4R63A

Binary complex crystal structure of r258a mutant of dna polymerase beta
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIALIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Substrate-induced DNA Polymerase beta Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4r63A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4r63A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4r63A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4r63A03
4KLFA 1NZPA 2HHWA 9ICIA 1SKSA 2KFZA 2XGQA 4DFJA 3Q8QB 3JPQA 4LZGA 8ICJA 1R89A 1S0OA 2M9NA 5KFUA 5DDYA 5KFKA 1RZTA 1R8CA 1UT5A 4TUQA 4LT6A 2M2WA 5KFRA 3RH6A 4J9RA 4RQ5A 1L3UA 5CWRA 4TUSA 3AU6A 5J0TA 3KTQA 1WOTA 3OUYA 1MQ2A 1HUZA 5KFZA 5KG0A 3OSNA 4M2YA 2HHXA 4AT8A 4QZAA 2NRTA 2AGQA 4DEZA 2AQ4A 1XS9D 4M6WA 5KFPA 3MBYA 4UAYA 4MEYA 5KT4A 4MFAA 5KG5A 4EYIB 4ECQA 4I28A 3GV7B 1NK0A 2BE3A 5CHGA 4F4ZA 1S0VA 5J2FA 4QZGA 5KT6A 4O5EA 1Z00A 5KFLA 3JPSA 2ZH5A 4PHPA 5J0QA 4DL3A 1U49A 3Q8SB 4NY8A 3M9NB 7ICFA 2HHSA 3AQKA 9ICUA 1NK6A 5J2IA 2ASLA 4KLTA 2BCVA 4I2DA 1D9DA 3EPGA 1U4BA 4GXJA 2HW3A 3V6JA 4DL4A 3IHQB 1MSWD 4PH5A 1CUKA 3OJSA 1T8EA 1SL2A 3MR3A 1Q79A 4KLEA 2DRBA 1JQRA 5L1IA 3RRHA 3BQ2A 5J2AA 2ATLA 4KTQA 5D46A 3EYZA 1SL1A 8ICIA 3H8JA 4I2IA 9ICOA 4WC2A 1KTQA 4WC3A 1QTMA 4C8OA 1RPLA 1NJWA 5J2EA 1WCNA 5DBAA 2R8IA 3T5HA 1Q78A 3PR4A 3KHRA 3KHGA 3JPPA 4R63A 1ZJNA 3RB0A 2C2RA 1S77D 1DK3A 1MIVA 3TI0A 3QEAZ 3G6XA 5KFXA 4ECUA 1TFRA 1LV5A 4ECXA 3MR2A 1TAUA 3EWAA 4PGQA 7ICGA 3V72A 3HT3A 2KZ3A 4F8RA 3TQ1A 3ZDEA 2ZH3A 2MAXA 2P6UA 2FMSA 4NLKA 1IM4A 5DLGA 3RR7A 1TK0A 2XCAA 8ICGA 2DPIA 4F2RA 3PX4A 8ICOA 1XC9A 5HMLA 9ICQA 4O0IA 1ZQZA 3HP6A 4BXOB 1K1SA 3AU2A 2R8KA 4F3OA 3RJFA 1LB2B 7ICQA 2FPMA 4X4SA 5IINA 5DB7A 2HVIA 4XA5A 5J2KA 4X0AA 4YR0A 5J0PA 4UB3A 4RQ1A 3C21A 4PHAA 2C28A 4B9MA 2ZJAA 1UA1A 1JIHA 2BDPA 4QWBA 1D8LA 8ICCA 4FH5A 4UBBA 1AROP 5DQGA 5KG3A 3G6VA 4ED3A 4O3RA 3BDPA 3M9MB 2AU0A 1ZQIA 2UVWA 3MFHA 4FHYA 1XU4A 3KHLA 4O3PA 4UB2A 4YD1A 1COOA 2DR5A 4JV0A 1RXWA 9ICWA 1YLQA 3GFKB 3JPOA 3ZDAA 4TQRA 5F2VO 3PW0A 4R64A 4IG8A 4KLHA 2RFFA 3OHBA 4WC7A 5HP4A 2RDJA 2W9CB 3PW2A 1X9SA 2M2VA 1FA0A 4X4VA 5HMMA 3QZ8A 3JPTA 5HHHA 3QE9Y 4EZ9A 4IQWA 4NM1A 4X4NA 3EW9A 5KFNA 4F4WA 3UQ2A 4X4UA 4ECWA 2IHMA 1S97A 1H38A 3H38A 4NKUA 4ZH4A 4AT9B 3OSPA 5J2GA 9ICPA 4JUZA 4J9MA 1ZQKA 5J0XA 1BVSA 4EBDA 1NK4A 1U48A 4EZ6A 4KLUA 2PFOA 2VA8A 4YMNA 9ICJA 5KFBA 2PI4A 4WBZA 1V4AA 2F1IA 1F5AA 4BDPA 2ZHBA 1NK8A 3KHHA 3LDAA 3TANA 4O3OA 1KLNA 1BPDA 5KTQA 2IBKA 3RJKA 5DQIA 4QZEA 5DB8A 4QZIA 4RPXA 5HRGA 2DR8A 2NRXA 4GLXA 5IIOA 3H4BA 1N48A 4K4IA 4UAZA 4ED0A 4NXZA 3QZ7A 2ZUBA 2J6SA 4QZ8A 2JEJA 4KLGA 5BPCA 3JZ0A 4ECTA 1V9PA 5KFOA 4UBCA 3Q8MA 4BXOA 4FS1A 4UD5A 4WBYA 4UAWA 1QSSA 5L9XA 4O5KA 3OVAA 2DPJA 3HW8A 1BPYA 1ZQFA 3C23A 4I2JA 3PMNA 5DLFA 4FHPA 4WC6A 4G3IA 1ZQYA 2ID1A 5CJ7A 4B9SA 1OU5A 1ZETA 2DRAA 2XC9A 4ED6A 3OJUA 3ZDDA 2O1PA 4TQSA 4RQ3A 5IIIA 4FHWA 4I2CA 2ASDA 2V4QA 4F5PA 1U9LA 1NKEA 1SKWA 4DS4A 4O9MA 3SI8A 5HR9A 3M9OB 1S0NA 2J6TA 4YN4A 5J0YA 3M8SA 7ICLA 4X0BA 1RYRA 4ECZA 3MGIA 2KTQA 5CP2A 4RPYA 3Q8KA 2FMPA 4QZ9A 2I9GA 5EOZA 3UPQA 4O5CA 1KNYA 9ICLA 4P4MA 3C1ZA 3RJIA 1T3NA 3JPNA 8ICRA 8ICFA 8ICUA 3RAQA 3H7IA 3V6KA 1ZQNA 2XO7A 4M9JA 2C2DA 1DK2A 1ZQTA 5J2JA 8ICHA 2VA3A 4RQ2A 5J0OA 2W9CA 4DFKA 4KLLA 2ISOA 3AQMA 1ZQWA 4ATBB 5HNKA 2LYHA 4F2SA 2HHVA 3BQTA 3H4DA 2XY5A 1C7YA 2VANA 4DQPA 3HWTA 2BPGA 3EZ5A 4X4PA 1ZQPA 1XO1A 4RNOA 1NK9A 5EWEA 3K4GA 1ZQLA 4DSLA 9ICKA 4AT9A 1A76A 2Q0ZX 3V7JA 1Y88A 2FLNA 5HRBA 4LVSA 2W9AA 2A1JB 4NLGA 1B22A 2NRKA 3WFOA 4F5OA 5J0RA 3T3FA 2ZH6A 2ALZA 1NJZA 4ECYA 1ZQMA 3H40A 8ICZA 3RTVA 2PFQA 8ICSA 4YR3A 4QZHA 1HUOA 2NRWA 8ICBA 4O3SA 4YMOA 4M9NA 2ZH7A 4EEYA 2HHTA 4QWCA 1VFGA 4YMMA 4MFCA 3GV8B 4IR9A 4Z6FA 8ICVA 1NO5A 4RT2A 2ZTEA 3MDAA 2P66A 3C5GA 4F4KA 8ICPA 2R8GA 2P6RA 4P4PA 3N97B 3PO5A 3NYBA 5DECA 5KFYA 3RB6A 3H37A 7ICSA 1JMSA 4YP3A 2PXIA 3GIMA 3MGHA 2KZMA 4E80A 2BQRA 1WCLA 4P4OA 3C2LA 3B0XA 4KLSA 2KFNA 9ICRA 8ICXA 4J9KA 4UD4A 3WFSC 3PNCA 9ICCA 5TZVA 4ED8A 2PBEA 3RJJA 7ICRA 4X4QA 3FDSA 1ZQRA 1ZQXA 4IRKA 4E7XA 1X9MA 3PVXA 2PFPA 1JAJA 3C66A 4IRCA 4RNNA 3BQ1A 4ECSA 4NLNA 3GIJA 1D9FA 3RRGA 3JPRA 2C2EA 5HRIA 4I29A 4AT7B 4M9LA 4KN4A 2XGPA 9ICXA 5DEDA 4RWOA 4EBKA 1BGXT 3G6YA 4DOBA 3TAQA 4KLDA 2BCUA 3HJ1A 3H8WA 4DSJA 2IMWP 4KLOA 2UVRA 4NKTA 4RWNA 3HJ4A 2O5AA 7ICKA 3OGUA 4M9GA 3LWLA 5L1LA 3ZDCA 2BCQA 4DQIA 1NK7A 4XQ8A 3TFSA 4M04A 8ICQA 1L3VA 2FMQA 3RH5A 4KMUA 4ATBA 4UB4A 4Q44A 4X5VA 4DWIA 2KZZA 1L3SA 5BOMA 5HRDA 4RQ7A 4RQ8A 7ICHA 2PFNA 3SZ2A 2DR7A 4XRHA 7ICTA 4DS5A 4DLEA 4FHVA 2R8JA 4TUPA 4I2AA 3ZDBA 4X4TA 3PW5A 2NRVA 5CA7A 4R8UB 4WC1A 5DG9A 2OWOA 2A1JA 2ZTCA 4O3QA 3AQLA 3QEBZ 1TK5A 1XWLA 4B9VA 3HPOA 9ICGA 4RUCA 4J9QA 1S10A 5KFMA 5HHIA 1A77A 5KFQA 4QZBA 4I2BA 4J9OA 4DFMA 3ORYA 2KN7A 3E2EA 3RJEA 4PGYA 4YVZA 4Q43A 5IIMA 7ICNA 4Z6DA 1TV9A 3H8SA 3RR8A 1KFTA 1ZQUA 2BGWA 4NM2A 1UT8A 3OVBA 2XCPA 4ELTA 4DQSA 4JV1A 1B43A 4DOAA 4FO6A 1S9FA 4CCHA 2FPKA 2JEGA 4QW9A 3EPIA 4HYKA 5J2DA 1ZQOA 2BCRA 4ELUA 8ICLA 2HHPA 1TFWA 1NOMA 3FYHA 4RQ6A 1BPZA 2W9MA 4B9NA 5DBCA 5KT7A 3TFRA 1JXEA 1JN3A 1ZQQA 4M0AA 4IQUA 3Q8LA 5KFWA 4RU9A 3IM1A 4QZDA 1K1QA 1L5UA 1TFYA 4YR2A 2V4RA 5IILA 1SKRA 5J0UA 4BGDA 5DG8A 4DFPA 3THVA 3K75D 5DG7A 1XSLA 1NKBA 4FBUA 3JYYA 4RWQA 1ZQGA 3LK9A 4EYHB 3C2KA 4JK1A 3H39A 2ZH2A 4DL2A 1ZYQA 1NJXA 2ZUCA 3GIKA 5J0SA 3PX0A 5KFFA 3Q8PB 1ZQBA 4YQWA 1TKDA 3GILA 3UXOA 4DSIA 2Q66A 5KFEA 4AT7A 1SL0A 2VA2A 4LZDA 3NGDA 8ICMA 4FBTA 5HRLA 4M5DA 4WCWA 3RAXA 2JEIA 4Q8EA 8ICNA 3Q8RB 4I2FA 4ED7A 1DGSA 3T5KA 3TARA 1ZQJA 5EWGA 5J0WA 3MR5A 4DF4A 3PY8A 7ICEA 4XUSA 3MFIA 4ECVA 1ZQCA 1NK5A 4F4XA 4I2GA 4B9LA 2BKEA 9ICSA 4QW8A 4Q8FA 4UB5A 4TURA 4MF8A 2J6UA 3WFRE 5JUMA 5KFDA 1TVAA 3HX0A 5KT3A 2Y1IA 1ZQDA 5KFAA 4YXJA 5IIJA 8ICWA 2ZH9A 1ZQVA 2ZH4A 4RQ4A 3LWMA 1MQ3A 1ZJMA 3TAPA 5DQHA 2R8HA 5J2BA 3N4MB 4RQ0A 5L1KA 4R8UA 3MABA 4DL7A 3OVSA 4RUAA 4YXMA 4KLQA 4YG2A 3SV4A 4F5RA 4B9UA 2ISPA 4IRDA 4I2HA 4C8NA 5HRHA 5L1JA 4E0DA 8ICYA 9ICEA 7ICOA 2Y1JA 3RH4A 4FH3A 4ED1A 5KG4A 4RT3A 4EBEA 2ZHAA 4I27A 2RDIA 3ZD8A 4F4YA 5J29A 3RBEA 2BQUA 3UQ0A 2XY7A 3PW4A 4PHEA 1D8YA 1HJPA 2H5XA 2ZJ8A 4DOCA 2PI5A 1MC8A 3T5JA 8ICAA 2XY6A 3AQNA 2F1HA 2JEFA 4ELVA 2DVIA 1BNPA 5IIKA 1NJYA 5KFSA 4KLIA 1BPEA 4XQ7A 4R66A 4DO9A 3C18A 4DSKA 1MIYA 4J9NA 2W8LA 1QSYA 4F50A 1XSPA 4F5QA 4KLJA 3SYZA 3MR6A 2FPLA 2NRZA 5DGAA 3PV8A 4PPXA 4FS2A 8ICKA 1BPBA 3AUOA 1T4GA 2W9BB 3BJYA 7ICVA 4E8FA 4M9HA 2BQ3A 9ICNA 2UVUA 3L9DA 4F92B 4EP7A 3PMLA 4RPZA 4QWDA 4YFKA 4S3NA 2JZBB 7ICPA 5J2CA 4GC7A 5EWFA 1N56A 9ICTA 5KG2A 2I1QA 1BNOA 2ZTDA 2MUTB 4C8MA 7ICJA 3SV3A 1RXVA 1DOQA 3PO4A 5KG1A 9ICVA 3RJGA 2HHUA 4QWAA 4GC6A 4JWNA 3NTUA 1X2IA 1MIWA 4F93B 3RB4A 4F5NA 2AGOA 3C2MA 5F9LA 2BHNA 2AGPA 4MFFA 1KDHA 3WFPA 4IR1A 3GDXA 3WFQE 1QLNA 5DB6A 4Z6EA 4IQVA 1U45A 2B21A 4ECRA 2M2TA 4NLZA 3T5LA 4C8KA 2WTFA 1JXLA 1KFDA 5KFHA 2AQ0A 4DF8A 1XSNA 2BR0A 2IA6A 5KG7A 4K4GA 3RJHA 5KFJA 9ICAA 3V6HA 1ZQSA 5KFCA 9ICBA 1R8AA 1ZQAA 5C5JA 3PR5B 4F91B 2GWSA 1EXNA 2W8KA 1TAQA 4Q45A 1U47A 5HRFA 2IHNA 4JWMA 4DSFA 4M47A 3C5FA 1KRPA 4UQGA 4UB1A 4KN7A 3OHAA 9ICMA 5KT5A 3RB3A 4ED2A 2FLPA 7ICMA 1UETA 2M2UA 5BOLA 5HC9A 5KT2A 3ISDA 4EBCA 2KP7A 1ZQEA 1KSPA 3OUYB 3OV7A 1IXRA 4QZCA 3GV5B 5DBBA 1L3TA 1QSLA 8ICEA 1S76D 3C1YA 4AT8B 4WC5A 5HREA 2AJQA 5CB1A 9ICHA 1TK8A 1PZNA 4M6WB 4RWPA 1SZPA 5DKWA 5J2HA 2DR9A 5HRKA 4B9TA 4BWJA 5KFTA 5DGBA 1R8BA 4DLGA 1UEUA 4EBJA 2ASJA 3H3AA 3M8RA 4BWMA 3MDCA 4YCXA 4R65A 2W9BA 2ZH8A 1Z00B 3ETLA 4KLMA 1X9WA 1BPXA 4J9LA 4WC4A 4KITB 1CEZA 2ZJ5A 7ICUA 3BQ0A 1VJ7A 4J9SA 1UA0A 4QZFA 1Z3EB 3UXPA 4MEXA 2BCSA 2JZBA 1JX4A 2F1JA 4MF2A 3GIIA 3UXNA 5F9NA 5KG6A 4YD2A 4PHDA 3ISBA 4DQQA 2MUTA 4Z6CA 4K4HA 4I2EA 4O3NA 2V9WA 5DB9A 5D4BA 5D49A 5KFIA 4RZRA 4J9PA 1ZQHA 1NKCA 3ZD9A 5DDMA 2C22A 2BPFA 2UVVA 4P2HA 2HVHA 1PX5A 3LQCB 3V7LA 3HIYA 4X4OA 2DFLA 4DQRA 2BPCA 4DSEA 4DL6A 3PX6A 1RYSA 3UPSA 4GXIA 5CR0A 5KFGA 2FLLA 4C8LA 4WC0A 4JV2A 3V7KA 7ICIA 5KFVA 2ZH1A 2ZUDA 1KEJA 3RBDA 1T7PA 9ICFA 3PW7A 3ISCA 8ICTA 2HHQA 1KFSA 4QWEA 4DL5A 4X4RA 4PGXA 1UEVA 3GQCA 4GXKA 3B0YA 4FHXA 4RNMA 1S0MA 4IQTA
chains in the Genus database with same CATH superfamily
1Q8KA 2HHWA 9ICIA 3AEVA 2XGQA 8ICJA 2I6XA 2M9NA 4EX6A 4EENA 5DDYA 1RZTA 3SAGA 1XNSA 4LT6A 2M2WA 4J9RA 3T79A 3AU6A 3KTQA 1WOTA 5J8YC 3OUYA 1J2MA 2O6KA 4WQKA 5KG0A 2NRTA 2AGQA 4DEZA 1XS9D 3TADA 5KFPA 3UMGA 3MBYA 4ECQA 3GV7B 4P0QA 2BE3A 5AI6A 1S0VA 5J2FA 4QZGA 2P35A 4O5EA 1Z00A 4PHPA 5J0QA 7ICFA 3M9NB 3AQKA 3JCFA 5J2IA 2QARA 2D8CA 4IC9A 1MSWD 4PH5A 1Q79A 3N7PD 4KTQA 8ICIA 4WC2A 3H8JA 4I2IA 9ICOA 5ALMA 1NI3A 1RPLA 1NJWA 5DBAA 1Q78A 3KHGA 1ZJNA 2C2RA 1S77D 3G6XA 5KFXA 4ECUA 4ECXA 3MR2A 1F5SA 4US9A 2CRXA 4PGQA 2KZ3A 5G5HA 3KBBA 2F3NA 1IM4A 1N5XA 2DPIA 3M7DA 2FCLA 4DCCA 4Y2YA 3SD7A 4O0IA 3KFUF 3PSPA 1LB2B 7ICQA 1AQ6A 2HVIA 4XA5A 3HILA 3L5KA 1RQLA 4PHAA 4B9MA 3WKCA 1QQ6A 1JIHA 4QWBA 2WF9A 1AROP 4UAVA 4ED3A 2UVWA 3GU3A 4BX9C 3KHLA 2ZIWB 2HI0A 4O3PA 1RXWA 9ICWA 1YLQA 1ZRMA 3JPOA 3ZDAA 4IG8A 5ALHA 4P0PB 4WC7A 2RDJA 3MC1A 2W9CB 4NV0A 3UQ2A 4X4UA 2IHMA 2KNJA 3ONNA 4AT9B 2KJ9A 5J0XA 5L1MA 5ALPA 4WBZA 1V4AA 2QB0A 2F1IA 1DXSA 1O03A 4BDPA 3KHHA 4O3OA 1KLNA 4HAIA 1BPDA 5ALNA 5AKEA 5DB8A 4QZIA 5HRGA 5IIOA 4UAZA 3QZ7A 2WAQF 2ZUBA 3JZ0A 1V9PA 4UBCA 1N5WA 2RHFA 1QSSA 2WF7A 3OVAA 2DPJA 1BPYA 2BZFA 4WC6A 1O08A 5CJ7A 4B9SA 1ZETA 2IOFK 3PSIA 4I2CA 1U9LA 3NVZA 2J6TA 4YN4A 3M8SA 2KKVA 4ECZA 2KTQA 5EOZA 1KNYA 1T3NA 3RJIA 4C0ZA 8ICUA 3RAQA 3H7IA 3FAHA 1ZQNA 1DK2A 2C2DA 4RQ2A 2W11A 3AQMA 5ALTA 1Q3UA 3HWTA 2BPGA 4QIWF 1NK9A 1ZQLA 3K4GA 5F3XB 5HRBA 2FLNA 2W9AA 3WFOA 1B22A 2RQ5A 4WQLA 5J0RA 3QXGA 2Y9TA 2ZH6A 5AM0A 1RM6C 3U26A 2PFQA 4YR3A 8ICBA 2KSOA 2PMZF 4YMOA 4M9NA 4EEYA 2HHTA 1UPHA 2ZH7A 2FE9A 1VFGA 3NVWA 4O3MA 4MFCA 3GV8B 3HKZF 4IR9A 1NO5A 3EUB2 4EV6A 3C5GA 3N97B 2G0AA 2L5YA 1V38A 5C0YA 3C2LA 4KLSA 9ICRA 1LKYA 3PNCA 2PBEA 2LMRA 2HOFA 1ZQXA 3WK5A 4IRCA 4RNNA 3RRGA 4USAA 2C2EA 3WKBA 2EH9A 4I29A 2Q4TA 3HRDD 5DEDA 1URJA 4EBKA 4KLDA 3TAQA 2KICA 3HJ1A 4NKTA 1SV0A 3AM9A 3HJ4A 7ICKA 3OGUA 5L1LA 4DQIA 4HX0A 2G09A 4XQ8A 1NK7A 1JUDA 8ICQA 1L3VA 2FMQA 5EE1A 5AKXA 4ATBA 4X5VA 1L3SA 3SENA 5HRDA 2PFNA 2G5IB 4DS5A 4DLEA 4TUPA 4CF3A 4I2AA 4JLZA 4X4TA 4R8UB 4FZMA 1TK5A 1XWLA 1T3QA 3RJEA 4Q43A 5IIMA 7ICNA 3H8SA 1ZQUA 2BGWA 1UT8A 3I28A 2AXTU 4KLOA 2JEGA 3EPIA 5J2DA 1FIQA 1BPZA 3TFRA 1JXEA 1CRXA 1ZQQA 1L5UA 4Y2JA 2EZZA 3IM1A 4QZDA 3ER9B 1SKRA 3THVA 1NKBA 1ZRNA 5AK5A 3QU2A 2ZH2A 1SIJA 3E0FA 4CE6A 1PK3A 4YQWA 1TKDA 5ALIA 3UXOA 5KFEA 2VA2A 4M5DA 2FI1A 3E58A 4I2FA 1DGSA 1ZQJA 3MR5A 5J0WA 4DF4A 3PY8A 3OV7A 2BKEA 4UB5A 4TURA 5AI5A 5KFDA 1L7OA 1ZQDA 3SAFA 2ZH9A 5IIJA 1ZQVA 1MQ3A 3TAPA 5J2BA 3OVSA 3K1RB 4RUAA 1X42A 4YG2A 1V97A 5HRHA 1N61A 4E0DA 3RFAA 4KMOB 2Y1JA 3J81j 2BQUA 1D8YA 4KLGA 4PHEA 3T5JA 4A8EA 1BPEA 4K9BA 5K4LA 2HSZA 2DQNB 2QKQA 3BJYA 7ICVA 4E8FA 4M9HA 9ICNA 2JH7A 2W3SA 2DUYA 5J2CA 1N56A 1WG8A 2ZTDA 4UAUA 2E8NA 4NLCA 3SV3A 1DOQA 1RXVA 9ICVA 1X2IA 1YZ6A 3RB4A 3WFPA 1ZD5A 2B21A 4ECRA 2ZXHA 4IL6U 2JXJA 4C8KA 2F77X 2H3FA 1JXLA 2WF5A 5KFJA 3TADC 1ZQSA 1R8AA 5AKYA 5AKGA 4DSFA 2WB1C 3C5FA 4UQGA 4KN7A 4ED2A 2FLPA 7ICMA 2M2UA 5BOLA 2MU2A 5HC9A 2ODGA 2LHTA 1ZQEA 4RQNA 3GV5B 4WC5A 1PZNA 4M6WB 5DKWA 5HRKA 5T14A 5GTIU 3MDCA 4YCXA 2KHQA 4KITB 2YB1A 3UXPA 2BCSA 3BS5B 4LEVA 4I2EA 3BZKA 5AK4A 4O3NA 5AI4A 4BJQA 5D49A 5B66U 1SXEA 1NKCA 4RQMA 4P2HA 2A19A 1PX5A 4DQRA 3LYSA 4C8LA 2ZUDA 4UB8U 5CEHA 3ISCA 8ICTA 2HHQA 1KFSA 5EE0A 2HBLA 2GAFD 1UEVA 2EDUA 2ZIUA 1S0MA 4RWNA 4IQTA 1NZPA 2KFZA 4DFJA 2K89A 4LZGA 5KFUA 1S8OA 5KFKA 1R8CA 1UT5A 4TUQA 5B3PA 4RQ5A 4TUSA 5J0TA 3IV6A 2FJ6A 1HUZA 5KFZA 1FO4A 2HHXA 1JROA 4UAYA 4MFAA 1L8LA 4EYIB 1QQ5A 4N7RA 1NK0A 5CHGA 1KBUA 2E8MA 2VJ5A 5KFLA 2ZH5A 4NY8A 1U49A 5AHXA 2HHSA 4LJXA 4EX7A 2ASLA 4KLTA 4GXJA 4CF5A 2HW3A 3V6JA 4WJ3B 3IHQB 1T8EA 4OJPA 3NVYA 1KTQA 5B5EU 2OHFA 3KHRA 4PL2A 3QEAZ 1PK1A 4K98A 3WK4A 1TAUA 3EWAA 7ICGA 3V72A 3HT3A 3QUTA 4F8RA 3ZDEA 2G5HB 2E1EA 2H3ZA 3K1ZA 3RR7A 1TK0A 4UARA 8ICGA 4F2RA 3PX4A 9ICQA 2KEYA 1ZQZA 3AU2A 2R8KA 2YQEA 2EANA 2FPMA 5IINA 5DB7A 3OPXA 5J2KA 4X0AA 5J0PA 2BDPA 8ICCA 1L8OA 3BDPA 5D62A 2AU0A 1ZQIA 3NWIA 2HBMA 1XU4A 4EELA 3GFKB 4R64A 4K99A 4KLHA 1A6SA 5HMMA 2KVCA 2W54A 3QZ8A 3JPTA 4JLXA 5CFUA 4IQWA 4ECWA 1H38A 2QB1A 5D61A 2WF6A 5CRXA 9ICPA 3O0FA 4Y2UA 4JUZA 4J9MA 1ZQKA 1NK4A 4KLUA 2PFOA 1L7NA 4YMNA 5KFBA 2ZHBA 3TANA 3QX7A 3RJKA 5DQIA 1RQNA 4GLXA 5CFTA 1N48A 5ALGA 5ALLA 4ED0A 4K4IA 2XVTA 3Q8MA 1SV0C 4C4SA 2H3QA 2ID1A 2XC9A 2W04A 4ED6A 2ZIVB 3N7SC 1B4FA 2V4QA 4O9MA 5HR9A 1S0NA 4X0BA 5ALSA 3CP8A 5ALFA 4QZ9A 1OXJA 3UPQA 2F76X 3F2CA 4P0PA 4M9JA 2W9CA 2K8AA 5HNKA 2HHVA 3H4DA 2XY5A 1VJ5A 4C4TA 4DSLA 4AT9A 9ICKA 1L6NA 2XI9A 4LVSA 2NRKA 2I5HA 4NLGA 2Y0SF 3T3FA 1K5OA 2ALZA 4ECYA 1ZQMA 3H40A 5AK6A 3A0HU 4K96A 8ICZA 3MCRA 8ICSA 4OAGA 4OO1J 5A0LA 3WK8A 4YMMA 2EZYA 3CW2C 4Z6FA 8ICVA 4RT2A 3MDAA 3D6JA 5DECA 5KFYA 2KVSA 7ICSA 2PXIA 4YP3A 2BQRA 4P4OA 3B0XA 3WFSC 3TACB 4J9KA 5JTGA 1V85A 4LEYA 4ED8A 3FDSA 3PVXA 3IRUA 3BQ1A 5AI0A 3QYPA 2XGPA 4RWOA 1MA7A 4EEKA 2M0NA 3H8WA 2UVRA 1ZXIA 3N7RC 4ACOA 3RH5A 4UB4A 2K4PA 2DKXA 1KQQA 3SZ2A 4NXUA 4XRHA 7ICTA 5CA7A 5DG9A 4O3QA 2B6GA 2E8OA 1PVPA 4RUCA 4J9QA 5KFMA 2H3IA 1A77A 2W55A 1WUDA 3IP4B 5KFQA 4PGYA 4OAHA 4YVZA 5ALQA 3H8MA 1KFTA 5KL1B 3OVBA 4DQSA 1B43A 2BDUA 4FO6A 3ETRA 7ICJA 2FPKA 5EE3A 4QW9A 4HYKA 4ELUA 2HHPA 2BCRA 4U7CA 1TFWA 4B6JA 2MA1A 2W9MA 4B9NA 5DBCA 3CRXA 4M0AA 1K1QA 2V4RA 5IILA 3K75D 4FBUA 4OAIZ 1ZQGA 1B0XA 4JK1A 3H39A 4DL2A 5ALUA 3GIKA 1ZQBA 5KFFA 3Q8PB 2Q66A 3WKDA 2KIVA 2JEIA 4Q8EA 3Q8RB 2KJ8A 2D6FC 2EWRA 4KX3A 3QU7A 2E1FA 4S3NA 5EWGA 1ZQCA 4QNLA 4F4XA 4B9LA 4Q8FA 1TVAA 5KT3A 5KFAA 8ICWA 2LKYA 3KD3A 4OJOA 1ZJMA 2W7OA 2R8HA 2NV3A 3N4MB 4RQ0A 5L1KA 4R8UA 4YXMA 4KLQA 3SV4A 4F5RA 3HKZC 1X66A 9ICEA 1X9XA 3K7DA 7ICOA 4ED1A 4I27A 2RDIA 3ZD8A 4F4YA 5AIAA 2XY7A 3WK9A 2PI5A 2ZJ8A 4PJ0U 4JB3A 1MC8A 3AQNA 3PSFA 1NJYA 5KFSA 4XQ7A 4OCZA 4DO9A 2DL0A 1KW4A 4DSKA 2W8LA 3NRWA 1QSYA 3SYZA 4KB6A 3MR6A 3PV8A 2VIXA 2VKQA 1T4GA 2BQ3A 5AM4A 2YX8A 1YT3A 3PMLA 4QWDA 4YFKA 1BNOA 5KG2A 2I1QA 2YMLA 5KNIA 4QWAA 4AYBF 1D8BA 4JWNA 3NTUA 2AGPA 1X6JA 1P7DA 3GDXA 1RG6A 4DFDA 3T5LA 1KFDA 1XSNA 5KG7A 4K4GA 3IN5A 3RJHA 9ICAA 1JALA 4Y2QA 3PR5B 1DGJA 1U47A 1TAQA 2DWQA 2IHNA 4JWMA 3WK7A 4IS7A 9ICMA 2NYVA 2HBKA 3ISDA 2K8CB 2W43A 2ZIXB 1IXRA 1S76D 1QSLA 4AT8B 3C1YA 2AJQA 5CB1A 3I76A 4RWPA 1SZPA 3DEEA 4B9TA 4EBJA 1UEUA 4OJ5A 4R65A 2ZH8A 2KJ5A 1X9WA 2ZJ5A 4J9SA 4MEXA 4NLBA 1JX4A 4K97A 3ISBA 4DQQA 2E3TA 2V9WA 5DB9A 4RZRA 5KFIA 4KX5A 4J9PA 1ZQHA 2C22A 5ALKA 2HVHA 4X4OA 4DL6A 3PX6A 5D63A 3UPSA 2LPEA 5CR0A 5KFGA 4FFDA 4WC0A 3V7KA 1KEJA 1T7PA 2A3VA 2GO7A 1Q3VA 4PGXA 1J97A 1SWWA 5ALYA 4KLFA 2FDRA 3M1YA 2LYAA 3JPQA 1R89A 1S0OA 1RDFA 4CDGA 1L3UA 2W3RA 3WKEA 3L4PA 5ALJA 4M2YA 3OSNA 3F5EA 2AQ4A 3GZFA 4M6WA 4Y2TA 4C80A 4I28A 4NXWA 2WFAA 5KT6A 4DL3A 4UATA 2GA9D 1NK6A 4KM5A 2BCVA 4I2DA 3EPGA 1U4BA 4DL4A 3BS5A 1CUKA 4OJ6A 3OJSA 3MR3A 3RRHA 2ATLA 2B4VA 3EYZA 1C20A 3H0RB 4WC3A 5J2EA 2R8IA 3T5HA 5AIBA 3PR4A 3JPPA 4R63A 2EQYA 1MIVA 3TI0A 4EEBA 3CK6A 5ALEA 1N63A 2ZH3A 2MAXA 2P6UA 3ERCC 4NLKA 5DLGA 3LVWA 2XCAA 4F71A 1ECWA 8ICOA 1XC9A 1QQ7A 4BXOB 1K1SA 5HR6A 4F3OA 5GTHU 5AI8A 3SMVA 2YB4A 4RQ1A 2C28A 1ZD4A 2ZJAA 4FH5A 3G6VA 3M9MB 4FHYA 3MFHA 2XIDA 1HEKA 2G06A 2DR5A 2W7PA 2ES6A 4TQRA 2ZXIA 4EEDA 1ZOLA 2RFFA 4UB6U 1N2XA 5AKIA 1X9SA 2CN1A 1FA0A 3QE9Y 5HHHA 4NWIA 4NM1A 3EW9A 4F4WA 1S97A 3H38A 3ER8C 4NKUA 4NXVA 4C7YA 1U48A 2VA8A 1ZQ1C 2PI4A 1F5AA 2WB1F 4PL1A 1XO0A 1N60A 2IBKA 4QZEA 3D2QA 3H4BA 4QJFB 3SAHA 2J6SA 2JEJA 4ECTA 5KFOA 4FS1A 2RLTA 4UD5A 4O5KA 3AQFA 3PMNA 4FHPA 2LBOA 2DRAA 1OU5A 4JMUA 3OJUA 2BBHA 4RQ3A 4UASA 5IIIA 4FHWA 5AKKA 2CXYA 4F5PA 2ASDA 7ICLA 1RYRA 2DF4B 3MGIA 2I9GA 4O5CA 4WH5A 4GIBA 1OUQA 8ICRA 8ICFA 2OEHA 1ZQTA 4DFKA 2ISOA 1MN8A 2LYHA 4F2SA 1YZ7A 3BQTA 1C7YA 2NO5A 4DQPA 4PZNA 4X4PA 1XO1A 3PSTA 3V7JA 2A1JB 3NS1A 3RTVA 4QZHA 4O3SA 4Y2RA 4QWCA 1FFVA 2P66A 8ICPA 2R8GA 2P6RA 4P4PA 3PO5A 3NYBA 3RB6A 1JMSA 3GIMA 3NASA 4UD4A 8ICXA 9ICCA 2ZIVA 5AKJA 2ZG6A 7ICRA 3M6ZA 4LEZA 4IRKA 4E7XA 3C66A 5AI9A 3GIJA 1D9FA 3JPRA 2DGZA 4AT7B 4KN4A 2AH5A 5KL8B 1BGXT 2KOBA 3QU9A 2O5AA 4M9GA 2Z7JA 3QUCA 3LWLA 2BCQA 3ZDCA 4O6AA 2ZIUB 5AK3A 5ALZA 2KZZA 4DWIA 1F44A 5BOMA 4RQ8A 2DR7A 4PZOA 2R8JA 2F44A 4ZOHC 5B3QA 2K4HA 3AQLA 1FEZA 9ICGA 2IHOA 1S10A 5HHIA 4QZBA 4AP9A 4I2BA 4J9OA 4DFMA 3E2EA 2KN7A 1TV9A 3D2SA 4NM2A 3CNHA 4ELTA 3R9KA 3OTQA 1S9FA 4DOAA 3WU2U 2KIWA 3UMCA 2K4IA 4RQ6A 4US8A 4FE3A 5JU5A 4IQUA 3Q8LA 3B9JA 1TFYA 4YR2A 4CRXA 5J0UA 5DG8A 4DFPA 5DG7A 4RWQA 3JYYA 1ZD3A 2JRZA 2HDOA 3QUBA 1IG6A 3PX0A 5TISU 4LEWA 1SL0A 4NXTA 4LZDA 4FBTA 2PKEA 3WKAA 2Y9UA 2LM1A 3RAXA 2B0CA 2K4EA 4ED7A 3TARA 4XUSA 4ECVA 4I2GA 2ZIWA 9ICSA 4QW8A 2F8LA 4MF8A 3WFRE 5JUMA 2OM6A 3HX0A 1JI7A 4RQ4A 4IRDA 2ISPA 4I2HA 3IG8A 5L1JA 8ICYA 4U6PA 4FH3A 5KG4A 4EBEA 3RBEA 1GPJA 2K60A 5J29A 3PW4A 3PHZA 1HIWA 2DVIA 1BNPA 5IIKA 4R66A 3I1YA 3C18A 1MIYA 1XSPA 2LI6A 4CNQA 2OCEA 4PPXA 4FS2A 8ICKA 1BPBA 2W9BB 5ALWA 2UVUA 3L9DA 1ZD2P 4RPZA 2JZBB 4GC7A 5HR7A 2MUTB 4C8MA 3RF9A 2R18A 3RJGA 4GC6A 1MIWA 2KE7A 2AGOA 3C2MA 4MFFA 2IOHA 3F53A 4IR1A 2W03A 3FC4A 3WFQE 1QLNA 1U45A 4IQVA 1TAMA 2QLTA 4NLZA 2M2TA 5AICA 5KAFU 4DF8A 3QNMA 5KAIU 3V6HA 5KFCA 1VLBA 4NL9A 1ZQAA 3H0MB 2GWSA 4Q45A 4FO1A 2F2AB 1KRPA 2YN4A 3OHAA 4WOYA 3RB3A 4Y2SA 4EBCA 4K8VA 2WAQC 1KSPA 3OUYB 5JRTA 5DBBA 5J2HA 4CGZA 5DGBA 4DLGA 4P0QB 2ASJA 3KKAA 4OAFA 1Z00B 3ZI4A 3CYMA 2OXOA 1RYUA 3BQ0A 1VJ7A 1UA0A 4QZFA 1JRPA 2QARB 3QU5A 2ESEA 4MF2A 2B56A 5F9NA 5KG6A 3SR6A 5D4BA 3ZD9A 5DDMA 2BPFA 3LQCB 2WHEA 3AMZA 3V7LA 3A0BU 1RYSA 4GXIA 2FLLA 1NZBA 3F2DA 5KFVA 3RBDA 9ICFA 4QIWC 4QWEA 1T94A 4ICAA 4X4RA 3GQCA 3HW8A 3B0YA 4RNMA 2XICA 2H3VA 4F72A 1SKSA 1L7PA 3Q8QB 2PMZC 3ICXA 1UCVA 3UMBA 5KFRA 3HJEA 1NNLA 3RH6A 5CWRA 3H0LB 2ZIXA 1KKXA 1MQ2A 4AT8A 4O68A 5ALVA 4QZAA 3AN1A 4MEYA 5KT4A 5KG5A 3NRZA 3TKAA 1KL9A 3WK6A 4F4ZA 5FP0A 3F5AA 3VCBA 3JPSA 3Q8SB 4AYBC 2DKZA 1TE2A 9ICUA 2RP5A 2JMGA 5AKHA 1D9DA 1SL2A 2DRBA 4KLEA 1JQRA 5L1IA 3BQ2A 5J2AA 5D46A 1SL1A 1QTMA 4C8OA 1WCNA 3SQIA 5JTIA 3RB0A 1DK3A 4BUGA 1TFRA 1LV5A 1DRGA 2QB0B 5AKLA 2D3DA 2KKPA 2N1RA 3TQ1A 2FMSA 2KK0A 5ALDA 2KHVA 5HMLA 5AM5A 3HP6A 3RJFA 3MGVA 4X4SA 4YR0A 4UB3A 3C21A 3ALRA 1UA1A 1D8LA 4UBBA 5DQGA 5KG3A 4O3RA 3BZCA 4UB2A 4YD1A 1COOA 4JV0A 2HN1A 5F2VO 3PW0A 3VC8A 2YTUA 2OYYA 5J8YA 3OHBA 2B51A 5HP4A 4GFJA 4UW9A 3PW2A 2M2VA 4X4VA 4EZ9A 4X4NA 5KFNA 3NVOA 4ZH4A 3OSPA 5J2GA 1SV4A 4EZ6A 1BVSA 4EBDA 9ICJA 1NK8A 3LDAA 3C28A 2KSOB 5KTQA 2DR8A 4RPXA 2JHDA 2NRXA 1SWVA 2HMXA 4FZLA 2LM4A 4NXZA 4QZ8A 2EAMA 5BPCA 4BXOA 1OW5A 4C7ZA 4WBYA 4UAWA 5L9XA 3EF2A 1ZQFA 3C23A 4I2JA 5DLFA 4G3IA 1ZQYA 5ALXA 1LKYB 1WYGA 2RRDA 3ZDDA 2O1PA 3DV9A 4TQSA 5CFSA 3IG5A 1Z1BA 1NKEA 1SKWA 4DS4A 3SI8A 3M9OB 5J0YA 5AKZA 3QU4A 3AQEA 5CP2A 4RPYA 3Q8KA 2FMPA 2E5SA 9ICLA 4P4MA 3C1ZA 3JPNA 4Y2PA 3V6KA 2XO7A 1UHUA 5J2JA 4OD0A 1Z4OA 2VA3A 8ICHA 4KLLA 5J0OA 4NXXA 2HOQA 1FFUA 1ZQWA 4FZNA 4ATBB 2VANA 3EZ5A 1ZQPA 4RNOA 5EWEA 1SXDA 4C4RA 1A76A 2Q0ZX 1Y88A 4EGWA 4CF4A 1WWVA 4F5OA 1QCKA 2G07A 1M6YA 1NJZA 5CHEA 3M6KA 1KN5A 1HUOA 2NRWA 2NO4A 1SZHA 2ZTEA 4F4KA 5ALRA 3BS7A 5AM3A 3H37A 3MGHA 2KZMA 4E80A 1WCLA 2KFNA 2IUBA 2JR5A 1PVQA 4O69A 5TZVA 3RJJA 4X4QA 1ZQRA 2WF8A 4I0UA 1X9MA 3UM9A 2PFPA 1JAJA 4NLNA 4ECSA 5ALOA 3SEIA 5HRIA 4M9LA 9ICXA 2DBYA 4Y2VA 1SGGA 2EAOA 3G6YA 4DOBA 2BCUA 2BBJA 4DSJA 2IMWP 4M04A 3TFSA 2JH1A 3PZPA 2HCFA 4KMUA 4Q44A 4RQ7A 2EAPA 7ICHA 3S6JA 4O67A 1CI4A 4FHVA 3ZDBA 3PW5A 2NRVA 4WC1A 1L7MA 2OWOA 2A1JA 2ZTCA 3QEBZ 4B9VA 3HPOA 1Q46A 2YMPA 3OWGA 2YMMA 2E8PA 5G5GA 3ORYA 3NKUA 4Z6DA 3RR8A 1X6IA 2XCPA 2YMQA 4JV1A 4CCHA 1ZQOA 1NOMA 3FYHA 5KT7A 1JN3A 1X40A 5KFWA 4RU9A 2CPRA 3NUQA 4BGDA 1XSLA 3DDHA 3LK9A 4EYHB 3AL0B 3C2KA 1A0PA 2JV3A 1ZYQA 1NJXA 2ZUCA 5J0SA 1J2NA 1S5LU 3GILA 4DSIA 2HBJA 4NL9C 4AT7A 3NGDA 8ICMA 5HRLA 4WCWA 8ICNA 3T5KA 8ICLA 5H2FU 7ICEA 3MFIA 1NK5A 3KZXA 2GH1A 1IV8A 2J6UA 2Y1IA 2KMDA 4YXJA 1PUZA 2ZH4A 3LWMA 5DQHA 4G9BA 3MABA 4DL7A 4MHVA 4B9UA 4C8NA 4OJLA 3KKAC 2YY6A 3RH4A 1COKA 4RT3A 2ZHAA 2HN2A 5AM1A 2HOIA 2KV2A 3UQ0A 2KG5A 8ICAA 1HJPA 2H5XA 1N62A 2LYBA 4DOCA 2A1AA 2XY6A 2F1HA 2JEFA 4ELVA 4KLIA 3BQ7A 2F8KA 5EE9A 4J9NA 2OH2A 4F50A 4F5QA 4KLJA 2FPLA 2NRZA 4Y2XA 5DGAA 3AUOA 2VJ4A 1GO3F 1WWUA 2AHOB 4F92B 1UQVA 1Z19A 4EP7A 7ICPA 5EWFA 9ICTA 3NVVA 3PO4A 5KG1A 2HHUA 4F93B 4F5NA 3KZIU 5F9LA 2BHNA 1KDHA 3D2NA 4NJ8A 1SB3C 5DB6A 2IOFA 4Z6EA 1Z4NA 2WTFA 4J03A 5KFHA 2AQ0A 2BR0A 2IA6A 2G08A 9ICBA 1F0MA 3FM9A 5C5JA 4F91B 1EXNA 2W8KA 5HRFA 4M47A 1VDVA 4UB1A 5KT5A 1UETA 2GLEA 5AM2A 5KT2A 1QH9A 2KP7A 5E79U 3L3FX 4K9AA 4QZCA 8ICEA 1L3TA 1PVRA 5HREA 9ICHA 1TK8A 3LVVA 2DR9A 4BWJA 5KFTA 1R8BA 2MSNA 3IDWA 3H3AA 3M8RA 4BWMA 1ED1A 2W9BA 3C29A 2MRLA 3ETLA 4KLMA 1BPXA 4J9LA 4MKPA 4WC4A 1CEZA 7ICUA 1Z3EB 2JZBA 2EZXA 2F1JA 2GOLA 3GIIA 1IIPA 3UXNA 4YD2A 4PHDA 1LVHA 2MUTA 4Z6CA 4K4HA 1Z1VA 2UVVA 3N28A 3HIYA 3ED5A 2DFLA 2BPCA 4DSEA 2KD1A 4XJEA 3QUQA 3KOOA 4JV2A 2K8BB 7ICIA 2ZH1A 1PK1B 2JGAA 3PW7A 3F2BA 4DL5A 4GXKA 4FHXA 2Y0SC
chains in the Genus database with same CATH topology
4KLFA 1NZPA 2HHWA 9ICIA 1SKSA 2KFZA 2XGQA 4DFJA 3Q8QB 3JPQA 4LZGA 8ICJA 1R89A 1S0OA 2M9NA 5KFUA 5DDYA 5KFKA 1RZTA 1R8CA 1UT5A 4TUQA 4LT6A 2M2WA 5KFRA 3RH6A 4J9RA 4RQ5A 1L3UA 5CWRA 4TUSA 3AU6A 5J0TA 3KTQA 1WOTA 3OUYA 1MQ2A 1HUZA 5KFZA 5KG0A 3OSNA 4M2YA 2HHXA 4AT8A 4QZAA 2NRTA 2AGQA 4DEZA 2AQ4A 1XS9D 4M6WA 5KFPA 3MBYA 4UAYA 4MEYA 5KT4A 4MFAA 5KG5A 4EYIB 4ECQA 4I28A 3GV7B 1NK0A 2BE3A 5CHGA 4F4ZA 1S0VA 5J2FA 4QZGA 5KT6A 4O5EA 1Z00A 5KFLA 3JPSA 2ZH5A 4PHPA 5J0QA 4DL3A 1U49A 3Q8SB 4NY8A 3M9NB 7ICFA 2HHSA 3AQKA 9ICUA 1NK6A 5J2IA 2ASLA 4KLTA 2BCVA 4I2DA 1D9DA 3EPGA 1U4BA 4GXJA 2HW3A 3V6JA 4DL4A 3IHQB 1MSWD 4PH5A 1CUKA 3OJSA 1T8EA 1SL2A 3MR3A 1Q79A 4KLEA 2DRBA 1JQRA 5L1IA 3RRHA 3BQ2A 5J2AA 2ATLA 4KTQA 5D46A 3EYZA 1SL1A 8ICIA 3H8JA 4I2IA 9ICOA 4WC2A 1KTQA 4WC3A 1QTMA 4C8OA 1RPLA 1NJWA 5J2EA 1WCNA 5DBAA 2R8IA 3T5HA 1Q78A 3PR4A 3KHRA 3KHGA 3JPPA 4R63A 1ZJNA 3RB0A 2C2RA 1S77D 1DK3A 1MIVA 3TI0A 3QEAZ 3G6XA 5KFXA 4ECUA 1TFRA 1LV5A 4ECXA 3MR2A 1TAUA 3EWAA 4PGQA 7ICGA 3V72A 3HT3A 2KZ3A 4F8RA 3TQ1A 3ZDEA 2ZH3A 2MAXA 2P6UA 2FMSA 4NLKA 1IM4A 5DLGA 3RR7A 1TK0A 2XCAA 8ICGA 2DPIA 4F2RA 3PX4A 8ICOA 1XC9A 5HMLA 9ICQA 4O0IA 1ZQZA 3HP6A 4BXOB 1K1SA 3AU2A 2R8KA 4F3OA 3RJFA 1LB2B 7ICQA 2FPMA 4X4SA 5IINA 5DB7A 2HVIA 4XA5A 5J2KA 4X0AA 4YR0A 5J0PA 4UB3A 4RQ1A 3C21A 4PHAA 2C28A 4B9MA 2ZJAA 1UA1A 1JIHA 2BDPA 4QWBA 1D8LA 8ICCA 4FH5A 4UBBA 1AROP 5DQGA 5KG3A 3G6VA 4ED3A 4O3RA 3BDPA 3M9MB 2AU0A 1ZQIA 2UVWA 3MFHA 4FHYA 1XU4A 3KHLA 4O3PA 4UB2A 4YD1A 1COOA 2DR5A 4JV0A 1RXWA 9ICWA 1YLQA 3GFKB 3JPOA 3ZDAA 4TQRA 5F2VO 3PW0A 4R64A 4IG8A 4KLHA 2RFFA 3OHBA 4WC7A 5HP4A 2RDJA 2W9CB 3PW2A 1X9SA 2M2VA 1FA0A 4X4VA 5HMMA 3QZ8A 3JPTA 5HHHA 3QE9Y 4EZ9A 4IQWA 4NM1A 4X4NA 3EW9A 5KFNA 4F4WA 3UQ2A 4X4UA 4ECWA 2IHMA 1S97A 1H38A 3H38A 4NKUA 4ZH4A 4AT9B 3OSPA 5J2GA 9ICPA 4JUZA 4J9MA 1ZQKA 5J0XA 1BVSA 4EBDA 1NK4A 1U48A 4EZ6A 4KLUA 2PFOA 2VA8A 4YMNA 9ICJA 5KFBA 2PI4A 4WBZA 1V4AA 2F1IA 1F5AA 4BDPA 2ZHBA 1NK8A 3KHHA 3LDAA 3TANA 4O3OA 1KLNA 1BPDA 5KTQA 2IBKA 3RJKA 5DQIA 4QZEA 5DB8A 4QZIA 4RPXA 5HRGA 2DR8A 2NRXA 4GLXA 5IIOA 3H4BA 1N48A 4K4IA 4UAZA 4ED0A 4NXZA 3QZ7A 2ZUBA 2J6SA 4QZ8A 2JEJA 4KLGA 5BPCA 3JZ0A 4ECTA 1V9PA 5KFOA 4UBCA 3Q8MA 4BXOA 4FS1A 4UD5A 4WBYA 4UAWA 1QSSA 5L9XA 4O5KA 3OVAA 2DPJA 3HW8A 1BPYA 1ZQFA 3C23A 4I2JA 3PMNA 5DLFA 4FHPA 4WC6A 4G3IA 1ZQYA 2ID1A 5CJ7A 4B9SA 1OU5A 1ZETA 2DRAA 2XC9A 4ED6A 3OJUA 3ZDDA 2O1PA 4TQSA 4RQ3A 5IIIA 4FHWA 4I2CA 2ASDA 2V4QA 4F5PA 1U9LA 1NKEA 1SKWA 4DS4A 4O9MA 3SI8A 5HR9A 3M9OB 1S0NA 2J6TA 4YN4A 5J0YA 3M8SA 7ICLA 4X0BA 1RYRA 4ECZA 3MGIA 2KTQA 5CP2A 4RPYA 3Q8KA 2FMPA 4QZ9A 2I9GA 5EOZA 3UPQA 4O5CA 1KNYA 9ICLA 4P4MA 3C1ZA 3RJIA 1T3NA 3JPNA 8ICRA 8ICFA 8ICUA 3RAQA 3H7IA 3V6KA 1ZQNA 2XO7A 4M9JA 2C2DA 1DK2A 1ZQTA 5J2JA 8ICHA 2VA3A 4RQ2A 5J0OA 2W9CA 4DFKA 4KLLA 2ISOA 3AQMA 1ZQWA 4ATBB 5HNKA 2LYHA 4F2SA 2HHVA 3BQTA 3H4DA 2XY5A 1C7YA 2VANA 4DQPA 3HWTA 2BPGA 3EZ5A 4X4PA 1ZQPA 1XO1A 4RNOA 1NK9A 5EWEA 3K4GA 1ZQLA 4DSLA 9ICKA 4AT9A 1A76A 2Q0ZX 3V7JA 1Y88A 2FLNA 5HRBA 4LVSA 2W9AA 2A1JB 4NLGA 1B22A 2NRKA 3WFOA 4F5OA 5J0RA 3T3FA 2ZH6A 2ALZA 1NJZA 4ECYA 1ZQMA 3H40A 8ICZA 3RTVA 2PFQA 8ICSA 4YR3A 4QZHA 1HUOA 2NRWA 8ICBA 4O3SA 4YMOA 4M9NA 2ZH7A 4EEYA 2HHTA 4QWCA 1VFGA 4YMMA 4MFCA 3GV8B 4IR9A 4Z6FA 8ICVA 1NO5A 4RT2A 2ZTEA 3MDAA 2P66A 3C5GA 4F4KA 8ICPA 2R8GA 2P6RA 4P4PA 3N97B 3PO5A 3NYBA 5DECA 5KFYA 3RB6A 3H37A 7ICSA 1JMSA 4YP3A 2PXIA 3GIMA 3MGHA 2KZMA 4E80A 2BQRA 1WCLA 4P4OA 3C2LA 3B0XA 4KLSA 2KFNA 9ICRA 8ICXA 4J9KA 4UD4A 3WFSC 3PNCA 9ICCA 5TZVA 4ED8A 2PBEA 3RJJA 7ICRA 4X4QA 3FDSA 1ZQRA 1ZQXA 4IRKA 4E7XA 1X9MA 3PVXA 2PFPA 1JAJA 3C66A 4IRCA 4RNNA 3BQ1A 4ECSA 4NLNA 3GIJA 1D9FA 3RRGA 3JPRA 2C2EA 5HRIA 4I29A 4AT7B 4M9LA 4KN4A 2XGPA 9ICXA 5DEDA 4RWOA 4EBKA 1BGXT 3G6YA 4DOBA 3TAQA 4KLDA 2BCUA 3HJ1A 3H8WA 4DSJA 2IMWP 4KLOA 2UVRA 4NKTA 4RWNA 3HJ4A 2O5AA 7ICKA 3OGUA 4M9GA 3LWLA 5L1LA 3ZDCA 2BCQA 4DQIA 1NK7A 4XQ8A 3TFSA 4M04A 8ICQA 1L3VA 2FMQA 3RH5A 4KMUA 4ATBA 4UB4A 4Q44A 4X5VA 4DWIA 2KZZA 1L3SA 5BOMA 5HRDA 4RQ7A 4RQ8A 7ICHA 2PFNA 3SZ2A 2DR7A 4XRHA 7ICTA 4DS5A 4DLEA 4FHVA 2R8JA 4TUPA 4I2AA 3ZDBA 4X4TA 3PW5A 2NRVA 5CA7A 4R8UB 4WC1A 5DG9A 2OWOA 2A1JA 2ZTCA 4O3QA 3AQLA 3QEBZ 1TK5A 1XWLA 4B9VA 3HPOA 9ICGA 4RUCA 4J9QA 1S10A 5KFMA 5HHIA 1A77A 5KFQA 4QZBA 4I2BA 4J9OA 4DFMA 3ORYA 2KN7A 3E2EA 3RJEA 4PGYA 4YVZA 4Q43A 5IIMA 7ICNA 4Z6DA 1TV9A 3H8SA 3RR8A 1KFTA 1ZQUA 2BGWA 4NM2A 1UT8A 3OVBA 2XCPA 4ELTA 4DQSA 4JV1A 1B43A 4DOAA 4FO6A 1S9FA 4CCHA 2FPKA 2JEGA 4QW9A 3EPIA 4HYKA 5J2DA 1ZQOA 2BCRA 4ELUA 8ICLA 2HHPA 1TFWA 1NOMA 3FYHA 4RQ6A 1BPZA 2W9MA 4B9NA 5DBCA 5KT7A 3TFRA 1JXEA 1JN3A 1ZQQA 4M0AA 4IQUA 3Q8LA 5KFWA 4RU9A 3IM1A 4QZDA 1K1QA 1L5UA 1TFYA 4YR2A 2V4RA 5IILA 1SKRA 5J0UA 4BGDA 5DG8A 4DFPA 3THVA 3K75D 5DG7A 1XSLA 1NKBA 4FBUA 3JYYA 4RWQA 1ZQGA 3LK9A 4EYHB 3C2KA 4JK1A 3H39A 2ZH2A 4DL2A 1ZYQA 1NJXA 2ZUCA 3GIKA 5J0SA 3PX0A 5KFFA 3Q8PB 1ZQBA 4YQWA 1TKDA 3GILA 3UXOA 4DSIA 2Q66A 5KFEA 4AT7A 1SL0A 2VA2A 4LZDA 3NGDA 8ICMA 4FBTA 5HRLA 4M5DA 4WCWA 3RAXA 2JEIA 4Q8EA 8ICNA 3Q8RB 4I2FA 4ED7A 1DGSA 3T5KA 3TARA 1ZQJA 5EWGA 5J0WA 3MR5A 4DF4A 3PY8A 7ICEA 4XUSA 3MFIA 4ECVA 1ZQCA 1NK5A 4F4XA 4I2GA 4B9LA 2BKEA 9ICSA 4QW8A 4Q8FA 4UB5A 4TURA 4MF8A 2J6UA 3WFRE 5JUMA 5KFDA 1TVAA 3HX0A 5KT3A 2Y1IA 1ZQDA 5KFAA 4YXJA 5IIJA 8ICWA 2ZH9A 1ZQVA 2ZH4A 4RQ4A 3LWMA 1MQ3A 1ZJMA 3TAPA 5DQHA 2R8HA 5J2BA 3N4MB 4RQ0A 5L1KA 4R8UA 3MABA 4DL7A 3OVSA 4RUAA 4YXMA 4KLQA 4YG2A 3SV4A 4F5RA 4B9UA 2ISPA 4IRDA 4I2HA 4C8NA 5HRHA 5L1JA 4E0DA 8ICYA 9ICEA 7ICOA 2Y1JA 3RH4A 4FH3A 4ED1A 5KG4A 4RT3A 4EBEA 2ZHAA 4I27A 2RDIA 3ZD8A 4F4YA 5J29A 3RBEA 2BQUA 3UQ0A 2XY7A 3PW4A 4PHEA 1D8YA 1HJPA 2H5XA 2ZJ8A 4DOCA 2PI5A 1MC8A 3T5JA 8ICAA 2XY6A 3AQNA 2F1HA 2JEFA 4ELVA 2DVIA 1BNPA 5IIKA 1NJYA 5KFSA 4KLIA 1BPEA 4XQ7A 4R66A 4DO9A 3C18A 4DSKA 1MIYA 4J9NA 2W8LA 1QSYA 4F50A 1XSPA 4F5QA 4KLJA 3SYZA 3MR6A 2FPLA 2NRZA 5DGAA 3PV8A 4PPXA 4FS2A 8ICKA 1BPBA 3AUOA 1T4GA 2W9BB 3BJYA 7ICVA 4E8FA 4M9HA 2BQ3A 9ICNA 2UVUA 3L9DA 4F92B 4EP7A 3PMLA 4RPZA 4QWDA 4YFKA 4S3NA 2JZBB 7ICPA 5J2CA 4GC7A 5EWFA 1N56A 9ICTA 5KG2A 2I1QA 1BNOA 2ZTDA 2MUTB 4C8MA 7ICJA 3SV3A 1RXVA 1DOQA 3PO4A 5KG1A 9ICVA 3RJGA 2HHUA 4QWAA 4GC6A 4JWNA 3NTUA 1X2IA 1MIWA 4F93B 3RB4A 4F5NA 2AGOA 3C2MA 5F9LA 2BHNA 2AGPA 4MFFA 1KDHA 3WFPA 4IR1A 3GDXA 3WFQE 1QLNA 5DB6A 4Z6EA 4IQVA 1U45A 2B21A 4ECRA 2M2TA 4NLZA 3T5LA 4C8KA 2WTFA 1JXLA 1KFDA 5KFHA 2AQ0A 4DF8A 1XSNA 2BR0A 2IA6A 5KG7A 4K4GA 3RJHA 5KFJA 9ICAA 3V6HA 1ZQSA 5KFCA 9ICBA 1R8AA 1ZQAA 5C5JA 3PR5B 4F91B 2GWSA 1EXNA 2W8KA 1TAQA 4Q45A 1U47A 5HRFA 2IHNA 4JWMA 4DSFA 4M47A 3C5FA 1KRPA 4UQGA 4UB1A 4KN7A 3OHAA 9ICMA 5KT5A 3RB3A 4ED2A 2FLPA 7ICMA 1UETA 2M2UA 5BOLA 5HC9A 5KT2A 3ISDA 4EBCA 2KP7A 1ZQEA 1KSPA 3OUYB 3OV7A 1IXRA 4QZCA 3GV5B 5DBBA 1L3TA 1QSLA 8ICEA 1S76D 3C1YA 4AT8B 4WC5A 5HREA 2AJQA 5CB1A 9ICHA 1TK8A 1PZNA 4M6WB 4RWPA 1SZPA 5DKWA 5J2HA 2DR9A 5HRKA 4B9TA 4BWJA 5KFTA 5DGBA 1R8BA 4DLGA 1UEUA 4EBJA 2ASJA 3H3AA 3M8RA 4BWMA 3MDCA 4YCXA 4R65A 2W9BA 2ZH8A 1Z00B 3ETLA 4KLMA 1X9WA 1BPXA 4J9LA 4WC4A 4KITB 1CEZA 2ZJ5A 7ICUA 3BQ0A 1VJ7A 4J9SA 1UA0A 4QZFA 1Z3EB 3UXPA 4MEXA 2BCSA 2JZBA 1JX4A 2F1JA 4MF2A 3GIIA 3UXNA 5F9NA 5KG6A 4YD2A 4PHDA 3ISBA 4DQQA 2MUTA 4Z6CA 4K4HA 4I2EA 4O3NA 2V9WA 5DB9A 5D4BA 5D49A 5KFIA 4RZRA 4J9PA 1ZQHA 1NKCA 3ZD9A 5DDMA 2C22A 2BPFA 2UVVA 4P2HA 2HVHA 1PX5A 3LQCB 3V7LA 3HIYA 4X4OA 2DFLA 4DQRA 2BPCA 4DSEA 4DL6A 3PX6A 1RYSA 3UPSA 4GXIA 5CR0A 5KFGA 2FLLA 4C8LA 4WC0A 4JV2A 3V7KA 7ICIA 5KFVA 2ZH1A 2ZUDA 1KEJA 3RBDA 1T7PA 9ICFA 3PW7A 3ISCA 8ICTA 2HHQA 1KFSA 4QWEA 4DL5A 4X4RA 4PGXA 1UEVA 3GQCA 4GXKA 3B0YA 4FHXA 4RNMA 1S0MA 4IQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLF A;  1NZP A;  2HHW A;  9ICI A;  1SKS A;  2KFZ A;  2XGQ A;  4DFJ A;  3Q8Q B;  3JPQ A;  4LZG A;  8ICJ A;  1R89 A;  1S0O A;  2M9N A;  5KFU A;  5DDY A;  5KFK A;  1RZT A;  1R8C A;  1UT5 A;  4TUQ A;  4LT6 A;  2M2W A;  5KFR A;  3RH6 A;  4J9R A;  4RQ5 A;  1L3U A;  5CWR A;  4TUS A;  3AU6 A;  5J0T A;  3KTQ A;  1WOT A;  3OUY A;  1MQ2 A;  1HUZ A;  5KFZ A;  5KG0 A;  3OSN A;  4M2Y A;  2HHX A;  4AT8 A;  4QZA A;  2NRT A;  2AGQ A;  4DEZ A;  2AQ4 A;  1XS9 D;  4M6W A;  5KFP A;  3MBY A;  4UAY A;  4MEY A;  5KT4 A;  4MFA A;  5KG5 A;  4EYI B;  4ECQ A;  4I28 A;  3GV7 B;  1NK0 A;  2BE3 A;  5CHG A;  4F4Z A;  1S0V A;  5J2F A;  4QZG A;  5KT6 A;  4O5E A;  1Z00 A;  5KFL A;  3JPS A;  2ZH5 A;  4PHP A;  5J0Q A;  4DL3 A;  1U49 A;  3Q8S B;  4NY8 A;  3M9N B;  7ICF A;  2HHS A;  3AQK A;  9ICU A;  1NK6 A;  5J2I A;  2ASL A;  4KLT A;  2BCV A;  4I2D A;  1D9D A;  3EPG A;  1U4B A;  4GXJ A;  2HW3 A;  3V6J A;  4DL4 A;  3IHQ B;  1MSW D;  4PH5 A;  1CUK A;  3OJS A;  1T8E A;  1SL2 A;  3MR3 A;  1Q79 A;  4KLE A;  2DRB A;  1JQR A;  5L1I A;  3RRH A;  3BQ2 A;  5J2A A;  2ATL A;  4KTQ A;  5D46 A;  3EYZ A;  1SL1 A;  8ICI A;  3H8J A;  4I2I A;  9ICO A;  4WC2 A;  1KTQ A;  4WC3 A;  1QTM A;  4C8O A;  1RPL A;  1NJW A;  5J2E A;  1WCN A;  5DBA A;  2R8I A;  3T5H A;  1Q78 A;  3PR4 A;  3KHR A;  3KHG A;  3JPP A;  4R63 A;  1ZJN A;  3RB0 A;  2C2R A;  1S77 D;  1DK3 A;  1MIV A;  3TI0 A;  3QEA Z;  3G6X A;  5KFX A;  4ECU A;  1TFR A;  1LV5 A;  4ECX A;  3MR2 A;  1TAU A;  3EWA A;  4PGQ A;  7ICG A;  3V72 A;  3HT3 A;  2KZ3 A;  4F8R A;  3TQ1 A;  3ZDE A;  2ZH3 A;  2MAX A;  2P6U A;  2FMS A;  4NLK A;  1IM4 A;  5DLG A;  3RR7 A;  1TK0 A;  2XCA A;  8ICG A;  2DPI A;  4F2R A;  3PX4 A;  8ICO A;  1XC9 A;  5HML A;  9ICQ A;  4O0I A;  1ZQZ A;  3HP6 A;  4BXO B;  1K1S A;  3AU2 A;  2R8K A;  4F3O A;  3RJF A;  1LB2 B;  7ICQ A;  2FPM A;  4X4S A;  5IIN A;  5DB7 A;  2HVI A;  4XA5 A;  5J2K A;  4X0A A;  4YR0 A;  5J0P A;  4UB3 A;  4RQ1 A;  3C21 A;  4PHA A;  2C28 A;  4B9M A;  2ZJA A;  1UA1 A;  1JIH A;  2BDP A;  4QWB A;  1D8L A;  8ICC A;  4FH5 A;  4UBB A;  1ARO P;  5DQG A;  5KG3 A;  3G6V A;  4ED3 A;  4O3R A;  3BDP A;  3M9M B;  2AU0 A;  1ZQI A;  2UVW A;  3MFH A;  4FHY A;  1XU4 A;  3KHL A;  4O3P A;  4UB2 A;  4YD1 A;  1COO A;  2DR5 A;  4JV0 A;  1RXW A;  9ICW A;  1YLQ A;  3GFK B;  3JPO A;  3ZDA A;  4TQR A;  5F2V O;  3PW0 A;  4R64 A;  4IG8 A;  4KLH A;  2RFF A;  3OHB A;  4WC7 A;  5HP4 A;  2RDJ A;  2W9C B;  3PW2 A;  1X9S A;  2M2V A;  1FA0 A;  4X4V A;  5HMM A;  3QZ8 A;  3JPT A;  5HHH A;  3QE9 Y;  4EZ9 A;  4IQW A;  4NM1 A;  4X4N A;  3EW9 A;  5KFN A;  4F4W A;  3UQ2 A;  4X4U A;  4ECW A;  2IHM A;  1S97 A;  1H38 A;  3H38 A;  4NKU A;  4ZH4 A;  4AT9 B;  3OSP A;  5J2G A;  9ICP A;  4JUZ A;  4J9M A;  1ZQK A;  5J0X A;  1BVS A;  4EBD A;  1NK4 A;  1U48 A;  4EZ6 A;  4KLU A;  2PFO A;  2VA8 A;  4YMN A;  9ICJ A;  5KFB A;  2PI4 A;  4WBZ A;  1V4A A;  2F1I A;  1F5A A;  4BDP A;  2ZHB A;  1NK8 A;  3KHH A;  3LDA A;  3TAN A;  4O3O A;  1KLN A;  1BPD A;  5KTQ A;  2IBK A;  3RJK A;  5DQI A;  4QZE A;  5DB8 A;  4QZI A;  4RPX A;  5HRG A;  2DR8 A;  2NRX A;  4GLX A;  5IIO A;  3H4B A;  1N48 A;  4K4I A;  4UAZ A;  4ED0 A;  4NXZ A;  3QZ7 A;  2ZUB A;  2J6S A;  4QZ8 A;  2JEJ A;  4KLG A;  5BPC A;  3JZ0 A;  4ECT A;  1V9P A;  5KFO A;  4UBC A;  3Q8M A;  4BXO A;  4FS1 A;  4UD5 A;  4WBY A;  4UAW A;  1QSS A;  5L9X A;  4O5K A;  3OVA A;  2DPJ A;  3HW8 A;  1BPY A;  1ZQF A;  3C23 A;  4I2J A;  3PMN A;  5DLF A;  4FHP A;  4WC6 A;  4G3I A;  1ZQY A;  2ID1 A;  5CJ7 A;  4B9S A;  1OU5 A;  1ZET A;  2DRA A;  2XC9 A;  4ED6 A;  3OJU A;  3ZDD A;  2O1P A;  4TQS A;  4RQ3 A;  5III A;  4FHW A;  4I2C A;  2ASD A;  2V4Q A;  4F5P A;  1U9L A;  1NKE A;  1SKW A;  4DS4 A;  4O9M A;  3SI8 A;  5HR9 A;  3M9O B;  1S0N A;  2J6T A;  4YN4 A;  5J0Y A;  3M8S A;  7ICL A;  4X0B A;  1RYR A;  4ECZ A;  3MGI A;  2KTQ A;  5CP2 A;  4RPY A;  3Q8K A;  2FMP A;  4QZ9 A;  2I9G A;  5EOZ A;  3UPQ A;  4O5C A;  1KNY A;  9ICL A;  4P4M A;  3C1Z A;  3RJI A;  1T3N A;  3JPN A;  8ICR A;  8ICF A;  8ICU A;  3RAQ A;  3H7I A;  3V6K A;  1ZQN A;  2XO7 A;  4M9J A;  2C2D A;  1DK2 A;  1ZQT A;  5J2J A;  8ICH A;  2VA3 A;  4RQ2 A;  5J0O A;  2W9C A;  4DFK A;  4KLL A;  2ISO A;  3AQM A;  1ZQW A;  4ATB B;  5HNK A;  2LYH A;  4F2S A;  2HHV A;  3BQT A;  3H4D A;  2XY5 A;  1C7Y A;  2VAN A;  4DQP A;  3HWT A;  2BPG A;  3EZ5 A;  4X4P A;  1ZQP A;  1XO1 A;  4RNO A;  1NK9 A;  5EWE A;  3K4G A;  1ZQL A;  4DSL A;  9ICK A;  4AT9 A;  1A76 A;  2Q0Z X;  3V7J A;  1Y88 A;  2FLN A;  5HRB A;  4LVS A;  2W9A A;  2A1J B;  4NLG A;  1B22 A;  2NRK A;  3WFO A;  4F5O A;  5J0R A;  3T3F A;  2ZH6 A;  2ALZ A;  1NJZ A;  4ECY A;  1ZQM A;  3H40 A;  8ICZ A;  3RTV A;  2PFQ A;  8ICS A;  4YR3 A;  4QZH A;  1HUO A;  2NRW A;  8ICB A;  4O3S A;  4YMO A;  4M9N A;  2ZH7 A;  4EEY A;  2HHT A;  4QWC A;  1VFG A;  4YMM A;  4MFC A;  3GV8 B;  4IR9 A;  4Z6F A;  8ICV A;  1NO5 A;  4RT2 A;  2ZTE A;  3MDA A;  2P66 A;  3C5G A;  4F4K A;  8ICP A;  2R8G A;  2P6R A;  4P4P A;  3N97 B;  3PO5 A;  3NYB A;  5DEC A;  5KFY A;  3RB6 A;  3H37 A;  7ICS A;  1JMS A;  4YP3 A;  2PXI A;  3GIM A;  3MGH A;  2KZM A;  4E80 A;  2BQR A;  1WCL A;  4P4O A;  3C2L A;  3B0X A;  4KLS A;  2KFN A;  9ICR A;  8ICX A;  4J9K A;  4UD4 A;  3WFS C;  3PNC A;  9ICC A;  5TZV A;  4ED8 A;  2PBE A;  3RJJ A;  7ICR A;  4X4Q A;  3FDS A;  1ZQR A;  1ZQX A;  4IRK A;  4E7X A;  1X9M A;  3PVX A;  2PFP A;  1JAJ A;  3C66 A;  4IRC A;  4RNN A;  3BQ1 A;  4ECS A;  4NLN A;  3GIJ A;  1D9F A;  3RRG A;  3JPR A;  2C2E A;  5HRI A;  4I29 A;  4AT7 B;  4M9L A;  4KN4 A;  2XGP A;  9ICX A;  5DED A;  4RWO A;  4EBK A;  1BGX T;  3G6Y A;  4DOB A;  3TAQ A;  4KLD A;  2BCU A;  3HJ1 A;  3H8W A;  4DSJ A;  2IMW P;  4KLO A;  2UVR A;  4NKT A;  4RWN A;  3HJ4 A;  2O5A A;  7ICK A;  3OGU A;  4M9G A;  3LWL A;  5L1L A;  3ZDC A;  2BCQ A;  4DQI A;  1NK7 A;  4XQ8 A;  3TFS A;  4M04 A;  8ICQ A;  1L3V A;  2FMQ A;  3RH5 A;  4KMU A;  4ATB A;  4UB4 A;  4Q44 A;  4X5V A;  4DWI A;  2KZZ A;  1L3S A;  5BOM A;  5HRD A;  4RQ7 A;  4RQ8 A;  7ICH A;  2PFN A;  3SZ2 A;  2DR7 A;  4XRH A;  7ICT A;  4DS5 A;  4DLE A;  4FHV A;  2R8J A;  4TUP A;  4I2A A;  3ZDB A;  4X4T A;  3PW5 A;  2NRV A;  5CA7 A;  4R8U B;  4WC1 A;  5DG9 A;  2OWO A;  2A1J A;  2ZTC A;  4O3Q A;  3AQL A;  3QEB Z;  1TK5 A;  1XWL A;  4B9V A;  3HPO A;  9ICG A;  4RUC A;  4J9Q A;  1S10 A;  5KFM A;  5HHI A;  1A77 A;  5KFQ A;  4QZB A;  4I2B A;  4J9O A;  4DFM A;  3ORY A;  2KN7 A;  3E2E A;  3RJE A;  4PGY A;  4YVZ A;  4Q43 A;  5IIM A;  7ICN A;  4Z6D A;  1TV9 A;  3H8S A;  3RR8 A;  1KFT A;  1ZQU A;  2BGW A;  4NM2 A;  1UT8 A;  3OVB A;  2XCP A;  4ELT A;  4DQS A;  4JV1 A;  1B43 A;  4DOA A;  4FO6 A;  1S9F A;  4CCH A;  2FPK A;  2JEG A;  4QW9 A;  3EPI A;  4HYK A;  5J2D A;  1ZQO A;  2BCR A;  4ELU A;  8ICL A;  2HHP A;  1TFW A;  1NOM A;  3FYH A;  4RQ6 A;  1BPZ A;  2W9M A;  4B9N A;  5DBC A;  5KT7 A;  3TFR A;  1JXE A;  1JN3 A;  1ZQQ A;  4M0A A;  4IQU A;  3Q8L A;  5KFW A;  4RU9 A;  3IM1 A;  4QZD A;  1K1Q A;  1L5U A;  1TFY A;  4YR2 A;  2V4R A;  5IIL A;  1SKR A;  5J0U A;  4BGD A;  5DG8 A;  4DFP A;  3THV A;  3K75 D;  5DG7 A;  1XSL A;  1NKB A;  4FBU A;  3JYY A;  4RWQ A;  1ZQG A;  3LK9 A;  4EYH B;  3C2K A;  4JK1 A;  3H39 A;  2ZH2 A;  4DL2 A;  1ZYQ A;  1NJX A;  2ZUC A;  3GIK A;  5J0S A;  3PX0 A;  5KFF A;  3Q8P B;  1ZQB A;  4YQW A;  1TKD A;  3GIL A;  3UXO A;  4DSI A;  2Q66 A;  5KFE A;  4AT7 A;  1SL0 A;  2VA2 A;  4LZD A;  3NGD A;  8ICM A;  4FBT A;  5HRL A;  4M5D A;  4WCW A;  3RAX A;  2JEI A;  4Q8E A;  8ICN A;  3Q8R B;  4I2F A;  4ED7 A;  1DGS A;  3T5K A;  3TAR A;  1ZQJ A;  5EWG A;  5J0W A;  3MR5 A;  4DF4 A;  3PY8 A;  7ICE A;  4XUS A;  3MFI A;  4ECV A;  1ZQC A;  1NK5 A;  4F4X A;  4I2G A;  4B9L A;  2BKE A;  9ICS A;  4QW8 A;  4Q8F A;  4UB5 A;  4TUR A;  4MF8 A;  2J6U A;  3WFR E;  5JUM A;  5KFD A;  1TVA A;  3HX0 A;  5KT3 A;  2Y1I A;  1ZQD A;  5KFA A;  4YXJ A;  5IIJ A;  8ICW A;  2ZH9 A;  1ZQV A;  2ZH4 A;  4RQ4 A;  3LWM A;  1MQ3 A;  1ZJM A;  3TAP A;  5DQH A;  2R8H A;  5J2B A;  3N4M B;  4RQ0 A;  5L1K A;  4R8U A;  3MAB A;  4DL7 A;  3OVS A;  4RUA A;  4YXM A;  4KLQ A;  4YG2 A;  3SV4 A;  4F5R A;  4B9U A;  2ISP A;  4IRD A;  4I2H A;  4C8N A;  5HRH A;  5L1J A;  4E0D A;  8ICY A;  9ICE A;  7ICO A;  2Y1J A;  3RH4 A;  4FH3 A;  4ED1 A;  5KG4 A;  4RT3 A;  4EBE A;  2ZHA A;  4I27 A;  2RDI A;  3ZD8 A;  4F4Y A;  5J29 A;  3RBE A;  2BQU A;  3UQ0 A;  2XY7 A;  3PW4 A;  4PHE A;  1D8Y A;  1HJP A;  2H5X A;  2ZJ8 A;  4DOC A;  2PI5 A;  1MC8 A;  3T5J A;  8ICA A;  2XY6 A;  3AQN A;  2F1H A;  2JEF A;  4ELV A;  2DVI A;  1BNP A;  5IIK A;  1NJY A;  5KFS A;  4KLI A;  1BPE A;  4XQ7 A;  4R66 A;  4DO9 A;  3C18 A;  4DSK A;  1MIY A;  4J9N A;  2W8L A;  1QSY A;  4F50 A;  1XSP A;  4F5Q A;  4KLJ A;  3SYZ A;  3MR6 A;  2FPL A;  2NRZ A;  5DGA A;  3PV8 A;  4PPX A;  4FS2 A;  8ICK A;  1BPB A;  3AUO A;  1T4G A;  2W9B B;  3BJY A;  7ICV A;  4E8F A;  4M9H A;  2BQ3 A;  9ICN A;  2UVU A;  3L9D A;  4F92 B;  4EP7 A;  3PML A;  4RPZ A;  4QWD A;  4YFK A;  4S3N A;  2JZB B;  7ICP A;  5J2C A;  4GC7 A;  5EWF A;  1N56 A;  9ICT A;  5KG2 A;  2I1Q A;  1BNO A;  2ZTD A;  2MUT B;  4C8M A;  7ICJ A;  3SV3 A;  1RXV A;  1DOQ A;  3PO4 A;  5KG1 A;  9ICV A;  3RJG A;  2HHU A;  4QWA A;  4GC6 A;  4JWN A;  3NTU A;  1X2I A;  1MIW A;  4F93 B;  3RB4 A;  4F5N A;  2AGO A;  3C2M A;  5F9L A;  2BHN A;  2AGP A;  4MFF A;  1KDH A;  3WFP A;  4IR1 A;  3GDX A;  3WFQ E;  1QLN A;  5DB6 A;  4Z6E A;  4IQV A;  1U45 A;  2B21 A;  4ECR A;  2M2T A;  4NLZ A;  3T5L A;  4C8K A;  2WTF A;  1JXL A;  1KFD A;  5KFH A;  2AQ0 A;  4DF8 A;  1XSN A;  2BR0 A;  2IA6 A;  5KG7 A;  4K4G A;  3RJH A;  5KFJ A;  9ICA A;  3V6H A;  1ZQS A;  5KFC A;  9ICB A;  1R8A A;  1ZQA A;  5C5J A;  3PR5 B;  4F91 B;  2GWS A;  1EXN A;  2W8K A;  1TAQ A;  4Q45 A;  1U47 A;  5HRF A;  2IHN A;  4JWM A;  4DSF A;  4M47 A;  3C5F A;  1KRP A;  4UQG A;  4UB1 A;  4KN7 A;  3OHA A;  9ICM A;  5KT5 A;  3RB3 A;  4ED2 A;  2FLP A;  7ICM A;  1UET A;  2M2U A;  5BOL A;  5HC9 A;  5KT2 A;  3ISD A;  4EBC A;  2KP7 A;  1ZQE A;  1KSP A;  3OUY B;  3OV7 A;  1IXR A;  4QZC A;  3GV5 B;  5DBB A;  1L3T A;  1QSL A;  8ICE A;  1S76 D;  3C1Y A;  4AT8 B;  4WC5 A;  5HRE A;  2AJQ A;  5CB1 A;  9ICH A;  1TK8 A;  1PZN A;  4M6W B;  4RWP A;  1SZP A;  5DKW A;  5J2H A;  2DR9 A;  5HRK A;  4B9T A;  4BWJ A;  5KFT A;  5DGB A;  1R8B A;  4DLG A;  1UEU A;  4EBJ A;  2ASJ A;  3H3A A;  3M8R A;  4BWM A;  3MDC A;  4YCX A;  4R65 A;  2W9B A;  2ZH8 A;  1Z00 B;  3ETL A;  4KLM A;  1X9W A;  1BPX A;  4J9L A;  4WC4 A;  4KIT B;  1CEZ A;  2ZJ5 A;  7ICU A;  3BQ0 A;  1VJ7 A;  4J9S A;  1UA0 A;  4QZF A;  1Z3E B;  3UXP A;  4MEX A;  2BCS A;  2JZB A;  1JX4 A;  2F1J A;  4MF2 A;  3GII A;  3UXN A;  5F9N A;  5KG6 A;  4YD2 A;  4PHD A;  3ISB A;  4DQQ A;  2MUT A;  4Z6C A;  4K4H A;  4I2E A;  4O3N A;  2V9W A;  5DB9 A;  5D4B A;  5D49 A;  5KFI A;  4RZR A;  4J9P A;  1ZQH A;  1NKC A;  3ZD9 A;  5DDM A;  2C22 A;  2BPF A;  2UVV A;  4P2H A;  2HVH A;  1PX5 A;  3LQC B;  3V7L A;  3HIY A;  4X4O A;  2DFL A;  4DQR A;  2BPC A;  4DSE A;  4DL6 A;  3PX6 A;  1RYS A;  3UPS A;  4GXI A;  5CR0 A;  5KFG A;  2FLL A;  4C8L A;  4WC0 A;  4JV2 A;  3V7K A;  7ICI A;  5KFV A;  2ZH1 A;  2ZUD A;  1KEJ A;  3RBD A;  1T7P A;  9ICF A;  3PW7 A;  3ISC A;  8ICT A;  2HHQ A;  1KFS A;  4QWE A;  4DL5 A;  4X4R A;  4PGX A;  1UEV A;  3GQC A;  4GXK A;  3B0Y A;  4FHX A;  4RNM A;  1S0M A;  4IQT A; 
#chains in the Genus database with same CATH topology
 1Q8K A;  2HHW A;  9ICI A;  3AEV A;  2XGQ A;  8ICJ A;  2I6X A;  2M9N A;  4EX6 A;  4EEN A;  5DDY A;  1RZT A;  3SAG A;  1XNS A;  4LT6 A;  2M2W A;  4J9R A;  3T79 A;  3AU6 A;  3KTQ A;  1WOT A;  5J8Y C;  3OUY A;  1J2M A;  2O6K A;  4WQK A;  5KG0 A;  2NRT A;  2AGQ A;  4DEZ A;  1XS9 D;  3TAD A;  5KFP A;  3UMG A;  3MBY A;  4ECQ A;  3GV7 B;  4P0Q A;  2BE3 A;  5AI6 A;  1S0V A;  5J2F A;  4QZG A;  2P35 A;  4O5E A;  1Z00 A;  4PHP A;  5J0Q A;  7ICF A;  3M9N B;  3AQK A;  3JCF A;  5J2I A;  2QAR A;  2D8C A;  4IC9 A;  1MSW D;  4PH5 A;  1Q79 A;  3N7P D;  4KTQ A;  8ICI A;  4WC2 A;  3H8J A;  4I2I A;  9ICO A;  5ALM A;  1NI3 A;  1RPL A;  1NJW A;  5DBA A;  1Q78 A;  3KHG A;  1ZJN A;  2C2R A;  1S77 D;  3G6X A;  5KFX A;  4ECU A;  4ECX A;  3MR2 A;  1F5S A;  4US9 A;  2CRX A;  4PGQ A;  2KZ3 A;  5G5H A;  3KBB A;  2F3N A;  1IM4 A;  1N5X A;  2DPI A;  3M7D A;  2FCL A;  4DCC A;  4Y2Y A;  3SD7 A;  4O0I A;  3KFU F;  3PSP A;  1LB2 B;  7ICQ A;  1AQ6 A;  2HVI A;  4XA5 A;  3HIL A;  3L5K A;  1RQL A;  4PHA A;  4B9M A;  3WKC A;  1QQ6 A;  1JIH A;  4QWB A;  2WF9 A;  1ARO P;  4UAV A;  4ED3 A;  2UVW A;  3GU3 A;  4BX9 C;  3KHL A;  2ZIW B;  2HI0 A;  4O3P A;  1RXW A;  9ICW A;  1YLQ A;  1ZRM A;  3JPO A;  3ZDA A;  4IG8 A;  5ALH A;  4P0P B;  4WC7 A;  2RDJ A;  3MC1 A;  2W9C B;  4NV0 A;  3UQ2 A;  4X4U A;  2IHM A;  2KNJ A;  3ONN A;  4AT9 B;  2KJ9 A;  5J0X A;  5L1M A;  5ALP A;  4WBZ A;  1V4A A;  2QB0 A;  2F1I A;  1DXS A;  1O03 A;  4BDP A;  3KHH A;  4O3O A;  1KLN A;  4HAI A;  1BPD A;  5ALN A;  5AKE A;  5DB8 A;  4QZI A;  5HRG A;  5IIO A;  4UAZ A;  3QZ7 A;  2WAQ F;  2ZUB A;  3JZ0 A;  1V9P A;  4UBC A;  1N5W A;  2RHF A;  1QSS A;  2WF7 A;  3OVA A;  2DPJ A;  1BPY A;  2BZF A;  4WC6 A;  1O08 A;  5CJ7 A;  4B9S A;  1ZET A;  2IOF K;  3PSI A;  4I2C A;  1U9L A;  3NVZ A;  2J6T A;  4YN4 A;  3M8S A;  2KKV A;  4ECZ A;  2KTQ A;  5EOZ A;  1KNY A;  1T3N A;  3RJI A;  4C0Z A;  8ICU A;  3RAQ A;  3H7I A;  3FAH A;  1ZQN A;  1DK2 A;  2C2D A;  4RQ2 A;  2W11 A;  3AQM A;  5ALT A;  1Q3U A;  3HWT A;  2BPG A;  4QIW F;  1NK9 A;  1ZQL A;  3K4G A;  5F3X B;  5HRB A;  2FLN A;  2W9A A;  3WFO A;  1B22 A;  2RQ5 A;  4WQL A;  5J0R A;  3QXG A;  2Y9T A;  2ZH6 A;  5AM0 A;  1RM6 C;  3U26 A;  2PFQ A;  4YR3 A;  8ICB A;  2KSO A;  2PMZ F;  4YMO A;  4M9N A;  4EEY A;  2HHT A;  1UPH A;  2ZH7 A;  2FE9 A;  1VFG A;  3NVW A;  4O3M A;  4MFC A;  3GV8 B;  3HKZ F;  4IR9 A;  1NO5 A;  3EUB 2;  4EV6 A;  3C5G A;  3N97 B;  2G0A A;  2L5Y A;  1V38 A;  5C0Y A;  3C2L A;  4KLS A;  9ICR A;  1LKY A;  3PNC A;  2PBE A;  2LMR A;  2HOF A;  1ZQX A;  3WK5 A;  4IRC A;  4RNN A;  3RRG A;  4USA A;  2C2E A;  3WKB A;  2EH9 A;  4I29 A;  2Q4T A;  3HRD D;  5DED A;  1URJ A;  4EBK A;  4KLD A;  3TAQ A;  2KIC A;  3HJ1 A;  4NKT A;  1SV0 A;  3AM9 A;  3HJ4 A;  7ICK A;  3OGU A;  5L1L A;  4DQI A;  4HX0 A;  2G09 A;  4XQ8 A;  1NK7 A;  1JUD A;  8ICQ A;  1L3V A;  2FMQ A;  5EE1 A;  5AKX A;  4ATB A;  4X5V A;  1L3S A;  3SEN A;  5HRD A;  2PFN A;  2G5I B;  4DS5 A;  4DLE A;  4TUP A;  4CF3 A;  4I2A A;  4JLZ A;  4X4T A;  4R8U B;  4FZM A;  1TK5 A;  1XWL A;  1T3Q A;  3RJE A;  4Q43 A;  5IIM A;  7ICN A;  3H8S A;  1ZQU A;  2BGW A;  1UT8 A;  3I28 A;  2AXT U;  4KLO A;  2JEG A;  3EPI A;  5J2D A;  1FIQ A;  1BPZ A;  3TFR A;  1JXE A;  1CRX A;  1ZQQ A;  1L5U A;  4Y2J A;  2EZZ A;  3IM1 A;  4QZD A;  3ER9 B;  1SKR A;  3THV A;  1NKB A;  1ZRN A;  5AK5 A;  3QU2 A;  2ZH2 A;  1SIJ A;  3E0F A;  4CE6 A;  1PK3 A;  4YQW A;  1TKD A;  5ALI A;  3UXO A;  5KFE A;  2VA2 A;  4M5D A;  2FI1 A;  3E58 A;  4I2F A;  1DGS A;  1ZQJ A;  3MR5 A;  5J0W A;  4DF4 A;  3PY8 A;  3OV7 A;  2BKE A;  4UB5 A;  4TUR A;  5AI5 A;  5KFD A;  1L7O A;  1ZQD A;  3SAF A;  2ZH9 A;  5IIJ A;  1ZQV A;  1MQ3 A;  3TAP A;  5J2B A;  3OVS A;  3K1R B;  4RUA A;  1X42 A;  4YG2 A;  1V97 A;  5HRH A;  1N61 A;  4E0D A;  3RFA A;  4KMO B;  2Y1J A;  3J81 j;  2BQU A;  1D8Y A;  4KLG A;  4PHE A;  3T5J A;  4A8E A;  1BPE A;  4K9B A;  5K4L A;  2HSZ A;  2DQN B;  2QKQ A;  3BJY A;  7ICV A;  4E8F A;  4M9H A;  9ICN A;  2JH7 A;  2W3S A;  2DUY A;  5J2C A;  1N56 A;  1WG8 A;  2ZTD A;  4UAU A;  2E8N A;  4NLC A;  3SV3 A;  1DOQ A;  1RXV A;  9ICV A;  1X2I A;  1YZ6 A;  3RB4 A;  3WFP A;  1ZD5 A;  2B21 A;  4ECR A;  2ZXH A;  4IL6 U;  2JXJ A;  4C8K A;  2F77 X;  2H3F A;  1JXL A;  2WF5 A;  5KFJ A;  3TAD C;  1ZQS A;  1R8A A;  5AKY A;  5AKG A;  4DSF A;  2WB1 C;  3C5F A;  4UQG A;  4KN7 A;  4ED2 A;  2FLP A;  7ICM A;  2M2U A;  5BOL A;  2MU2 A;  5HC9 A;  2ODG A;  2LHT A;  1ZQE A;  4RQN A;  3GV5 B;  4WC5 A;  1PZN A;  4M6W B;  5DKW A;  5HRK A;  5T14 A;  5GTI U;  3MDC A;  4YCX A;  2KHQ A;  4KIT B;  2YB1 A;  3UXP A;  2BCS A;  3BS5 B;  4LEV A;  4I2E A;  3BZK A;  5AK4 A;  4O3N A;  5AI4 A;  4BJQ A;  5D49 A;  5B66 U;  1SXE A;  1NKC A;  4RQM A;  4P2H A;  2A19 A;  1PX5 A;  4DQR A;  3LYS A;  4C8L A;  2ZUD A;  4UB8 U;  5CEH A;  3ISC A;  8ICT A;  2HHQ A;  1KFS A;  5EE0 A;  2HBL A;  2GAF D;  1UEV A;  2EDU A;  2ZIU A;  1S0M A;  4RWN A;  4IQT A;  1NZP A;  2KFZ A;  4DFJ A;  2K89 A;  4LZG A;  5KFU A;  1S8O A;  5KFK A;  1R8C A;  1UT5 A;  4TUQ A;  5B3P A;  4RQ5 A;  4TUS A;  5J0T A;  3IV6 A;  2FJ6 A;  1HUZ A;  5KFZ A;  1FO4 A;  2HHX A;  1JRO A;  4UAY A;  4MFA A;  1L8L A;  4EYI B;  1QQ5 A;  4N7R A;  1NK0 A;  5CHG A;  1KBU A;  2E8M A;  2VJ5 A;  5KFL A;  2ZH5 A;  4NY8 A;  1U49 A;  5AHX A;  2HHS A;  4LJX A;  4EX7 A;  2ASL A;  4KLT A;  4GXJ A;  4CF5 A;  2HW3 A;  3V6J A;  4WJ3 B;  3IHQ B;  1T8E A;  4OJP A;  3NVY A;  1KTQ A;  5B5E U;  2OHF A;  3KHR A;  4PL2 A;  3QEA Z;  1PK1 A;  4K98 A;  3WK4 A;  1TAU A;  3EWA A;  7ICG A;  3V72 A;  3HT3 A;  3QUT A;  4F8R A;  3ZDE A;  2G5H B;  2E1E A;  2H3Z A;  3K1Z A;  3RR7 A;  1TK0 A;  4UAR A;  8ICG A;  4F2R A;  3PX4 A;  9ICQ A;  2KEY A;  1ZQZ A;  3AU2 A;  2R8K A;  2YQE A;  2EAN A;  2FPM A;  5IIN A;  5DB7 A;  3OPX A;  5J2K A;  4X0A A;  5J0P A;  2BDP A;  8ICC A;  1L8O A;  3BDP A;  5D62 A;  2AU0 A;  1ZQI A;  3NWI A;  2HBM A;  1XU4 A;  4EEL A;  3GFK B;  4R64 A;  4K99 A;  4KLH A;  1A6S A;  5HMM A;  2KVC A;  2W54 A;  3QZ8 A;  3JPT A;  4JLX A;  5CFU A;  4IQW A;  4ECW A;  1H38 A;  2QB1 A;  5D61 A;  2WF6 A;  5CRX A;  9ICP A;  3O0F A;  4Y2U A;  4JUZ A;  4J9M A;  1ZQK A;  1NK4 A;  4KLU A;  2PFO A;  1L7N A;  4YMN A;  5KFB A;  2ZHB A;  3TAN A;  3QX7 A;  3RJK A;  5DQI A;  1RQN A;  4GLX A;  5CFT A;  1N48 A;  5ALG A;  5ALL A;  4ED0 A;  4K4I A;  2XVT A;  3Q8M A;  1SV0 C;  4C4S A;  2H3Q A;  2ID1 A;  2XC9 A;  2W04 A;  4ED6 A;  2ZIV B;  3N7S C;  1B4F A;  2V4Q A;  4O9M A;  5HR9 A;  1S0N A;  4X0B A;  5ALS A;  3CP8 A;  5ALF A;  4QZ9 A;  1OXJ A;  3UPQ A;  2F76 X;  3F2C A;  4P0P A;  4M9J A;  2W9C A;  2K8A A;  5HNK A;  2HHV A;  3H4D A;  2XY5 A;  1VJ5 A;  4C4T A;  4DSL A;  4AT9 A;  9ICK A;  1L6N A;  2XI9 A;  4LVS A;  2NRK A;  2I5H A;  4NLG A;  2Y0S F;  3T3F A;  1K5O A;  2ALZ A;  4ECY A;  1ZQM A;  3H40 A;  5AK6 A;  3A0H U;  4K96 A;  8ICZ A;  3MCR A;  8ICS A;  4OAG A;  4OO1 J;  5A0L A;  3WK8 A;  4YMM A;  2EZY A;  3CW2 C;  4Z6F A;  8ICV A;  4RT2 A;  3MDA A;  3D6J A;  5DEC A;  5KFY A;  2KVS A;  7ICS A;  2PXI A;  4YP3 A;  2BQR A;  4P4O A;  3B0X A;  3WFS C;  3TAC B;  4J9K A;  5JTG A;  1V85 A;  4LEY A;  4ED8 A;  3FDS A;  3PVX A;  3IRU A;  3BQ1 A;  5AI0 A;  3QYP A;  2XGP A;  4RWO A;  1MA7 A;  4EEK A;  2M0N A;  3H8W A;  2UVR A;  1ZXI A;  3N7R C;  4ACO A;  3RH5 A;  4UB4 A;  2K4P A;  2DKX A;  1KQQ A;  3SZ2 A;  4NXU A;  4XRH A;  7ICT A;  5CA7 A;  5DG9 A;  4O3Q A;  2B6G A;  2E8O A;  1PVP A;  4RUC A;  4J9Q A;  5KFM A;  2H3I A;  1A77 A;  2W55 A;  1WUD A;  3IP4 B;  5KFQ A;  4PGY A;  4OAH A;  4YVZ A;  5ALQ A;  3H8M A;  1KFT A;  5KL1 B;  3OVB A;  4DQS A;  1B43 A;  2BDU A;  4FO6 A;  3ETR A;  7ICJ A;  2FPK A;  5EE3 A;  4QW9 A;  4HYK A;  4ELU A;  2HHP A;  2BCR A;  4U7C A;  1TFW A;  4B6J A;  2MA1 A;  2W9M A;  4B9N A;  5DBC A;  3CRX A;  4M0A A;  1K1Q A;  2V4R A;  5IIL A;  3K75 D;  4FBU A;  4OAI Z;  1ZQG A;  1B0X A;  4JK1 A;  3H39 A;  4DL2 A;  5ALU A;  3GIK A;  1ZQB A;  5KFF A;  3Q8P B;  2Q66 A;  3WKD A;  2KIV A;  2JEI A;  4Q8E A;  3Q8R B;  2KJ8 A;  2D6F C;  2EWR A;  4KX3 A;  3QU7 A;  2E1F A;  4S3N A;  5EWG A;  1ZQC A;  4QNL A;  4F4X A;  4B9L A;  4Q8F A;  1TVA A;  5KT3 A;  5KFA A;  8ICW A;  2LKY A;  3KD3 A;  4OJO A;  1ZJM A;  2W7O A;  2R8H A;  2NV3 A;  3N4M B;  4RQ0 A;  5L1K A;  4R8U A;  4YXM A;  4KLQ A;  3SV4 A;  4F5R A;  3HKZ C;  1X66 A;  9ICE A;  1X9X A;  3K7D A;  7ICO A;  4ED1 A;  4I27 A;  2RDI A;  3ZD8 A;  4F4Y A;  5AIA A;  2XY7 A;  3WK9 A;  2PI5 A;  2ZJ8 A;  4PJ0 U;  4JB3 A;  1MC8 A;  3AQN A;  3PSF A;  1NJY A;  5KFS A;  4XQ7 A;  4OCZ A;  4DO9 A;  2DL0 A;  1KW4 A;  4DSK A;  2W8L A;  3NRW A;  1QSY A;  3SYZ A;  4KB6 A;  3MR6 A;  3PV8 A;  2VIX A;  2VKQ A;  1T4G A;  2BQ3 A;  5AM4 A;  2YX8 A;  1YT3 A;  3PML A;  4QWD A;  4YFK A;  1BNO A;  5KG2 A;  2I1Q A;  2YML A;  5KNI A;  4QWA A;  4AYB F;  1D8B A;  4JWN A;  3NTU A;  2AGP A;  1X6J A;  1P7D A;  3GDX A;  1RG6 A;  4DFD A;  3T5L A;  1KFD A;  1XSN A;  5KG7 A;  4K4G A;  3IN5 A;  3RJH A;  9ICA A;  1JAL A;  4Y2Q A;  3PR5 B;  1DGJ A;  1U47 A;  1TAQ A;  2DWQ A;  2IHN A;  4JWM A;  3WK7 A;  4IS7 A;  9ICM A;  2NYV A;  2HBK A;  3ISD A;  2K8C B;  2W43 A;  2ZIX B;  1IXR A;  1S76 D;  1QSL A;  4AT8 B;  3C1Y A;  2AJQ A;  5CB1 A;  3I76 A;  4RWP A;  1SZP A;  3DEE A;  4B9T A;  4EBJ A;  1UEU A;  4OJ5 A;  4R65 A;  2ZH8 A;  2KJ5 A;  1X9W A;  2ZJ5 A;  4J9S A;  4MEX A;  4NLB A;  1JX4 A;  4K97 A;  3ISB A;  4DQQ A;  2E3T A;  2V9W A;  5DB9 A;  4RZR A;  5KFI A;  4KX5 A;  4J9P A;  1ZQH A;  2C22 A;  5ALK A;  2HVH A;  4X4O A;  4DL6 A;  3PX6 A;  5D63 A;  3UPS A;  2LPE A;  5CR0 A;  5KFG A;  4FFD A;  4WC0 A;  3V7K A;  1KEJ A;  1T7P A;  2A3V A;  2GO7 A;  1Q3V A;  4PGX A;  1J97 A;  1SWW A;  5ALY A;  4KLF A;  2FDR A;  3M1Y A;  2LYA A;  3JPQ A;  1R89 A;  1S0O A;  1RDF A;  4CDG A;  1L3U A;  2W3R A;  3WKE A;  3L4P A;  5ALJ A;  4M2Y A;  3OSN A;  3F5E A;  2AQ4 A;  3GZF A;  4M6W A;  4Y2T A;  4C80 A;  4I28 A;  4NXW A;  2WFA A;  5KT6 A;  4DL3 A;  4UAT A;  2GA9 D;  1NK6 A;  4KM5 A;  2BCV A;  4I2D A;  3EPG A;  1U4B A;  4DL4 A;  3BS5 A;  1CUK A;  4OJ6 A;  3OJS A;  3MR3 A;  3RRH A;  2ATL A;  2B4V A;  3EYZ A;  1C20 A;  3H0R B;  4WC3 A;  5J2E A;  2R8I A;  3T5H A;  5AIB A;  3PR4 A;  3JPP A;  4R63 A;  2EQY A;  1MIV A;  3TI0 A;  4EEB A;  3CK6 A;  5ALE A;  1N63 A;  2ZH3 A;  2MAX A;  2P6U A;  3ERC C;  4NLK A;  5DLG A;  3LVW A;  2XCA A;  4F71 A;  1ECW A;  8ICO A;  1XC9 A;  1QQ7 A;  4BXO B;  1K1S A;  5HR6 A;  4F3O A;  5GTH U;  5AI8 A;  3SMV A;  2YB4 A;  4RQ1 A;  2C28 A;  1ZD4 A;  2ZJA A;  4FH5 A;  3G6V A;  3M9M B;  4FHY A;  3MFH A;  2XID A;  1HEK A;  2G06 A;  2DR5 A;  2W7P A;  2ES6 A;  4TQR A;  2ZXI A;  4EED A;  1ZOL A;  2RFF A;  4UB6 U;  1N2X A;  5AKI A;  1X9S A;  2CN1 A;  1FA0 A;  3QE9 Y;  5HHH A;  4NWI A;  4NM1 A;  3EW9 A;  4F4W A;  1S97 A;  3H38 A;  3ER8 C;  4NKU A;  4NXV A;  4C7Y A;  1U48 A;  2VA8 A;  1ZQ1 C;  2PI4 A;  1F5A A;  2WB1 F;  4PL1 A;  1XO0 A;  1N60 A;  2IBK A;  4QZE A;  3D2Q A;  3H4B A;  4QJF B;  3SAH A;  2J6S A;  2JEJ A;  4ECT A;  5KFO A;  4FS1 A;  2RLT A;  4UD5 A;  4O5K A;  3AQF A;  3PMN A;  4FHP A;  2LBO A;  2DRA A;  1OU5 A;  4JMU A;  3OJU A;  2BBH A;  4RQ3 A;  4UAS A;  5III A;  4FHW A;  5AKK A;  2CXY A;  4F5P A;  2ASD A;  7ICL A;  1RYR A;  2DF4 B;  3MGI A;  2I9G A;  4O5C A;  4WH5 A;  4GIB A;  1OUQ A;  8ICR A;  8ICF A;  2OEH A;  1ZQT A;  4DFK A;  2ISO A;  1MN8 A;  2LYH A;  4F2S A;  1YZ7 A;  3BQT A;  1C7Y A;  2NO5 A;  4DQP A;  4PZN A;  4X4P A;  1XO1 A;  3PST A;  3V7J A;  2A1J B;  3NS1 A;  3RTV A;  4QZH A;  4O3S A;  4Y2R A;  4QWC A;  1FFV A;  2P66 A;  8ICP A;  2R8G A;  2P6R A;  4P4P A;  3PO5 A;  3NYB A;  3RB6 A;  1JMS A;  3GIM A;  3NAS A;  4UD4 A;  8ICX A;  9ICC A;  2ZIV A;  5AKJ A;  2ZG6 A;  7ICR A;  3M6Z A;  4LEZ A;  4IRK A;  4E7X A;  3C66 A;  5AI9 A;  3GIJ A;  1D9F A;  3JPR A;  2DGZ A;  4AT7 B;  4KN4 A;  2AH5 A;  5KL8 B;  1BGX T;  2KOB A;  3QU9 A;  2O5A A;  4M9G A;  2Z7J A;  3QUC A;  3LWL A;  2BCQ A;  3ZDC A;  4O6A A;  2ZIU B;  5AK3 A;  5ALZ A;  2KZZ A;  4DWI A;  1F44 A;  5BOM A;  4RQ8 A;  2DR7 A;  4PZO A;  2R8J A;  2F44 A;  4ZOH C;  5B3Q A;  2K4H A;  3AQL A;  1FEZ A;  9ICG A;  2IHO A;  1S10 A;  5HHI A;  4QZB A;  4AP9 A;  4I2B A;  4J9O A;  4DFM A;  3E2E A;  2KN7 A;  1TV9 A;  3D2S A;  4NM2 A;  3CNH A;  4ELT A;  3R9K A;  3OTQ A;  1S9F A;  4DOA A;  3WU2 U;  2KIW A;  3UMC A;  2K4I A;  4RQ6 A;  4US8 A;  4FE3 A;  5JU5 A;  4IQU A;  3Q8L A;  3B9J A;  1TFY A;  4YR2 A;  4CRX A;  5J0U A;  5DG8 A;  4DFP A;  5DG7 A;  4RWQ A;  3JYY A;  1ZD3 A;  2JRZ A;  2HDO A;  3QUB A;  1IG6 A;  3PX0 A;  5TIS U;  4LEW A;  1SL0 A;  4NXT A;  4LZD A;  4FBT A;  2PKE A;  3WKA A;  2Y9U A;  2LM1 A;  3RAX A;  2B0C A;  2K4E A;  4ED7 A;  3TAR A;  4XUS A;  4ECV A;  4I2G A;  2ZIW A;  9ICS A;  4QW8 A;  2F8L A;  4MF8 A;  3WFR E;  5JUM A;  2OM6 A;  3HX0 A;  1JI7 A;  4RQ4 A;  4IRD A;  2ISP A;  4I2H A;  3IG8 A;  5L1J A;  8ICY A;  4U6P A;  4FH3 A;  5KG4 A;  4EBE A;  3RBE A;  1GPJ A;  2K60 A;  5J29 A;  3PW4 A;  3PHZ A;  1HIW A;  2DVI A;  1BNP A;  5IIK A;  4R66 A;  3I1Y A;  3C18 A;  1MIY A;  1XSP A;  2LI6 A;  4CNQ A;  2OCE A;  4PPX A;  4FS2 A;  8ICK A;  1BPB A;  2W9B B;  5ALW A;  2UVU A;  3L9D A;  1ZD2 P;  4RPZ A;  2JZB B;  4GC7 A;  5HR7 A;  2MUT B;  4C8M A;  3RF9 A;  2R18 A;  3RJG A;  4GC6 A;  1MIW A;  2KE7 A;  2AGO A;  3C2M A;  4MFF A;  2IOH A;  3F53 A;  4IR1 A;  2W03 A;  3FC4 A;  3WFQ E;  1QLN A;  1U45 A;  4IQV A;  1TAM A;  2QLT A;  4NLZ A;  2M2T A;  5AIC A;  5KAF U;  4DF8 A;  3QNM A;  5KAI U;  3V6H A;  5KFC A;  1VLB A;  4NL9 A;  1ZQA A;  3H0M B;  2GWS A;  4Q45 A;  4FO1 A;  2F2A B;  1KRP A;  2YN4 A;  3OHA A;  4WOY A;  3RB3 A;  4Y2S A;  4EBC A;  4K8V A;  2WAQ C;  1KSP A;  3OUY B;  5JRT A;  5DBB A;  5J2H A;  4CGZ A;  5DGB A;  4DLG A;  4P0Q B;  2ASJ A;  3KKA A;  4OAF A;  1Z00 B;  3ZI4 A;  3CYM A;  2OXO A;  1RYU A;  3BQ0 A;  1VJ7 A;  1UA0 A;  4QZF A;  1JRP A;  2QAR B;  3QU5 A;  2ESE A;  4MF2 A;  2B56 A;  5F9N A;  5KG6 A;  3SR6 A;  5D4B A;  3ZD9 A;  5DDM A;  2BPF A;  3LQC B;  2WHE A;  3AMZ A;  3V7L A;  3A0B U;  1RYS A;  4GXI A;  2FLL A;  1NZB A;  3F2D A;  5KFV A;  3RBD A;  9ICF A;  4QIW C;  4QWE A;  1T94 A;  4ICA A;  4X4R A;  3GQC A;  3HW8 A;  3B0Y A;  4RNM A;  2XIC A;  2H3V A;  4F72 A;  1SKS A;  1L7P A;  3Q8Q B;  2PMZ C;  3ICX A;  1UCV A;  3UMB A;  5KFR A;  3HJE A;  1NNL A;  3RH6 A;  5CWR A;  3H0L B;  2ZIX A;  1KKX A;  1MQ2 A;  4AT8 A;  4O68 A;  5ALV A;  4QZA A;  3AN1 A;  4MEY A;  5KT4 A;  5KG5 A;  3NRZ A;  3TKA A;  1KL9 A;  3WK6 A;  4F4Z A;  5FP0 A;  3F5A A;  3VCB A;  3JPS A;  3Q8S B;  4AYB C;  2DKZ A;  1TE2 A;  9ICU A;  2RP5 A;  2JMG A;  5AKH A;  1D9D A;  1SL2 A;  2DRB A;  4KLE A;  1JQR A;  5L1I A;  3BQ2 A;  5J2A A;  5D46 A;  1SL1 A;  1QTM A;  4C8O A;  1WCN A;  3SQI A;  5JTI A;  3RB0 A;  1DK3 A;  4BUG A;  1TFR A;  1LV5 A;  1DRG A;  2QB0 B;  5AKL A;  2D3D A;  2KKP A;  2N1R A;  3TQ1 A;  2FMS A;  2KK0 A;  5ALD A;  2KHV A;  5HML A;  5AM5 A;  3HP6 A;  3RJF A;  3MGV A;  4X4S A;  4YR0 A;  4UB3 A;  3C21 A;  3ALR A;  1UA1 A;  1D8L A;  4UBB A;  5DQG A;  5KG3 A;  4O3R A;  3BZC A;  4UB2 A;  4YD1 A;  1COO A;  4JV0 A;  2HN1 A;  5F2V O;  3PW0 A;  3VC8 A;  2YTU A;  2OYY A;  5J8Y A;  3OHB A;  2B51 A;  5HP4 A;  4GFJ A;  4UW9 A;  3PW2 A;  2M2V A;  4X4V A;  4EZ9 A;  4X4N A;  5KFN A;  3NVO A;  4ZH4 A;  3OSP A;  5J2G A;  1SV4 A;  4EZ6 A;  1BVS A;  4EBD A;  9ICJ A;  1NK8 A;  3LDA A;  3C28 A;  2KSO B;  5KTQ A;  2DR8 A;  4RPX A;  2JHD A;  2NRX A;  1SWV A;  2HMX A;  4FZL A;  2LM4 A;  4NXZ A;  4QZ8 A;  2EAM A;  5BPC A;  4BXO A;  1OW5 A;  4C7Z A;  4WBY A;  4UAW A;  5L9X A;  3EF2 A;  1ZQF A;  3C23 A;  4I2J A;  5DLF A;  4G3I A;  1ZQY A;  5ALX A;  1LKY B;  1WYG A;  2RRD A;  3ZDD A;  2O1P A;  3DV9 A;  4TQS A;  5CFS A;  3IG5 A;  1Z1B A;  1NKE A;  1SKW A;  4DS4 A;  3SI8 A;  3M9O B;  5J0Y A;  5AKZ A;  3QU4 A;  3AQE A;  5CP2 A;  4RPY A;  3Q8K A;  2FMP A;  2E5S A;  9ICL A;  4P4M A;  3C1Z A;  3JPN A;  4Y2P A;  3V6K A;  2XO7 A;  1UHU A;  5J2J A;  4OD0 A;  1Z4O A;  2VA3 A;  8ICH A;  4KLL A;  5J0O A;  4NXX A;  2HOQ A;  1FFU A;  1ZQW A;  4FZN A;  4ATB B;  2VAN A;  3EZ5 A;  1ZQP A;  4RNO A;  5EWE A;  1SXD A;  4C4R A;  1A76 A;  2Q0Z X;  1Y88 A;  4EGW A;  4CF4 A;  1WWV A;  4F5O A;  1QCK A;  2G07 A;  1M6Y A;  1NJZ A;  5CHE A;  3M6K A;  1KN5 A;  1HUO A;  2NRW A;  2NO4 A;  1SZH A;  2ZTE A;  4F4K A;  5ALR A;  3BS7 A;  5AM3 A;  3H37 A;  3MGH A;  2KZM A;  4E80 A;  1WCL A;  2KFN A;  2IUB A;  2JR5 A;  1PVQ A;  4O69 A;  5TZV A;  3RJJ A;  4X4Q A;  1ZQR A;  2WF8 A;  4I0U A;  1X9M A;  3UM9 A;  2PFP A;  1JAJ A;  4NLN A;  4ECS A;  5ALO A;  3SEI A;  5HRI A;  4M9L A;  9ICX A;  2DBY A;  4Y2V A;  1SGG A;  2EAO A;  3G6Y A;  4DOB A;  2BCU A;  2BBJ A;  4DSJ A;  2IMW P;  4M04 A;  3TFS A;  2JH1 A;  3PZP A;  2HCF A;  4KMU A;  4Q44 A;  4RQ7 A;  2EAP A;  7ICH A;  3S6J A;  4O67 A;  1CI4 A;  4FHV A;  3ZDB A;  3PW5 A;  2NRV A;  4WC1 A;  1L7M A;  2OWO A;  2A1J A;  2ZTC A;  3QEB Z;  4B9V A;  3HPO A;  1Q46 A;  2YMP A;  3OWG A;  2YMM A;  2E8P A;  5G5G A;  3ORY A;  3NKU A;  4Z6D A;  3RR8 A;  1X6I A;  2XCP A;  2YMQ A;  4JV1 A;  4CCH A;  1ZQO A;  1NOM A;  3FYH A;  5KT7 A;  1JN3 A;  1X40 A;  5KFW A;  4RU9 A;  2CPR A;  3NUQ A;  4BGD A;  1XSL A;  3DDH A;  3LK9 A;  4EYH B;  3AL0 B;  3C2K A;  1A0P A;  2JV3 A;  1ZYQ A;  1NJX A;  2ZUC A;  5J0S A;  1J2N A;  1S5L U;  3GIL A;  4DSI A;  2HBJ A;  4NL9 C;  4AT7 A;  3NGD A;  8ICM A;  5HRL A;  4WCW A;  8ICN A;  3T5K A;  8ICL A;  5H2F U;  7ICE A;  3MFI A;  1NK5 A;  3KZX A;  2GH1 A;  1IV8 A;  2J6U A;  2Y1I A;  2KMD A;  4YXJ A;  1PUZ A;  2ZH4 A;  3LWM A;  5DQH A;  4G9B A;  3MAB A;  4DL7 A;  4MHV A;  4B9U A;  4C8N A;  4OJL A;  3KKA C;  2YY6 A;  3RH4 A;  1COK A;  4RT3 A;  2ZHA A;  2HN2 A;  5AM1 A;  2HOI A;  2KV2 A;  3UQ0 A;  2KG5 A;  8ICA A;  1HJP A;  2H5X A;  1N62 A;  2LYB A;  4DOC A;  2A1A A;  2XY6 A;  2F1H A;  2JEF A;  4ELV A;  4KLI A;  3BQ7 A;  2F8K A;  5EE9 A;  4J9N A;  2OH2 A;  4F50 A;  4F5Q A;  4KLJ A;  2FPL A;  2NRZ A;  4Y2X A;  5DGA A;  3AUO A;  2VJ4 A;  1GO3 F;  1WWU A;  2AHO B;  4F92 B;  1UQV A;  1Z19 A;  4EP7 A;  7ICP A;  5EWF A;  9ICT A;  3NVV A;  3PO4 A;  5KG1 A;  2HHU A;  4F93 B;  4F5N A;  3KZI U;  5F9L A;  2BHN A;  1KDH A;  3D2N A;  4NJ8 A;  1SB3 C;  5DB6 A;  2IOF A;  4Z6E A;  1Z4N A;  2WTF A;  4J03 A;  5KFH A;  2AQ0 A;  2BR0 A;  2IA6 A;  2G08 A;  9ICB A;  1F0M A;  3FM9 A;  5C5J A;  4F91 B;  1EXN A;  2W8K A;  5HRF A;  4M47 A;  1VDV A;  4UB1 A;  5KT5 A;  1UET A;  2GLE A;  5AM2 A;  5KT2 A;  1QH9 A;  2KP7 A;  5E79 U;  3L3F X;  4K9A A;  4QZC A;  8ICE A;  1L3T A;  1PVR A;  5HRE A;  9ICH A;  1TK8 A;  3LVV A;  2DR9 A;  4BWJ A;  5KFT A;  1R8B A;  2MSN A;  3IDW A;  3H3A A;  3M8R A;  4BWM A;  1ED1 A;  2W9B A;  3C29 A;  2MRL A;  3ETL A;  4KLM A;  1BPX A;  4J9L A;  4MKP A;  4WC4 A;  1CEZ A;  7ICU A;  1Z3E B;  2JZB A;  2EZX A;  2F1J A;  2GOL A;  3GII A;  1IIP A;  3UXN A;  4YD2 A;  4PHD A;  1LVH A;  2MUT A;  4Z6C A;  4K4H A;  1Z1V A;  2UVV A;  3N28 A;  3HIY A;  3ED5 A;  2DFL A;  2BPC A;  4DSE A;  2KD1 A;  4XJE A;  3QUQ A;  3KOO A;  4JV2 A;  2K8B B;  7ICI A;  2ZH1 A;  1PK1 B;  2JGA A;  3PW7 A;  3F2B A;  4DL5 A;  4GXK A;  4FHX A;  2Y0S C; 
#chains in the Genus database with same CATH homology
 4KLF A;  1NZP A;  2HHW A;  9ICI A;  1SKS A;  2KFZ A;  2XGQ A;  4DFJ A;  3Q8Q B;  3JPQ A;  4LZG A;  8ICJ A;  1R89 A;  1S0O A;  2M9N A;  5KFU A;  5DDY A;  5KFK A;  1RZT A;  1R8C A;  1UT5 A;  4TUQ A;  4LT6 A;  2M2W A;  5KFR A;  3RH6 A;  4J9R A;  4RQ5 A;  1L3U A;  5CWR A;  4TUS A;  3AU6 A;  5J0T A;  3KTQ A;  1WOT A;  3OUY A;  1MQ2 A;  1HUZ A;  5KFZ A;  5KG0 A;  3OSN A;  4M2Y A;  2HHX A;  4AT8 A;  4QZA A;  2NRT A;  2AGQ A;  4DEZ A;  2AQ4 A;  1XS9 D;  4M6W A;  5KFP A;  3MBY A;  4UAY A;  4MEY A;  5KT4 A;  4MFA A;  5KG5 A;  4EYI B;  4ECQ A;  4I28 A;  3GV7 B;  1NK0 A;  2BE3 A;  5CHG A;  4F4Z A;  1S0V A;  5J2F A;  4QZG A;  5KT6 A;  4O5E A;  1Z00 A;  5KFL A;  3JPS A;  2ZH5 A;  4PHP A;  5J0Q A;  4DL3 A;  1U49 A;  3Q8S B;  4NY8 A;  3M9N B;  7ICF A;  2HHS A;  3AQK A;  9ICU A;  1NK6 A;  5J2I A;  2ASL A;  4KLT A;  2BCV A;  4I2D A;  1D9D A;  3EPG A;  1U4B A;  4GXJ A;  2HW3 A;  3V6J A;  4DL4 A;  3IHQ B;  1MSW D;  4PH5 A;  1CUK A;  3OJS A;  1T8E A;  1SL2 A;  3MR3 A;  1Q79 A;  4KLE A;  2DRB A;  1JQR A;  5L1I A;  3RRH A;  3BQ2 A;  5J2A A;  2ATL A;  4KTQ A;  5D46 A;  3EYZ A;  1SL1 A;  8ICI A;  3H8J A;  4I2I A;  9ICO A;  4WC2 A;  1KTQ A;  4WC3 A;  1QTM A;  4C8O A;  1RPL A;  1NJW A;  5J2E A;  1WCN A;  5DBA A;  2R8I A;  3T5H A;  1Q78 A;  3PR4 A;  3KHR A;  3KHG A;  3JPP A;  4R63 A;  1ZJN A;  3RB0 A;  2C2R A;  1S77 D;  1DK3 A;  1MIV A;  3TI0 A;  3QEA Z;  3G6X A;  5KFX A;  4ECU A;  1TFR A;  1LV5 A;  4ECX A;  3MR2 A;  1TAU A;  3EWA A;  4PGQ A;  7ICG A;  3V72 A;  3HT3 A;  2KZ3 A;  4F8R A;  3TQ1 A;  3ZDE A;  2ZH3 A;  2MAX A;  2P6U A;  2FMS A;  4NLK A;  1IM4 A;  5DLG A;  3RR7 A;  1TK0 A;  2XCA A;  8ICG A;  2DPI A;  4F2R A;  3PX4 A;  8ICO A;  1XC9 A;  5HML A;  9ICQ A;  4O0I A;  1ZQZ A;  3HP6 A;  4BXO B;  1K1S A;  3AU2 A;  2R8K A;  4F3O A;  3RJF A;  1LB2 B;  7ICQ A;  2FPM A;  4X4S A;  5IIN A;  5DB7 A;  2HVI A;  4XA5 A;  5J2K A;  4X0A A;  4YR0 A;  5J0P A;  4UB3 A;  4RQ1 A;  3C21 A;  4PHA A;  2C28 A;  4B9M A;  2ZJA A;  1UA1 A;  1JIH A;  2BDP A;  4QWB A;  1D8L A;  8ICC A;  4FH5 A;  4UBB A;  1ARO P;  5DQG A;  5KG3 A;  3G6V A;  4ED3 A;  4O3R A;  3BDP A;  3M9M B;  2AU0 A;  1ZQI A;  2UVW A;  3MFH A;  4FHY A;  1XU4 A;  3KHL A;  4O3P A;  4UB2 A;  4YD1 A;  1COO A;  2DR5 A;  4JV0 A;  1RXW A;  9ICW A;  1YLQ A;  3GFK B;  3JPO A;  3ZDA A;  4TQR A;  5F2V O;  3PW0 A;  4R64 A;  4IG8 A;  4KLH A;  2RFF A;  3OHB A;  4WC7 A;  5HP4 A;  2RDJ A;  2W9C B;  3PW2 A;  1X9S A;  2M2V A;  1FA0 A;  4X4V A;  5HMM A;  3QZ8 A;  3JPT A;  5HHH A;  3QE9 Y;  4EZ9 A;  4IQW A;  4NM1 A;  4X4N A;  3EW9 A;  5KFN A;  4F4W A;  3UQ2 A;  4X4U A;  4ECW A;  2IHM A;  1S97 A;  1H38 A;  3H38 A;  4NKU A;  4ZH4 A;  4AT9 B;  3OSP A;  5J2G A;  9ICP A;  4JUZ A;  4J9M A;  1ZQK A;  5J0X A;  1BVS A;  4EBD A;  1NK4 A;  1U48 A;  4EZ6 A;  4KLU A;  2PFO A;  2VA8 A;  4YMN A;  9ICJ A;  5KFB A;  2PI4 A;  4WBZ A;  1V4A A;  2F1I A;  1F5A A;  4BDP A;  2ZHB A;  1NK8 A;  3KHH A;  3LDA A;  3TAN A;  4O3O A;  1KLN A;  1BPD A;  5KTQ A;  2IBK A;  3RJK A;  5DQI A;  4QZE A;  5DB8 A;  4QZI A;  4RPX A;  5HRG A;  2DR8 A;  2NRX A;  4GLX A;  5IIO A;  3H4B A;  1N48 A;  4K4I A;  4UAZ A;  4ED0 A;  4NXZ A;  3QZ7 A;  2ZUB A;  2J6S A;  4QZ8 A;  2JEJ A;  4KLG A;  5BPC A;  3JZ0 A;  4ECT A;  1V9P A;  5KFO A;  4UBC A;  3Q8M A;  4BXO A;  4FS1 A;  4UD5 A;  4WBY A;  4UAW A;  1QSS A;  5L9X A;  4O5K A;  3OVA A;  2DPJ A;  3HW8 A;  1BPY A;  1ZQF A;  3C23 A;  4I2J A;  3PMN A;  5DLF A;  4FHP A;  4WC6 A;  4G3I A;  1ZQY A;  2ID1 A;  5CJ7 A;  4B9S A;  1OU5 A;  1ZET A;  2DRA A;  2XC9 A;  4ED6 A;  3OJU A;  3ZDD A;  2O1P A;  4TQS A;  4RQ3 A;  5III A;  4FHW A;  4I2C A;  2ASD A;  2V4Q A;  4F5P A;  1U9L A;  1NKE A;  1SKW A;  4DS4 A;  4O9M A;  3SI8 A;  5HR9 A;  3M9O B;  1S0N A;  2J6T A;  4YN4 A;  5J0Y A;  3M8S A;  7ICL A;  4X0B A;  1RYR A;  4ECZ A;  3MGI A;  2KTQ A;  5CP2 A;  4RPY A;  3Q8K A;  2FMP A;  4QZ9 A;  2I9G A;  5EOZ A;  3UPQ A;  4O5C A;  1KNY A;  9ICL A;  4P4M A;  3C1Z A;  3RJI A;  1T3N A;  3JPN A;  8ICR A;  8ICF A;  8ICU A;  3RAQ A;  3H7I A;  3V6K A;  1ZQN A;  2XO7 A;  4M9J A;  2C2D A;  1DK2 A;  1ZQT A;  5J2J A;  8ICH A;  2VA3 A;  4RQ2 A;  5J0O A;  2W9C A;  4DFK A;  4KLL A;  2ISO A;  3AQM A;  1ZQW A;  4ATB B;  5HNK A;  2LYH A;  4F2S A;  2HHV A;  3BQT A;  3H4D A;  2XY5 A;  1C7Y A;  2VAN A;  4DQP A;  3HWT A;  2BPG A;  3EZ5 A;  4X4P A;  1ZQP A;  1XO1 A;  4RNO A;  1NK9 A;  5EWE A;  3K4G A;  1ZQL A;  4DSL A;  9ICK A;  4AT9 A;  1A76 A;  2Q0Z X;  3V7J A;  1Y88 A;  2FLN A;  5HRB A;  4LVS A;  2W9A A;  2A1J B;  4NLG A;  1B22 A;  2NRK A;  3WFO A;  4F5O A;  5J0R A;  3T3F A;  2ZH6 A;  2ALZ A;  1NJZ A;  4ECY A;  1ZQM A;  3H40 A;  8ICZ A;  3RTV A;  2PFQ A;  8ICS A;  4YR3 A;  4QZH A;  1HUO A;  2NRW A;  8ICB A;  4O3S A;  4YMO A;  4M9N A;  2ZH7 A;  4EEY A;  2HHT A;  4QWC A;  1VFG A;  4YMM A;  4MFC A;  3GV8 B;  4IR9 A;  4Z6F A;  8ICV A;  1NO5 A;  4RT2 A;  2ZTE A;  3MDA A;  2P66 A;  3C5G A;  4F4K A;  8ICP A;  2R8G A;  2P6R A;  4P4P A;  3N97 B;  3PO5 A;  3NYB A;  5DEC A;  5KFY A;  3RB6 A;  3H37 A;  7ICS A;  1JMS A;  4YP3 A;  2PXI A;  3GIM A;  3MGH A;  2KZM A;  4E80 A;  2BQR A;  1WCL A;  4P4O A;  3C2L A;  3B0X A;  4KLS A;  2KFN A;  9ICR A;  8ICX A;  4J9K A;  4UD4 A;  3WFS C;  3PNC A;  9ICC A;  5TZV A;  4ED8 A;  2PBE A;  3RJJ A;  7ICR A;  4X4Q A;  3FDS A;  1ZQR A;  1ZQX A;  4IRK A;  4E7X A;  1X9M A;  3PVX A;  2PFP A;  1JAJ A;  3C66 A;  4IRC A;  4RNN A;  3BQ1 A;  4ECS A;  4NLN A;  3GIJ A;  1D9F A;  3RRG A;  3JPR A;  2C2E A;  5HRI A;  4I29 A;  4AT7 B;  4M9L A;  4KN4 A;  2XGP A;  9ICX A;  5DED A;  4RWO A;  4EBK A;  1BGX T;  3G6Y A;  4DOB A;  3TAQ A;  4KLD A;  2BCU A;  3HJ1 A;  3H8W A;  4DSJ A;  2IMW P;  4KLO A;  2UVR A;  4NKT A;  4RWN A;  3HJ4 A;  2O5A A;  7ICK A;  3OGU A;  4M9G A;  3LWL A;  5L1L A;  3ZDC A;  2BCQ A;  4DQI A;  1NK7 A;  4XQ8 A;  3TFS A;  4M04 A;  8ICQ A;  1L3V A;  2FMQ A;  3RH5 A;  4KMU A;  4ATB A;  4UB4 A;  4Q44 A;  4X5V A;  4DWI A;  2KZZ A;  1L3S A;  5BOM A;  5HRD A;  4RQ7 A;  4RQ8 A;  7ICH A;  2PFN A;  3SZ2 A;  2DR7 A;  4XRH A;  7ICT A;  4DS5 A;  4DLE A;  4FHV A;  2R8J A;  4TUP A;  4I2A A;  3ZDB A;  4X4T A;  3PW5 A;  2NRV A;  5CA7 A;  4R8U B;  4WC1 A;  5DG9 A;  2OWO A;  2A1J A;  2ZTC A;  4O3Q A;  3AQL A;  3QEB Z;  1TK5 A;  1XWL A;  4B9V A;  3HPO A;  9ICG A;  4RUC A;  4J9Q A;  1S10 A;  5KFM A;  5HHI A;  1A77 A;  5KFQ A;  4QZB A;  4I2B A;  4J9O A;  4DFM A;  3ORY A;  2KN7 A;  3E2E A;  3RJE A;  4PGY A;  4YVZ A;  4Q43 A;  5IIM A;  7ICN A;  4Z6D A;  1TV9 A;  3H8S A;  3RR8 A;  1KFT A;  1ZQU A;  2BGW A;  4NM2 A;  1UT8 A;  3OVB A;  2XCP A;  4ELT A;  4DQS A;  4JV1 A;  1B43 A;  4DOA A;  4FO6 A;  1S9F A;  4CCH A;  2FPK A;  2JEG A;  4QW9 A;  3EPI A;  4HYK A;  5J2D A;  1ZQO A;  2BCR A;  4ELU A;  8ICL A;  2HHP A;  1TFW A;  1NOM A;  3FYH A;  4RQ6 A;  1BPZ A;  2W9M A;  4B9N A;  5DBC A;  5KT7 A;  3TFR A;  1JXE A;  1JN3 A;  1ZQQ A;  4M0A A;  4IQU A;  3Q8L A;  5KFW A;  4RU9 A;  3IM1 A;  4QZD A;  1K1Q A;  1L5U A;  1TFY A;  4YR2 A;  2V4R A;  5IIL A;  1SKR A;  5J0U A;  4BGD A;  5DG8 A;  4DFP A;  3THV A;  3K75 D;  5DG7 A;  1XSL A;  1NKB A;  4FBU A;  3JYY A;  4RWQ A;  1ZQG A;  3LK9 A;  4EYH B;  3C2K A;  4JK1 A;  3H39 A;  2ZH2 A;  4DL2 A;  1ZYQ A;  1NJX A;  2ZUC A;  3GIK A;  5J0S A;  3PX0 A;  5KFF A;  3Q8P B;  1ZQB A;  4YQW A;  1TKD A;  3GIL A;  3UXO A;  4DSI A;  2Q66 A;  5KFE A;  4AT7 A;  1SL0 A;  2VA2 A;  4LZD A;  3NGD A;  8ICM A;  4FBT A;  5HRL A;  4M5D A;  4WCW A;  3RAX A;  2JEI A;  4Q8E A;  8ICN A;  3Q8R B;  4I2F A;  4ED7 A;  1DGS A;  3T5K A;  3TAR A;  1ZQJ A;  5EWG A;  5J0W A;  3MR5 A;  4DF4 A;  3PY8 A;  7ICE A;  4XUS A;  3MFI A;  4ECV A;  1ZQC A;  1NK5 A;  4F4X A;  4I2G A;  4B9L A;  2BKE A;  9ICS A;  4QW8 A;  4Q8F A;  4UB5 A;  4TUR A;  4MF8 A;  2J6U A;  3WFR E;  5JUM A;  5KFD A;  1TVA A;  3HX0 A;  5KT3 A;  2Y1I A;  1ZQD A;  5KFA A;  4YXJ A;  5IIJ A;  8ICW A;  2ZH9 A;  1ZQV A;  2ZH4 A;  4RQ4 A;  3LWM A;  1MQ3 A;  1ZJM A;  3TAP A;  5DQH A;  2R8H A;  5J2B A;  3N4M B;  4RQ0 A;  5L1K A;  4R8U A;  3MAB A;  4DL7 A;  3OVS A;  4RUA A;  4YXM A;  4KLQ A;  4YG2 A;  3SV4 A;  4F5R A;  4B9U A;  2ISP A;  4IRD A;  4I2H A;  4C8N A;  5HRH A;  5L1J A;  4E0D A;  8ICY A;  9ICE A;  7ICO A;  2Y1J A;  3RH4 A;  4FH3 A;  4ED1 A;  5KG4 A;  4RT3 A;  4EBE A;  2ZHA A;  4I27 A;  2RDI A;  3ZD8 A;  4F4Y A;  5J29 A;  3RBE A;  2BQU A;  3UQ0 A;  2XY7 A;  3PW4 A;  4PHE A;  1D8Y A;  1HJP A;  2H5X A;  2ZJ8 A;  4DOC A;  2PI5 A;  1MC8 A;  3T5J A;  8ICA A;  2XY6 A;  3AQN A;  2F1H A;  2JEF A;  4ELV A;  2DVI A;  1BNP A;  5IIK A;  1NJY A;  5KFS A;  4KLI A;  1BPE A;  4XQ7 A;  4R66 A;  4DO9 A;  3C18 A;  4DSK A;  1MIY A;  4J9N A;  2W8L A;  1QSY A;  4F50 A;  1XSP A;  4F5Q A;  4KLJ A;  3SYZ A;  3MR6 A;  2FPL A;  2NRZ A;  5DGA A;  3PV8 A;  4PPX A;  4FS2 A;  8ICK A;  1BPB A;  3AUO A;  1T4G A;  2W9B B;  3BJY A;  7ICV A;  4E8F A;  4M9H A;  2BQ3 A;  9ICN A;  2UVU A;  3L9D A;  4F92 B;  4EP7 A;  3PML A;  4RPZ A;  4QWD A;  4YFK A;  4S3N A;  2JZB B;  7ICP A;  5J2C A;  4GC7 A;  5EWF A;  1N56 A;  9ICT A;  5KG2 A;  2I1Q A;  1BNO A;  2ZTD A;  2MUT B;  4C8M A;  7ICJ A;  3SV3 A;  1RXV A;  1DOQ A;  3PO4 A;  5KG1 A;  9ICV A;  3RJG A;  2HHU A;  4QWA A;  4GC6 A;  4JWN A;  3NTU A;  1X2I A;  1MIW A;  4F93 B;  3RB4 A;  4F5N A;  2AGO A;  3C2M A;  5F9L A;  2BHN A;  2AGP A;  4MFF A;  1KDH A;  3WFP A;  4IR1 A;  3GDX A;  3WFQ E;  1QLN A;  5DB6 A;  4Z6E A;  4IQV A;  1U45 A;  2B21 A;  4ECR A;  2M2T A;  4NLZ A;  3T5L A;  4C8K A;  2WTF A;  1JXL A;  1KFD A;  5KFH A;  2AQ0 A;  4DF8 A;  1XSN A;  2BR0 A;  2IA6 A;  5KG7 A;  4K4G A;  3RJH A;  5KFJ A;  9ICA A;  3V6H A;  1ZQS A;  5KFC A;  9ICB A;  1R8A A;  1ZQA A;  5C5J A;  3PR5 B;  4F91 B;  2GWS A;  1EXN A;  2W8K A;  1TAQ A;  4Q45 A;  1U47 A;  5HRF A;  2IHN A;  4JWM A;  4DSF A;  4M47 A;  3C5F A;  1KRP A;  4UQG A;  4UB1 A;  4KN7 A;  3OHA A;  9ICM A;  5KT5 A;  3RB3 A;  4ED2 A;  2FLP A;  7ICM A;  1UET A;  2M2U A;  5BOL A;  5HC9 A;  5KT2 A;  3ISD A;  4EBC A;  2KP7 A;  1ZQE A;  1KSP A;  3OUY B;  3OV7 A;  1IXR A;  4QZC A;  3GV5 B;  5DBB A;  1L3T A;  1QSL A;  8ICE A;  1S76 D;  3C1Y A;  4AT8 B;  4WC5 A;  5HRE A;  2AJQ A;  5CB1 A;  9ICH A;  1TK8 A;  1PZN A;  4M6W B;  4RWP A;  1SZP A;  5DKW A;  5J2H A;  2DR9 A;  5HRK A;  4B9T A;  4BWJ A;  5KFT A;  5DGB A;  1R8B A;  4DLG A;  1UEU A;  4EBJ A;  2ASJ A;  3H3A A;  3M8R A;  4BWM A;  3MDC A;  4YCX A;  4R65 A;  2W9B A;  2ZH8 A;  1Z00 B;  3ETL A;  4KLM A;  1X9W A;  1BPX A;  4J9L A;  4WC4 A;  4KIT B;  1CEZ A;  2ZJ5 A;  7ICU A;  3BQ0 A;  1VJ7 A;  4J9S A;  1UA0 A;  4QZF A;  1Z3E B;  3UXP A;  4MEX A;  2BCS A;  2JZB A;  1JX4 A;  2F1J A;  4MF2 A;  3GII A;  3UXN A;  5F9N A;  5KG6 A;  4YD2 A;  4PHD A;  3ISB A;  4DQQ A;  2MUT A;  4Z6C A;  4K4H A;  4I2E A;  4O3N A;  2V9W A;  5DB9 A;  5D4B A;  5D49 A;  5KFI A;  4RZR A;  4J9P A;  1ZQH A;  1NKC A;  3ZD9 A;  5DDM A;  2C22 A;  2BPF A;  2UVV A;  4P2H A;  2HVH A;  1PX5 A;  3LQC B;  3V7L A;  3HIY A;  4X4O A;  2DFL A;  4DQR A;  2BPC A;  4DSE A;  4DL6 A;  3PX6 A;  1RYS A;  3UPS A;  4GXI A;  5CR0 A;  5KFG A;  2FLL A;  4C8L A;  4WC0 A;  4JV2 A;  3V7K A;  7ICI A;  5KFV A;  2ZH1 A;  2ZUD A;  1KEJ A;  3RBD A;  1T7P A;  9ICF A;  3PW7 A;  3ISC A;  8ICT A;  2HHQ A;  1KFS A;  4QWE A;  4DL5 A;  4X4R A;  4PGX A;  1UEV A;  3GQC A;  4GXK A;  3B0Y A;  4FHX A;  4RNM A;  1S0M A;  4IQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...