A 4IS7A 3ZDAA 2HOFA 7ICEA 2KVSA 3QU7A 3NVOA 2AH5A 2HOIA 4EGWA 1VDVA 2GO7A 1QSSA 4LEWA 4M6WB 5L1JA 3UPSA 2EZXA 4YR3A 8ICPA 4B9VA 4DFDA 1T3QA 3WFPA 5IIOA 1ECWA 2PFQA 4KTQA 5ALYA 4J9QA 3V6HA 4RQ2A 2GA9D 1UETA 3IN5A 3SV3A 5HRKA 2DR9A 4P4OA 4RPXA 2OCEA 3H8JA 3NVZA 4EBJA 4Z6FA 3TAPA 4O3SA 4Y2SA 1JX4A 5DG9A 3I1YA 2F44A 1RYUA 3RJFA 4DFKA 5F9LA 3NASA 5J0UA 4C0ZA 1FFUA 4FE3A 3ER9B 7ICMA 5ALXA 4QJFB 7ICIA 2A1JA 1BPYA 2YB4A 3RB4A 3C5FA 4ED8A 4Q45A 4Y2XA 1UA0A 1V38A 4TUPA 4DOBA 2I9GA 3AMZA 4BDPA 2KHQA 2K4IA 3LYSA 3GILA 2BCSA 2VA8A 4KLSA 3MR2A 4WH5A 4NM1A 9ICAA 5KFTA 1Z3EB 3NVWA 4KLUA 4J9LA 3PSTA 5KFAA 3GU3A 4UAYA 2RRDA 3U26A 1ZQFA 2Q66A 3NRWA 4RU9A 2XI9A 8ICNA 2ZH2A 2RDIA 1J2MA 4QZHA 1FFVA 3PO5A 1B0XA 1X9XA 5EWFA 2HBMA 9ICCA 1D8BA 2DRAA 2QLTA 1QCKA 4WC5A 7ICTA 3HKZC 5TZVA 3PX0A 1RYRA 5AM4A 3BS5A 2F1IA 5CFTA 2BPGA 4M2YA 2FJ6A 4O3QA 2BE3A 5KG0A 4JMUA 4EELA 1PX5A 3KBBA 2RQ5A 3EPIA 4KLFA 1WOTA 4OJOA 5KT6A 2BR0A 5ALTA 4RNNA 2H3QA 2XY5A 4KLQA 2ZTCA 5KFPA 5L1MA 4USAA 4EENA 2F1JA 2WAQF 2KIWA 1KL9A 1JIHA 3JPQA 5J2JA 5AM2A 1DK2A 1MIVA 4TURA 3D2QA 4Q8FA 2BCVA 3SZ2A 5HHHA 3K4GA 4LZDA 4KLLA 1NJYA 1L6NA 4I2FA 4BWJA 1HIWA 1Q46A 3ED5A 2HHXA 3HW8A 3SYZA 4PHEA 4ECYA 4WOYA 4EX7A 1F0MA 3KFUF 3JPRA 4ECVA 3NS1A 4F5OA 1TAUA 1SGGA 4LT6A 4QW8A 4X5VA 2BCUA 4AT8A 3N4MB 4QZ8A 2J6UA 5CJ7A 4DOAA 7ICPA 1J97A 2RDJA 5D62A 5DB6A 5AHXA 2BZFA 3FAHA 5J0YA 2F3NA 4GIBA 4PHDA 2BQUA 4EZ9A 4BGDA 2ZJ8A 2KG5A 4ECRA 1RQLA 5KNIA 3WFRE 3CW2C 3I28A 5EOZA 3V6JA 1C20A 2CN1A 4ZH4A 1K1SA 4M6WA 1RG6A 2HHUA 5KG3A 4RQ8A 3Q8QB 1ZQGA 4NV0A 2XICA 4KB6A 1Z00B 3AN1A 2R8JA 5KFRA 1O03A 1ZXIA 1SV4A 4YG2A 4RNMA 4MFAA 5C5JA 4KLMA 2KV2A 1A6SA 2E8NA 3AU2A 1WWVA 4I2BA 5AI9A 5IIKA 5CFUA 3AQFA 3SENA 3KZXA 1Z1VA 3G6YA 3JPSA 3RJIA 5JTIA 2IUBA 4WC2A 4I2GA 2G0AA 4M9JA 1N48A 1IG6A 1UT5A 3RJGA 1NZBA 4UQGA 4NLBA 5AKEA 1ED1A 4YR2A 3E0FA 2ZUBA 2NRWA 4BXOB 4XQ8A 1UA1A 2HCFA 2PBEA 4YQWA 3VCBA 5J0PA 2M2WA 4DL3A 3IHQB 4O0IA 4UBBA 1TFWA 2PXIA 2VJ5A 3GV8B 4IRCA 4K4IA 5DLFA 2FMQA 2M2UA 1S8OA 1C7YA 1UEUA 2BDUA 3NRZA 2E8PA 2B0CA 3EW9A 3M7DA 3NTUA 1M6YA 3QUBA 2JEFA 1N5WA 9ICGA 4DLGA 4OD0A 4M5DA 2NRXA 4DSJA 2H3FA 3OWGA 3T5JA 3F5AA 5E79U 4NXZA 5AI0A 4QZCA 1Q3UA 5J2KA 2ISPA 3GZFA 3OTQA 3ZDBA 2IOFA 1KRPA 1VJ7A 2HOQA 3NKUA 2IMWP 5F3XB 3M6ZA 2V9WA 2HHTA 2AGQA 4RWPA 1ZRMA 2DKZA 2YMPA 4OAGA 3PO4A 5JRTA 1B22A 8ICOA 1F44A 1WG8A 8ICVA 1NKBA 2K8BB 4I29A 2MUTA 4WCWA 3EF2A 4XQ7A 1YZ7A 3UMCA 7ICSA 4KLJA 2EDUA 5J2HA 3THVA 9ICHA 3JPTA 4CNQA 2E8OA 3GIIA 4O3OA 3HRDD 2EAMA 2Y1IA 2JR5A 1IV8A 8ICBA 8ICLA 3OUYA 1MQ2A 3TFSA 5DGAA 2H5XA 3BZCA 2RLTA 3IP4B 4NKTA 2WF8A 4RQ1A 4EEYA 2RFFA 1LKYB 2IHMA 2YB1A 3C28A 1MIYA 2BQRA 1JRPA 1QH9A 2AGPA 7ICGA 4J9OA 4X4NA 4QIWF 3GV7B 5CB1A 2A3VA 4A8EA 2HDOA 4YN4A 2UVWA 4P2HA 1S0MA 4DSIA 4UASA 1L7NA 1N63A 2EAOA 4EEKA 9ICJA 2A1AA 3SAGA 2H3IA 5HRGA 3M1YA 1R8BA 3MBYA 3LDAA 1DGJA 4NL9A 3VC8A 4J9SA 5KFIA 5J0WA 1QLNA 4FS2A 5ALUA 2B56A 3BJYA 1BPDA 2KSOB 1U49A 2KNJA 2NYVA 3H40A 3B9JA 5BOLA 2HHSA 5KFVA 4F4ZA 1IIPA 3KHGA 5DLGA 5KT2A 3QU5A 5KFWA 2KHVA 7ICFA 2DUYA 4K96A 3NVVA 2FI1A 1ZQSA 1ZD5A 2ZH8A 2ES6A 1YZ6A 4EYIB 3OV7A 5J0RA 1KLNA 3SAFA 1BPBA 2JRZA 2XGQA 2W04A 2ZJAA 1U47A 2K8CB 1ZQXA 4NLKA 1HUOA 3T5HA 3JPNA 5AKXA 3Q8PB 5AM1A 1X9MA 1LV5A 3ONNA 2JEJA 2XY7A 3SV4A 2LPEA 4YXMA 4Y2YA 2PI5A 4M9NA 5KFSA 4RUAA 4KLHA 3KOOA 3GDXA 4NXUA 4ECSA 3RH5A 4IL6U 3KHLA 1JI7A 4MHVA 2B4VA 3IG8A 3LK9A 2JMGA 3ORYA 4TUQA 2DRBA 3WKDA 1Z4OA 3UQ2A 3L3FX 1RYSA 5HREA 1A76A 3V6KA 8ICSA 4ELUA 2DF4B 1TK8A 2ZIUB 4ED3A 2NO5A 1FO4A 4I2CA 1KKXA 1GO3F 2ZJ5A 1UHUA 2ALZA 2K4EA 2Z7JA 3H8WA 3SMVA 1SV0C 4RNOA 1V85A 4KLIA 4J03A 4LJXA 3TAQA 4OO1J 3QEAZ 9ICMA 8ICKA 1R8CA 3RB0A 1T94A 2F76X 2JV3A 1MQ3A 4CF4A 3PW5A 3AQKA 2W3RA 1ZQCA 5AI4A 2GLEA 1XO0A 2KJ8A 2QARB 4NWIA 3BZKA 1UQVA 3TANA 5DB9A 2XIDA 1ZQWA 2XO7A 1ZQPA 1NJWA 2ZIVA 5EWGA 5DB7A 5D61A 1PZNA 3S6JA 4B9MA 3AQLA 1KFTA 2P35A 4O5KA 4FBUA 1F5SA 4YR0A 4O9MA 2E1EA 3G6XA 4DS5A 3RF9A 4YP3A 3C2LA 1S76D 5AIAA 2XCPA 5KL1B 2E1FA 1RZTA 4PH5A 1ZQ1C 3TADA 2R8KA 2HMXA 4MEYA 3UMBA 2ZTDA 1Q3VA 4RWQA 1FA0A 2XC9A 4HYKA 1K1QA 1L3SA 4DQQA 4QZEA 4PJ0U 3DDHA 4C8MA 2ZIUA 1JN3A 2N1RA 5GTHU 4C4TA 4KX3A 8ICMA 4RWNA 1YLQA 2W54A 2Y0SF 4NL9C 5ALIA 2G08A 4NXWA 3M6KA 2VA2A 4FFDA 2OEHA 1BNPA 3C21A 4FHYA 4RWOA 1JAJA 5K4LA 4QWEA 2GOLA 1VJ5A 4IRKA 3H4BA 1PUZA 4RQMA 1FEZA 1XC9A 2LI6A 3CYMA 2PFPA 2W8KA 3D2SA 3CK6A 4ZOHC 2EH9A 1NJXA 4IQTA 1DRGA 1A77A 1CEZA 3KD3A 4DWIA 3MGVA 2ZUDA 4I2JA 3PHZA 4JLXA 4N7RA 4CRXA 1X6JA 3TACB 3K75D 4E8FA 1KTQA 3GFKB 5ALGA 4IQVA 2QB0B 5AKJA 1ZJMA 2LBOA 4O6AA 2JZBA 2FE9A 2W11A 3UXPA 4EBCA 1HUZA 2DVIA 4GXIA 1CUKA 1T4GA 4KLTA 4GFJA 7ICKA 1SIJA 3IV6A 5J0TA 8ICXA 3J81j 3EUB2 2P6UA 1X66A 5ALRA 4QZFA 1YT3A 5CEHA 4P0QB 2KK0A 1DOQA 1QTMA 1S9FA 5ALPA 2MRLA 3NYBA 2BBJA 1N61A 3H38A 8ICTA 1P7DA 3WK8A 4PGQA 1X40A 2IHNA 1L8LA 3PY8A 2ZG6A 1ZJNA 1S97A 5CHEA 3RJJA 4KLGA 4OAFA 5B3QA 2ZH9A 4QWCA 4PZNA 4RQ6A 3JYYA 2FPLA 4S3NA 3PW7A 3D2NA 4QZDA 9ICPA 4UW9A 1PK1B 3ETLA 5EE9A 3RJEA 4X4TA 4C8OA 1UT8A 5JU5A 5DDMA 5J2BA 1OW5A 2W55A 3MR6A 4C8KA 1JROA 3QU4A 2UVUA 3QX7A 2NV3A 2ZH7A 1A0PA 8ICYA 2B51A 3WK5A 3N28A 3RAXA 1Y88A 5B3PA 3C66A 3EWAA 9ICEA 4BUGA 3BS5B 3H37A 3OJSA 4PHAA 3ZDCA 1ZQKA 2YTUA 3ER8C 4KMUA 5HMMA 3UM9A 2EWRA 3FYHA 2ASDA 5HR7A 1Q78A 1OXJA 5HC9A 1ZQQA 4Y2UA 3FM9A 4K4HA 4M9HA 3T3FA 2GH1A 5B5EU 3LVWA 1XSPA 2DPJA 4K98A 5DG8A 5J2GA 3EYZA 1XSLA 4XJEA 2HHVA 5JTGA 5ALHA 2NO4A 4Y2PA 3PV8A 4F72A 4J9NA 1NK4A 5KFUA 2W7OA 4KITB 1SL0A 5G5GA 4R66A 1QSYA 1WCNA 1L7OA 2WB1C 2W43A 1TAQA 5HRBA 2VKQA 9ICNA 1ZQHA 4BX9C 4RUCA 4ECTA 3KZIU 2KICA 3F2DA 1JUDA 2DWQA 4I28A 2MU2A 2AU0A 4ED7A 3AQMA 2EAPA 2BHNA 2V4RA 5ALNA 4WJ3B 1XS9D 1K5OA 1PVRA 1QSLA 3K1RB 4IQUA 7ICUA 2DKXA 4DLEA 3OSNA 4J9RA 1TAMA 2WTFA 3MC1A 5D49A 4I27A 4MKPA 4OJLA 1MIWA 4UARA 1DGSA 4F92B 4M47A 5C0YA 2AHOB 3K1ZA 2DR8A 2IHOA 5ALQA 5CRXA 4DEZA 4Q43A 4AP9A 4EBKA 4E7XA 1SZHA 4O69A 4C4SA 5DBBA 2VA3A 2C2DA 3GIMA 3QZ8A 2DL0A 1OU5A 2JH7A 4QNLA 3QUQA 3OPXA 1ZQVA 9ICIA 3R9KA 3H0LB 3PMNA 3TADC 3WKAA 4FH3A 4X4VA 4M9LA 1B4FA 1ZQBA 3QU9A 4K97A 2ATLA 4OJPA 2O5AA 4BWMA 4WC1A 2DR5A 2WF9A 4PZOA 4F5RA 3QUCA 5T14A 3C2KA 4DFMA 4ECQA 2AQ0A 3T5LA 2VJ4A 4X4PA 4ECZA 4ACOA 3HX0A 1KEJA 3HIYA 4P4PA 1XO1A 7ICHA 5J0SA 4US8A 4K9AA 5KFBA 3F2CA 5J0QA 4FO6A 4C8LA 3H7IA 5ALVA 2JXJA 4F2RA 4UB8U 4Q8EA 4MFFA 5J2AA 1ZD2P 3QUTA 3UXNA 3L4PA 5HHIA 1SXEA 4R8UA 3JPPA 3DEEA 4RQ4A 3Q8MA 3OUYB 2PI4A 3PW2A 1U9LA 1T8EA 4DOCA 4F5NA 1BPZA 1N56A 2ZH6A 5HRFA 2HSZA 1COOA 5HR6A 9ICOA 1UPHA 4F91B 3OHBA 4AT9B 3M8RA 2B6GA 1ZQUA 3WKCA 4TQRA 4XRHA 1KSPA 3TFRA 4UB3A 4YFKA 1KN5A 2K89A 3RBDA 2OWOA 2KZZA 8ICHA 5HRDA 4F5QA 5AK3A 1RQNA 2ISOA 1UEVA 5IIIA 1TE2A 2E3TA 3ZI4A 1ZYQA 3IRUA 4F93B 2JZBB 4RQ0A 2OYYA 4OAIZ 3ERCC 3PR5B 4Z6DA 4Q44A 2IOHA 4DL2A 5D46A 4B9UA 2OH2A 2MUTB 3RJKA 2JEIA 2ZH3A 4ED6A 1TVAA 2O1PA 4KN7A 2PFOA 2XCAA 5HRHA 2ZIXB 4ICAA 1ZQYA 4EEBA 3PMLA 1NK0A 4B9TA 4ATBA 4X4RA 2AJQA 4YD2A 5IIJA 2I6XA 2JGAA 2K60A 4O3PA 2G5IB 4EEDA 3OJUA 5KFHA 2IBKA 5KFZA 2EQYA 5DQGA 5CFSA 4F50A 2HVIA 3B0YA 5DQHA 5KL8B 1Z1BA 1ZQDA 5IILA 3NGDA 1H38A 3TQ1A 4WBZA 1VFGA 4MFCA 4RZRA 4UBCA 3MR5A 2GWSA 3SD7A 2KIVA 2ZIWB 3HKZF 5AKKA 3EZ5A 4DF8A 3SR6A 4KMOB 3IDWA 1ZQTA 4JUZA 4NLGA 4U6PA 4ECWA 4WC3A 3GQCA 4QIWC 4OAHA 2KKPA 4JB3A 4OCZA 2KJ5A 5J8YA 2C2EA 4QWBA 9ICWA 3ALRA 4OJ6A 1MSWD 1IXRA 2G09A 5KFQA 4YMMA 4YD1A 3MABA 2R18A 4DL4A 2VANA 1WWUA 2YQEA 5J2FA 8ICWA 3H8MA 4MF2A 4O3NA 4U7CA 7ICVA 5CHGA 2A19A 3PSFA 2ZH4A 4PPXA 1QQ6A 1ZD4A 3PSPA 1XU4A 4JWNA 2HW3A 4DL6A 4P4MA 2QARA 4J9PA 5KT7A 1BVSA 3UMGA 4B9NA 3NUQA 3F53A 4RQ5A 5DGBA 4EP7A 3HJEA 4PL1A 1COKA 1XNSA 3ETRA 2E8MA 2YMLA 4TUSA 1S0VA 3BDPA 9ICQA 4LVSA 2RP5A 2NRKA 4YVZA 5J2IA 1T7PA 8ICRA 1B43A 4CGZA 4EV6A 5FP0A 3RR7A 4YMNA 4AT8B 3H0RB 1KDHA 4P0QA 3RBEA 4RPZA 3BS7A 5KT5A 1HJPA 1SZPA 2I5HA 4F4XA 2BCQA 3B0XA 1ZQZA 4OJ5A 8ICJA 1KW4A 5HR9A 3WFQE 4EBEA 3LQCB 2FCLA 7ICQA 3N7PD 5ALSA 3QU2A 1WCLA 3TARA 1L3UA 1HEKA 5HRIA 1ZQEA 2KN7A 2DBYA 2AQ4A 1PVPA 1SXDA 5AKGA 4FHPA 4NKUA 5AKHA 1TK5A 2IA6A 2PFNA 4PGXA 4CDGA 5L9XA 3NWIA 3CP8A 3QNMA 4FO1A 4O68A 3ZDEA 4DQPA 3AQNA 1CRXA 3TKAA 4F4KA 4I2EA 3M8SA 1URJA 4QZBA 9ICKA 5JUMA 3HT3A 3MGIA 1RM6C 3C23A 2KE7A 1ZOLA 3LWMA 4WC6A 2BBHA 2W9CB 1NJZA 2ZHAA 1LVHA 3MFHA 2P66A 4RT3A 3K7DA 2KZ3A 8ICCA 1N2XA 2W9BA 2LYHA 5AI5A 3WFOA 4AYBF 4I2DA 8ICFA 1JMSA 2LM1A 4GC7A 1ZETA 3DV9A 1NKCA 3Q8SB
chains in the Genus database with same CATH topology
4QWDA 4I2BA 4DSKA 1V4AA 1UT8A 5IIKA 5DDMA 4E0DA 5DDYA 5J2BA 4I2IA 4IR1A 4O5EA 9ICBA 3G6YA 3RAQA 4F8RA 3HJ1A 2FLLA 3JPSA 3RJIA 3MR6A 4C8KA 2FLPA 2UVUA 4AT7B 1ZQIA 4WC2A 4I2GA 4M9JA 2ZH7A 3N97B 1N48A 4ED2A 8ICYA 3RB3A 5CR0A 1UT5A 3RJGA 3RAXA 4UQGA 1Y88A 2NRZA 1MC8A 3C1ZA 1SL1A 1NOMA 3C66A 4C8NA 4YR2A 5BOMA 3EWAA 1L3VA 9ICEA 1SKSA 3MGHA 2ZUBA 3EPGA 2NRWA 4BXOB 4XQ8A 7ICJA 1RXWA 3H37A 1UA1A 2PBEA 3OJSA 4PHAA 3Q8KA 9ICLA 4YQWA 3ZDCA 3PW4A 1ZQKA 5J0PA 4DFJA 2M2WA 2ZHBA 4KMUA 5HMMA 4DL3A 3IHQB 4O0IA 4UBBA 3FYHA 2ASDA 1L5UA 4MEXA 3RB6A 1Q78A 5HC9A 2PXIA 3RTVA 1TFWA 3GV8B 3ISBA 4IRCA 1ZQQA 3HWTA 4K4IA 1TKDA 5DLFA 2FMQA 4K4HA 3RH4A 4XUSA 4M9HA 2M2UA 4WC0A 5KFFA 3T3FA 1C7YA 1D8LA 4JK1A 2BPFA 4ECXA 4E80A 1XSPA 1UEUA 3C5GA 2DPJA 4ELTA 5DG8A 5J2GA 3EYZA 4DSFA 1XSLA 4FH5A 2ZH5A 3EW9A 3GIKA 8ICIA 1SKWA 3NTUA 2HHVA 5HRHA 4R63A 5KT4A 3H4DA 4JV0A 3PV8A 2JEFA 2BQ3A 4DLGA 1XSNA 9ICGA 4J9NA 1NK4A 5KG1A 1ZQMA 5KFUA 2FPMA 3UPQA 4M5DA 2DR7A 4KITB 2NRXA 1SL0A 4I2HA 2ZH1A 4R66A 1QSYA 1WCNA 4DSJA 1NZPA 3T5JA 4JWMA 4GXJA 4YCXA 4DO9A 1TAQA 4NXZA 4F2SA 3GV5B 1U48A 3ISDA 5HRBA 4QZCA 9ICNA 2FPKA 3MDCA 3FDSA 1ZQHA 4RUCA 4ECTA 5J2KA 1X9WA 2ISPA 4LZGA 3ZDBA 1KRPA 1VJ7A 3C2MA 3RJHA 5KFYA 4UB4A 2IMWP 4I28A 4IRDA 2KFZA 4J9KA 5J2CA 1X2IA 2AU0A 3OVBA 4ED7A 3AQMA 1U45A 2V9WA 5CWRA 2AGQA 2HHTA 4RWPA 2BHNA 2V4RA 2DFLA 1XS9D 5DKWA 2R8IA 1QSLA 5KFOA 3RR8A 4IQUA 1D9DA 7ICUA 2R8GA 5KG2A 4O3RA 4X4QA 3PO4A 9ICVA 4DLEA 1B22A 2UVRA 1TV9A 4PHPA 8ICOA 3OSNA 4B9LA 3TI0A 1KFSA 4J9RA 2WTFA 8ICVA 5D49A 5IINA 1NKBA 1NK9A 1NK6A 4I27A 1MIWA 4I29A 1DGSA 2MUTA 4F92B 3OHAA 4WCWA 4M47A 2ID1A 4EBDA 4XQ7A 3OVAA 9ICRA 4RPYA 1D9FA 3OGUA 7ICSA 2FMPA 2KZMA 4F4WA 4KLJA 5KFNA 2F1HA 5J2HA 2DR8A 3THVA 7ICNA 9ICHA 3JPTA 4RQ7A 3KTQA 4Q43A 4DEZA 3GIIA 5J0XA 4O3OA 4EBKA 4DL5A 5DB8A 3MR3A 2Y1IA 2DPIA 4E7XA 3HP6A 8ICBA 5DBBA 8ICLA 2VA3A 3PW0A 1R89A 2J6TA 9ICTA 3OUYA 1MQ2A 1Z00A 3TFSA 8ICQA 5DGAA 9ICXA 2B21A 2H5XA 1X9SA 2C2DA 3UXOA 3QZ8A 3GIMA 3PR4A 4DFPA 2W9CA 1JQRA 1OU5A 5DEDA 4FBTA 5F2VO 5J2EA 4KLOA 4NKTA 4UAZA 3H39A 4KN4A 2J6SA 1ZQVA 4RQ1A 4EEYA 9ICIA 3T5KA 3PMNA 2RFFA 2IHMA 1MIYA 2BQRA 2AGPA 7ICGA 4J9OA 4X4NA 4FH3A 2BGWA 1KFDA 5KFXA 4DS4A 4X4VA 4RQ3A 3GV7B 3C1YA 1RPLA 4M9LA 5J2DA 4X0BA 5CB1A 4IG8A 1ZQBA 4YN4A 2ATLA 1NO5A 3OVSA 2Q0ZX 2V4QA 2UVWA 4P2HA 1S0MA 2O5AA 5BPCA 4F3OA 4DSIA 2JEGA 2PI4A 4BWMA 9ICJA 4WC1A 1BGXT 8ICAA 2DR5A 3OSPA 3C18A 3LWLA 5KT3A 4IR9A 3L9DA 4MF8A 3JPOA 1S0OA 3G6VA 3KHHA 4UB2A 5HRGA 4AT7A 1R8BA 4F5RA 5D4BA 3MBYA 5F9NA 4I2AA 3LDAA 4ELVA 4J9SA 3C2KA 5KFIA 3UQ0A 4DFMA 4DL7A 9ICFA 4ECQA 2AQ0A 5J0WA 3T5LA 3Q8LA 1QLNA 1SKRA 2BDPA 5J29A 4FS2A 4X4PA 2ZUCA 4KLDA 5IIMA 4X0AA 4ECZA 3BJYA 1BPDA 2ZTEA 4QZ9A 1U49A 4FHWA 3QZ7A 5KG6A 3ISCA 3H40A 5KFLA 3HX0A 4FHXA 1KEJA 5BOLA 4P4PA 3GIJA 5KFVA 4F4ZA 4K4GA 2HHSA 3HIYA 1XWLA 1V9PA 3KHGA 1AROP 5KFCA 3Q8RB 1XO1A 5DLGA 2C28A 7ICHA 5J0SA 4X4OA 5KT2A 2KTQA 9ICUA 4X4SA 5KFBA 5DG7A 5KFWA 5KFDA 4GC6A 5J0QA 1R8AA 1TFYA 4FO6A 4C8LA 3H7IA 7ICFA 3H8SA 4F2RA 5DBCA 4F5PA 1T3NA 3V7LA 2DR9A 4UAWA 4X4UA 4Q8EA 4Z6EA 1IM4A 2W9BB 1S0NA 1ZQSA 3AUOA 4MFFA 3WFSC 2P6RA 5J2AA 2ZH8A 1ZQLA 1TFRA 3UXNA 4EYIB 2M2VA 3OV7A 5J0RA 1Q79A 8ICZA 5HHIA 1KLNA 2HHQA 2HVHA 3ZDDA 4R8UA 2XY6A 3JPPA 4NM2A 2ASJA 1BPBA 4RT2A 4ECUA 4EZ6A 2HHPA 4RQ4A 4WC7A 5KFKA 2XGQA 2I1QA 2ZJAA 3Q8MA 4NLZA 1S77D 1U47A 3OUYB 5L1IA 3PW2A 1ZQXA 3ZD8A 1U9LA 1T8EA 4DOCA 4F5NA 1HUOA 1BPZA 4NLKA 2KFNA 8ICFA 1N56A 3T5HA 2ZH6A 4KLEA 5HRFA 3JPNA 4FHVA 5CA7A 4DQIA 3Q8PB 4JV1A 1COOA 2ASLA 1F5AA 1X9MA 1LV5A 4CCHA 3BQTA 5KFMA 1LB2B 4F91B 3OHBA 9ICOA 3V7KA 4AT9B 3M8RA 2JEJA 1ZQUA 4ED1A 2XY7A 5DECA 4TQRA 3BQ0A 3SV4A 1ZQOA 4XRHA 2MAXA 4YXMA 4UB3A 3KHRA 3TFRA 1KSPA 2PI5A 4YFKA 3JZ0A 1KNYA 5KTQA 4M9NA 3HJ4A 4NLNA 3RBDA 5KFSA 4RUAA 2OWOA 4KLHA 2KZZA 1NK7A 4F5QA 2A1JB 3GDXA 8ICHA 3ZDAA 5HRDA 7ICEA 4ECSA 3RH5A 2ISOA 1UEVA 3KHLA 5IIIA 1QSSA 4M6WB 3LK9A 1ZYQA 5L1JA 3UPSA 3ORYA 4F93B 4TUQA 4YR3A 8ICPA 4G3IA 2DRBA 4R64A 3M9MB 2JZBB 4B9VA 4RQ0A 3UQ2A 5HREA 5CP2A 3PR5B 1RYSA 4Z6DA 4Q44A 4DL2A 1A76A 5D46A 3V6KA 4B9UA 8ICSA 4ELUA 3WFPA 2MUTB 5IIOA 3RJKA 2JEIA 1TK8A 4ED3A 2PFQA 4I2CA 4ED6A 4KTQA 2ZH3A 2ZJ5A 4J9QA 1TVAA 2O1PA 5J0OA 4KN7A 3V6HA 2ALZA 2BPCA 2XCAA 4ED0A 4QW9A 4RQ2A 3BQ2A 3H8WA 5KG7A 3HPOA 2PFOA 1UETA 1ZQYA 1U4BA 1BPXA 3SV3A 4RNOA 4KLIA 3PMLA 1NK0A 4B9TA 5HRKA 4ATBA 4WC4A 2AJQA 4X4RA 3TAQA 4YD2A 2BKEA 4P4OA 4RPXA 4DF4A 3H8JA 3QEAZ 9ICMA 8ICKA 4EBJA 5IIJA 1R8CA 4Z6FA 3RB0A 5HP4A 3TAPA 4O3PA 4O3SA 1JX4A 1MQ3A 5DG9A 4R65A 4DQRA 3OJUA 5KFHA 2FMSA 5KFZA 2IBKA 3RJFA 4DFKA 5F9LA 3PW5A 5DQGA 5J0UA 3QEBZ 1ZQCA 3AQKA 4YMOA 4F50A 3V72A 2HVIA 2C22A 7ICMA 7ICIA 3B0YA 5DQHA 4AT9A 2A1JA 5L1LA 1BPYA 1ZQDA 5IILA 3RB4A 3C5FA 3NGDA 1H38A 3TQ1A 4ED8A 3TANA 5DB9A 2FLNA 1ZQWA 4RZRA 4Q45A 4UBCA 4MFCA 3MR5A 1UA0A 4JV2A 4TUPA 2XO7A 1ZQPA 1NJWA 4DOBA 3PNCA 5EWGA 5DB7A 2I9GA 1PZNA 4B9MA 3AQLA 1KFTA 2GWSA 3E2EA 4QZIA 4O5KA 1RXVA 4FBUA 4YR0A 4BDPA 7ICRA 4O5CA 4O9MA 2W9AA 2NRVA 3GILA 3G6XA 4QZAA 3EZ5A 4DS5A 2BCSA 2VA8A 4DF8A 4YP3A 3MR2A 4DSLA 4KLSA 3C2LA 4J9MA 3QE9Y 4JUZA 5L1KA 1SL2A 1ZQTA 4NLGA 4NM1A 1S76D 9ICAA 2XCPA 2M2TA 5KFTA 5KFGA 1Z3EB 4M04A 4KLUA 4ECWA 4J9LA 4QZGA 4PH5A 1RZTA 4WC3A 3GQCA 5KFAA 9ICWA 2C2EA 4QWBA 4UAYA 2Y1JA 2R8KA 4MEYA 1MSWD 1IXRA 5KFQA 4YMMA 1ZQFA 4YD1A 4TQSA 2NRTA 3MABA 2Q66A 2ZTDA 5EWEA 4DL4A 5KFEA 4RU9A 8ICNA 2ZH2A 2RDIA 2VANA 4RWQA 1FA0A 4QZHA 5J2FA 2XC9A 4HYKA 3RH6A 1K1QA 4R8UB 1L3SA 8ICWA 4DQQA 3PO5A 4QZEA 5EWFA 2M9NA 4MF2A 9ICCA 7ICLA 2DRAA 4O3NA 4C8MA 7ICVA 5CHGA 1JN3A 4WC5A 7ICTA 2ZH4A 3SI8A 1ZQAA 4PPXA 8ICMA 4RWNA 1YLQA 9ICSA 5TZVA 1XU4A 4FS1A 3PX0A 4JWNA 1RYRA 2VA2A 4BXOA 2F1IA 2HW3A 1BNPA 2BPGA 3C21A 4GLXA 4DL6A 4M2YA 4O3QA 4FHYA 4P4MA 1JAJA 1D8YA 2BE3A 4RWOA 4J9PA 5KG0A 4QWEA 1PX5A 5KT7A 4IRKA 3EPIA 4KLFA 4F4YA 1BVSA 1WOTA 4XA5A 2KP7A 5HNKA 1DK3A 5KT6A 4B9NA 3H4BA 4RQ5A 1NKEA 4UB5A 3ZD9A 5DGBA 2AGOA 2BR0A 1XC9A 4EP7A 4RNNA 2XY5A 2W8KA 2PFPA 4KLQA 2ZTCA 1NJXA 5KFPA 4TUSA 4IQTA 1S0VA 3BDPA 2F1JA 9ICQA 1A77A 4LVSA 1CEZA 2NRKA 4YVZA 5J2IA 1T7PA 3AU6A 8ICRA 5HRLA 4DWIA 1B43A 4QWAA 1JIHA 3IM1A 3JPQA 2ZUDA 3PVXA 8ICEA 4NY8A 4I2JA 3M9OB 2W8LA 4YMNA 5J2JA 3RR7A 3BQ1A 1DK2A 4AT8B 3H3AA 1MIVA 4TURA 4ATBB 4UD5A 1KDHA 3K75D 4E8FA 4Q8FA 1KTQA 3PX6A 3RBEA 4WBZA 4RPZA 5KT5A 2BCVA 1HJPA 1SZPA 3GFKB 4F4XA 1VFGA 5KFJA 3SZ2A 2BCQA 5HHHA 3B0XA 1BPEA 1ZQZA 3K4GA 4LZDA 1ZQRA 4KLLA 1NJYA 4IQVA 8ICJA 4UD4A 5HR9A 3WFQE 4EBEA 4I2FA 3LQCB 4BWJA 1ZJMA 2XGPA 4EYHB 7ICQA 2HHXA 2W9MA 3HW8A 3SYZA 4PHEA 4ECYA 3RRGA 2JZBA 8ICGA 1WCLA 3TARA 3UXPA 1L3UA 5HRIA 5HMLA 1ZQEA 4EBCA 3JPRA 4ECVA 4M9GA 4DSEA 1HUZA 4F5OA 1TAUA 2KN7A 2DVIA 5DQIA 4GXIA 1JXLA 2AQ4A 1CUKA 1S10A 4QW8A 2UVVA 4LT6A 1T4GA 2BCRA 4KLTA 4X5VA 2BCUA 4FHPA 4AT8A 3N4MB 4NKUA 1JXEA 4QZ8A 1TK5A 3RRHA 1ZQJA 2IA6A 4UB1A 5CJ7A 2J6UA 5J0TA 4GXKA 4DOAA 2PFNA 8ICXA 7ICPA 2P6UA 2RDJA 5DB6A 4QZFA 4PGXA 5L9XA 7ICKA 1DOQA 5J0YA 4PHDA 2BQUA 4EZ9A 1QTMA 1S9FA 4BGDA 3ZDEA 2ZJ8A 3NYBA 4WBYA 4ECRA 3PX4A 4DQPA 3H38A 4Z6CA 8ICTA 3AQNA 5DBAA 3WFRE 4F4KA 4I2EA 5EOZA 3M8SA 3V6JA 4YXJA 4B9SA 2HHWA 4QZBA 4PGQA 4ZH4A 9ICKA 5JUMA 1TK0A 1K1SA 3HT3A 4M6WA 3MGIA 2IHNA 3C23A 3PY8A 2HHUA 5KG3A 8ICUA 1ZJNA 4RQ8A 3Q8QB 3LWMA 1S97A 3RJJA 4KLGA 4WC6A 1ZQGA 3MFIA 5KG4A 2W9CB 2R8HA 1L3TA 1NJZA 2ZHAA 3MFHA 3M9NB 2P66A 4PGYA 2ZH9A 4RT3A 1Z00B 4QWCA 2KZ3A 2R8JA 8ICCA 5KFRA 4DQSA 2C2RA 1NK5A 1BNOA 2W9BA 2LYHA 4RQ6A 3JYYA 2FPLA 4S3NA 3PW7A 3WFOA 4YG2A 4QZDA 9ICPA 4I2DA 4RNMA 1EXNA 4MFAA 3MDAA 1NK8A 1ZQNA 5C5JA 4KLMA 3V7JA 1JMSA 3ETLA 4GC7A 1ZETA 1NKCA 3RJEA 4IQWA 4M0AA 4X4TA 3Q8SB 5KG5A 3AU2A 4C8OA 7ICOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWD A;  4I2B A;  4DSK A;  1V4A A;  1UT8 A;  5IIK A;  5DDM A;  4E0D A;  5DDY A;  5J2B A;  4I2I A;  4IR1 A;  4O5E A;  9ICB A;  3G6Y A;  3RAQ A;  4F8R A;  3HJ1 A;  2FLL A;  3JPS A;  3RJI A;  3MR6 A;  4C8K A;  2FLP A;  2UVU A;  4AT7 B;  1ZQI A;  4WC2 A;  4I2G A;  4M9J A;  2ZH7 A;  3N97 B;  1N48 A;  4ED2 A;  8ICY A;  3RB3 A;  5CR0 A;  1UT5 A;  3RJG A;  3RAX A;  4UQG A;  1Y88 A;  2NRZ A;  1MC8 A;  3C1Z A;  1SL1 A;  1NOM A;  3C66 A;  4C8N A;  4YR2 A;  5BOM A;  3EWA A;  1L3V A;  9ICE A;  1SKS A;  3MGH A;  2ZUB A;  3EPG A;  2NRW A;  4BXO B;  4XQ8 A;  7ICJ A;  1RXW A;  3H37 A;  1UA1 A;  2PBE A;  3OJS A;  4PHA A;  3Q8K A;  9ICL A;  4YQW A;  3ZDC A;  3PW4 A;  1ZQK A;  5J0P A;  4DFJ A;  2M2W A;  2ZHB A;  4KMU A;  5HMM A;  4DL3 A;  3IHQ B;  4O0I A;  4UBB A;  3FYH A;  2ASD A;  1L5U A;  4MEX A;  3RB6 A;  1Q78 A;  5HC9 A;  2PXI A;  3RTV A;  1TFW A;  3GV8 B;  3ISB A;  4IRC A;  1ZQQ A;  3HWT A;  4K4I A;  1TKD A;  5DLF A;  2FMQ A;  4K4H A;  3RH4 A;  4XUS A;  4M9H A;  2M2U A;  4WC0 A;  5KFF A;  3T3F A;  1C7Y A;  1D8L A;  4JK1 A;  2BPF A;  4ECX A;  4E80 A;  1XSP A;  1UEU A;  3C5G A;  2DPJ A;  4ELT A;  5DG8 A;  5J2G A;  3EYZ A;  4DSF A;  1XSL A;  4FH5 A;  2ZH5 A;  3EW9 A;  3GIK A;  8ICI A;  1SKW A;  3NTU A;  2HHV A;  5HRH A;  4R63 A;  5KT4 A;  3H4D A;  4JV0 A;  3PV8 A;  2JEF A;  2BQ3 A;  4DLG A;  1XSN A;  9ICG A;  4J9N A;  1NK4 A;  5KG1 A;  1ZQM A;  5KFU A;  2FPM A;  3UPQ A;  4M5D A;  2DR7 A;  4KIT B;  2NRX A;  1SL0 A;  4I2H A;  2ZH1 A;  4R66 A;  1QSY A;  1WCN A;  4DSJ A;  1NZP A;  3T5J A;  4JWM A;  4GXJ A;  4YCX A;  4DO9 A;  1TAQ A;  4NXZ A;  4F2S A;  3GV5 B;  1U48 A;  3ISD A;  5HRB A;  4QZC A;  9ICN A;  2FPK A;  3MDC A;  3FDS A;  1ZQH A;  4RUC A;  4ECT A;  5J2K A;  1X9W A;  2ISP A;  4LZG A;  3ZDB A;  1KRP A;  1VJ7 A;  3C2M A;  3RJH A;  5KFY A;  4UB4 A;  2IMW P;  4I28 A;  4IRD A;  2KFZ A;  4J9K A;  5J2C A;  1X2I A;  2AU0 A;  3OVB A;  4ED7 A;  3AQM A;  1U45 A;  2V9W A;  5CWR A;  2AGQ A;  2HHT A;  4RWP A;  2BHN A;  2V4R A;  2DFL A;  1XS9 D;  5DKW A;  2R8I A;  1QSL A;  5KFO A;  3RR8 A;  4IQU A;  1D9D A;  7ICU A;  2R8G A;  5KG2 A;  4O3R A;  4X4Q A;  3PO4 A;  9ICV A;  4DLE A;  1B22 A;  2UVR A;  1TV9 A;  4PHP A;  8ICO A;  3OSN A;  4B9L A;  3TI0 A;  1KFS A;  4J9R A;  2WTF A;  8ICV A;  5D49 A;  5IIN A;  1NKB A;  1NK9 A;  1NK6 A;  4I27 A;  1MIW A;  4I29 A;  1DGS A;  2MUT A;  4F92 B;  3OHA A;  4WCW A;  4M47 A;  2ID1 A;  4EBD A;  4XQ7 A;  3OVA A;  9ICR A;  4RPY A;  1D9F A;  3OGU A;  7ICS A;  2FMP A;  2KZM A;  4F4W A;  4KLJ A;  5KFN A;  2F1H A;  5J2H A;  2DR8 A;  3THV A;  7ICN A;  9ICH A;  3JPT A;  4RQ7 A;  3KTQ A;  4Q43 A;  4DEZ A;  3GII A;  5J0X A;  4O3O A;  4EBK A;  4DL5 A;  5DB8 A;  3MR3 A;  2Y1I A;  2DPI A;  4E7X A;  3HP6 A;  8ICB A;  5DBB A;  8ICL A;  2VA3 A;  3PW0 A;  1R89 A;  2J6T A;  9ICT A;  3OUY A;  1MQ2 A;  1Z00 A;  3TFS A;  8ICQ A;  5DGA A;  9ICX A;  2B21 A;  2H5X A;  1X9S A;  2C2D A;  3UXO A;  3QZ8 A;  3GIM A;  3PR4 A;  4DFP A;  2W9C A;  1JQR A;  1OU5 A;  5DED A;  4FBT A;  5F2V O;  5J2E A;  4KLO A;  4NKT A;  4UAZ A;  3H39 A;  4KN4 A;  2J6S A;  1ZQV A;  4RQ1 A;  4EEY A;  9ICI A;  3T5K A;  3PMN A;  2RFF A;  2IHM A;  1MIY A;  2BQR A;  2AGP A;  7ICG A;  4J9O A;  4X4N A;  4FH3 A;  2BGW A;  1KFD A;  5KFX A;  4DS4 A;  4X4V A;  4RQ3 A;  3GV7 B;  3C1Y A;  1RPL A;  4M9L A;  5J2D A;  4X0B A;  5CB1 A;  4IG8 A;  1ZQB A;  4YN4 A;  2ATL A;  1NO5 A;  3OVS A;  2Q0Z X;  2V4Q A;  2UVW A;  4P2H A;  1S0M A;  2O5A A;  5BPC A;  4F3O A;  4DSI A;  2JEG A;  2PI4 A;  4BWM A;  9ICJ A;  4WC1 A;  1BGX T;  8ICA A;  2DR5 A;  3OSP A;  3C18 A;  3LWL A;  5KT3 A;  4IR9 A;  3L9D A;  4MF8 A;  3JPO A;  1S0O A;  3G6V A;  3KHH A;  4UB2 A;  5HRG A;  4AT7 A;  1R8B A;  4F5R A;  5D4B A;  3MBY A;  5F9N A;  4I2A A;  3LDA A;  4ELV A;  4J9S A;  3C2K A;  5KFI A;  3UQ0 A;  4DFM A;  4DL7 A;  9ICF A;  4ECQ A;  2AQ0 A;  5J0W A;  3T5L A;  3Q8L A;  1QLN A;  1SKR A;  2BDP A;  5J29 A;  4FS2 A;  4X4P A;  2ZUC A;  4KLD A;  5IIM A;  4X0A A;  4ECZ A;  3BJY A;  1BPD A;  2ZTE A;  4QZ9 A;  1U49 A;  4FHW A;  3QZ7 A;  5KG6 A;  3ISC A;  3H40 A;  5KFL A;  3HX0 A;  4FHX A;  1KEJ A;  5BOL A;  4P4P A;  3GIJ A;  5KFV A;  4F4Z A;  4K4G A;  2HHS A;  3HIY A;  1XWL A;  1V9P A;  3KHG A;  1ARO P;  5KFC A;  3Q8R B;  1XO1 A;  5DLG A;  2C28 A;  7ICH A;  5J0S A;  4X4O A;  5KT2 A;  2KTQ A;  9ICU A;  4X4S A;  5KFB A;  5DG7 A;  5KFW A;  5KFD A;  4GC6 A;  5J0Q A;  1R8A A;  1TFY A;  4FO6 A;  4C8L A;  3H7I A;  7ICF A;  3H8S A;  4F2R A;  5DBC A;  4F5P A;  1T3N A;  3V7L A;  2DR9 A;  4UAW A;  4X4U A;  4Q8E A;  4Z6E A;  1IM4 A;  2W9B B;  1S0N A;  1ZQS A;  3AUO A;  4MFF A;  3WFS C;  2P6R A;  5J2A A;  2ZH8 A;  1ZQL A;  1TFR A;  3UXN A;  4EYI B;  2M2V A;  3OV7 A;  5J0R A;  1Q79 A;  8ICZ A;  5HHI A;  1KLN A;  2HHQ A;  2HVH A;  3ZDD A;  4R8U A;  2XY6 A;  3JPP A;  4NM2 A;  2ASJ A;  1BPB A;  4RT2 A;  4ECU A;  4EZ6 A;  2HHP A;  4RQ4 A;  4WC7 A;  5KFK A;  2XGQ A;  2I1Q A;  2ZJA A;  3Q8M A;  4NLZ A;  1S77 D;  1U47 A;  3OUY B;  5L1I A;  3PW2 A;  1ZQX A;  3ZD8 A;  1U9L A;  1T8E A;  4DOC A;  4F5N A;  1HUO A;  1BPZ A;  4NLK A;  2KFN A;  8ICF A;  1N56 A;  3T5H A;  2ZH6 A;  4KLE A;  5HRF A;  3JPN A;  4FHV A;  5CA7 A;  4DQI A;  3Q8P B;  4JV1 A;  1COO A;  2ASL A;  1F5A A;  1X9M A;  1LV5 A;  4CCH A;  3BQT A;  5KFM A;  1LB2 B;  4F91 B;  3OHB A;  9ICO A;  3V7K A;  4AT9 B;  3M8R A;  2JEJ A;  1ZQU A;  4ED1 A;  2XY7 A;  5DEC A;  4TQR A;  3BQ0 A;  3SV4 A;  1ZQO A;  4XRH A;  2MAX A;  4YXM A;  4UB3 A;  3KHR A;  3TFR A;  1KSP A;  2PI5 A;  4YFK A;  3JZ0 A;  1KNY A;  5KTQ A;  4M9N A;  3HJ4 A;  4NLN A;  3RBD A;  5KFS A;  4RUA A;  2OWO A;  4KLH A;  2KZZ A;  1NK7 A;  4F5Q A;  2A1J B;  3GDX A;  8ICH A;  3ZDA A;  5HRD A;  7ICE A;  4ECS A;  3RH5 A;  2ISO A;  1UEV A;  3KHL A;  5III A;  1QSS A;  4M6W B;  3LK9 A;  1ZYQ A;  5L1J A;  3UPS A;  3ORY A;  4F93 B;  4TUQ A;  4YR3 A;  8ICP A;  4G3I A;  2DRB A;  4R64 A;  3M9M B;  2JZB B;  4B9V A;  4RQ0 A;  3UQ2 A;  5HRE A;  5CP2 A;  3PR5 B;  1RYS A;  4Z6D A;  4Q44 A;  4DL2 A;  1A76 A;  5D46 A;  3V6K A;  4B9U A;  8ICS A;  4ELU A;  3WFP A;  2MUT B;  5IIO A;  3RJK A;  2JEI A;  1TK8 A;  4ED3 A;  2PFQ A;  4I2C A;  4ED6 A;  4KTQ A;  2ZH3 A;  2ZJ5 A;  4J9Q A;  1TVA A;  2O1P A;  5J0O A;  4KN7 A;  3V6H A;  2ALZ A;  2BPC A;  2XCA A;  4ED0 A;  4QW9 A;  4RQ2 A;  3BQ2 A;  3H8W A;  5KG7 A;  3HPO A;  2PFO A;  1UET A;  1ZQY A;  1U4B A;  1BPX A;  3SV3 A;  4RNO A;  4KLI A;  3PML A;  1NK0 A;  4B9T A;  5HRK A;  4ATB A;  4WC4 A;  2AJQ A;  4X4R A;  3TAQ A;  4YD2 A;  2BKE A;  4P4O A;  4RPX A;  4DF4 A;  3H8J A;  3QEA Z;  9ICM A;  8ICK A;  4EBJ A;  5IIJ A;  1R8C A;  4Z6F A;  3RB0 A;  5HP4 A;  3TAP A;  4O3P A;  4O3S A;  1JX4 A;  1MQ3 A;  5DG9 A;  4R65 A;  4DQR A;  3OJU A;  5KFH A;  2FMS A;  5KFZ A;  2IBK A;  3RJF A;  4DFK A;  5F9L A;  3PW5 A;  5DQG A;  5J0U A;  3QEB Z;  1ZQC A;  3AQK A;  4YMO A;  4F50 A;  3V72 A;  2HVI A;  2C22 A;  7ICM A;  7ICI A;  3B0Y A;  5DQH A;  4AT9 A;  2A1J A;  5L1L A;  1BPY A;  1ZQD A;  5IIL A;  3RB4 A;  3C5F A;  3NGD A;  1H38 A;  3TQ1 A;  4ED8 A;  3TAN A;  5DB9 A;  2FLN A;  1ZQW A;  4RZR A;  4Q45 A;  4UBC A;  4MFC A;  3MR5 A;  1UA0 A;  4JV2 A;  4TUP A;  2XO7 A;  1ZQP A;  1NJW A;  4DOB A;  3PNC A;  5EWG A;  5DB7 A;  2I9G A;  1PZN A;  4B9M A;  3AQL A;  1KFT A;  2GWS A;  3E2E A;  4QZI A;  4O5K A;  1RXV A;  4FBU A;  4YR0 A;  4BDP A;  7ICR A;  4O5C A;  4O9M A;  2W9A A;  2NRV A;  3GIL A;  3G6X A;  4QZA A;  3EZ5 A;  4DS5 A;  2BCS A;  2VA8 A;  4DF8 A;  4YP3 A;  3MR2 A;  4DSL A;  4KLS A;  3C2L A;  4J9M A;  3QE9 Y;  4JUZ A;  5L1K A;  1SL2 A;  1ZQT A;  4NLG A;  4NM1 A;  1S76 D;  9ICA A;  2XCP A;  2M2T A;  5KFT A;  5KFG A;  1Z3E B;  4M04 A;  4KLU A;  4ECW A;  4J9L A;  4QZG A;  4PH5 A;  1RZT A;  4WC3 A;  3GQC A;  5KFA A;  9ICW A;  2C2E A;  4QWB A;  4UAY A;  2Y1J A;  2R8K A;  4MEY A;  1MSW D;  1IXR A;  5KFQ A;  4YMM A;  1ZQF A;  4YD1 A;  4TQS A;  2NRT A;  3MAB A;  2Q66 A;  2ZTD A;  5EWE A;  4DL4 A;  5KFE A;  4RU9 A;  8ICN A;  2ZH2 A;  2RDI A;  2VAN A;  4RWQ A;  1FA0 A;  4QZH A;  5J2F A;  2XC9 A;  4HYK A;  3RH6 A;  1K1Q A;  4R8U B;  1L3S A;  8ICW A;  4DQQ A;  3PO5 A;  4QZE A;  5EWF A;  2M9N A;  4MF2 A;  9ICC A;  7ICL A;  2DRA A;  4O3N A;  4C8M A;  7ICV A;  5CHG A;  1JN3 A;  4WC5 A;  7ICT A;  2ZH4 A;  3SI8 A;  1ZQA A;  4PPX A;  8ICM A;  4RWN A;  1YLQ A;  9ICS A;  5TZV A;  1XU4 A;  4FS1 A;  3PX0 A;  4JWN A;  1RYR A;  2VA2 A;  4BXO A;  2F1I A;  2HW3 A;  1BNP A;  2BPG A;  3C21 A;  4GLX A;  4DL6 A;  4M2Y A;  4O3Q A;  4FHY A;  4P4M A;  1JAJ A;  1D8Y A;  2BE3 A;  4RWO A;  4J9P A;  5KG0 A;  4QWE A;  1PX5 A;  5KT7 A;  4IRK A;  3EPI A;  4KLF A;  4F4Y A;  1BVS A;  1WOT A;  4XA5 A;  2KP7 A;  5HNK A;  1DK3 A;  5KT6 A;  4B9N A;  3H4B A;  4RQ5 A;  1NKE A;  4UB5 A;  3ZD9 A;  5DGB A;  2AGO A;  2BR0 A;  1XC9 A;  4EP7 A;  4RNN A;  2XY5 A;  2W8K A;  2PFP A;  4KLQ A;  2ZTC A;  1NJX A;  5KFP A;  4TUS A;  4IQT A;  1S0V A;  3BDP A;  2F1J A;  9ICQ A;  1A77 A;  4LVS A;  1CEZ A;  2NRK A;  4YVZ A;  5J2I A;  1T7P A;  3AU6 A;  8ICR A;  5HRL A;  4DWI A;  1B43 A;  4QWA A;  1JIH A;  3IM1 A;  3JPQ A;  2ZUD A;  3PVX A;  8ICE A;  4NY8 A;  4I2J A;  3M9O B;  2W8L A;  4YMN A;  5J2J A;  3RR7 A;  3BQ1 A;  1DK2 A;  4AT8 B;  3H3A A;  1MIV A;  4TUR A;  4ATB B;  4UD5 A;  1KDH A;  3K75 D;  4E8F A;  4Q8F A;  1KTQ A;  3PX6 A;  3RBE A;  4WBZ A;  4RPZ A;  5KT5 A;  2BCV A;  1HJP A;  1SZP A;  3GFK B;  4F4X A;  1VFG A;  5KFJ A;  3SZ2 A;  2BCQ A;  5HHH A;  3B0X A;  1BPE A;  1ZQZ A;  3K4G A;  4LZD A;  1ZQR A;  4KLL A;  1NJY A;  4IQV A;  8ICJ A;  4UD4 A;  5HR9 A;  3WFQ E;  4EBE A;  4I2F A;  3LQC B;  4BWJ A;  1ZJM A;  2XGP A;  4EYH B;  7ICQ A;  2HHX A;  2W9M A;  3HW8 A;  3SYZ A;  4PHE A;  4ECY A;  3RRG A;  2JZB A;  8ICG A;  1WCL A;  3TAR A;  3UXP A;  1L3U A;  5HRI A;  5HML A;  1ZQE A;  4EBC A;  3JPR A;  4ECV A;  4M9G A;  4DSE A;  1HUZ A;  4F5O A;  1TAU A;  2KN7 A;  2DVI A;  5DQI A;  4GXI A;  1JXL A;  2AQ4 A;  1CUK A;  1S10 A;  4QW8 A;  2UVV A;  4LT6 A;  1T4G A;  2BCR A;  4KLT A;  4X5V A;  2BCU A;  4FHP A;  4AT8 A;  3N4M B;  4NKU A;  1JXE A;  4QZ8 A;  1TK5 A;  3RRH A;  1ZQJ A;  2IA6 A;  4UB1 A;  5CJ7 A;  2J6U A;  5J0T A;  4GXK A;  4DOA A;  2PFN A;  8ICX A;  7ICP A;  2P6U A;  2RDJ A;  5DB6 A;  4QZF A;  4PGX A;  5L9X A;  7ICK A;  1DOQ A;  5J0Y A;  4PHD A;  2BQU A;  4EZ9 A;  1QTM A;  1S9F A;  4BGD A;  3ZDE A;  2ZJ8 A;  3NYB A;  4WBY A;  4ECR A;  3PX4 A;  4DQP A;  3H38 A;  4Z6C A;  8ICT A;  3AQN A;  5DBA A;  3WFR E;  4F4K A;  4I2E A;  5EOZ A;  3M8S A;  3V6J A;  4YXJ A;  4B9S A;  2HHW A;  4QZB A;  4PGQ A;  4ZH4 A;  9ICK A;  5JUM A;  1TK0 A;  1K1S A;  3HT3 A;  4M6W A;  3MGI A;  2IHN A;  3C23 A;  3PY8 A;  2HHU A;  5KG3 A;  8ICU A;  1ZJN A;  4RQ8 A;  3Q8Q B;  3LWM A;  1S97 A;  3RJJ A;  4KLG A;  4WC6 A;  1ZQG A;  3MFI A;  5KG4 A;  2W9C B;  2R8H A;  1L3T A;  1NJZ A;  2ZHA A;  3MFH A;  3M9N B;  2P66 A;  4PGY A;  2ZH9 A;  4RT3 A;  1Z00 B;  4QWC A;  2KZ3 A;  2R8J A;  8ICC A;  5KFR A;  4DQS A;  2C2R A;  1NK5 A;  1BNO A;  2W9B A;  2LYH A;  4RQ6 A;  3JYY A;  2FPL A;  4S3N A;  3PW7 A;  3WFO A;  4YG2 A;  4QZD A;  9ICP A;  4I2D A;  4RNM A;  1EXN A;  4MFA A;  3MDA A;  1NK8 A;  1ZQN A;  5C5J A;  4KLM A;  3V7J A;  1JMS A;  3ETL A;  4GC7 A;  1ZET A;  1NKC A;  3RJE A;  4IQW A;  4M0A A;  4X4T A;  3Q8S B;  5KG5 A;  3AU2 A;  4C8O A;  7ICO A; 
#chains in the Genus database with same CATH topology
 5AKY A;  2WF6 A;  1V4A A;  3E58 A;  4IR1 A;  4E0D A;  9ICB A;  3T79 A;  3RAQ A;  2QB0 A;  2PMZ F;  2D3D A;  4AT7 B;  1ZQI A;  3N97 B;  4Y2T A;  3RB3 A;  5AM3 A;  5CR0 A;  1N5X A;  4O67 A;  2NRZ A;  1MC8 A;  3C1Z A;  2CPR A;  1NOM A;  1L3V A;  1SKS A;  2K4H A;  3EPG A;  3Q8K A;  9ICL A;  1JAL A;  4DFJ A;  4CE6 A;  1Q8K A;  4MEX A;  1SWV A;  3N7R C;  3ISB A;  5AI8 A;  1TKD A;  5AM0 A;  5GTI U;  4CF3 A;  3N7S C;  4JK1 A;  2G5H B;  2BPF A;  2W3S A;  3C5G A;  3C29 A;  4ELT A;  4DSF A;  3GIK A;  8ICI A;  1SKW A;  2JHD A;  1J2N A;  4R63 A;  2YMM A;  4NXX A;  1XSN A;  2FPM A;  3UPQ A;  4G9B A;  2DR7 A;  4I2H A;  4UAU A;  5ALL A;  4GXJ A;  4P0P A;  3FDS A;  1X9W A;  2KVC A;  5ALZ A;  3RJH A;  4UB4 A;  4IRD A;  2KFZ A;  3OVB A;  5CWR A;  2DFL A;  5DKW A;  2R8I A;  3RR8 A;  4K99 A;  2F77 X;  4X4Q A;  1TV9 A;  4PHP A;  2OXO A;  5IIN A;  1NK9 A;  2ODG A;  1NK6 A;  2QB1 A;  3OHA A;  2KMD A;  4EBD A;  9ICR A;  5AKL A;  4RPY A;  1D9F A;  2WHE A;  2FMP A;  2KZM A;  4F4W A;  2F1H A;  1PK1 A;  4C7Y A;  2KEY A;  4RQ7 A;  2LHT A;  5J0X A;  2GAF D;  2HBJ A;  5DB8 A;  2HBK A;  1R89 A;  2J6T A;  8ICQ A;  9ICX A;  3AEV A;  2B21 A;  1X9S A;  3UXO A;  4DFP A;  3PR4 A;  5F2V O;  3H39 A;  3T5K A;  2EAN A;  5AKI A;  1KFD A;  5KFX A;  4RQ3 A;  4IG8 A;  1NO5 A;  3OVS A;  2Q0Z X;  1KQQ A;  2JEG A;  2LYB A;  8ICA A;  4Y2Q A;  3LWL A;  3SEI A;  2HN2 A;  3C18 A;  4MF8 A;  3JPO A;  3G6V A;  3KHH A;  4UB2 A;  4AT7 A;  5F9N A;  2Q4T A;  3UQ0 A;  4DL7 A;  3Q8L A;  1SKR A;  5AK6 A;  3AL0 B;  1UCV A;  5IIM A;  4QZ9 A;  3QZ7 A;  5KG6 A;  5KFL A;  4FHX A;  3MCR A;  2L5Y A;  4K4G A;  1XWL A;  1ARO P;  3I76 A;  5KFC A;  2C28 A;  2M0N A;  4X4O A;  4X4S A;  4NXV A;  4GC6 A;  1R8A A;  2Y9T A;  3H8S A;  1T3N A;  5ALK A;  4X4U A;  2KJ9 A;  4Z6E A;  1IM4 A;  2W9B B;  1S0N A;  2W7P A;  3WFS C;  1ZQL A;  1TFR A;  1V97 A;  2M2V A;  1Q79 A;  2HHQ A;  2HVH A;  2ASJ A;  2O6K A;  2XY6 A;  2HHP A;  4RT2 A;  4EZ6 A;  4WC7 A;  5KFK A;  1S77 D;  5ALO A;  3ZD8 A;  1N60 A;  1OUQ A;  4KLE A;  5CA7 A;  2HN1 A;  4DQI A;  4JV1 A;  1F5A A;  1GPJ A;  3BQT A;  5KFM A;  5ALJ A;  1QQ7 A;  4ED1 A;  5DEC A;  1ZQO A;  2K8A A;  1KNY A;  5KTQ A;  4NLN A;  2ZXI A;  2KSO A;  1NK7 A;  2A1J B;  5AIC A;  2YN4 A;  3WKB A;  5ALE A;  2ESE A;  4G3I A;  4R64 A;  3M9M B;  3IG5 A;  2EZZ A;  5CP2 A;  1PK3 A;  2MSN A;  5J0O A;  4KLO A;  2BPC A;  4ED0 A;  4QW9 A;  3BQ2 A;  4WQL A;  5KG7 A;  3HPO A;  2G07 A;  1U4B A;  1BPX A;  5AM5 A;  4WC4 A;  3AM9 A;  2BKE A;  4DF4 A;  2D6F C;  5HP4 A;  1X42 A;  2HI0 A;  4DQR A;  2D8C A;  4R65 A;  1L7P A;  2F8L A;  2FMS A;  4HX0 A;  3QEB Z;  4YMO A;  3V72 A;  2C22 A;  3WK6 A;  5EE0 A;  4AT9 A;  3D6J A;  5L1L A;  5H2F U;  4Y2V A;  2FLN A;  4JV2 A;  1L7M A;  4FZL A;  3PNC A;  4LEZ A;  3E2E A;  4QZI A;  1RXV A;  2Y0S C;  7ICR A;  4O5C A;  4K8V A;  2W9A A;  2NRV A;  4QZA A;  4LEY A;  3RFA A;  4DSL A;  4J9M A;  3QE9 Y;  5L1K A;  1SL2 A;  4C4R A;  2VIX A;  2M2T A;  4M04 A;  5KFG A;  2KKV A;  4QZG A;  2Y1J A;  1O08 A;  4TQS A;  2NRT A;  5EWE A;  2QKQ A;  5KFE A;  3F2B A;  2ZIV B;  3RH6 A;  4FZM A;  4R8U B;  2G06 A;  2M9N A;  7ICL A;  1MN8 A;  3SI8 A;  1ZQA A;  4JLZ A;  4CF5 A;  4UAT A;  9ICS A;  4FS1 A;  1KBU A;  4BXO A;  1X6I A;  4GLX A;  2RHF A;  1D8Y A;  2CXY A;  1Z4N A;  4F4Y A;  4XA5 A;  2KP7 A;  1DK3 A;  5HNK A;  1NKE A;  4UB5 A;  1ZD3 A;  3ZD9 A;  2AGO A;  2FDR A;  2IOF K;  2XVT A;  3AU6 A;  5AK5 A;  5HRL A;  8ICE A;  4QWA A;  3IM1 A;  3PVX A;  3CRX A;  4NY8 A;  3M9O B;  3NVY A;  2W8L A;  4C80 A;  3BQ1 A;  3H3A A;  4ATB B;  4UD5 A;  3PX6 A;  4P0P B;  5B66 U;  3QXG A;  2E5S A;  5KFJ A;  2ZIX A;  3SAH A;  1BPE A;  1ZQR A;  2OM6 A;  4DCC A;  4UD4 A;  5D63 A;  2ZXH A;  2XGP A;  5ALF A;  1NI3 A;  4EYH B;  2W9M A;  5A0L A;  3JCF A;  2EZY A;  3RRG A;  8ICG A;  4LEV A;  3WU2 U;  3PSI A;  4NJ8 A;  5HML A;  4M9G A;  4US9 A;  4DSE A;  5DQI A;  1JXL A;  1S10 A;  2UVV A;  2BCR A;  1VLB A;  1JXE A;  3RRH A;  1ZQJ A;  4UB1 A;  4GXK A;  4FZN A;  3AQE A;  3KKA A;  4WBY A;  3PX4 A;  4Z6C A;  3WK9 A;  5DBA A;  2JH1 A;  3PZP A;  2HHW A;  4YXJ A;  4B9S A;  1TK0 A;  2LM4 A;  8ICU A;  2CRX A;  3MFI A;  1CI4 A;  5KG4 A;  2R8H A;  1L3T A;  3M9N B;  4PGY A;  2HBL A;  4B6J A;  4DQS A;  2C2R A;  5J8Y C;  1BNO A;  1NK5 A;  4WQK A;  3BQ7 A;  1SWW A;  2YMQ A;  4PL2 A;  3WK4 A;  3MDA A;  1EXN A;  1NK8 A;  1ZQN A;  4UAV A;  3V7J A;  4M0A A;  4IQW A;  5KG5 A;  2LKY A;  4KX5 A;  7ICO A;  4QWD A;  4DSK A;  5KAF U;  4O5E A;  5DDY A;  4I2I A;  2H3Z A;  4HAI A;  3HJ1 A;  4F8R A;  2FLL A;  5EE3 A;  2FLP A;  4ED2 A;  4IC9 A;  2LMR A;  1SL1 A;  4C8N A;  5BOM A;  3MGH A;  7ICJ A;  1RXW A;  3PW4 A;  2AXT U;  2ZHB A;  2K4P A;  1L5U A;  3RB6 A;  3RTV A;  3FC4 A;  3HWT A;  3O0F A;  3LVV A;  3RH4 A;  4XUS A;  4WC0 A;  4C7Z A;  5KFF A;  1D8L A;  4ECX A;  4E80 A;  3L5K A;  4FH5 A;  1FIQ A;  2ZH5 A;  2MA1 A;  2WF5 A;  5KT4 A;  3H4D A;  4JV0 A;  2BQ3 A;  5KG1 A;  4AYB C;  1WUD A;  1ZQM A;  2ZH1 A;  4K9B A;  3ICX A;  1NZP A;  5AKZ A;  4F71 A;  4JWM A;  4YCX A;  4DO9 A;  4F2S A;  3GV5 B;  1U48 A;  3ISD A;  2FPK A;  3MDC A;  1LKY A;  4LZG A;  3C2M A;  1S5L U;  5KFY A;  2W03 A;  4Y2J A;  2YX8 A;  5J2C A;  1X2I A;  4J9K A;  1U45 A;  4EX6 A;  5KFO A;  5ALM A;  2PMZ C;  5ALW A;  1D9D A;  2R8G A;  3QYP A;  5KG2 A;  4O3R A;  9ICV A;  2UVR A;  4B9L A;  1SB3 C;  3TI0 A;  2WB1 F;  1KFS A;  5ALD A;  1RDF A;  2WF7 A;  2Y9U A;  4BJQ A;  2ID1 A;  3OVA A;  2F2A B;  3OGU A;  1QQ5 A;  5KFN A;  7ICN A;  3KTQ A;  3F5E A;  4DL5 A;  5AI6 A;  2DPI A;  3MR3 A;  3HP6 A;  3PW0 A;  9ICT A;  1Z00 A;  4NXT A;  1AQ6 A;  2W9C A;  1JQR A;  5DED A;  4FBT A;  2ZIW A;  5J2E A;  5AK4 A;  4UAZ A;  4UB6 U;  4KN4 A;  2J6S A;  3SQI A;  2BGW A;  2H3V A;  4DS4 A;  3C1Y A;  1RPL A;  5J2D A;  4X0B A;  3KKA C;  2V4Q A;  4Y2R A;  2LYA A;  5BPC A;  4F3O A;  2DGZ A;  1BGX T;  3A0H U;  3OSP A;  2F8K A;  5KT3 A;  4IR9 A;  3L9D A;  1S0O A;  2WAQ C;  5D4B A;  4I2A A;  4ELV A;  9ICF A;  2BDP A;  1MA7 A;  5KAI U;  5J29 A;  2ZUC A;  4KLD A;  1SV0 A;  4X0A A;  2ZTE A;  4FHW A;  3ISC A;  2PKE A;  3GIJ A;  4KM5 A;  1V9P A;  3Q8R B;  3A0B U;  1ZRN A;  2KTQ A;  5EE1 A;  9ICU A;  5DG7 A;  5KFD A;  1DXS A;  1TFY A;  5G5H A;  5DBC A;  4F5P A;  1Z19 A;  3V7L A;  5AIB A;  4I0U A;  4UAW A;  1N62 A;  4RQN A;  3AUO A;  2P6R A;  2KOB A;  5TIS U;  2WFA A;  8ICZ A;  3ZDD A;  4NM2 A;  3CNH A;  4ECU A;  2DQN B;  2I1Q A;  4NLZ A;  3HIL A;  1WYG A;  5L1I A;  2KFN A;  4NLC A;  1L8O A;  4FHV A;  3H0M B;  2ASL A;  4CCH A;  1PVQ A;  1LB2 B;  3V7K A;  4O3M A;  1NNL A;  3WK7 A;  3WKE A;  2YY6 A;  3BQ0 A;  2MAX A;  3KHR A;  2KD1 A;  3JZ0 A;  2OHF A;  3HJ4 A;  4IS7 A;  3ZDA A;  2HOF A;  7ICE A;  2KVS A;  3QU7 A;  3NVO A;  2AH5 A;  2HOI A;  4EGW A;  1VDV A;  2GO7 A;  1QSS A;  4LEW A;  4M6W B;  5L1J A;  3UPS A;  2EZX A;  4YR3 A;  8ICP A;  4B9V A;  4DFD A;  1T3Q A;  3WFP A;  5IIO A;  1ECW A;  2PFQ A;  4KTQ A;  5ALY A;  4J9Q A;  3V6H A;  4RQ2 A;  2GA9 D;  1UET A;  3IN5 A;  3SV3 A;  5HRK A;  2DR9 A;  4P4O A;  4RPX A;  2OCE A;  3H8J A;  3NVZ A;  4EBJ A;  4Z6F A;  3TAP A;  4O3S A;  4Y2S A;  1JX4 A;  5DG9 A;  3I1Y A;  2F44 A;  1RYU A;  3RJF A;  4DFK A;  5F9L A;  3NAS A;  5J0U A;  4C0Z A;  1FFU A;  4FE3 A;  3ER9 B;  7ICM A;  5ALX A;  4QJF B;  7ICI A;  2A1J A;  1BPY A;  2YB4 A;  3RB4 A;  3C5F A;  4ED8 A;  4Q45 A;  4Y2X A;  1UA0 A;  1V38 A;  4TUP A;  4DOB A;  2I9G A;  3AMZ A;  4BDP A;  2KHQ A;  2K4I A;  3LYS A;  3GIL A;  2BCS A;  2VA8 A;  4KLS A;  3MR2 A;  4WH5 A;  4NM1 A;  9ICA A;  5KFT A;  1Z3E B;  3NVW A;  4KLU A;  4J9L A;  3PST A;  5KFA A;  3GU3 A;  4UAY A;  2RRD A;  3U26 A;  1ZQF A;  2Q66 A;  3NRW A;  4RU9 A;  2XI9 A;  8ICN A;  2ZH2 A;  2RDI A;  1J2M A;  4QZH A;  1FFV A;  3PO5 A;  1B0X A;  1X9X A;  5EWF A;  2HBM A;  9ICC A;  1D8B A;  2DRA A;  2QLT A;  1QCK A;  4WC5 A;  7ICT A;  3HKZ C;  5TZV A;  3PX0 A;  1RYR A;  5AM4 A;  3BS5 A;  2F1I A;  5CFT A;  2BPG A;  4M2Y A;  2FJ6 A;  4O3Q A;  2BE3 A;  5KG0 A;  4JMU A;  4EEL A;  1PX5 A;  3KBB A;  2RQ5 A;  3EPI A;  4KLF A;  1WOT A;  4OJO A;  5KT6 A;  2BR0 A;  5ALT A;  4RNN A;  2H3Q A;  2XY5 A;  4KLQ A;  2ZTC A;  5KFP A;  5L1M A;  4USA A;  4EEN A;  2F1J A;  2WAQ F;  2KIW A;  1KL9 A;  1JIH A;  3JPQ A;  5J2J A;  5AM2 A;  1DK2 A;  1MIV A;  4TUR A;  3D2Q A;  4Q8F A;  2BCV A;  3SZ2 A;  5HHH A;  3K4G A;  4LZD A;  4KLL A;  1NJY A;  1L6N A;  4I2F A;  4BWJ A;  1HIW A;  1Q46 A;  3ED5 A;  2HHX A;  3HW8 A;  3SYZ A;  4PHE A;  4ECY A;  4WOY A;  4EX7 A;  1F0M A;  3KFU F;  3JPR A;  4ECV A;  3NS1 A;  4F5O A;  1TAU A;  1SGG A;  4LT6 A;  4QW8 A;  4X5V A;  2BCU A;  4AT8 A;  3N4M B;  4QZ8 A;  2J6U A;  5CJ7 A;  4DOA A;  7ICP A;  1J97 A;  2RDJ A;  5D62 A;  5DB6 A;  5AHX A;  2BZF A;  3FAH A;  5J0Y A;  2F3N A;  4GIB A;  4PHD A;  2BQU A;  4EZ9 A;  4BGD A;  2ZJ8 A;  2KG5 A;  4ECR A;  1RQL A;  5KNI A;  3WFR E;  3CW2 C;  3I28 A;  5EOZ A;  3V6J A;  1C20 A;  2CN1 A;  4ZH4 A;  1K1S A;  4M6W A;  1RG6 A;  2HHU A;  5KG3 A;  4RQ8 A;  3Q8Q B;  1ZQG A;  4NV0 A;  2XIC A;  4KB6 A;  1Z00 B;  3AN1 A;  2R8J A;  5KFR A;  1O03 A;  1ZXI A;  1SV4 A;  4YG2 A;  4RNM A;  4MFA A;  5C5J A;  4KLM A;  2KV2 A;  1A6S A;  2E8N A;  3AU2 A;  1WWV A;  4I2B A;  5AI9 A;  5IIK A;  5CFU A;  3AQF A;  3SEN A;  3KZX A;  1Z1V A;  3G6Y A;  3JPS A;  3RJI A;  5JTI A;  2IUB A;  4WC2 A;  4I2G A;  2G0A A;  4M9J A;  1N48 A;  1IG6 A;  1UT5 A;  3RJG A;  1NZB A;  4UQG A;  4NLB A;  5AKE A;  1ED1 A;  4YR2 A;  3E0F A;  2ZUB A;  2NRW A;  4BXO B;  4XQ8 A;  1UA1 A;  2HCF A;  2PBE A;  4YQW A;  3VCB A;  5J0P A;  2M2W A;  4DL3 A;  3IHQ B;  4O0I A;  4UBB A;  1TFW A;  2PXI A;  2VJ5 A;  3GV8 B;  4IRC A;  4K4I A;  5DLF A;  2FMQ A;  2M2U A;  1S8O A;  1C7Y A;  1UEU A;  2BDU A;  3NRZ A;  2E8P A;  2B0C A;  3EW9 A;  3M7D A;  3NTU A;  1M6Y A;  3QUB A;  2JEF A;  1N5W A;  9ICG A;  4DLG A;  4OD0 A;  4M5D A;  2NRX A;  4DSJ A;  2H3F A;  3OWG A;  3T5J A;  3F5A A;  5E79 U;  4NXZ A;  5AI0 A;  4QZC A;  1Q3U A;  5J2K A;  2ISP A;  3GZF A;  3OTQ A;  3ZDB A;  2IOF A;  1KRP A;  1VJ7 A;  2HOQ A;  3NKU A;  2IMW P;  5F3X B;  3M6Z A;  2V9W A;  2HHT A;  2AGQ A;  4RWP A;  1ZRM A;  2DKZ A;  2YMP A;  4OAG A;  3PO4 A;  5JRT A;  1B22 A;  8ICO A;  1F44 A;  1WG8 A;  8ICV A;  1NKB A;  2K8B B;  4I29 A;  2MUT A;  4WCW A;  3EF2 A;  4XQ7 A;  1YZ7 A;  3UMC A;  7ICS A;  4KLJ A;  2EDU A;  5J2H A;  3THV A;  9ICH A;  3JPT A;  4CNQ A;  2E8O A;  3GII A;  4O3O A;  3HRD D;  2EAM A;  2Y1I A;  2JR5 A;  1IV8 A;  8ICB A;  8ICL A;  3OUY A;  1MQ2 A;  3TFS A;  5DGA A;  2H5X A;  3BZC A;  2RLT A;  3IP4 B;  4NKT A;  2WF8 A;  4RQ1 A;  4EEY A;  2RFF A;  1LKY B;  2IHM A;  2YB1 A;  3C28 A;  1MIY A;  2BQR A;  1JRP A;  1QH9 A;  2AGP A;  7ICG A;  4J9O A;  4X4N A;  4QIW F;  3GV7 B;  5CB1 A;  2A3V A;  4A8E A;  2HDO A;  4YN4 A;  2UVW A;  4P2H A;  1S0M A;  4DSI A;  4UAS A;  1L7N A;  1N63 A;  2EAO A;  4EEK A;  9ICJ A;  2A1A A;  3SAG A;  2H3I A;  5HRG A;  3M1Y A;  1R8B A;  3MBY A;  3LDA A;  1DGJ A;  4NL9 A;  3VC8 A;  4J9S A;  5KFI A;  5J0W A;  1QLN A;  4FS2 A;  5ALU A;  2B56 A;  3BJY A;  1BPD A;  2KSO B;  1U49 A;  2KNJ A;  2NYV A;  3H40 A;  3B9J A;  5BOL A;  2HHS A;  5KFV A;  4F4Z A;  1IIP A;  3KHG A;  5DLG A;  5KT2 A;  3QU5 A;  5KFW A;  2KHV A;  7ICF A;  2DUY A;  4K96 A;  3NVV A;  2FI1 A;  1ZQS A;  1ZD5 A;  2ZH8 A;  2ES6 A;  1YZ6 A;  4EYI B;  3OV7 A;  5J0R A;  1KLN A;  3SAF A;  1BPB A;  2JRZ A;  2XGQ A;  2W04 A;  2ZJA A;  1U47 A;  2K8C B;  1ZQX A;  4NLK A;  1HUO A;  3T5H A;  3JPN A;  5AKX A;  3Q8P B;  5AM1 A;  1X9M A;  1LV5 A;  3ONN A;  2JEJ A;  2XY7 A;  3SV4 A;  2LPE A;  4YXM A;  4Y2Y A;  2PI5 A;  4M9N A;  5KFS A;  4RUA A;  4KLH A;  3KOO A;  3GDX A;  4NXU A;  4ECS A;  3RH5 A;  4IL6 U;  3KHL A;  1JI7 A;  4MHV A;  2B4V A;  3IG8 A;  3LK9 A;  2JMG A;  3ORY A;  4TUQ A;  2DRB A;  3WKD A;  1Z4O A;  3UQ2 A;  3L3F X;  1RYS A;  5HRE A;  1A76 A;  3V6K A;  8ICS A;  4ELU A;  2DF4 B;  1TK8 A;  2ZIU B;  4ED3 A;  2NO5 A;  1FO4 A;  4I2C A;  1KKX A;  1GO3 F;  2ZJ5 A;  1UHU A;  2ALZ A;  2K4E A;  2Z7J A;  3H8W A;  3SMV A;  1SV0 C;  4RNO A;  1V85 A;  4KLI A;  4J03 A;  4LJX A;  3TAQ A;  4OO1 J;  3QEA Z;  9ICM A;  8ICK A;  1R8C A;  3RB0 A;  1T94 A;  2F76 X;  2JV3 A;  1MQ3 A;  4CF4 A;  3PW5 A;  3AQK A;  2W3R A;  1ZQC A;  5AI4 A;  2GLE A;  1XO0 A;  2KJ8 A;  2QAR B;  4NWI A;  3BZK A;  1UQV A;  3TAN A;  5DB9 A;  2XID A;  1ZQW A;  2XO7 A;  1ZQP A;  1NJW A;  2ZIV A;  5EWG A;  5DB7 A;  5D61 A;  1PZN A;  3S6J A;  4B9M A;  3AQL A;  1KFT A;  2P35 A;  4O5K A;  4FBU A;  1F5S A;  4YR0 A;  4O9M A;  2E1E A;  3G6X A;  4DS5 A;  3RF9 A;  4YP3 A;  3C2L A;  1S76 D;  5AIA A;  2XCP A;  5KL1 B;  2E1F A;  1RZT A;  4PH5 A;  1ZQ1 C;  3TAD A;  2R8K A;  2HMX A;  4MEY A;  3UMB A;  2ZTD A;  1Q3V A;  4RWQ A;  1FA0 A;  2XC9 A;  4HYK A;  1K1Q A;  1L3S A;  4DQQ A;  4QZE A;  4PJ0 U;  3DDH A;  4C8M A;  2ZIU A;  1JN3 A;  2N1R A;  5GTH U;  4C4T A;  4KX3 A;  8ICM A;  4RWN A;  1YLQ A;  2W54 A;  2Y0S F;  4NL9 C;  5ALI A;  2G08 A;  4NXW A;  3M6K A;  2VA2 A;  4FFD A;  2OEH A;  1BNP A;  3C21 A;  4FHY A;  4RWO A;  1JAJ A;  5K4L A;  4QWE A;  2GOL A;  1VJ5 A;  4IRK A;  3H4B A;  1PUZ A;  4RQM A;  1FEZ A;  1XC9 A;  2LI6 A;  3CYM A;  2PFP A;  2W8K A;  3D2S A;  3CK6 A;  4ZOH C;  2EH9 A;  1NJX A;  4IQT A;  1DRG A;  1A77 A;  1CEZ A;  3KD3 A;  4DWI A;  3MGV A;  2ZUD A;  4I2J A;  3PHZ A;  4JLX A;  4N7R A;  4CRX A;  1X6J A;  3TAC B;  3K75 D;  4E8F A;  1KTQ A;  3GFK B;  5ALG A;  4IQV A;  2QB0 B;  5AKJ A;  1ZJM A;  2LBO A;  4O6A A;  2JZB A;  2FE9 A;  2W11 A;  3UXP A;  4EBC A;  1HUZ A;  2DVI A;  4GXI A;  1CUK A;  1T4G A;  4KLT A;  4GFJ A;  7ICK A;  1SIJ A;  3IV6 A;  5J0T A;  8ICX A;  3J81 j;  3EUB 2;  2P6U A;  1X66 A;  5ALR A;  4QZF A;  1YT3 A;  5CEH A;  4P0Q B;  2KK0 A;  1DOQ A;  1QTM A;  1S9F A;  5ALP A;  2MRL A;  3NYB A;  2BBJ A;  1N61 A;  3H38 A;  8ICT A;  1P7D A;  3WK8 A;  4PGQ A;  1X40 A;  2IHN A;  1L8L A;  3PY8 A;  2ZG6 A;  1ZJN A;  1S97 A;  5CHE A;  3RJJ A;  4KLG A;  4OAF A;  5B3Q A;  2ZH9 A;  4QWC A;  4PZN A;  4RQ6 A;  3JYY A;  2FPL A;  4S3N A;  3PW7 A;  3D2N A;  4QZD A;  9ICP A;  4UW9 A;  1PK1 B;  3ETL A;  5EE9 A;  3RJE A;  4X4T A;  4C8O A;  1UT8 A;  5JU5 A;  5DDM A;  5J2B A;  1OW5 A;  2W55 A;  3MR6 A;  4C8K A;  1JRO A;  3QU4 A;  2UVU A;  3QX7 A;  2NV3 A;  2ZH7 A;  1A0P A;  8ICY A;  2B51 A;  3WK5 A;  3N28 A;  3RAX A;  1Y88 A;  5B3P A;  3C66 A;  3EWA A;  9ICE A;  4BUG A;  3BS5 B;  3H37 A;  3OJS A;  4PHA A;  3ZDC A;  1ZQK A;  2YTU A;  3ER8 C;  4KMU A;  5HMM A;  3UM9 A;  2EWR A;  3FYH A;  2ASD A;  5HR7 A;  1Q78 A;  1OXJ A;  5HC9 A;  1ZQQ A;  4Y2U A;  3FM9 A;  4K4H A;  4M9H A;  3T3F A;  2GH1 A;  5B5E U;  3LVW A;  1XSP A;  2DPJ A;  4K98 A;  5DG8 A;  5J2G A;  3EYZ A;  1XSL A;  4XJE A;  2HHV A;  5JTG A;  5ALH A;  2NO4 A;  4Y2P A;  3PV8 A;  4F72 A;  4J9N A;  1NK4 A;  5KFU A;  2W7O A;  4KIT B;  1SL0 A;  5G5G A;  4R66 A;  1QSY A;  1WCN A;  1L7O A;  2WB1 C;  2W43 A;  1TAQ A;  5HRB A;  2VKQ A;  9ICN A;  1ZQH A;  4BX9 C;  4RUC A;  4ECT A;  3KZI U;  2KIC A;  3F2D A;  1JUD A;  2DWQ A;  4I28 A;  2MU2 A;  2AU0 A;  4ED7 A;  3AQM A;  2EAP A;  2BHN A;  2V4R A;  5ALN A;  4WJ3 B;  1XS9 D;  1K5O A;  1PVR A;  1QSL A;  3K1R B;  4IQU A;  7ICU A;  2DKX A;  4DLE A;  3OSN A;  4J9R A;  1TAM A;  2WTF A;  3MC1 A;  5D49 A;  4I27 A;  4MKP A;  4OJL A;  1MIW A;  4UAR A;  1DGS A;  4F92 B;  4M47 A;  5C0Y A;  2AHO B;  3K1Z A;  2DR8 A;  2IHO A;  5ALQ A;  5CRX A;  4DEZ A;  4Q43 A;  4AP9 A;  4EBK A;  4E7X A;  1SZH A;  4O69 A;  4C4S A;  5DBB A;  2VA3 A;  2C2D A;  3GIM A;  3QZ8 A;  2DL0 A;  1OU5 A;  2JH7 A;  4QNL A;  3QUQ A;  3OPX A;  1ZQV A;  9ICI A;  3R9K A;  3H0L B;  3PMN A;  3TAD C;  3WKA A;  4FH3 A;  4X4V A;  4M9L A;  1B4F A;  1ZQB A;  3QU9 A;  4K97 A;  2ATL A;  4OJP A;  2O5A A;  4BWM A;  4WC1 A;  2DR5 A;  2WF9 A;  4PZO A;  4F5R A;  3QUC A;  5T14 A;  3C2K A;  4DFM A;  4ECQ A;  2AQ0 A;  3T5L A;  2VJ4 A;  4X4P A;  4ECZ A;  4ACO A;  3HX0 A;  1KEJ A;  3HIY A;  4P4P A;  1XO1 A;  7ICH A;  5J0S A;  4US8 A;  4K9A A;  5KFB A;  3F2C A;  5J0Q A;  4FO6 A;  4C8L A;  3H7I A;  5ALV A;  2JXJ A;  4F2R A;  4UB8 U;  4Q8E A;  4MFF A;  5J2A A;  1ZD2 P;  3QUT A;  3UXN A;  3L4P A;  5HHI A;  1SXE A;  4R8U A;  3JPP A;  3DEE A;  4RQ4 A;  3Q8M A;  3OUY B;  2PI4 A;  3PW2 A;  1U9L A;  1T8E A;  4DOC A;  4F5N A;  1BPZ A;  1N56 A;  2ZH6 A;  5HRF A;  2HSZ A;  1COO A;  5HR6 A;  9ICO A;  1UPH A;  4F91 B;  3OHB A;  4AT9 B;  3M8R A;  2B6G A;  1ZQU A;  3WKC A;  4TQR A;  4XRH A;  1KSP A;  3TFR A;  4UB3 A;  4YFK A;  1KN5 A;  2K89 A;  3RBD A;  2OWO A;  2KZZ A;  8ICH A;  5HRD A;  4F5Q A;  5AK3 A;  1RQN A;  2ISO A;  1UEV A;  5III A;  1TE2 A;  2E3T A;  3ZI4 A;  1ZYQ A;  3IRU A;  4F93 B;  2JZB B;  4RQ0 A;  2OYY A;  4OAI Z;  3ERC C;  3PR5 B;  4Z6D A;  4Q44 A;  2IOH A;  4DL2 A;  5D46 A;  4B9U A;  2OH2 A;  2MUT B;  3RJK A;  2JEI A;  2ZH3 A;  4ED6 A;  1TVA A;  2O1P A;  4KN7 A;  2PFO A;  2XCA A;  5HRH A;  2ZIX B;  4ICA A;  1ZQY A;  4EEB A;  3PML A;  1NK0 A;  4B9T A;  4ATB A;  4X4R A;  2AJQ A;  4YD2 A;  5IIJ A;  2I6X A;  2JGA A;  2K60 A;  4O3P A;  2G5I B;  4EED A;  3OJU A;  5KFH A;  2IBK A;  5KFZ A;  2EQY A;  5DQG A;  5CFS A;  4F50 A;  2HVI A;  3B0Y A;  5DQH A;  5KL8 B;  1Z1B A;  1ZQD A;  5IIL A;  3NGD A;  1H38 A;  3TQ1 A;  4WBZ A;  1VFG A;  4MFC A;  4RZR A;  4UBC A;  3MR5 A;  2GWS A;  3SD7 A;  2KIV A;  2ZIW B;  3HKZ F;  5AKK A;  3EZ5 A;  4DF8 A;  3SR6 A;  4KMO B;  3IDW A;  1ZQT A;  4JUZ A;  4NLG A;  4U6P A;  4ECW A;  4WC3 A;  3GQC A;  4QIW C;  4OAH A;  2KKP A;  4JB3 A;  4OCZ A;  2KJ5 A;  5J8Y A;  2C2E A;  4QWB A;  9ICW A;  3ALR A;  4OJ6 A;  1MSW D;  1IXR A;  2G09 A;  5KFQ A;  4YMM A;  4YD1 A;  3MAB A;  2R18 A;  4DL4 A;  2VAN A;  1WWU A;  2YQE A;  5J2F A;  8ICW A;  3H8M A;  4MF2 A;  4O3N A;  4U7C A;  7ICV A;  5CHG A;  2A19 A;  3PSF A;  2ZH4 A;  4PPX A;  1QQ6 A;  1ZD4 A;  3PSP A;  1XU4 A;  4JWN A;  2HW3 A;  4DL6 A;  4P4M A;  2QAR A;  4J9P A;  5KT7 A;  1BVS A;  3UMG A;  4B9N A;  3NUQ A;  3F53 A;  4RQ5 A;  5DGB A;  4EP7 A;  3HJE A;  4PL1 A;  1COK A;  1XNS A;  3ETR A;  2E8M A;  2YML A;  4TUS A;  1S0V A;  3BDP A;  9ICQ A;  4LVS A;  2RP5 A;  2NRK A;  4YVZ A;  5J2I A;  1T7P A;  8ICR A;  1B43 A;  4CGZ A;  4EV6 A;  5FP0 A;  3RR7 A;  4YMN A;  4AT8 B;  3H0R B;  1KDH A;  4P0Q A;  3RBE A;  4RPZ A;  3BS7 A;  5KT5 A;  1HJP A;  1SZP A;  2I5H A;  4F4X A;  2BCQ A;  3B0X A;  1ZQZ A;  4OJ5 A;  8ICJ A;  1KW4 A;  5HR9 A;  3WFQ E;  4EBE A;  3LQC B;  2FCL A;  7ICQ A;  3N7P D;  5ALS A;  3QU2 A;  1WCL A;  3TAR A;  1L3U A;  1HEK A;  5HRI A;  1ZQE A;  2KN7 A;  2DBY A;  2AQ4 A;  1PVP A;  1SXD A;  5AKG A;  4FHP A;  4NKU A;  5AKH A;  1TK5 A;  2IA6 A;  2PFN A;  4PGX A;  4CDG A;  5L9X A;  3NWI A;  3CP8 A;  3QNM A;  4FO1 A;  4O68 A;  3ZDE A;  4DQP A;  3AQN A;  1CRX A;  3TKA A;  4F4K A;  4I2E A;  3M8S A;  1URJ A;  4QZB A;  9ICK A;  5JUM A;  3HT3 A;  3MGI A;  1RM6 C;  3C23 A;  2KE7 A;  1ZOL A;  3LWM A;  4WC6 A;  2BBH A;  2W9C B;  1NJZ A;  2ZHA A;  1LVH A;  3MFH A;  2P66 A;  4RT3 A;  3K7D A;  2KZ3 A;  8ICC A;  1N2X A;  2W9B A;  2LYH A;  5AI5 A;  3WFO A;  4AYB F;  4I2D A;  8ICF A;  1JMS A;  2LM1 A;  4GC7 A;  1ZET A;  3DV9 A;  1NKC A;  3Q8S B; 
#chains in the Genus database with same CATH homology
 4QWD A;  4I2B A;  4DSK A;  1V4A A;  1UT8 A;  5IIK A;  5DDM A;  4E0D A;  5DDY A;  5J2B A;  4I2I A;  4IR1 A;  4O5E A;  9ICB A;  3G6Y A;  3RAQ A;  4F8R A;  3HJ1 A;  2FLL A;  3JPS A;  3RJI A;  3MR6 A;  4C8K A;  2FLP A;  2UVU A;  4AT7 B;  1ZQI A;  4WC2 A;  4I2G A;  4M9J A;  2ZH7 A;  3N97 B;  1N48 A;  4ED2 A;  8ICY A;  3RB3 A;  5CR0 A;  1UT5 A;  3RJG A;  3RAX A;  4UQG A;  1Y88 A;  2NRZ A;  1MC8 A;  3C1Z A;  1SL1 A;  1NOM A;  3C66 A;  4C8N A;  4YR2 A;  5BOM A;  3EWA A;  1L3V A;  9ICE A;  1SKS A;  3MGH A;  2ZUB A;  3EPG A;  2NRW A;  4BXO B;  4XQ8 A;  7ICJ A;  1RXW A;  3H37 A;  1UA1 A;  2PBE A;  3OJS A;  4PHA A;  3Q8K A;  9ICL A;  4YQW A;  3ZDC A;  3PW4 A;  1ZQK A;  5J0P A;  4DFJ A;  2M2W A;  2ZHB A;  4KMU A;  5HMM A;  4DL3 A;  3IHQ B;  4O0I A;  4UBB A;  3FYH A;  2ASD A;  1L5U A;  4MEX A;  3RB6 A;  1Q78 A;  5HC9 A;  2PXI A;  3RTV A;  1TFW A;  3GV8 B;  3ISB A;  4IRC A;  1ZQQ A;  3HWT A;  4K4I A;  1TKD A;  5DLF A;  2FMQ A;  4K4H A;  3RH4 A;  4XUS A;  4M9H A;  2M2U A;  4WC0 A;  5KFF A;  3T3F A;  1C7Y A;  1D8L A;  4JK1 A;  2BPF A;  4ECX A;  4E80 A;  1XSP A;  1UEU A;  3C5G A;  2DPJ A;  4ELT A;  5DG8 A;  5J2G A;  3EYZ A;  4DSF A;  1XSL A;  4FH5 A;  2ZH5 A;  3EW9 A;  3GIK A;  8ICI A;  1SKW A;  3NTU A;  2HHV A;  5HRH A;  4R63 A;  5KT4 A;  3H4D A;  4JV0 A;  3PV8 A;  2JEF A;  2BQ3 A;  4DLG A;  1XSN A;  9ICG A;  4J9N A;  1NK4 A;  5KG1 A;  1ZQM A;  5KFU A;  2FPM A;  3UPQ A;  4M5D A;  2DR7 A;  4KIT B;  2NRX A;  1SL0 A;  4I2H A;  2ZH1 A;  4R66 A;  1QSY A;  1WCN A;  4DSJ A;  1NZP A;  3T5J A;  4JWM A;  4GXJ A;  4YCX A;  4DO9 A;  1TAQ A;  4NXZ A;  4F2S A;  3GV5 B;  1U48 A;  3ISD A;  5HRB A;  4QZC A;  9ICN A;  2FPK A;  3MDC A;  3FDS A;  1ZQH A;  4RUC A;  4ECT A;  5J2K A;  1X9W A;  2ISP A;  4LZG A;  3ZDB A;  1KRP A;  1VJ7 A;  3C2M A;  3RJH A;  5KFY A;  4UB4 A;  2IMW P;  4I28 A;  4IRD A;  2KFZ A;  4J9K A;  5J2C A;  1X2I A;  2AU0 A;  3OVB A;  4ED7 A;  3AQM A;  1U45 A;  2V9W A;  5CWR A;  2AGQ A;  2HHT A;  4RWP A;  2BHN A;  2V4R A;  2DFL A;  1XS9 D;  5DKW A;  2R8I A;  1QSL A;  5KFO A;  3RR8 A;  4IQU A;  1D9D A;  7ICU A;  2R8G A;  5KG2 A;  4O3R A;  4X4Q A;  3PO4 A;  9ICV A;  4DLE A;  1B22 A;  2UVR A;  1TV9 A;  4PHP A;  8ICO A;  3OSN A;  4B9L A;  3TI0 A;  1KFS A;  4J9R A;  2WTF A;  8ICV A;  5D49 A;  5IIN A;  1NKB A;  1NK9 A;  1NK6 A;  4I27 A;  1MIW A;  4I29 A;  1DGS A;  2MUT A;  4F92 B;  3OHA A;  4WCW A;  4M47 A;  2ID1 A;  4EBD A;  4XQ7 A;  3OVA A;  9ICR A;  4RPY A;  1D9F A;  3OGU A;  7ICS A;  2FMP A;  2KZM A;  4F4W A;  4KLJ A;  5KFN A;  2F1H A;  5J2H A;  2DR8 A;  3THV A;  7ICN A;  9ICH A;  3JPT A;  4RQ7 A;  3KTQ A;  4Q43 A;  4DEZ A;  3GII A;  5J0X A;  4O3O A;  4EBK A;  4DL5 A;  5DB8 A;  3MR3 A;  2Y1I A;  2DPI A;  4E7X A;  3HP6 A;  8ICB A;  5DBB A;  8ICL A;  2VA3 A;  3PW0 A;  1R89 A;  2J6T A;  9ICT A;  3OUY A;  1MQ2 A;  1Z00 A;  3TFS A;  8ICQ A;  5DGA A;  9ICX A;  2B21 A;  2H5X A;  1X9S A;  2C2D A;  3UXO A;  3QZ8 A;  3GIM A;  3PR4 A;  4DFP A;  2W9C A;  1JQR A;  1OU5 A;  5DED A;  4FBT A;  5F2V O;  5J2E A;  4KLO A;  4NKT A;  4UAZ A;  3H39 A;  4KN4 A;  2J6S A;  1ZQV A;  4RQ1 A;  4EEY A;  9ICI A;  3T5K A;  3PMN A;  2RFF A;  2IHM A;  1MIY A;  2BQR A;  2AGP A;  7ICG A;  4J9O A;  4X4N A;  4FH3 A;  2BGW A;  1KFD A;  5KFX A;  4DS4 A;  4X4V A;  4RQ3 A;  3GV7 B;  3C1Y A;  1RPL A;  4M9L A;  5J2D A;  4X0B A;  5CB1 A;  4IG8 A;  1ZQB A;  4YN4 A;  2ATL A;  1NO5 A;  3OVS A;  2Q0Z X;  2V4Q A;  2UVW A;  4P2H A;  1S0M A;  2O5A A;  5BPC A;  4F3O A;  4DSI A;  2JEG A;  2PI4 A;  4BWM A;  9ICJ A;  4WC1 A;  1BGX T;  8ICA A;  2DR5 A;  3OSP A;  3C18 A;  3LWL A;  5KT3 A;  4IR9 A;  3L9D A;  4MF8 A;  3JPO A;  1S0O A;  3G6V A;  3KHH A;  4UB2 A;  5HRG A;  4AT7 A;  1R8B A;  4F5R A;  5D4B A;  3MBY A;  5F9N A;  4I2A A;  3LDA A;  4ELV A;  4J9S A;  3C2K A;  5KFI A;  3UQ0 A;  4DFM A;  4DL7 A;  9ICF A;  4ECQ A;  2AQ0 A;  5J0W A;  3T5L A;  3Q8L A;  1QLN A;  1SKR A;  2BDP A;  5J29 A;  4FS2 A;  4X4P A;  2ZUC A;  4KLD A;  5IIM A;  4X0A A;  4ECZ A;  3BJY A;  1BPD A;  2ZTE A;  4QZ9 A;  1U49 A;  4FHW A;  3QZ7 A;  5KG6 A;  3ISC A;  3H40 A;  5KFL A;  3HX0 A;  4FHX A;  1KEJ A;  5BOL A;  4P4P A;  3GIJ A;  5KFV A;  4F4Z A;  4K4G A;  2HHS A;  3HIY A;  1XWL A;  1V9P A;  3KHG A;  1ARO P;  5KFC A;  3Q8R B;  1XO1 A;  5DLG A;  2C28 A;  7ICH A;  5J0S A;  4X4O A;  5KT2 A;  2KTQ A;  9ICU A;  4X4S A;  5KFB A;  5DG7 A;  5KFW A;  5KFD A;  4GC6 A;  5J0Q A;  1R8A A;  1TFY A;  4FO6 A;  4C8L A;  3H7I A;  7ICF A;  3H8S A;  4F2R A;  5DBC A;  4F5P A;  1T3N A;  3V7L A;  2DR9 A;  4UAW A;  4X4U A;  4Q8E A;  4Z6E A;  1IM4 A;  2W9B B;  1S0N A;  1ZQS A;  3AUO A;  4MFF A;  3WFS C;  2P6R A;  5J2A A;  2ZH8 A;  1ZQL A;  1TFR A;  3UXN A;  4EYI B;  2M2V A;  3OV7 A;  5J0R A;  1Q79 A;  8ICZ A;  5HHI A;  1KLN A;  2HHQ A;  2HVH A;  3ZDD A;  4R8U A;  2XY6 A;  3JPP A;  4NM2 A;  2ASJ A;  1BPB A;  4RT2 A;  4ECU A;  4EZ6 A;  2HHP A;  4RQ4 A;  4WC7 A;  5KFK A;  2XGQ A;  2I1Q A;  2ZJA A;  3Q8M A;  4NLZ A;  1S77 D;  1U47 A;  3OUY B;  5L1I A;  3PW2 A;  1ZQX A;  3ZD8 A;  1U9L A;  1T8E A;  4DOC A;  4F5N A;  1HUO A;  1BPZ A;  4NLK A;  2KFN A;  8ICF A;  1N56 A;  3T5H A;  2ZH6 A;  4KLE A;  5HRF A;  3JPN A;  4FHV A;  5CA7 A;  4DQI A;  3Q8P B;  4JV1 A;  1COO A;  2ASL A;  1F5A A;  1X9M A;  1LV5 A;  4CCH A;  3BQT A;  5KFM A;  1LB2 B;  4F91 B;  3OHB A;  9ICO A;  3V7K A;  4AT9 B;  3M8R A;  2JEJ A;  1ZQU A;  4ED1 A;  2XY7 A;  5DEC A;  4TQR A;  3BQ0 A;  3SV4 A;  1ZQO A;  4XRH A;  2MAX A;  4YXM A;  4UB3 A;  3KHR A;  3TFR A;  1KSP A;  2PI5 A;  4YFK A;  3JZ0 A;  1KNY A;  5KTQ A;  4M9N A;  3HJ4 A;  4NLN A;  3RBD A;  5KFS A;  4RUA A;  2OWO A;  4KLH A;  2KZZ A;  1NK7 A;  4F5Q A;  2A1J B;  3GDX A;  8ICH A;  3ZDA A;  5HRD A;  7ICE A;  4ECS A;  3RH5 A;  2ISO A;  1UEV A;  3KHL A;  5III A;  1QSS A;  4M6W B;  3LK9 A;  1ZYQ A;  5L1J A;  3UPS A;  3ORY A;  4F93 B;  4TUQ A;  4YR3 A;  8ICP A;  4G3I A;  2DRB A;  4R64 A;  3M9M B;  2JZB B;  4B9V A;  4RQ0 A;  3UQ2 A;  5HRE A;  5CP2 A;  3PR5 B;  1RYS A;  4Z6D A;  4Q44 A;  4DL2 A;  1A76 A;  5D46 A;  3V6K A;  4B9U A;  8ICS A;  4ELU A;  3WFP A;  2MUT B;  5IIO A;  3RJK A;  2JEI A;  1TK8 A;  4ED3 A;  2PFQ A;  4I2C A;  4ED6 A;  4KTQ A;  2ZH3 A;  2ZJ5 A;  4J9Q A;  1TVA A;  2O1P A;  5J0O A;  4KN7 A;  3V6H A;  2ALZ A;  2BPC A;  2XCA A;  4ED0 A;  4QW9 A;  4RQ2 A;  3BQ2 A;  3H8W A;  5KG7 A;  3HPO A;  2PFO A;  1UET A;  1ZQY A;  1U4B A;  1BPX A;  3SV3 A;  4RNO A;  4KLI A;  3PML A;  1NK0 A;  4B9T A;  5HRK A;  4ATB A;  4WC4 A;  2AJQ A;  4X4R A;  3TAQ A;  4YD2 A;  2BKE A;  4P4O A;  4RPX A;  4DF4 A;  3H8J A;  3QEA Z;  9ICM A;  8ICK A;  4EBJ A;  5IIJ A;  1R8C A;  4Z6F A;  3RB0 A;  5HP4 A;  3TAP A;  4O3P A;  4O3S A;  1JX4 A;  1MQ3 A;  5DG9 A;  4R65 A;  4DQR A;  3OJU A;  5KFH A;  2FMS A;  5KFZ A;  2IBK A;  3RJF A;  4DFK A;  5F9L A;  3PW5 A;  5DQG A;  5J0U A;  3QEB Z;  1ZQC A;  3AQK A;  4YMO A;  4F50 A;  3V72 A;  2HVI A;  2C22 A;  7ICM A;  7ICI A;  3B0Y A;  5DQH A;  4AT9 A;  2A1J A;  5L1L A;  1BPY A;  1ZQD A;  5IIL A;  3RB4 A;  3C5F A;  3NGD A;  1H38 A;  3TQ1 A;  4ED8 A;  3TAN A;  5DB9 A;  2FLN A;  1ZQW A;  4RZR A;  4Q45 A;  4UBC A;  4MFC A;  3MR5 A;  1UA0 A;  4JV2 A;  4TUP A;  2XO7 A;  1ZQP A;  1NJW A;  4DOB A;  3PNC A;  5EWG A;  5DB7 A;  2I9G A;  1PZN A;  4B9M A;  3AQL A;  1KFT A;  2GWS A;  3E2E A;  4QZI A;  4O5K A;  1RXV A;  4FBU A;  4YR0 A;  4BDP A;  7ICR A;  4O5C A;  4O9M A;  2W9A A;  2NRV A;  3GIL A;  3G6X A;  4QZA A;  3EZ5 A;  4DS5 A;  2BCS A;  2VA8 A;  4DF8 A;  4YP3 A;  3MR2 A;  4DSL A;  4KLS A;  3C2L A;  4J9M A;  3QE9 Y;  4JUZ A;  5L1K A;  1SL2 A;  1ZQT A;  4NLG A;  4NM1 A;  1S76 D;  9ICA A;  2XCP A;  2M2T A;  5KFT A;  5KFG A;  1Z3E B;  4M04 A;  4KLU A;  4ECW A;  4J9L A;  4QZG A;  4PH5 A;  1RZT A;  4WC3 A;  3GQC A;  5KFA A;  9ICW A;  2C2E A;  4QWB A;  4UAY A;  2Y1J A;  2R8K A;  4MEY A;  1MSW D;  1IXR A;  5KFQ A;  4YMM A;  1ZQF A;  4YD1 A;  4TQS A;  2NRT A;  3MAB A;  2Q66 A;  2ZTD A;  5EWE A;  4DL4 A;  5KFE A;  4RU9 A;  8ICN A;  2ZH2 A;  2RDI A;  2VAN A;  4RWQ A;  1FA0 A;  4QZH A;  5J2F A;  2XC9 A;  4HYK A;  3RH6 A;  1K1Q A;  4R8U B;  1L3S A;  8ICW A;  4DQQ A;  3PO5 A;  4QZE A;  5EWF A;  2M9N A;  4MF2 A;  9ICC A;  7ICL A;  2DRA A;  4O3N A;  4C8M A;  7ICV A;  5CHG A;  1JN3 A;  4WC5 A;  7ICT A;  2ZH4 A;  3SI8 A;  1ZQA A;  4PPX A;  8ICM A;  4RWN A;  1YLQ A;  9ICS A;  5TZV A;  1XU4 A;  4FS1 A;  3PX0 A;  4JWN A;  1RYR A;  2VA2 A;  4BXO A;  2F1I A;  2HW3 A;  1BNP A;  2BPG A;  3C21 A;  4GLX A;  4DL6 A;  4M2Y A;  4O3Q A;  4FHY A;  4P4M A;  1JAJ A;  1D8Y A;  2BE3 A;  4RWO A;  4J9P A;  5KG0 A;  4QWE A;  1PX5 A;  5KT7 A;  4IRK A;  3EPI A;  4KLF A;  4F4Y A;  1BVS A;  1WOT A;  4XA5 A;  2KP7 A;  5HNK A;  1DK3 A;  5KT6 A;  4B9N A;  3H4B A;  4RQ5 A;  1NKE A;  4UB5 A;  3ZD9 A;  5DGB A;  2AGO A;  2BR0 A;  1XC9 A;  4EP7 A;  4RNN A;  2XY5 A;  2W8K A;  2PFP A;  4KLQ A;  2ZTC A;  1NJX A;  5KFP A;  4TUS A;  4IQT A;  1S0V A;  3BDP A;  2F1J A;  9ICQ A;  1A77 A;  4LVS A;  1CEZ A;  2NRK A;  4YVZ A;  5J2I A;  1T7P A;  3AU6 A;  8ICR A;  5HRL A;  4DWI A;  1B43 A;  4QWA A;  1JIH A;  3IM1 A;  3JPQ A;  2ZUD A;  3PVX A;  8ICE A;  4NY8 A;  4I2J A;  3M9O B;  2W8L A;  4YMN A;  5J2J A;  3RR7 A;  3BQ1 A;  1DK2 A;  4AT8 B;  3H3A A;  1MIV A;  4TUR A;  4ATB B;  4UD5 A;  1KDH A;  3K75 D;  4E8F A;  4Q8F A;  1KTQ A;  3PX6 A;  3RBE A;  4WBZ A;  4RPZ A;  5KT5 A;  2BCV A;  1HJP A;  1SZP A;  3GFK B;  4F4X A;  1VFG A;  5KFJ A;  3SZ2 A;  2BCQ A;  5HHH A;  3B0X A;  1BPE A;  1ZQZ A;  3K4G A;  4LZD A;  1ZQR A;  4KLL A;  1NJY A;  4IQV A;  8ICJ A;  4UD4 A;  5HR9 A;  3WFQ E;  4EBE A;  4I2F A;  3LQC B;  4BWJ A;  1ZJM A;  2XGP A;  4EYH B;  7ICQ A;  2HHX A;  2W9M A;  3HW8 A;  3SYZ A;  4PHE A;  4ECY A;  3RRG A;  2JZB A;  8ICG A;  1WCL A;  3TAR A;  3UXP A;  1L3U A;  5HRI A;  5HML A;  1ZQE A;  4EBC A;  3JPR A;  4ECV A;  4M9G A;  4DSE A;  1HUZ A;  4F5O A;  1TAU A;  2KN7 A;  2DVI A;  5DQI A;  4GXI A;  1JXL A;  2AQ4 A;  1CUK A;  1S10 A;  4QW8 A;  2UVV A;  4LT6 A;  1T4G A;  2BCR A;  4KLT A;  4X5V A;  2BCU A;  4FHP A;  4AT8 A;  3N4M B;  4NKU A;  1JXE A;  4QZ8 A;  1TK5 A;  3RRH A;  1ZQJ A;  2IA6 A;  4UB1 A;  5CJ7 A;  2J6U A;  5J0T A;  4GXK A;  4DOA A;  2PFN A;  8ICX A;  7ICP A;  2P6U A;  2RDJ A;  5DB6 A;  4QZF A;  4PGX A;  5L9X A;  7ICK A;  1DOQ A;  5J0Y A;  4PHD A;  2BQU A;  4EZ9 A;  1QTM A;  1S9F A;  4BGD A;  3ZDE A;  2ZJ8 A;  3NYB A;  4WBY A;  4ECR A;  3PX4 A;  4DQP A;  3H38 A;  4Z6C A;  8ICT A;  3AQN A;  5DBA A;  3WFR E;  4F4K A;  4I2E A;  5EOZ A;  3M8S A;  3V6J A;  4YXJ A;  4B9S A;  2HHW A;  4QZB A;  4PGQ A;  4ZH4 A;  9ICK A;  5JUM A;  1TK0 A;  1K1S A;  3HT3 A;  4M6W A;  3MGI A;  2IHN A;  3C23 A;  3PY8 A;  2HHU A;  5KG3 A;  8ICU A;  1ZJN A;  4RQ8 A;  3Q8Q B;  3LWM A;  1S97 A;  3RJJ A;  4KLG A;  4WC6 A;  1ZQG A;  3MFI A;  5KG4 A;  2W9C B;  2R8H A;  1L3T A;  1NJZ A;  2ZHA A;  3MFH A;  3M9N B;  2P66 A;  4PGY A;  2ZH9 A;  4RT3 A;  1Z00 B;  4QWC A;  2KZ3 A;  2R8J A;  8ICC A;  5KFR A;  4DQS A;  2C2R A;  1NK5 A;  1BNO A;  2W9B A;  2LYH A;  4RQ6 A;  3JYY A;  2FPL A;  4S3N A;  3PW7 A;  3WFO A;  4YG2 A;  4QZD A;  9ICP A;  4I2D A;  4RNM A;  1EXN A;  4MFA A;  3MDA A;  1NK8 A;  1ZQN A;  5C5J A;  4KLM A;  3V7J A;  1JMS A;  3ETL A;  4GC7 A;  1ZET A;  1NKC A;  3RJE A;  4IQW A;  4M0A A;  4X4T A;  3Q8S B;  5KG5 A;  3AU2 A;  4C8O A;  7ICO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...