4R63A

Binary complex crystal structure of r258a mutant of dna polymerase beta
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIALIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Substrate-induced DNA Polymerase beta Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4r63A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4r63A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4r63A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4r63A03
4X4NA 1T3NA 4KLUA 2BCVA 9ICLA 1CUKA 4XRHA 4X4TA 9ICIA 3BQTA 1NO5A 2BGWA 4X0BA 5F9LA 4DLGA 3SV4A 9ICKA 3NTUA 4DS4A 2A1JB 4TUQA 4ED6A 2J6UA 1BPXA 5CJ7A 3PMLA 4JUZA 5DKWA 4PGXA 3JPTA 5L1KA 4J9NA 4ED1A 4WC3A 1ZQTA 4O3SA 7ICIA 2JEFA 2XC9A 1TK8A 3RJEA 4FO6A 3HWTA 4UB4A 8ICLA 4XA5A 2NRWA 1L3SA 4E8FA 3MFIA 5KFKA 3BJYA 1ZQJA 2IHMA 3IM1A 1ZQCA 7ICMA 4X4RA 4M0AA 4YD2A 1MIVA 4EBCA 4MFFA 4PHPA 2ZJAA 1L3VA 5KT7A 2I1QA 5D4BA 1Z00B 2UVRA 3H8SA 3AQLA 1SKWA 4ED0A 5DB6A 3PV8A 3RB4A 3AUOA 5HP4A 1UA1A 3Q8PB 3G6YA 5HRLA 1TK0A 7ICFA 5IIIA 1RXVA 3PR5B 4F93B 3T5JA 4ECTA 4B9UA 3OUYA 2C2RA 4WC2A 5J2AA 4DSJA 1ZQFA 1X9WA 4F5RA 1L3TA 2M2VA 4RQ6A 1NK6A 1X2IA 3RR7A 4NM1A 3H40A 4ECZA 7ICGA 4F50A 1T7PA 5DEDA 1QTMA 1ZQYA 4S3NA 3M9MB 4DSEA 1JIHA 1TAQA 5IIKA 3V7JA 4IG8A 1S97A 4NXZA 5CA7A 5KFJA 4DQRA 2C2EA 4J9PA 4RQ5A 1OU5A 5J2JA 3M9NB 4WBYA 5DBCA 4YR0A 3GV5B 5KG1A 7ICQA 3OVBA 1ZQBA 3L9DA 1TV9A 4X4QA 1UETA 8ICMA 3WFSC 1NK8A 3ORYA 4MF8A 2W9AA 3RJJA 7ICUA 1Q79A 3ZDBA 1SKSA 5J0UA 2ZUBA 4JWNA 8ICZA 5J0XA 4KN7A 1ZQWA 2KN7A 5J0PA 4FS2A 1ZQKA 2I9GA 2W9CA 1DK3A 3OJSA 1ZQGA 4YFKA 4DQSA 4DOCA 4ED7A 1UEVA 1V9PA 4DF4A 5KFCA 5J2IA 4R8UA 5CHGA 4IR9A 1MSWD 3H4DA 1NK7A 2XY6A 4NM2A 5HHIA 3RTVA 4QZDA 3UPQA 3RJIA 4RWQA 3RRGA 4QZBA 5L9XA 4B9LA 9ICGA 3K4GA 3TI0A 5DDMA 5J0QA 3C2LA 4QZGA 4I2AA 2V9WA 1FA0A 1ZJNA 4WC6A 1ZYQA 3TAPA 2Q0ZX 3RH5A 8ICJA 4DFKA 1S0MA 3LWLA 4IRKA 2ALZA 2C28A 5KFSA 3JPOA 7ICVA 3SV3A 1NKEA 3M8RA 5DBBA 5HRFA 3G6VA 4FBUA 4RQ1A 4Q8FA 4EP7A 4RWPA 2KZ3A 1JQRA 4ECRA 4LZGA 1H38A 4F8RA 4O9MA 2AJQA 4NKTA 2MUTB 3AQNA 1MIWA 3RH4A 3M9OB 1XO1A 2PFPA 1PX5A 2DR7A 2XGQA 3H38A 4NLKA 4BGDA 3MBYA 5J0WA 1BPBA 2PI5A 4MF2A 8ICTA 1TFWA 4M04A 5KFBA 5KFUA 3JPNA 4WBZA 4DEZA 3PVXA 5J0RA 2BCSA 1MIYA 4ECVA 1L5UA 4QZCA 3V6KA 1NKCA 8ICXA 3FDSA 1AROP 4ELUA 2Y1IA 8ICCA 4O3NA 5KG7A 2AGPA 3PO5A 4YMOA 3C2KA 4UD4A 4AT9B 4AT8A 1VFGA 1BPZA 5KFHA 3OSNA 3PW0A 2F1HA 1HUOA 3GQCA 1ZQQA 3PMNA 4WC4A 4PGQA 4FHXA 7ICHA 5HR9A 5F9NA 5HRDA 2UVUA 5HREA 2IHNA 1KFSA 4DL7A 3V6JA 4PGYA 1JN3A 4RT2A 2ZTDA 2VA2A 2KP7A 3N4MB 2C2DA 3HT3A 3HIYA 5CWRA 4PHEA 3GDXA 2M9NA 2ZH6A 5KT5A 4I2FA 5KFDA 3ZDCA 8ICUA 1JXEA 4PPXA 4ECYA 2XY5A 9ICXA 4YN4A 4RQ8A 3GIJA 1S0OA 4RQ3A 3WFQE 4BXOA 4Z6EA 9ICVA 2XCPA 3HPOA 1R8BA 7ICLA 4F4WA 2ZHAA 3H4BA 1VJ7A 5DDYA 4O5CA 1IM4A 4TQRA 4TURA 1XSLA 1NK5A 4ED8A 3PX0A 1QSLA 2HHQA 4E7XA 2UVVA 2HHSA 3Q8MA 4QWDA 4KLEA 3GIKA 4ZH4A 4YMMA 4F4ZA 4KLGA 7ICKA 5F2VO 4ED3A 3QEAZ 4C8OA 1R8AA 4QW9A 4TQSA 9ICCA 5J0YA 1YLQA 1U9LA 5DLGA 5JUMA 5KFTA 4J9QA 2R8GA 3KTQA 3RB0A 2AQ4A 5CR0A 1XS9D 2ISPA 5J0SA 3HW8A 1MQ2A 2HHTA 4YCXA 9ICSA 2DRBA 3ZDEA 1CEZA 8ICFA 5HRIA 2PI4A 4UAYA 3ZD8A 3RR8A 2V4QA 4WC7A 4RUCA 4WCWA 1RPLA 3GILA 1T4GA 2J6SA 9ICAA 4M9GA 5HC9A 2M2WA 4RWOA 1WCNA 2HHXA 4NLGA 1QLNA 2DVIA 2LYHA 3RAXA 4J9MA 5KFVA 3WFOA 2W8LA 4Z6DA 2ZH3A 4IQVA 4O3OA 3KHGA 1UA0A 3GIMA 2BCRA 1A76A 8ICNA 5DQIA 4YVZA 4DQQA 4NLNA 2HHVA 4FHWA 4DFMA 5BOLA 3SZ2A 4X4VA 1KLNA 1BPDA 8ICHA 1NK4A 5J2CA 3WFPA 4QW8A 3T5HA 5L1LA 3H7IA 3PR4A 4GXIA 2J6TA 3OUYB 4M9JA 2HHUA 2ZTCA 4IR1A 2KZZA 3C1ZA 5DQHA 4JWMA 4IRDA 5DB8A 2O1PA 3C21A 4I2JA 2AGQA 3Q8KA 3H3AA 1TFYA 3UPSA 4I2DA 4ECUA 4DFPA 4HYKA 4UB1A 5J2EA 4K4IA 1KTQA 4RQ0A 4F2RA 4O0IA 4TUSA 2IMWP 2FMSA 5DB9A 9ICPA 3LQCB 1SL0A 2KTQA 3MR2A 1JMSA 4RPZA 1BGXT 1NJYA 1ZQMA 2AQ0A 2BQ3A 1XU4A 4B9MA 4UB2A 5HRKA 2ZJ5A 8ICOA 1C7YA 4YQWA 4IRCA 1R89A 8ICQA 2R8KA 2F1IA 4M6WA 1BPYA 2BCQA 1KFDA 1QSYA 3T5LA 4M6WB 4RUAA 1ZQDA 3RJFA 4O5EA 3E2EA 2W9CB 8ICVA 4XUSA 3BQ2A 4WC1A 5EOZA 2ZUDA 3V7LA 2NRVA 4X4SA 5J0OA 4YD1A 1TVAA 4R8UB 4KITB 2ZHBA 3RJKA 3UQ0A 5D49A 3OHAA 3RB6A 2BE3A 4B9TA 3HX0A 4YR2A 4DL2A 2W9BA 2FLPA 3EW9A 4UAZA 2RFFA 4AT7A 4GC6A 4PHAA 3B0YA 4DL6A 2XGPA 2W9BB 3T5KA 4J9OA 1S0NA 4KLQA 4UAWA 2VA8A 4RNOA 5KFZA 3NGDA 3M8SA 3ETLA 8ICEA 4IQTA 2NRTA 3PY8A 4DQPA 4KMUA 3AU6A 1U47A 1D9FA 1HUZA 4QWAA 3MGIA 4E0DA 4RPXA 3H8JA 2BPCA 3UXOA 4I27A 4DSKA 4FHVA 1KNYA 1COOA 5KT3A 1KSPA 1ZQEA 1DOQA 4UBCA 1RYRA 4RWNA 4RNMA 3MDAA 2ISOA 7ICEA 5KFRA 5DG7A 4I2BA 4R63A 3SI8A 1NK0A 5KFLA 5HNKA 1ZQRA 5HRGA 2JEIA 1Q78A 4I2HA 3EZ5A 4I29A 3V7KA 1KDHA 5KTQA 4F5OA 3QEBZ 1S10A 3JPRA 4FHYA 2BR0A 2JZBA 3FYHA 1NKBA 5J0TA 4NY8A 5J2GA 2FPLA 5EWFA 4DSFA 1X9SA 1ZQIA 4EZ6A 4KLIA 2FPMA 4DL5A 4NLZA 4EYIB 5KT2A 4YMNA 2BPFA 3TAQA 8ICYA 4AT8B 4GXKA 4EEYA 2AGOA 7ICJA 1UT5A 1ZQZA 3KHLA 5HMMA 4Q8EA 4BWJA 3JYYA 2Y1JA 4DSIA 8ICBA 2R8JA 2BCUA 5J2HA 4J9LA 2VANA 2ASLA 1SL1A 2JEJA 4DO9A 2PFQA 4LVSA 1S77D 4JV0A 1BNPA 3TFRA 3B0XA 4UB5A 3H37A 5HRHA 9ICRA 1DK2A 3GIIA 3LDAA 3KHRA 4JV2A 5KFAA 5KFEA 1ZQNA 1D8YA 2HVHA 4WC5A 4M9LA 2NRKA 3EPIA 2M2TA 2JEGA 4KLOA 1RZTA 4R64A 4EZ9A 3HP6A 2B21A 4R65A 3OGUA 4F5QA 4BXOB 4X4UA 5DBAA 5J29A 4LT6A 1XSNA 4EBJA 3MDCA 5KFIA 4MFAA 1D9DA 3HJ4A 1U48A 3TARA 5HHHA 3HJ1A 4JK1A 1ZQXA 5DQGA 2NRXA 3RH6A 3UXPA 2V4RA 3C18A 1D8LA 3KHHA 3H8WA 2PXIA 4GC7A 3BDPA 2P66A 1XSPA 3QZ7A 8ICRA 2XCAA 1Z3EB 4QZHA 4G3IA 1A77A 4KN4A 4DLEA 4X0AA 2W8KA 2ZUCA 4ECXA 4IQUA 3PNCA 3RBEA 4PH5A 4QZFA 1BPEA 3Q8SB 3BQ1A 5KFOA 1T8EA 4B9NA 3PW5A 5KG0A 1ZQOA 1ZQSA 1ZQPA 2P6RA 5IINA 2W9MA 5DB7A 3ISCA 1N48A 4RPYA 4MFCA 4TUPA 4ATBA 4K4GA 4YXMA 1QSSA 3OV7A 4J9RA 5KFQA 4QZIA 4FBTA 4EBDA 2PFOA 4YG2A 3Q8LA 3LWMA 5KG5A 2HHWA 1UT8A 3MR3A 2O5AA 1ZQUA 3MABA 3JPSA 4FS1A 2R8HA 3K75D 1U4BA 1ZQHA 3OVSA 4DOBA 1DGSA 4Q45A 4RZRA 4O3RA 1RYSA 2ZTEA 2A1JA 2FLLA 5BOMA 9ICUA 3MR6A 7ICOA 7ICSA 4R66A 3JPPA 3GV7B 5J2FA 1KEJA 1ZQLA 4I2EA 4M47A 5D46A 5KG3A 2ASJA 3T3FA 1NJWA 4IQWA 3TFSA 2MAXA 1N56A 4GLXA 8ICAA 9ICBA 5J2DA 1NK9A 1WCLA 3IHQB 5DG8A 5KG4A 4M2YA 2BPGA 9ICOA 5TZVA 1PZNA 2OWOA 5HMLA 1S0VA 4O3PA 2HW3A 2KFZA 2PBEA 3C66A 7ICNA 1X9MA 4J9SA 2HHPA 3EYZA 3PO4A 4DSLA 3OJUA 4KLDA 1S76D 4F5PA 3PW2A 5DLFA 4KTQA 1Z00A 4GXJA 4I2GA 5KFFA 2VA3A 3GFKB 2FMQA 4KLSA 1TFRA 1ZQAA 2ZH2A 4X5VA 3ZDDA 2WTFA 1JX4A 3WFRE 2R8IA 4MEXA 1TKDA 2ZH1A 1NJZA 4KLMA 1K1QA 3JPQA 2ID1A 9ICHA 5DGBA 4Z6FA 2RDIA 8ICGA 4RNNA 4LZDA 2KZMA 1B43A 9ICMA 4KLHA 4RQ4A 2AU0A 4I28A 4RQ2A 4YR3A 3MR5A 1K1SA 3G6XA 3RB3A 1LV5A 9ICTA 2XY7A 2C22A 5KFPA 4XQ7A 5KFXA 4KLFA 5KG6A 2XO7A 4ECWA 3RJHA 4KLLA 3THVA 5CP2A 4ELVA 3TQ1A 2F1JA 4C8NA 2NRZA 4I2CA 5J2BA 5HRBA 5C5JA 4UBBA 4MEYA 8ICWA 3RBDA 1NOMA 4AT7B 2ZH9A 2HVIA 3C2MA 3TANA 1WOTA 4FH3A 4QZ9A 2DR5A 5IIOA 5KFWA 4NKUA 4ELTA 5KT6A 3RRHA 5EWGA 2DPIA 2FPKA 2IBKA 4CCHA 4M9NA 4YXJA 4F91B 5KT4A 4P4PA 1XWLA 3AQKA 2ZJ8A 5IIMA 2M2UA 3SYZA 3PX4A 1ZQVA 5KFMA 4DFJA 2DRAA 4F92B 3MGHA 2BKEA 4F5NA 2BQUA 1BVSA 4DL3A 4BWMA 4DWIA 4ECSA 4Z6CA 5J2KA 7ICPA 4RQ7A 2KFNA 4B9VA 4DQIA 1R8CA 4QWEA 3RAQA 1MQ3A 3C5FA 3EPGA 5IIJA 4C8LA 4FHPA 3MFHA 4DS5A 5DGAA 2JZBB 4P2HA 2UVWA 4Q44A 4O5KA 1NZPA 3C5GA 2BHNA 1EXNA 4YP3A 4F2SA 4B9SA 9ICEA 2Q66A 5KFNA 4DF8A 7ICTA 2BDPA 1IXRA 1XC9A 9ICQA 2MUTA 3AQMA 5IILA 9ICWA 5KG2A 4KLTA 9ICFA 1UEUA 5BPCA 4QZ8A 3ISBA 4C8MA 2ZH4A 3PW4A 1ZJMA 1LB2B 4O3QA 1KRPA 3AU2A 4I2IA 8ICIA 4X4OA 9ICJA 1JAJA 3OVAA 1U49A 3Q8RB 5DG9A 4KLJA 4UQGA 4J9KA 2BQRA 2DPJA 5CB1A 4F4KA 1BNOA 4C8KA 2FMPA 2ZH7A 3PW7A 5EWEA 3QZ8A 3V6HA 4UD5A 3RJGA 1JXLA 4Q43A 8ICPA 1KFTA 4XQ8A 4RT3A 1RXWA 3ISDA 4F3OA 3Q8QB 2GWSA 5KFGA 7ICRA 3OHBA 4QZAA 4M5DA 1V4AA 4AT9A 3LK9A 2H5XA 2ASDA 5DECA 1TK5A 1TAUA 1SL2A 1L3UA 3ZDAA 1F5AA 4QWCA 2DR8A 3JZ0A 4DOAA 1U45A 4ED2A 4EBKA 1SKRA 2ZH5A 2IA6A 1SZPA 3UXNA 4JV1A 3GV8B 1B22A 2DFLA 4PHDA 5KFYA 3V72A 3NYBA 4E80A 1Y88A 4EBEA 2RDJA 4DL4A 2FLNA 1S9FA 3UQ2A 1ZETA 4X4PA 2DR9A 4P4MA 4P4OA 4UB3A 1MC8A 3H39A 8ICKA 4F4YA 9ICNA 3EWAA 3N97B 1HJPA 4QZEA 5L1IA 2P6UA 4F4XA 4QWBA 3QE9Y 3OSPA 4BDPA 4K4HA 4M9HA 8ICSA 4ECQA 4FH5A 4WC0A 3C1YA 4RU9A 3BQ0A 5L1JA 3ZD9A 2ATLA 3C23A 2PFNA 4EYHB 3PX6A 1NJXA 4ATBB 2ZH8A
chains in the Genus database with same CATH superfamily
5AM5A 3QUBA 4NXUA 4XRHA 1NO5A 2BGWA 1QCKA 5JTGA 3SQIA 2A1JB 4USAA 2OHFA 4CF5A 5CJ7A 3PMLA 5L1KA 4WC3A 3KKAA 1TK8A 4FO6A 2IOHA 4XA5A 4E8FA 3BJYA 3BZCA 3CYMA 4NWIA 5KFKA 3IM1A 1ZQCA 7ICMA 4M0AA 4YD2A 4MFFA 4PHPA 1L3VA 2I1QA 2UVRA 3H8SA 3PV8A 2Q4TA 3Q8PB 1RXVA 3PR5B 3F5EA 3OUYA 4NLCA 4WC2A 4DSJA 2AHOB 1ZQFA 1X9WA 1L3TA 2M2VA 7ICGA 5ALDA 4S3NA 3AN1A 4DSEA 4EX7A 3WK6A 3V7JA 1S97A 4OAFA 4J9PA 3GV5B 5KG1A 1ZQBA 2FI1A 2HBKA 1XNSA 2W9AA 2JXJA 2E5SA 2KN7A 3SAFA 1ZQGA 4P0QB 4DQSA 4DOCA 1V9PA 4R8UA 4K8VA 1KN5A 5EE3A 1HIWA 4NM2A 5KL8B 3UPQA 3RJIA 5ALUA 5L9XA 2FE9A 2Y9TA 4OJOA 4QIWC 4QZGA 3C29A 2V9WA 1ZJNA 3RH5A 3LWLA 2HOQA 5KFSA 2F2AB 2B4VA 4K97A 3E58A 4GIBA 3GU3A 4FBUA 4Q8FA 4EP7A 5AKZA 4ECRA 4F8RA 2AJQA 2I6XA 2KKVA 3AQNA 1SWWA 2PFPA 2BZFA 4BGDA 3MBYA 8ICTA 4M04A 3JPNA 2YTUA 4DEZA 3PVXA 2BCSA 4ECVA 1L5UA 4QZCA 4FHPA 1NKCA 3FDSA 4O3NA 5KG7A 2AGPA 4AT9B 3C2KA 4UD4A 5CHEA 1VFGA 5KFHA 2FCLA 2ZXHA 3PW0A 4CE6A 3RFAA 2OM6A 5ALHA 4DL7A 1KFSA 2EAPA 2KP7A 1Q3UA 2C2DA 3HIYA 5CWRA 3GDXA 2EDUA 2K8CB 1OUQA 4HX0A 8ICUA 1JXEA 1N5WA 4YN4A 4LEVA 4O67A 1QQ6A 4Z6EA 9ICVA 2XCPA 3HPOA 3H4BA 4AYBF 3BS7A 1NK5A 3T79A 2HHQA 2R18A 2HHSA 4E7XA 4F4ZA 7ICKA 2RQ5A 3QEAZ 1R8AA 5AI0A 1V97A 2ZIUA 1U9LA 2R8GA 5HR7A 5KFTA 5AKHA 2HHTA 2ZIUB 1MQ2A 5CEHA 2DRBA 1Q8KA 3RR8A 1KKXA 4WH5A 1T4GA 2J6SA 9ICAA 1QLNA 2LYHA 3RAXA 2FJ6A 2EANA 2VIXA 2W8LA 3D2QA 4Z6DA 4IQVA 4O3OA 2W54A 5G5HA 3H0LB 5DQIA 4KX5A 2VJ4A 8ICHA 4QW8A 4KB6A 3AM9A 3AQEA 5AKJA 2HN2A 1FEZA 5ALEA 4IRDA 4US8A 2DUYA 2O1PA 4I2JA 4ECUA 4DFPA 5J2EA 1ZD2P 1KTQA 4F2RA 5ALMA 2K89A 3M6ZA 1SL0A 3NRWA 5HRKA 4FZMA 2F8KA 1T94A 2DBYA 8ICQA 2BCQA 2JH7A 1KFDA 1RQNA 1SXDA 4UW9A 3T5LA 1ZQDA 8ICVA 4WC1A 2ZUDA 2NRVA 4YD1A 4KITB 3WKAA 3R9KA 3OHAA 3UM9A 2BE3A 2JV3A 2W7OA 4DL2A 1HEKA 2H3ZA 3B0YA 3HKZC 4WQKA 2LPEA 4KLQA 4UAWA 3NVYA 3M8SA 4C0ZA 3PY8A 2JH1A 3H8JA 2BPCA 5KT3A 1DOQA 1RYRA 2OEHA 4RNMA 2QB0B 5AICA 4R63A 3SAGA 3QEBZ 1JI7A 3JPRA 2JZBA 4NY8A 3WU2U 1X9SA 5B3QA 4KLIA 2E8NA 4NLZA 4EYIB 3NASA 4AT8B 2AGOA 7ICJA 2BBJA 3KHLA 1ZD4A 5HMMA 3JYYA 2Y1JA 4B6JA 2ASLA 2OH2A 2JEJA 4DO9A 2ES6A 3ER8C 2KEYA 3TFRA 4UB5A 3IRUA 3H37A 9ICRA 2G07A 3LDAA 3KHRA 4JV2A 4WC5A 2HVHA 4NL9A 2JGAA 2M2TA 5ALQA 3N7RC 2MU2A 2L5YA 2B21A 3OWGA 5G5GA 2YMPA 3MDCA 2EQYA 1D9DA 2NRXA 4K96A 1PVPA 1N63A 4CDGA 3QZ7A 8ICRA 2KJ5A 3K7DA 2IHOA 1A77A 4KN4A 4DLEA 2W8KA 1URJA 3RBEA 3KKAC 3Q8SB 4X4PA 3BQ1A 4B9NA 3ETRA 1ZQSA 1ZQPA 5DB7A 1N48A 4TUPA 1QH9A 4FBTA 4YG2A 3K75D 1U4BA 3QU9A 2WF5A 1WOTA 2ZTEA 5BOMA 3PSIA 7ICSA 5J2FA 1VDVA 4I2EA 2HBMA 4UB6U 4IQWA 2Y0SC 4GLXA 9ICBA 1A6SA 5KG4A 4HAIA 2HW3A 4O3PA 7ICNA 1X9MA 4J9SA 3L3FX 2HHPA 1S76D 3OJUA 2GO7A 5KFFA 2ZH2A 1TFRA 2JMGA 4X5VA 1KBUA 2WTFA 3ZDDA 3WFRE 3QUCA 2R8IA 4LEZA 1TKDA 2ZH1A 4KLMA 5DGBA 1GO3F 4RNNA 3FC4A 2A3VA 4I28A 4YR3A 1LV5A 5KFPA 5KFXA 2ZIVB 2E8OA 2XO7A 3RJHA 1SV4A 2HI0A 3TQ1A 2NRZA 5HRBA 1N5XA 1ED1A 5C5JA 4MEYA 8ICWA 4AT7B 1NOMA 5KL1B 1NNLA 3IV6A 3C2MA 5A0LA 5KFWA 5KT6A 2IBKA 3WK4A 4CCHA 4FE3A 4YXJA 4P4PA 3AQKA 5AKKA 2KVSA 2M2UA 3MGHA 2BKEA 1T3QA 3QU7A 7ICPA 3C5FA 4DCCA 3SEIA 4DS5A 2OYYA 2BBHA 2NYVA 1NZPA 4O5KA 2Q66A 5FP0A 5IILA 5KG2A 4F71A 5BPCA 1ZJMA 8ICIA 4O3QA 3AU2A 9ICJA 2BQRA 2FMPA 5EWEA 3V6HA 1JXLA 8ICPA 1KFTA 5KFGA 7ICRA 3M6KA 5L1MA 1SL2A 1F5AA 5ALXA 3I1YA 3JZ0A 4ED2A 1SKRA 3MCRA 4C4SA 3GV8B 3NYBA 4E80A 1J2MA 4EBEA 2RDJA 2FLNA 3QX7A 1ZETA 2DR9A 4UB3A 1MC8A 4F4YA 4Y2JA 3C1YA 5L1JA 1OXJA 2G09A 2ATLA 2HBLA 4OO1J 2GOLA 4WOYA 2ZH8A 1T3NA 4KLUA 9ICLA 4QJFB 5AK4A 3IN5A 2HDOA 3NTUA 4DS4A 2D8CA 4ED6A 1Z1BA 2J6UA 1BPXA 3JPTA 7ICIA 2JEFA 4N7RA 4UB4A 1L3SA 2G0AA 4X4RA 1ZOLA 5KT7A 4F72A 4Y2UA 3AQLA 4ED0A 3H0RB 3RB4A 4JLXA 3AUOA 1UA1A 3H8MA 5IIIA 3HRDD 2DGZA 1NK6A 4ECZA 1JIHA 1TAQA 5IIKA 5CA7A 4DQRA 5KFJA 4RQ5A 4BJQA 3UMCA 3M9NB 2QKQA 4Y2QA 4WBYA 4YR0A 3F2DA 4LJXA 3L9DA 2JHDA 4X4QA 1UETA 8ICMA 3WFSC 2VJ5A 4KX3A 3RJJA 3ZDBA 2ZUBA 8ICZA 5J0XA 2W9CA 3OJSA 4YFKA 5ALYA 1DGJA 4OAGA 3SAHA 3H4DA 1WUDA 2KJ8A 1L6NA 5HHIA 3RTVA 4RWQA 3RRGA 4QZBA 4B9LA 9ICGA 3TI0A 5DDMA 3C2LA 4I2AA 2GLEA 3PSPA 4IRKA 5AIBA 5AKXA 2C28A 2LBOA 7ICVA 3SV3A 2E8PA 3IDWA 5AK6A 4I0UA 2KZ3A 4LZGA 3VCBA 4K98A 2MUTB 3RH4A 3M9OB 1XO1A 2DR7A 1PX5A 4IC9A 5EE0A 4MF2A 1TFWA 5J0RA 1MIYA 4NL9C 5ALLA 8ICXA 4ELUA 2Y1IA 1IG6A 3PO5A 4YMOA 2E1EA 3F2CA 1HUOA 3GQCA 2YMQA 1FFUA 4WC4A 4FHXA 5HR9A 3NRZA 2UVUA 3V6JA 3N4MB 3ICXA 5K4LA 3HT3A 2M9NA 1ZD5A 4PPXA 4ECYA 4RQ8A 1Z4NA 3GIJA 1S0OA 3WFQE 2ZHAA 4F4WA 4EV6A 4KLEA 4QWDA 3MGVA 4ZH4A 4KLGA 1JUDA 2MSNA 4QW9A 2WF6A 2HOIA 5TISU 5DLGA 4J9QA 3VC8A 1GPJA 5CR0A 5J0SA 4YCXA 2KG5A 2V4QA 4WC7A 4RUCA 3EUB2 4MKPA 2M2WA 4RWOA 4NXTA 2YN4A 2DVIA 4C4RA 3CK6A 5ALKA 1O03A 2ZIXA 1UA0A 2BCRA 4FHWA 4NLNA 5H2FU 3WK7A 5L1LA 3KFUF 3OUYB 1Z1VA 1KL9A 4JWMA 5DQHA 5DB8A 3C21A 2AGQA 3H3AA 4C4TA 4RQ0A 3NS1A 9ICPA 4TUSA 2KTQA 1NJYA 2HOFA 2F3NA 2LYAA 1LKYA 5J8YC 1BPYA 1QSYA 4RUAA 4NXVA 4O5EA 4XUSA 3BQ2A 5EOZA 2GH1A 3V7LA 2K8BB 4X4SA 1TVAA 2PMZF 4R8UB 2I5HA 1N60A 2LKYA 5D49A 3DDHA 4B9TA 3NWIA 3BS5A 4U6PA 3EW9A 4GC6A 4DL6A 3T5KA 3UMGA 2VA8A 2O6KA 5KFZA 2NRTA 4DQPA 4KMUA 1U47A 1D9FA 3MGIA 5AKGA 4RPXA 4I27A 4FHVA 1COOA 1N61A 5AM2A 1ZQRA 1NK0A 1Q78A 4I2HA 5AHXA 1KDHA 4F5OA 2RRDA 1N2XA 3WKBA 2QLTA 4FHYA 2BR0A 5J2GA 4DSFA 1ZQIA 1YZ7A 5KT2A 1JROA 1UT5A 2WB1F 2WFAA 5J2HA 4CGZA 4JV0A 2AXTU 1Q3VA 1P7DA 2KICA 4OD0A 2G06A 1X40A 1RZTA 4R64A 1B0XA 4F5QA 3OGUA 4X4UA 5DBAA 5J29A 3M1YA 4LT6A 5D62A 4EBJA 5KFIA 1U48A 2G5IB 1D8LA 1UCVA 2P66A 3QU2A 2XCAA 3FM9A 4QZHA 4G3IA 4M9GA 4IQUA 3PNCA 4PH5A 1T8EA 2ZH4A 4US9A 3ISCA 4RPYA 1QSSA 5KFQA 5ALVA 2K4EA 2WF8A 3MR3A 1ZQUA 3JPSA 3OVSA 1DGSA 1S5LU 2G08A 4RQMA 9ICUA 4R66A 3GV7B 1ZQLA 2N1RA 5KG3A 2ASJA 3T3FA 4LEYA 1NK9A 1WCLA 2PKEA 3SR6A 1RQLA 3OTQA 2BPGA 4WQLA 1PZNA 2OWOA 2PBEA 4O68A 2ESEA 4OAIZ 4BUGA 1Z00A 4I2GA 2FMQA 5AKYA 3H0MB 2K4IA 3F53A 2WAQF 1K1QA 2ID1A 2AH5A 3OPXA 8ICGA 3KZIU 1B43A 2NO4A 1YZ6A 3G6XA 3RB3A 1K1SA 9ICTA 4Y2PA 2C22A 2ZIWA 4KLFA 1V38A 4ECWA 5CP2A 5ALGA 4C8NA 4I2CA 2OCEA 2VKQA 3TANA 3M7DA 1JRPA 5AM0A 4NLBA 4ELTA 2KHVA 1FIQA 2DPIA 5KT4A 2ZJ8A 1J2NA 1ZQVA 5KFMA 1BVSA 5J2KA 5GTIU 2KFNA 4B9VA 4DQIA 1R8CA 4QWEA 1MQ3A 3EPGA 2JZBB 4EX6A 4PL2A 3NVZA 3C5GA 1EXNA 2RP5A 7ICTA 1IXRA 9ICQA 2KMDA 2P35A 5AK5A 4KMOB 9ICFA 3NVVA 3ISBA 3PW4A 1RG6A 1JAJA 1U49A 3QUTA 1BNOA 5CB1A 3PW7A 1RXWA 4F3OA 4RQNA 3OHBA 1TAMA 2G5HB 5T14A 3ZDAA 2K60A 4DOAA 4Y2SA 4EEKA 5ALWA 2DFLA 4DL4A 3UQ2A 4O69A 2KKPA 4P4OA 9ICNA 3OSPA 4F4XA 2P6UA 4BDPA 4WC0A 4RU9A 3BQ0A 3ZD9A 2PFNA 3C23A 4QIWF 4X4NA 2BCVA 1ZRMA 4X4TA 9ICIA 4ACOA 2EZXA 5F9LA 4DLGA 3SV4A 2E3TA 5AM4A 4J9NA 4PGXA 4ED1A 1ZQTA 4O3SA 4OJ6A 3RJEA 2F8LA 2NRWA 1ZQJA 1MIVA 2IUBA 3WK9A 3WKDA 1SKWA 5ALOA 2KIWA 5HP4A 3G6YA 4F93B 3T5JA 2C2RA 4OJ5A 4NM1A 2H3QA 4F50A 5DEDA 1QTMA 1ZQYA 2C2EA 1OU5A 4GFJA 4IL6U 2NO5A 5DBCA 3HILA 5B5EU 3OVBA 1TV9A 4EEDA 4MF8A 4UATA 1Q79A 1SKSA 2HCFA 2D3DA 1DK3A 1ZQKA 1UEVA 4ED7A 3ALRA 5KFCA 2H3VA 1MSWD 2MA1A 5EE9A 2DQNB 3TAPA 2Q0ZX 4P0PA 4DFKA 1ECWA 1Q46A 5JTIA 2ALZA 5D61A 3JPOA 5HRFA 3M8RA 3G6VA 4RWPA 3D2NA 1MIWA 5AKEA 2A1AA 4NLKA 5J0WA 3CNHA 1AQ6A 3DV9A 1VLBA 5KNIA 1WWUA 5KFUA 5KFBA 3QUQA 2KV2A 2HBJA 5AI8A 3V6KA 1RDFA 1AROP 2W7PA 5AM3A 1N62A 1BPZA 3OSNA 1ZQQA 5ALNA 3PMNA 5F9NA 5HRDA 2E1FA 5HREA 2IHNA 2VA2A 5KAIU 2ODGA 4PHEA 5GTHU 5KFDA 4C7ZA 9ICXA 2QARA 4BXOA 5CFSA 7ICLA 3K1ZA 5ALPA 2LYBA 5DDYA 4O5CA 1IM4A 4TQRA 2GA9D 5ALIA 3CW2C 3TADA 4ED8A 3PX0A 1QSLA 2UVVA 3Q8MA 4YMMA 4TQSA 2HMXA 5J0YA 1YLQA 5JUMA 3KTQA 2W3RA 4KLJA 3RB0A 2AQ4A 2ISPA 3HW8A 3ZDEA 1CEZA 4K99A 4UAYA 2PMZC 4XJEA 5D63A 4WCWA 5KAFU 3GILA 1WCNA 2HHXA 2CRXA 1COKA 5KFVA 3KHGA 8ICNA 2HHVA 5BOLA 3SZ2A 4X4VA 1KLNA 1BPDA 2YB1A 5J2CA 3WFPA 3T5HA 1PK1A 3H7IA 3PR4A 4GXIA 2HHUA 2YX8A 2ZTCA 4IR1A 2HN1A 3Q8KA 2XICA 4I2DA 4UB1A 4K4IA 4Y2VA 2IMWP 5DB9A 2EAOA 3LQCB 1BGXT 1ZQMA 4UB2A 4IRCA 1WYGA 2F1IA 4M6WA 3F5AA 4CRXA 4M6WB 3RJFA 3QNMA 3E2EA 2W9CB 2W11A 2KHQA 1OW5A 1Z4OA 2ZHBA 3RJKA 1O08A 3HX0A 2FDRA 2W9BA 4AYBC 4PHAA 2XGPA 2W9BB 4J9OA 4UASA 1KQQA 4IQTA 3MC1A 3AU6A 4QWAA 2LM1A 4E0DA 3SMVA 3CRXA 4IS7A 1PK3A 1KNYA 1KSPA 1ZQEA 4RWNA 7ICEA 2ISOA 5KFRA 2Y0SF 3N7PD 3AEVA 3K1RB 2JEIA 3ED5A 4I29A 1S10A 2LI6A 3ER9B 1NKBA 3FYHA 2KSOA 2FPLA 1CI4A 4EZ6A 4YMNA 4EEYA 3C28A 1ZQZA 4Q8EA 4BWJA 4DSIA 8ICBA 4J9LA 2DL0A 2PFQA 1S77D 1BNPA 2RHFA 5HRHA 1DK2A 2CXYA 5KFAA 1D8YA 4MHVA 4JLZA 2NRKA 4R65A 1XSNA 4MFAA 1A0PA 5HHHA 4JK1A 1ZQXA 5DQGA 5B3PA 3RH6A 3UXPA 2V4RA 2PXIA 3H8WA 3BDPA 5AM1A 3BQ7A 1Z3EB 4X0AA 4ECXA 1BPEA 4C8KA 1ZQOA 2P6RA 4UB8U 4ATBA 4K4GA 3JCFA 3WKEA 3IG5A 4QZIA 3Q8LA 3LWMA 2ZXIA 5KG5A 2HHWA 4DOBA 2E8MA 2KE7A 3RF9A 4Q45A 2ZIXB 4PZOA 2A1JA 3MR6A 7ICOA 5AI6A 3JPPA 1KEJA 2W3SA 1NJWA 8ICAA 2MAXA 1N56A 3IHQB 4M2YA 9ICOA 1S0VA 5CFUA 4KLDA 2EAMA 4F5PA 3PW2A 5DLFA 4KTQA 4GXJA 3TKAA 1X66A 4KLSA 5AKIA 1JX4A 4O6AA 2W04A 1V85A 3ERCC 1F44A 1SV0A 4Z6FA 2RDIA 2KZMA 3WK8A 1LKYB 2AU0A 4RQ2A 2XY7A 1UQVA 4UARA 1FO4A 5KG6A 4KLLA 4ELVA 3KBBA 2F1JA 1X42A 3BS5B 4QZ9A 2DR5A 5IIOA 3QYPA 2IOFK 4NKUA 4P0QA 3RRHA 3PSFA 5EWGA 2MRLA 1UPHA 2FPKA 4F91B 2JRZA 1XWLA 3SYZA 3PX4A 4DFJA 2BQUA 3PZPA 4DL3A 4ECSA 5AI5A 4AP9A 3SD7A 5EE1A 4NXXA 5DGAA 2UVWA 3F2BA 9ICEA 1SGGA 1XC9A 2W43A 3AQMA 3ONNA 3WK5A 1PVRA 4Y2YA 4KLTA 1UEUA 4QZ8A 1LB2B 1KRPA 4I2IA 3Q8RB 4WJ3B 4UQGA 2ZH7A 2DPJA 4FZLA 4F4KA 4XQ8A 4RT3A 4AT9A 4M5DA 1V4AA 2H5XA 2EH9A 1TK5A 1L3UA 2D6FC 2DR8A 3TADC 1IV8A 1U45A 2ZH5A 4EBKA 3UXNA 4EELA 4JV1A 2WHEA 3L4PA 5KFYA 3V72A 1Y88A 4DFDA 1ZXIA 1WWVA 4P4MA 4OJPA 3H39A 3N97B 1HJPA 8ICSA 4K4HA 4QWBA 4FH5A 2B0CA 2DF4B 4ECQA 3PX6A 1ZQHA 1NJXA 3I28A 2XI9A 2EWRA 1SZHA 2B56A 2LHTA 1CUKA 3BQTA 4O3MA 4C80A 4X0BA 5B66U 9ICKA 1X6IA 4TUQA 1DRGA 3D2SA 4JUZA 5DKWA 2H3FA 2XC9A 4JB3A 3HWTA 8ICLA 3MFIA 4OJLA 3IP4B 4EBCA 2ZJAA 1L7MA 2CN1A 4C7YA 5D4BA 1Z00B 5DB6A 2KNJA 5CRXA 1CRXA 5HRLA 1TK0A 7ICFA 2QB1A 1NI3A 4B9UA 4ECTA 5J2AA 4F5RA 4RQ6A 3RR7A 1X2IA 3A0HU 3KOOA 3H40A 1T7PA 2EZZA 2IOFA 3M9MB 2ZIWB 4IG8A 4FZNA 4NXZA 4K9AA 3D6JA 5F3XB 5J2JA 2YB4A 3WKCA 7ICQA 1L7NA 1NK8A 3ORYA 7ICUA 5J0UA 4JWNA 4KN7A 1ZQWA 5J0PA 5ALJA 4FS2A 2I9GA 4DF4A 5J2IA 5CHGA 4IR9A 2ZG6A 1ZD3A 2XY6A 1NK7A 3J81j 4QZDA 3O0FA 5ALZA 2KVCA 3K4GA 5J0QA 1FA0A 4WC6A 1ZYQA 2WF9A 8ICJA 1S0MA 4G9BA 3TACB 1NKEA 5DBBA 4RQ1A 5ALRA 1JQRA 2LM4A 1H38A 4O9MA 3LYSA 4NKTA 2QB0A 5AIAA 5HR6A 4U7CA 1L8LA 5JU5A 2XGQA 3H38A 2PI5A 1BPBA 4WBZA 2K4PA 3NKUA 5E79U 5AI4A 1IIPA 1S8OA 8ICCA 3AL0B 4AT8A 1PUZA 5AI9A 2W03A 2F1HA 4PJ0U 1KW4A 4PGQA 7ICHA 4PGYA 1JN3A 4RT2A 2ZTDA 2F44A 4CF3A 2YQEA 2ZH6A 5KT5A 4I2FA 4UAUA 3ZDCA 1JALA 4NXWA 2XY5A 2HSZA 4RQ3A 1R8BA 1VJ7A 4EEBA 4TURA 1XSLA 2DWQA 3GIKA 5F2VO 4K9BA 3BZKA 4ED3A 4C8OA 2W55A 9ICCA 3ZI4A 4CF4A 2O5AA 2KK0A 1XS9D 9ICSA 5HRIA 8ICFA 2PI4A 3FAHA 3ZD8A 1RPLA 4QNLA 5HC9A 2B6GA 4NLGA 4J9MA 5ALFA 1X9XA 2ZH3A 1L7OA 3GIMA 1A76A 2A19A 4YVZA 4CNQA 4DQQA 4DFMA 4PZNA 1SV0C 1DXSA 1F0MA 1NK4A 3E0FA 3NVWA 1MA7A 2J6TA 1K5OA 3GZFA 4M9JA 3C1ZA 2B51A 2M0NA 2BDUA 3UPSA 4HYKA 4UAVA 2YY6A 2F76X 3QXGA 4O0IA 2FMSA 3A0BU 3MR2A 1JMSA 4RPZA 1F5SA 2AQ0A 2BQ3A 1XU4A 5ALSA 4B9MA 1L8OA 2ZJ5A 8ICOA 1C7YA 4YQWA 1R89A 4ICAA 2R8KA 4Y2TA 2ZIVA 1J97A 5J0OA 2KIVA 2DKZA 3UQ0A 2KOBA 3RB6A 2RFFA 4AT7A 4YR2A 2FLPA 1SIJA 4UAZA 3IG8A 3WFOA 1S0NA 3NGDA 4RNOA 3ETLA 8ICEA 4P0PB 1RM6C 2WF7A 3I76A 1HUZA 2KD1A 3UXOA 5J8YA 4DSKA 1ZQ1C 4UBCA 3MDAA 5DG7A 4I2BA 4LEWA 5HRGA 3SI8A 5C0YA 5KFLA 5HNKA 3UMBA 3CP8A 3EZ5A 3KD3A 3V7KA 2CPRA 5KTQA 2Z7JA 5J0TA 5EWFA 2LMRA 4JMUA 4ZOHC 2FPMA 3NUQA 4DL5A 2BPFA 8ICYA 2XIDA 5JRTA 3TAQA 4GXKA 1LVHA 4OCZA 2R8JA 2BCUA 2YMMA 2VANA 1SL1A 2Y9UA 4LVSA 3B0XA 3N7SC 3GIIA 5KFEA 1ZQNA 4Y2XA 4M9LA 3EPIA 4FFDA 2JEGA 4KLOA 4EZ9A 2QARB 3AQFA 3HP6A 4BXOB 2JR5A 3HKZF 3HJ4A 3TARA 3HJ1A 1X6JA 3HJEA 2DKXA 3C18A 3KHHA 4GC7A 2K8AA 1XSPA 1YT3A 1Z19A 2ZUCA 2IHMA 4NV0A 4QZFA 5KFOA 4NJ8A 3PW5A 2H3IA 5KG0A 4MFCA 1B22A 5IINA 2W9MA 4FO1A 4YXMA 3OV7A 5ALTA 1QQ7A 4J9RA 4EBDA 2PFOA 1NZBA 1UT8A 3MABA 4FS1A 2R8HA 5AKLA 4O3RA 4RZRA 1XO0A 3U26A 1RYSA 2FLLA 1WG8A 4M47A 5D46A 3TFSA 5J2DA 1PK1B 4Y2RA 5DG8A 4EGWA 5TZVA 2KFZA 5HMLA 1D8BA 3C66A 3EYZA 3PO4A 4DSLA 3NVOA 2VA3A 3GFKB 1ZQAA 3EF2A 4MEXA 1NJZA 3JPQA 9ICHA 3QU5A 4EENA 2WB1C 4LZDA 9ICMA 3PHZA 3DEEA 4RQ4A 4KLHA 3MR5A 3L5KA 4XQ7A 1UHUA 1SB3C 1FFVA 3THVA 5AK3A 2XVTA 5J2BA 2EZYA 4UBBA 4A8EA 3RBDA 2ZH9A 2HVIA 4FH3A 4BX9C 4J03A 2OXOA 4M9NA 5IIMA 2GAFD 2DRAA 4F92B 4F5NA 4BWMA 4DWIA 2RLTA 4Z6CA 4RQ7A 3RAQA 4C8LA 5IIJA 3KZXA 3SENA 4PL1A 3MFHA 4P2HA 2KSOB 3AMZA 4Q44A 5CFTA 2BHNA 4YP3A 3LVVA 4F2SA 3B9JA 4B9SA 5KFNA 4DF8A 2BDPA 2MUTA 1RYUA 9ICWA 4C8MA 1L7PA 3N28A 1QQ5A 4X4OA 3OVAA 2KZZA 5DG9A 4J9KA 3QZ8A 4UD5A 3RJGA 1MN8A 4Q43A 3ISDA 3Q8QB 2GWSA 4QZAA 3LK9A 2ASDA 5DECA 2NV3A 1TAUA 3QU4A 4QWCA 3S6JA 1C20A 1SXEA 2WAQC 2YMLA 2K4HA 2F77X 1SWVA 2IA6A 3PSTA 1SZPA 1B4FA 1VJ5A 4PHDA 3LVWA 1PVQA 1S9FA 8ICKA 3EWAA 4OAHA 4QZEA 5L1IA 1TE2A 3QE9Y 1TFYA 4M9HA 1ZRNA 1M6YA 4KM5A 4EYHB 4ATBB 2KJ9A
chains in the Genus database with same CATH topology
4X4NA 1T3NA 4KLUA 2BCVA 9ICLA 1CUKA 4XRHA 4X4TA 9ICIA 3BQTA 1NO5A 2BGWA 4X0BA 5F9LA 4DLGA 3SV4A 9ICKA 3NTUA 4DS4A 2A1JB 4TUQA 4ED6A 2J6UA 1BPXA 5CJ7A 3PMLA 4JUZA 5DKWA 4PGXA 3JPTA 5L1KA 4J9NA 4ED1A 4WC3A 1ZQTA 4O3SA 7ICIA 2JEFA 2XC9A 1TK8A 3RJEA 4FO6A 3HWTA 4UB4A 8ICLA 4XA5A 2NRWA 1L3SA 4E8FA 3MFIA 5KFKA 3BJYA 1ZQJA 2IHMA 3IM1A 1ZQCA 7ICMA 4X4RA 4M0AA 4YD2A 1MIVA 4EBCA 4MFFA 4PHPA 2ZJAA 1L3VA 5KT7A 2I1QA 5D4BA 1Z00B 2UVRA 3H8SA 3AQLA 1SKWA 4ED0A 5DB6A 3PV8A 3RB4A 3AUOA 5HP4A 1UA1A 3Q8PB 3G6YA 5HRLA 1TK0A 7ICFA 5IIIA 1RXVA 3PR5B 4F93B 3T5JA 4ECTA 4B9UA 3OUYA 2C2RA 4WC2A 5J2AA 4DSJA 1ZQFA 1X9WA 4F5RA 1L3TA 2M2VA 4RQ6A 1NK6A 1X2IA 3RR7A 4NM1A 3H40A 4ECZA 7ICGA 4F50A 1T7PA 5DEDA 1QTMA 1ZQYA 4S3NA 3M9MB 4DSEA 1JIHA 1TAQA 5IIKA 3V7JA 4IG8A 1S97A 4NXZA 5CA7A 5KFJA 4DQRA 2C2EA 4J9PA 4RQ5A 1OU5A 5J2JA 3M9NB 4WBYA 5DBCA 4YR0A 3GV5B 5KG1A 7ICQA 3OVBA 1ZQBA 3L9DA 1TV9A 4X4QA 1UETA 8ICMA 3WFSC 1NK8A 3ORYA 4MF8A 2W9AA 3RJJA 7ICUA 1Q79A 3ZDBA 1SKSA 5J0UA 2ZUBA 4JWNA 8ICZA 5J0XA 4KN7A 1ZQWA 2KN7A 5J0PA 4FS2A 1ZQKA 2I9GA 2W9CA 1DK3A 3OJSA 1ZQGA 4YFKA 4DQSA 4DOCA 4ED7A 1UEVA 1V9PA 4DF4A 5KFCA 5J2IA 4R8UA 5CHGA 4IR9A 1MSWD 3H4DA 1NK7A 2XY6A 4NM2A 5HHIA 3RTVA 4QZDA 3UPQA 3RJIA 4RWQA 3RRGA 4QZBA 5L9XA 4B9LA 9ICGA 3K4GA 3TI0A 5DDMA 5J0QA 3C2LA 4QZGA 4I2AA 2V9WA 1FA0A 1ZJNA 4WC6A 1ZYQA 3TAPA 2Q0ZX 3RH5A 8ICJA 4DFKA 1S0MA 3LWLA 4IRKA 2ALZA 2C28A 5KFSA 3JPOA 7ICVA 3SV3A 1NKEA 3M8RA 5DBBA 5HRFA 3G6VA 4FBUA 4RQ1A 4Q8FA 4EP7A 4RWPA 2KZ3A 1JQRA 4ECRA 4LZGA 1H38A 4F8RA 4O9MA 2AJQA 4NKTA 2MUTB 3AQNA 1MIWA 3RH4A 3M9OB 1XO1A 2PFPA 1PX5A 2DR7A 2XGQA 3H38A 4NLKA 4BGDA 3MBYA 5J0WA 1BPBA 2PI5A 4MF2A 8ICTA 1TFWA 4M04A 5KFBA 5KFUA 3JPNA 4WBZA 4DEZA 3PVXA 5J0RA 2BCSA 1MIYA 4ECVA 1L5UA 4QZCA 3V6KA 1NKCA 8ICXA 3FDSA 1AROP 4ELUA 2Y1IA 8ICCA 4O3NA 5KG7A 2AGPA 3PO5A 4YMOA 3C2KA 4UD4A 4AT9B 4AT8A 1VFGA 1BPZA 5KFHA 3OSNA 3PW0A 2F1HA 1HUOA 3GQCA 1ZQQA 3PMNA 4WC4A 4PGQA 4FHXA 7ICHA 5HR9A 5F9NA 5HRDA 2UVUA 5HREA 2IHNA 1KFSA 4DL7A 3V6JA 4PGYA 1JN3A 4RT2A 2ZTDA 2VA2A 2KP7A 3N4MB 2C2DA 3HT3A 3HIYA 5CWRA 4PHEA 3GDXA 2M9NA 2ZH6A 5KT5A 4I2FA 5KFDA 3ZDCA 8ICUA 1JXEA 4PPXA 4ECYA 2XY5A 9ICXA 4YN4A 4RQ8A 3GIJA 1S0OA 4RQ3A 3WFQE 4BXOA 4Z6EA 9ICVA 2XCPA 3HPOA 1R8BA 7ICLA 4F4WA 2ZHAA 3H4BA 1VJ7A 5DDYA 4O5CA 1IM4A 4TQRA 4TURA 1XSLA 1NK5A 4ED8A 3PX0A 1QSLA 2HHQA 4E7XA 2UVVA 2HHSA 3Q8MA 4QWDA 4KLEA 3GIKA 4ZH4A 4YMMA 4F4ZA 4KLGA 7ICKA 5F2VO 4ED3A 3QEAZ 4C8OA 1R8AA 4QW9A 4TQSA 9ICCA 5J0YA 1YLQA 1U9LA 5DLGA 5JUMA 5KFTA 4J9QA 2R8GA 3KTQA 3RB0A 2AQ4A 5CR0A 1XS9D 2ISPA 5J0SA 3HW8A 1MQ2A 2HHTA 4YCXA 9ICSA 2DRBA 3ZDEA 1CEZA 8ICFA 5HRIA 2PI4A 4UAYA 3ZD8A 3RR8A 2V4QA 4WC7A 4RUCA 4WCWA 1RPLA 3GILA 1T4GA 2J6SA 9ICAA 4M9GA 5HC9A 2M2WA 4RWOA 1WCNA 2HHXA 4NLGA 1QLNA 2DVIA 2LYHA 3RAXA 4J9MA 5KFVA 3WFOA 2W8LA 4Z6DA 2ZH3A 4IQVA 4O3OA 3KHGA 1UA0A 3GIMA 2BCRA 1A76A 8ICNA 5DQIA 4YVZA 4DQQA 4NLNA 2HHVA 4FHWA 4DFMA 5BOLA 3SZ2A 4X4VA 1KLNA 1BPDA 8ICHA 1NK4A 5J2CA 3WFPA 4QW8A 3T5HA 5L1LA 3H7IA 3PR4A 4GXIA 2J6TA 3OUYB 4M9JA 2HHUA 2ZTCA 4IR1A 2KZZA 3C1ZA 5DQHA 4JWMA 4IRDA 5DB8A 2O1PA 3C21A 4I2JA 2AGQA 3Q8KA 3H3AA 1TFYA 3UPSA 4I2DA 4ECUA 4DFPA 4HYKA 4UB1A 5J2EA 4K4IA 1KTQA 4RQ0A 4F2RA 4O0IA 4TUSA 2IMWP 2FMSA 5DB9A 9ICPA 3LQCB 1SL0A 2KTQA 3MR2A 1JMSA 4RPZA 1BGXT 1NJYA 1ZQMA 2AQ0A 2BQ3A 1XU4A 4B9MA 4UB2A 5HRKA 2ZJ5A 8ICOA 1C7YA 4YQWA 4IRCA 1R89A 8ICQA 2R8KA 2F1IA 4M6WA 1BPYA 2BCQA 1KFDA 1QSYA 3T5LA 4M6WB 4RUAA 1ZQDA 3RJFA 4O5EA 3E2EA 2W9CB 8ICVA 4XUSA 3BQ2A 4WC1A 5EOZA 2ZUDA 3V7LA 2NRVA 4X4SA 5J0OA 4YD1A 1TVAA 4R8UB 4KITB 2ZHBA 3RJKA 3UQ0A 5D49A 3OHAA 3RB6A 2BE3A 4B9TA 3HX0A 4YR2A 4DL2A 2W9BA 2FLPA 3EW9A 4UAZA 2RFFA 4AT7A 4GC6A 4PHAA 3B0YA 4DL6A 2XGPA 2W9BB 3T5KA 4J9OA 1S0NA 4KLQA 4UAWA 2VA8A 4RNOA 5KFZA 3NGDA 3M8SA 3ETLA 8ICEA 4IQTA 2NRTA 3PY8A 4DQPA 4KMUA 3AU6A 1U47A 1D9FA 1HUZA 4QWAA 3MGIA 4E0DA 4RPXA 3H8JA 2BPCA 3UXOA 4I27A 4DSKA 4FHVA 1KNYA 1COOA 5KT3A 1KSPA 1ZQEA 1DOQA 4UBCA 1RYRA 4RWNA 4RNMA 3MDAA 2ISOA 7ICEA 5KFRA 5DG7A 4I2BA 4R63A 3SI8A 1NK0A 5KFLA 5HNKA 1ZQRA 5HRGA 2JEIA 1Q78A 4I2HA 3EZ5A 4I29A 3V7KA 1KDHA 5KTQA 4F5OA 3QEBZ 1S10A 3JPRA 4FHYA 2BR0A 2JZBA 3FYHA 1NKBA 5J0TA 4NY8A 5J2GA 2FPLA 5EWFA 4DSFA 1X9SA 1ZQIA 4EZ6A 4KLIA 2FPMA 4DL5A 4NLZA 4EYIB 5KT2A 4YMNA 2BPFA 3TAQA 8ICYA 4AT8B 4GXKA 4EEYA 2AGOA 7ICJA 1UT5A 1ZQZA 3KHLA 5HMMA 4Q8EA 4BWJA 3JYYA 2Y1JA 4DSIA 8ICBA 2R8JA 2BCUA 5J2HA 4J9LA 2VANA 2ASLA 1SL1A 2JEJA 4DO9A 2PFQA 4LVSA 1S77D 4JV0A 1BNPA 3TFRA 3B0XA 4UB5A 3H37A 5HRHA 9ICRA 1DK2A 3GIIA 3LDAA 3KHRA 4JV2A 5KFAA 5KFEA 1ZQNA 1D8YA 2HVHA 4WC5A 4M9LA 2NRKA 3EPIA 2M2TA 2JEGA 4KLOA 1RZTA 4R64A 4EZ9A 3HP6A 2B21A 4R65A 3OGUA 4F5QA 4BXOB 4X4UA 5DBAA 5J29A 4LT6A 1XSNA 4EBJA 3MDCA 5KFIA 4MFAA 1D9DA 3HJ4A 1U48A 3TARA 5HHHA 3HJ1A 4JK1A 1ZQXA 5DQGA 2NRXA 3RH6A 3UXPA 2V4RA 3C18A 1D8LA 3KHHA 3H8WA 2PXIA 4GC7A 3BDPA 2P66A 1XSPA 3QZ7A 8ICRA 2XCAA 1Z3EB 4QZHA 4G3IA 1A77A 4KN4A 4DLEA 4X0AA 2W8KA 2ZUCA 4ECXA 4IQUA 3PNCA 3RBEA 4PH5A 4QZFA 1BPEA 3Q8SB 3BQ1A 5KFOA 1T8EA 4B9NA 3PW5A 5KG0A 1ZQOA 1ZQSA 1ZQPA 2P6RA 5IINA 2W9MA 5DB7A 3ISCA 1N48A 4RPYA 4MFCA 4TUPA 4ATBA 4K4GA 4YXMA 1QSSA 3OV7A 4J9RA 5KFQA 4QZIA 4FBTA 4EBDA 2PFOA 4YG2A 3Q8LA 3LWMA 5KG5A 2HHWA 1UT8A 3MR3A 2O5AA 1ZQUA 3MABA 3JPSA 4FS1A 2R8HA 3K75D 1U4BA 1ZQHA 3OVSA 4DOBA 1DGSA 4Q45A 4RZRA 4O3RA 1RYSA 2ZTEA 2A1JA 2FLLA 5BOMA 9ICUA 3MR6A 7ICOA 7ICSA 4R66A 3JPPA 3GV7B 5J2FA 1KEJA 1ZQLA 4I2EA 4M47A 5D46A 5KG3A 2ASJA 3T3FA 1NJWA 4IQWA 3TFSA 2MAXA 1N56A 4GLXA 8ICAA 9ICBA 5J2DA 1NK9A 1WCLA 3IHQB 5DG8A 5KG4A 4M2YA 2BPGA 9ICOA 5TZVA 1PZNA 2OWOA 5HMLA 1S0VA 4O3PA 2HW3A 2KFZA 2PBEA 3C66A 7ICNA 1X9MA 4J9SA 2HHPA 3EYZA 3PO4A 4DSLA 3OJUA 4KLDA 1S76D 4F5PA 3PW2A 5DLFA 4KTQA 1Z00A 4GXJA 4I2GA 5KFFA 2VA3A 3GFKB 2FMQA 4KLSA 1TFRA 1ZQAA 2ZH2A 4X5VA 3ZDDA 2WTFA 1JX4A 3WFRE 2R8IA 4MEXA 1TKDA 2ZH1A 1NJZA 4KLMA 1K1QA 3JPQA 2ID1A 9ICHA 5DGBA 4Z6FA 2RDIA 8ICGA 4RNNA 4LZDA 2KZMA 1B43A 9ICMA 4KLHA 4RQ4A 2AU0A 4I28A 4RQ2A 4YR3A 3MR5A 1K1SA 3G6XA 3RB3A 1LV5A 9ICTA 2XY7A 2C22A 5KFPA 4XQ7A 5KFXA 4KLFA 5KG6A 2XO7A 4ECWA 3RJHA 4KLLA 3THVA 5CP2A 4ELVA 3TQ1A 2F1JA 4C8NA 2NRZA 4I2CA 5J2BA 5HRBA 5C5JA 4UBBA 4MEYA 8ICWA 3RBDA 1NOMA 4AT7B 2ZH9A 2HVIA 3C2MA 3TANA 1WOTA 4FH3A 4QZ9A 2DR5A 5IIOA 5KFWA 4NKUA 4ELTA 5KT6A 3RRHA 5EWGA 2DPIA 2FPKA 2IBKA 4CCHA 4M9NA 4YXJA 4F91B 5KT4A 4P4PA 1XWLA 3AQKA 2ZJ8A 5IIMA 2M2UA 3SYZA 3PX4A 1ZQVA 5KFMA 4DFJA 2DRAA 4F92B 3MGHA 2BKEA 4F5NA 2BQUA 1BVSA 4DL3A 4BWMA 4DWIA 4ECSA 4Z6CA 5J2KA 7ICPA 4RQ7A 2KFNA 4B9VA 4DQIA 1R8CA 4QWEA 3RAQA 1MQ3A 3C5FA 3EPGA 5IIJA 4C8LA 4FHPA 3MFHA 4DS5A 5DGAA 2JZBB 4P2HA 2UVWA 4Q44A 4O5KA 1NZPA 3C5GA 2BHNA 1EXNA 4YP3A 4F2SA 4B9SA 9ICEA 2Q66A 5KFNA 4DF8A 7ICTA 2BDPA 1IXRA 1XC9A 9ICQA 2MUTA 3AQMA 5IILA 9ICWA 5KG2A 4KLTA 9ICFA 1UEUA 5BPCA 4QZ8A 3ISBA 4C8MA 2ZH4A 3PW4A 1ZJMA 1LB2B 4O3QA 1KRPA 3AU2A 4I2IA 8ICIA 4X4OA 9ICJA 1JAJA 3OVAA 1U49A 3Q8RB 5DG9A 4KLJA 4UQGA 4J9KA 2BQRA 2DPJA 5CB1A 4F4KA 1BNOA 4C8KA 2FMPA 2ZH7A 3PW7A 5EWEA 3QZ8A 3V6HA 4UD5A 3RJGA 1JXLA 4Q43A 8ICPA 1KFTA 4XQ8A 4RT3A 1RXWA 3ISDA 4F3OA 3Q8QB 2GWSA 5KFGA 7ICRA 3OHBA 4QZAA 4M5DA 1V4AA 4AT9A 3LK9A 2H5XA 2ASDA 5DECA 1TK5A 1TAUA 1SL2A 1L3UA 3ZDAA 1F5AA 4QWCA 2DR8A 3JZ0A 4DOAA 1U45A 4ED2A 4EBKA 1SKRA 2ZH5A 2IA6A 1SZPA 3UXNA 4JV1A 3GV8B 1B22A 2DFLA 4PHDA 5KFYA 3V72A 3NYBA 4E80A 1Y88A 4EBEA 2RDJA 4DL4A 2FLNA 1S9FA 3UQ2A 1ZETA 4X4PA 2DR9A 4P4MA 4P4OA 4UB3A 1MC8A 3H39A 8ICKA 4F4YA 9ICNA 3EWAA 3N97B 1HJPA 4QZEA 5L1IA 2P6UA 4F4XA 4QWBA 3QE9Y 3OSPA 4BDPA 4K4HA 4M9HA 8ICSA 4ECQA 4FH5A 4WC0A 3C1YA 4RU9A 3BQ0A 5L1JA 3ZD9A 2ATLA 3C23A 2PFNA 4EYHB 3PX6A 1NJXA 4ATBB 2ZH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4N A;  1T3N A;  4KLU A;  2BCV A;  9ICL A;  1CUK A;  4XRH A;  4X4T A;  9ICI A;  3BQT A;  1NO5 A;  2BGW A;  4X0B A;  5F9L A;  4DLG A;  3SV4 A;  9ICK A;  3NTU A;  4DS4 A;  2A1J B;  4TUQ A;  4ED6 A;  2J6U A;  1BPX A;  5CJ7 A;  3PML A;  4JUZ A;  5DKW A;  4PGX A;  3JPT A;  5L1K A;  4J9N A;  4ED1 A;  4WC3 A;  1ZQT A;  4O3S A;  7ICI A;  2JEF A;  2XC9 A;  1TK8 A;  3RJE A;  4FO6 A;  3HWT A;  4UB4 A;  8ICL A;  4XA5 A;  2NRW A;  1L3S A;  4E8F A;  3MFI A;  5KFK A;  3BJY A;  1ZQJ A;  2IHM A;  3IM1 A;  1ZQC A;  7ICM A;  4X4R A;  4M0A A;  4YD2 A;  1MIV A;  4EBC A;  4MFF A;  4PHP A;  2ZJA A;  1L3V A;  5KT7 A;  2I1Q A;  5D4B A;  1Z00 B;  2UVR A;  3H8S A;  3AQL A;  1SKW A;  4ED0 A;  5DB6 A;  3PV8 A;  3RB4 A;  3AUO A;  5HP4 A;  1UA1 A;  3Q8P B;  3G6Y A;  5HRL A;  1TK0 A;  7ICF A;  5III A;  1RXV A;  3PR5 B;  4F93 B;  3T5J A;  4ECT A;  4B9U A;  3OUY A;  2C2R A;  4WC2 A;  5J2A A;  4DSJ A;  1ZQF A;  1X9W A;  4F5R A;  1L3T A;  2M2V A;  4RQ6 A;  1NK6 A;  1X2I A;  3RR7 A;  4NM1 A;  3H40 A;  4ECZ A;  7ICG A;  4F50 A;  1T7P A;  5DED A;  1QTM A;  1ZQY A;  4S3N A;  3M9M B;  4DSE A;  1JIH A;  1TAQ A;  5IIK A;  3V7J A;  4IG8 A;  1S97 A;  4NXZ A;  5CA7 A;  5KFJ A;  4DQR A;  2C2E A;  4J9P A;  4RQ5 A;  1OU5 A;  5J2J A;  3M9N B;  4WBY A;  5DBC A;  4YR0 A;  3GV5 B;  5KG1 A;  7ICQ A;  3OVB A;  1ZQB A;  3L9D A;  1TV9 A;  4X4Q A;  1UET A;  8ICM A;  3WFS C;  1NK8 A;  3ORY A;  4MF8 A;  2W9A A;  3RJJ A;  7ICU A;  1Q79 A;  3ZDB A;  1SKS A;  5J0U A;  2ZUB A;  4JWN A;  8ICZ A;  5J0X A;  4KN7 A;  1ZQW A;  2KN7 A;  5J0P A;  4FS2 A;  1ZQK A;  2I9G A;  2W9C A;  1DK3 A;  3OJS A;  1ZQG A;  4YFK A;  4DQS A;  4DOC A;  4ED7 A;  1UEV A;  1V9P A;  4DF4 A;  5KFC A;  5J2I A;  4R8U A;  5CHG A;  4IR9 A;  1MSW D;  3H4D A;  1NK7 A;  2XY6 A;  4NM2 A;  5HHI A;  3RTV A;  4QZD A;  3UPQ A;  3RJI A;  4RWQ A;  3RRG A;  4QZB A;  5L9X A;  4B9L A;  9ICG A;  3K4G A;  3TI0 A;  5DDM A;  5J0Q A;  3C2L A;  4QZG A;  4I2A A;  2V9W A;  1FA0 A;  1ZJN A;  4WC6 A;  1ZYQ A;  3TAP A;  2Q0Z X;  3RH5 A;  8ICJ A;  4DFK A;  1S0M A;  3LWL A;  4IRK A;  2ALZ A;  2C28 A;  5KFS A;  3JPO A;  7ICV A;  3SV3 A;  1NKE A;  3M8R A;  5DBB A;  5HRF A;  3G6V A;  4FBU A;  4RQ1 A;  4Q8F A;  4EP7 A;  4RWP A;  2KZ3 A;  1JQR A;  4ECR A;  4LZG A;  1H38 A;  4F8R A;  4O9M A;  2AJQ A;  4NKT A;  2MUT B;  3AQN A;  1MIW A;  3RH4 A;  3M9O B;  1XO1 A;  2PFP A;  1PX5 A;  2DR7 A;  2XGQ A;  3H38 A;  4NLK A;  4BGD A;  3MBY A;  5J0W A;  1BPB A;  2PI5 A;  4MF2 A;  8ICT A;  1TFW A;  4M04 A;  5KFB A;  5KFU A;  3JPN A;  4WBZ A;  4DEZ A;  3PVX A;  5J0R A;  2BCS A;  1MIY A;  4ECV A;  1L5U A;  4QZC A;  3V6K A;  1NKC A;  8ICX A;  3FDS A;  1ARO P;  4ELU A;  2Y1I A;  8ICC A;  4O3N A;  5KG7 A;  2AGP A;  3PO5 A;  4YMO A;  3C2K A;  4UD4 A;  4AT9 B;  4AT8 A;  1VFG A;  1BPZ A;  5KFH A;  3OSN A;  3PW0 A;  2F1H A;  1HUO A;  3GQC A;  1ZQQ A;  3PMN A;  4WC4 A;  4PGQ A;  4FHX A;  7ICH A;  5HR9 A;  5F9N A;  5HRD A;  2UVU A;  5HRE A;  2IHN A;  1KFS A;  4DL7 A;  3V6J A;  4PGY A;  1JN3 A;  4RT2 A;  2ZTD A;  2VA2 A;  2KP7 A;  3N4M B;  2C2D A;  3HT3 A;  3HIY A;  5CWR A;  4PHE A;  3GDX A;  2M9N A;  2ZH6 A;  5KT5 A;  4I2F A;  5KFD A;  3ZDC A;  8ICU A;  1JXE A;  4PPX A;  4ECY A;  2XY5 A;  9ICX A;  4YN4 A;  4RQ8 A;  3GIJ A;  1S0O A;  4RQ3 A;  3WFQ E;  4BXO A;  4Z6E A;  9ICV A;  2XCP A;  3HPO A;  1R8B A;  7ICL A;  4F4W A;  2ZHA A;  3H4B A;  1VJ7 A;  5DDY A;  4O5C A;  1IM4 A;  4TQR A;  4TUR A;  1XSL A;  1NK5 A;  4ED8 A;  3PX0 A;  1QSL A;  2HHQ A;  4E7X A;  2UVV A;  2HHS A;  3Q8M A;  4QWD A;  4KLE A;  3GIK A;  4ZH4 A;  4YMM A;  4F4Z A;  4KLG A;  7ICK A;  5F2V O;  4ED3 A;  3QEA Z;  4C8O A;  1R8A A;  4QW9 A;  4TQS A;  9ICC A;  5J0Y A;  1YLQ A;  1U9L A;  5DLG A;  5JUM A;  5KFT A;  4J9Q A;  2R8G A;  3KTQ A;  3RB0 A;  2AQ4 A;  5CR0 A;  1XS9 D;  2ISP A;  5J0S A;  3HW8 A;  1MQ2 A;  2HHT A;  4YCX A;  9ICS A;  2DRB A;  3ZDE A;  1CEZ A;  8ICF A;  5HRI A;  2PI4 A;  4UAY A;  3ZD8 A;  3RR8 A;  2V4Q A;  4WC7 A;  4RUC A;  4WCW A;  1RPL A;  3GIL A;  1T4G A;  2J6S A;  9ICA A;  4M9G A;  5HC9 A;  2M2W A;  4RWO A;  1WCN A;  2HHX A;  4NLG A;  1QLN A;  2DVI A;  2LYH A;  3RAX A;  4J9M A;  5KFV A;  3WFO A;  2W8L A;  4Z6D A;  2ZH3 A;  4IQV A;  4O3O A;  3KHG A;  1UA0 A;  3GIM A;  2BCR A;  1A76 A;  8ICN A;  5DQI A;  4YVZ A;  4DQQ A;  4NLN A;  2HHV A;  4FHW A;  4DFM A;  5BOL A;  3SZ2 A;  4X4V A;  1KLN A;  1BPD A;  8ICH A;  1NK4 A;  5J2C A;  3WFP A;  4QW8 A;  3T5H A;  5L1L A;  3H7I A;  3PR4 A;  4GXI A;  2J6T A;  3OUY B;  4M9J A;  2HHU A;  2ZTC A;  4IR1 A;  2KZZ A;  3C1Z A;  5DQH A;  4JWM A;  4IRD A;  5DB8 A;  2O1P A;  3C21 A;  4I2J A;  2AGQ A;  3Q8K A;  3H3A A;  1TFY A;  3UPS A;  4I2D A;  4ECU A;  4DFP A;  4HYK A;  4UB1 A;  5J2E A;  4K4I A;  1KTQ A;  4RQ0 A;  4F2R A;  4O0I A;  4TUS A;  2IMW P;  2FMS A;  5DB9 A;  9ICP A;  3LQC B;  1SL0 A;  2KTQ A;  3MR2 A;  1JMS A;  4RPZ A;  1BGX T;  1NJY A;  1ZQM A;  2AQ0 A;  2BQ3 A;  1XU4 A;  4B9M A;  4UB2 A;  5HRK A;  2ZJ5 A;  8ICO A;  1C7Y A;  4YQW A;  4IRC A;  1R89 A;  8ICQ A;  2R8K A;  2F1I A;  4M6W A;  1BPY A;  2BCQ A;  1KFD A;  1QSY A;  3T5L A;  4M6W B;  4RUA A;  1ZQD A;  3RJF A;  4O5E A;  3E2E A;  2W9C B;  8ICV A;  4XUS A;  3BQ2 A;  4WC1 A;  5EOZ A;  2ZUD A;  3V7L A;  2NRV A;  4X4S A;  5J0O A;  4YD1 A;  1TVA A;  4R8U B;  4KIT B;  2ZHB A;  3RJK A;  3UQ0 A;  5D49 A;  3OHA A;  3RB6 A;  2BE3 A;  4B9T A;  3HX0 A;  4YR2 A;  4DL2 A;  2W9B A;  2FLP A;  3EW9 A;  4UAZ A;  2RFF A;  4AT7 A;  4GC6 A;  4PHA A;  3B0Y A;  4DL6 A;  2XGP A;  2W9B B;  3T5K A;  4J9O A;  1S0N A;  4KLQ A;  4UAW A;  2VA8 A;  4RNO A;  5KFZ A;  3NGD A;  3M8S A;  3ETL A;  8ICE A;  4IQT A;  2NRT A;  3PY8 A;  4DQP A;  4KMU A;  3AU6 A;  1U47 A;  1D9F A;  1HUZ A;  4QWA A;  3MGI A;  4E0D A;  4RPX A;  3H8J A;  2BPC A;  3UXO A;  4I27 A;  4DSK A;  4FHV A;  1KNY A;  1COO A;  5KT3 A;  1KSP A;  1ZQE A;  1DOQ A;  4UBC A;  1RYR A;  4RWN A;  4RNM A;  3MDA A;  2ISO A;  7ICE A;  5KFR A;  5DG7 A;  4I2B A;  4R63 A;  3SI8 A;  1NK0 A;  5KFL A;  5HNK A;  1ZQR A;  5HRG A;  2JEI A;  1Q78 A;  4I2H A;  3EZ5 A;  4I29 A;  3V7K A;  1KDH A;  5KTQ A;  4F5O A;  3QEB Z;  1S10 A;  3JPR A;  4FHY A;  2BR0 A;  2JZB A;  3FYH A;  1NKB A;  5J0T A;  4NY8 A;  5J2G A;  2FPL A;  5EWF A;  4DSF A;  1X9S A;  1ZQI A;  4EZ6 A;  4KLI A;  2FPM A;  4DL5 A;  4NLZ A;  4EYI B;  5KT2 A;  4YMN A;  2BPF A;  3TAQ A;  8ICY A;  4AT8 B;  4GXK A;  4EEY A;  2AGO A;  7ICJ A;  1UT5 A;  1ZQZ A;  3KHL A;  5HMM A;  4Q8E A;  4BWJ A;  3JYY A;  2Y1J A;  4DSI A;  8ICB A;  2R8J A;  2BCU A;  5J2H A;  4J9L A;  2VAN A;  2ASL A;  1SL1 A;  2JEJ A;  4DO9 A;  2PFQ A;  4LVS A;  1S77 D;  4JV0 A;  1BNP A;  3TFR A;  3B0X A;  4UB5 A;  3H37 A;  5HRH A;  9ICR A;  1DK2 A;  3GII A;  3LDA A;  3KHR A;  4JV2 A;  5KFA A;  5KFE A;  1ZQN A;  1D8Y A;  2HVH A;  4WC5 A;  4M9L A;  2NRK A;  3EPI A;  2M2T A;  2JEG A;  4KLO A;  1RZT A;  4R64 A;  4EZ9 A;  3HP6 A;  2B21 A;  4R65 A;  3OGU A;  4F5Q A;  4BXO B;  4X4U A;  5DBA A;  5J29 A;  4LT6 A;  1XSN A;  4EBJ A;  3MDC A;  5KFI A;  4MFA A;  1D9D A;  3HJ4 A;  1U48 A;  3TAR A;  5HHH A;  3HJ1 A;  4JK1 A;  1ZQX A;  5DQG A;  2NRX A;  3RH6 A;  3UXP A;  2V4R A;  3C18 A;  1D8L A;  3KHH A;  3H8W A;  2PXI A;  4GC7 A;  3BDP A;  2P66 A;  1XSP A;  3QZ7 A;  8ICR A;  2XCA A;  1Z3E B;  4QZH A;  4G3I A;  1A77 A;  4KN4 A;  4DLE A;  4X0A A;  2W8K A;  2ZUC A;  4ECX A;  4IQU A;  3PNC A;  3RBE A;  4PH5 A;  4QZF A;  1BPE A;  3Q8S B;  3BQ1 A;  5KFO A;  1T8E A;  4B9N A;  3PW5 A;  5KG0 A;  1ZQO A;  1ZQS A;  1ZQP A;  2P6R A;  5IIN A;  2W9M A;  5DB7 A;  3ISC A;  1N48 A;  4RPY A;  4MFC A;  4TUP A;  4ATB A;  4K4G A;  4YXM A;  1QSS A;  3OV7 A;  4J9R A;  5KFQ A;  4QZI A;  4FBT A;  4EBD A;  2PFO A;  4YG2 A;  3Q8L A;  3LWM A;  5KG5 A;  2HHW A;  1UT8 A;  3MR3 A;  2O5A A;  1ZQU A;  3MAB A;  3JPS A;  4FS1 A;  2R8H A;  3K75 D;  1U4B A;  1ZQH A;  3OVS A;  4DOB A;  1DGS A;  4Q45 A;  4RZR A;  4O3R A;  1RYS A;  2ZTE A;  2A1J A;  2FLL A;  5BOM A;  9ICU A;  3MR6 A;  7ICO A;  7ICS A;  4R66 A;  3JPP A;  3GV7 B;  5J2F A;  1KEJ A;  1ZQL A;  4I2E A;  4M47 A;  5D46 A;  5KG3 A;  2ASJ A;  3T3F A;  1NJW A;  4IQW A;  3TFS A;  2MAX A;  1N56 A;  4GLX A;  8ICA A;  9ICB A;  5J2D A;  1NK9 A;  1WCL A;  3IHQ B;  5DG8 A;  5KG4 A;  4M2Y A;  2BPG A;  9ICO A;  5TZV A;  1PZN A;  2OWO A;  5HML A;  1S0V A;  4O3P A;  2HW3 A;  2KFZ A;  2PBE A;  3C66 A;  7ICN A;  1X9M A;  4J9S A;  2HHP A;  3EYZ A;  3PO4 A;  4DSL A;  3OJU A;  4KLD A;  1S76 D;  4F5P A;  3PW2 A;  5DLF A;  4KTQ A;  1Z00 A;  4GXJ A;  4I2G A;  5KFF A;  2VA3 A;  3GFK B;  2FMQ A;  4KLS A;  1TFR A;  1ZQA A;  2ZH2 A;  4X5V A;  3ZDD A;  2WTF A;  1JX4 A;  3WFR E;  2R8I A;  4MEX A;  1TKD A;  2ZH1 A;  1NJZ A;  4KLM A;  1K1Q A;  3JPQ A;  2ID1 A;  9ICH A;  5DGB A;  4Z6F A;  2RDI A;  8ICG A;  4RNN A;  4LZD A;  2KZM A;  1B43 A;  9ICM A;  4KLH A;  4RQ4 A;  2AU0 A;  4I28 A;  4RQ2 A;  4YR3 A;  3MR5 A;  1K1S A;  3G6X A;  3RB3 A;  1LV5 A;  9ICT A;  2XY7 A;  2C22 A;  5KFP A;  4XQ7 A;  5KFX A;  4KLF A;  5KG6 A;  2XO7 A;  4ECW A;  3RJH A;  4KLL A;  3THV A;  5CP2 A;  4ELV A;  3TQ1 A;  2F1J A;  4C8N A;  2NRZ A;  4I2C A;  5J2B A;  5HRB A;  5C5J A;  4UBB A;  4MEY A;  8ICW A;  3RBD A;  1NOM A;  4AT7 B;  2ZH9 A;  2HVI A;  3C2M A;  3TAN A;  1WOT A;  4FH3 A;  4QZ9 A;  2DR5 A;  5IIO A;  5KFW A;  4NKU A;  4ELT A;  5KT6 A;  3RRH A;  5EWG A;  2DPI A;  2FPK A;  2IBK A;  4CCH A;  4M9N A;  4YXJ A;  4F91 B;  5KT4 A;  4P4P A;  1XWL A;  3AQK A;  2ZJ8 A;  5IIM A;  2M2U A;  3SYZ A;  3PX4 A;  1ZQV A;  5KFM A;  4DFJ A;  2DRA A;  4F92 B;  3MGH A;  2BKE A;  4F5N A;  2BQU A;  1BVS A;  4DL3 A;  4BWM A;  4DWI A;  4ECS A;  4Z6C A;  5J2K A;  7ICP A;  4RQ7 A;  2KFN A;  4B9V A;  4DQI A;  1R8C A;  4QWE A;  3RAQ A;  1MQ3 A;  3C5F A;  3EPG A;  5IIJ A;  4C8L A;  4FHP A;  3MFH A;  4DS5 A;  5DGA A;  2JZB B;  4P2H A;  2UVW A;  4Q44 A;  4O5K A;  1NZP A;  3C5G A;  2BHN A;  1EXN A;  4YP3 A;  4F2S A;  4B9S A;  9ICE A;  2Q66 A;  5KFN A;  4DF8 A;  7ICT A;  2BDP A;  1IXR A;  1XC9 A;  9ICQ A;  2MUT A;  3AQM A;  5IIL A;  9ICW A;  5KG2 A;  4KLT A;  9ICF A;  1UEU A;  5BPC A;  4QZ8 A;  3ISB A;  4C8M A;  2ZH4 A;  3PW4 A;  1ZJM A;  1LB2 B;  4O3Q A;  1KRP A;  3AU2 A;  4I2I A;  8ICI A;  4X4O A;  9ICJ A;  1JAJ A;  3OVA A;  1U49 A;  3Q8R B;  5DG9 A;  4KLJ A;  4UQG A;  4J9K A;  2BQR A;  2DPJ A;  5CB1 A;  4F4K A;  1BNO A;  4C8K A;  2FMP A;  2ZH7 A;  3PW7 A;  5EWE A;  3QZ8 A;  3V6H A;  4UD5 A;  3RJG A;  1JXL A;  4Q43 A;  8ICP A;  1KFT A;  4XQ8 A;  4RT3 A;  1RXW A;  3ISD A;  4F3O A;  3Q8Q B;  2GWS A;  5KFG A;  7ICR A;  3OHB A;  4QZA A;  4M5D A;  1V4A A;  4AT9 A;  3LK9 A;  2H5X A;  2ASD A;  5DEC A;  1TK5 A;  1TAU A;  1SL2 A;  1L3U A;  3ZDA A;  1F5A A;  4QWC A;  2DR8 A;  3JZ0 A;  4DOA A;  1U45 A;  4ED2 A;  4EBK A;  1SKR A;  2ZH5 A;  2IA6 A;  1SZP A;  3UXN A;  4JV1 A;  3GV8 B;  1B22 A;  2DFL A;  4PHD A;  5KFY A;  3V72 A;  3NYB A;  4E80 A;  1Y88 A;  4EBE A;  2RDJ A;  4DL4 A;  2FLN A;  1S9F A;  3UQ2 A;  1ZET A;  4X4P A;  2DR9 A;  4P4M A;  4P4O A;  4UB3 A;  1MC8 A;  3H39 A;  8ICK A;  4F4Y A;  9ICN A;  3EWA A;  3N97 B;  1HJP A;  4QZE A;  5L1I A;  2P6U A;  4F4X A;  4QWB A;  3QE9 Y;  3OSP A;  4BDP A;  4K4H A;  4M9H A;  8ICS A;  4ECQ A;  4FH5 A;  4WC0 A;  3C1Y A;  4RU9 A;  3BQ0 A;  5L1J A;  3ZD9 A;  2ATL A;  3C23 A;  2PFN A;  4EYH B;  3PX6 A;  1NJX A;  4ATB B;  2ZH8 A; 
#chains in the Genus database with same CATH topology
 5AM5 A;  3QUB A;  4NXU A;  4XRH A;  1NO5 A;  2BGW A;  1QCK A;  5JTG A;  3SQI A;  2A1J B;  4USA A;  2OHF A;  4CF5 A;  5CJ7 A;  3PML A;  5L1K A;  4WC3 A;  3KKA A;  1TK8 A;  4FO6 A;  2IOH A;  4XA5 A;  4E8F A;  3BJY A;  3BZC A;  3CYM A;  4NWI A;  5KFK A;  3IM1 A;  1ZQC A;  7ICM A;  4M0A A;  4YD2 A;  4MFF A;  4PHP A;  1L3V A;  2I1Q A;  2UVR A;  3H8S A;  3PV8 A;  2Q4T A;  3Q8P B;  1RXV A;  3PR5 B;  3F5E A;  3OUY A;  4NLC A;  4WC2 A;  4DSJ A;  2AHO B;  1ZQF A;  1X9W A;  1L3T A;  2M2V A;  7ICG A;  5ALD A;  4S3N A;  3AN1 A;  4DSE A;  4EX7 A;  3WK6 A;  3V7J A;  1S97 A;  4OAF A;  4J9P A;  3GV5 B;  5KG1 A;  1ZQB A;  2FI1 A;  2HBK A;  1XNS A;  2W9A A;  2JXJ A;  2E5S A;  2KN7 A;  3SAF A;  1ZQG A;  4P0Q B;  4DQS A;  4DOC A;  1V9P A;  4R8U A;  4K8V A;  1KN5 A;  5EE3 A;  1HIW A;  4NM2 A;  5KL8 B;  3UPQ A;  3RJI A;  5ALU A;  5L9X A;  2FE9 A;  2Y9T A;  4OJO A;  4QIW C;  4QZG A;  3C29 A;  2V9W A;  1ZJN A;  3RH5 A;  3LWL A;  2HOQ A;  5KFS A;  2F2A B;  2B4V A;  4K97 A;  3E58 A;  4GIB A;  3GU3 A;  4FBU A;  4Q8F A;  4EP7 A;  5AKZ A;  4ECR A;  4F8R A;  2AJQ A;  2I6X A;  2KKV A;  3AQN A;  1SWW A;  2PFP A;  2BZF A;  4BGD A;  3MBY A;  8ICT A;  4M04 A;  3JPN A;  2YTU A;  4DEZ A;  3PVX A;  2BCS A;  4ECV A;  1L5U A;  4QZC A;  4FHP A;  1NKC A;  3FDS A;  4O3N A;  5KG7 A;  2AGP A;  4AT9 B;  3C2K A;  4UD4 A;  5CHE A;  1VFG A;  5KFH A;  2FCL A;  2ZXH A;  3PW0 A;  4CE6 A;  3RFA A;  2OM6 A;  5ALH A;  4DL7 A;  1KFS A;  2EAP A;  2KP7 A;  1Q3U A;  2C2D A;  3HIY A;  5CWR A;  3GDX A;  2EDU A;  2K8C B;  1OUQ A;  4HX0 A;  8ICU A;  1JXE A;  1N5W A;  4YN4 A;  4LEV A;  4O67 A;  1QQ6 A;  4Z6E A;  9ICV A;  2XCP A;  3HPO A;  3H4B A;  4AYB F;  3BS7 A;  1NK5 A;  3T79 A;  2HHQ A;  2R18 A;  2HHS A;  4E7X A;  4F4Z A;  7ICK A;  2RQ5 A;  3QEA Z;  1R8A A;  5AI0 A;  1V97 A;  2ZIU A;  1U9L A;  2R8G A;  5HR7 A;  5KFT A;  5AKH A;  2HHT A;  2ZIU B;  1MQ2 A;  5CEH A;  2DRB A;  1Q8K A;  3RR8 A;  1KKX A;  4WH5 A;  1T4G A;  2J6S A;  9ICA A;  1QLN A;  2LYH A;  3RAX A;  2FJ6 A;  2EAN A;  2VIX A;  2W8L A;  3D2Q A;  4Z6D A;  4IQV A;  4O3O A;  2W54 A;  5G5H A;  3H0L B;  5DQI A;  4KX5 A;  2VJ4 A;  8ICH A;  4QW8 A;  4KB6 A;  3AM9 A;  3AQE A;  5AKJ A;  2HN2 A;  1FEZ A;  5ALE A;  4IRD A;  4US8 A;  2DUY A;  2O1P A;  4I2J A;  4ECU A;  4DFP A;  5J2E A;  1ZD2 P;  1KTQ A;  4F2R A;  5ALM A;  2K89 A;  3M6Z A;  1SL0 A;  3NRW A;  5HRK A;  4FZM A;  2F8K A;  1T94 A;  2DBY A;  8ICQ A;  2BCQ A;  2JH7 A;  1KFD A;  1RQN A;  1SXD A;  4UW9 A;  3T5L A;  1ZQD A;  8ICV A;  4WC1 A;  2ZUD A;  2NRV A;  4YD1 A;  4KIT B;  3WKA A;  3R9K A;  3OHA A;  3UM9 A;  2BE3 A;  2JV3 A;  2W7O A;  4DL2 A;  1HEK A;  2H3Z A;  3B0Y A;  3HKZ C;  4WQK A;  2LPE A;  4KLQ A;  4UAW A;  3NVY A;  3M8S A;  4C0Z A;  3PY8 A;  2JH1 A;  3H8J A;  2BPC A;  5KT3 A;  1DOQ A;  1RYR A;  2OEH A;  4RNM A;  2QB0 B;  5AIC A;  4R63 A;  3SAG A;  3QEB Z;  1JI7 A;  3JPR A;  2JZB A;  4NY8 A;  3WU2 U;  1X9S A;  5B3Q A;  4KLI A;  2E8N A;  4NLZ A;  4EYI B;  3NAS A;  4AT8 B;  2AGO A;  7ICJ A;  2BBJ A;  3KHL A;  1ZD4 A;  5HMM A;  3JYY A;  2Y1J A;  4B6J A;  2ASL A;  2OH2 A;  2JEJ A;  4DO9 A;  2ES6 A;  3ER8 C;  2KEY A;  3TFR A;  4UB5 A;  3IRU A;  3H37 A;  9ICR A;  2G07 A;  3LDA A;  3KHR A;  4JV2 A;  4WC5 A;  2HVH A;  4NL9 A;  2JGA A;  2M2T A;  5ALQ A;  3N7R C;  2MU2 A;  2L5Y A;  2B21 A;  3OWG A;  5G5G A;  2YMP A;  3MDC A;  2EQY A;  1D9D A;  2NRX A;  4K96 A;  1PVP A;  1N63 A;  4CDG A;  3QZ7 A;  8ICR A;  2KJ5 A;  3K7D A;  2IHO A;  1A77 A;  4KN4 A;  4DLE A;  2W8K A;  1URJ A;  3RBE A;  3KKA C;  3Q8S B;  4X4P A;  3BQ1 A;  4B9N A;  3ETR A;  1ZQS A;  1ZQP A;  5DB7 A;  1N48 A;  4TUP A;  1QH9 A;  4FBT A;  4YG2 A;  3K75 D;  1U4B A;  3QU9 A;  2WF5 A;  1WOT A;  2ZTE A;  5BOM A;  3PSI A;  7ICS A;  5J2F A;  1VDV A;  4I2E A;  2HBM A;  4UB6 U;  4IQW A;  2Y0S C;  4GLX A;  9ICB A;  1A6S A;  5KG4 A;  4HAI A;  2HW3 A;  4O3P A;  7ICN A;  1X9M A;  4J9S A;  3L3F X;  2HHP A;  1S76 D;  3OJU A;  2GO7 A;  5KFF A;  2ZH2 A;  1TFR A;  2JMG A;  4X5V A;  1KBU A;  2WTF A;  3ZDD A;  3WFR E;  3QUC A;  2R8I A;  4LEZ A;  1TKD A;  2ZH1 A;  4KLM A;  5DGB A;  1GO3 F;  4RNN A;  3FC4 A;  2A3V A;  4I28 A;  4YR3 A;  1LV5 A;  5KFP A;  5KFX A;  2ZIV B;  2E8O A;  2XO7 A;  3RJH A;  1SV4 A;  2HI0 A;  3TQ1 A;  2NRZ A;  5HRB A;  1N5X A;  1ED1 A;  5C5J A;  4MEY A;  8ICW A;  4AT7 B;  1NOM A;  5KL1 B;  1NNL A;  3IV6 A;  3C2M A;  5A0L A;  5KFW A;  5KT6 A;  2IBK A;  3WK4 A;  4CCH A;  4FE3 A;  4YXJ A;  4P4P A;  3AQK A;  5AKK A;  2KVS A;  2M2U A;  3MGH A;  2BKE A;  1T3Q A;  3QU7 A;  7ICP A;  3C5F A;  4DCC A;  3SEI A;  4DS5 A;  2OYY A;  2BBH A;  2NYV A;  1NZP A;  4O5K A;  2Q66 A;  5FP0 A;  5IIL A;  5KG2 A;  4F71 A;  5BPC A;  1ZJM A;  8ICI A;  4O3Q A;  3AU2 A;  9ICJ A;  2BQR A;  2FMP A;  5EWE A;  3V6H A;  1JXL A;  8ICP A;  1KFT A;  5KFG A;  7ICR A;  3M6K A;  5L1M A;  1SL2 A;  1F5A A;  5ALX A;  3I1Y A;  3JZ0 A;  4ED2 A;  1SKR A;  3MCR A;  4C4S A;  3GV8 B;  3NYB A;  4E80 A;  1J2M A;  4EBE A;  2RDJ A;  2FLN A;  3QX7 A;  1ZET A;  2DR9 A;  4UB3 A;  1MC8 A;  4F4Y A;  4Y2J A;  3C1Y A;  5L1J A;  1OXJ A;  2G09 A;  2ATL A;  2HBL A;  4OO1 J;  2GOL A;  4WOY A;  2ZH8 A;  1T3N A;  4KLU A;  9ICL A;  4QJF B;  5AK4 A;  3IN5 A;  2HDO A;  3NTU A;  4DS4 A;  2D8C A;  4ED6 A;  1Z1B A;  2J6U A;  1BPX A;  3JPT A;  7ICI A;  2JEF A;  4N7R A;  4UB4 A;  1L3S A;  2G0A A;  4X4R A;  1ZOL A;  5KT7 A;  4F72 A;  4Y2U A;  3AQL A;  4ED0 A;  3H0R B;  3RB4 A;  4JLX A;  3AUO A;  1UA1 A;  3H8M A;  5III A;  3HRD D;  2DGZ A;  1NK6 A;  4ECZ A;  1JIH A;  1TAQ A;  5IIK A;  5CA7 A;  4DQR A;  5KFJ A;  4RQ5 A;  4BJQ A;  3UMC A;  3M9N B;  2QKQ A;  4Y2Q A;  4WBY A;  4YR0 A;  3F2D A;  4LJX A;  3L9D A;  2JHD A;  4X4Q A;  1UET A;  8ICM A;  3WFS C;  2VJ5 A;  4KX3 A;  3RJJ A;  3ZDB A;  2ZUB A;  8ICZ A;  5J0X A;  2W9C A;  3OJS A;  4YFK A;  5ALY A;  1DGJ A;  4OAG A;  3SAH A;  3H4D A;  1WUD A;  2KJ8 A;  1L6N A;  5HHI A;  3RTV A;  4RWQ A;  3RRG A;  4QZB A;  4B9L A;  9ICG A;  3TI0 A;  5DDM A;  3C2L A;  4I2A A;  2GLE A;  3PSP A;  4IRK A;  5AIB A;  5AKX A;  2C28 A;  2LBO A;  7ICV A;  3SV3 A;  2E8P A;  3IDW A;  5AK6 A;  4I0U A;  2KZ3 A;  4LZG A;  3VCB A;  4K98 A;  2MUT B;  3RH4 A;  3M9O B;  1XO1 A;  2DR7 A;  1PX5 A;  4IC9 A;  5EE0 A;  4MF2 A;  1TFW A;  5J0R A;  1MIY A;  4NL9 C;  5ALL A;  8ICX A;  4ELU A;  2Y1I A;  1IG6 A;  3PO5 A;  4YMO A;  2E1E A;  3F2C A;  1HUO A;  3GQC A;  2YMQ A;  1FFU A;  4WC4 A;  4FHX A;  5HR9 A;  3NRZ A;  2UVU A;  3V6J A;  3N4M B;  3ICX A;  5K4L A;  3HT3 A;  2M9N A;  1ZD5 A;  4PPX A;  4ECY A;  4RQ8 A;  1Z4N A;  3GIJ A;  1S0O A;  3WFQ E;  2ZHA A;  4F4W A;  4EV6 A;  4KLE A;  4QWD A;  3MGV A;  4ZH4 A;  4KLG A;  1JUD A;  2MSN A;  4QW9 A;  2WF6 A;  2HOI A;  5TIS U;  5DLG A;  4J9Q A;  3VC8 A;  1GPJ A;  5CR0 A;  5J0S A;  4YCX A;  2KG5 A;  2V4Q A;  4WC7 A;  4RUC A;  3EUB 2;  4MKP A;  2M2W A;  4RWO A;  4NXT A;  2YN4 A;  2DVI A;  4C4R A;  3CK6 A;  5ALK A;  1O03 A;  2ZIX A;  1UA0 A;  2BCR A;  4FHW A;  4NLN A;  5H2F U;  3WK7 A;  5L1L A;  3KFU F;  3OUY B;  1Z1V A;  1KL9 A;  4JWM A;  5DQH A;  5DB8 A;  3C21 A;  2AGQ A;  3H3A A;  4C4T A;  4RQ0 A;  3NS1 A;  9ICP A;  4TUS A;  2KTQ A;  1NJY A;  2HOF A;  2F3N A;  2LYA A;  1LKY A;  5J8Y C;  1BPY A;  1QSY A;  4RUA A;  4NXV A;  4O5E A;  4XUS A;  3BQ2 A;  5EOZ A;  2GH1 A;  3V7L A;  2K8B B;  4X4S A;  1TVA A;  2PMZ F;  4R8U B;  2I5H A;  1N60 A;  2LKY A;  5D49 A;  3DDH A;  4B9T A;  3NWI A;  3BS5 A;  4U6P A;  3EW9 A;  4GC6 A;  4DL6 A;  3T5K A;  3UMG A;  2VA8 A;  2O6K A;  5KFZ A;  2NRT A;  4DQP A;  4KMU A;  1U47 A;  1D9F A;  3MGI A;  5AKG A;  4RPX A;  4I27 A;  4FHV A;  1COO A;  1N61 A;  5AM2 A;  1ZQR A;  1NK0 A;  1Q78 A;  4I2H A;  5AHX A;  1KDH A;  4F5O A;  2RRD A;  1N2X A;  3WKB A;  2QLT A;  4FHY A;  2BR0 A;  5J2G A;  4DSF A;  1ZQI A;  1YZ7 A;  5KT2 A;  1JRO A;  1UT5 A;  2WB1 F;  2WFA A;  5J2H A;  4CGZ A;  4JV0 A;  2AXT U;  1Q3V A;  1P7D A;  2KIC A;  4OD0 A;  2G06 A;  1X40 A;  1RZT A;  4R64 A;  1B0X A;  4F5Q A;  3OGU A;  4X4U A;  5DBA A;  5J29 A;  3M1Y A;  4LT6 A;  5D62 A;  4EBJ A;  5KFI A;  1U48 A;  2G5I B;  1D8L A;  1UCV A;  2P66 A;  3QU2 A;  2XCA A;  3FM9 A;  4QZH A;  4G3I A;  4M9G A;  4IQU A;  3PNC A;  4PH5 A;  1T8E A;  2ZH4 A;  4US9 A;  3ISC A;  4RPY A;  1QSS A;  5KFQ A;  5ALV A;  2K4E A;  2WF8 A;  3MR3 A;  1ZQU A;  3JPS A;  3OVS A;  1DGS A;  1S5L U;  2G08 A;  4RQM A;  9ICU A;  4R66 A;  3GV7 B;  1ZQL A;  2N1R A;  5KG3 A;  2ASJ A;  3T3F A;  4LEY A;  1NK9 A;  1WCL A;  2PKE A;  3SR6 A;  1RQL A;  3OTQ A;  2BPG A;  4WQL A;  1PZN A;  2OWO A;  2PBE A;  4O68 A;  2ESE A;  4OAI Z;  4BUG A;  1Z00 A;  4I2G A;  2FMQ A;  5AKY A;  3H0M B;  2K4I A;  3F53 A;  2WAQ F;  1K1Q A;  2ID1 A;  2AH5 A;  3OPX A;  8ICG A;  3KZI U;  1B43 A;  2NO4 A;  1YZ6 A;  3G6X A;  3RB3 A;  1K1S A;  9ICT A;  4Y2P A;  2C22 A;  2ZIW A;  4KLF A;  1V38 A;  4ECW A;  5CP2 A;  5ALG A;  4C8N A;  4I2C A;  2OCE A;  2VKQ A;  3TAN A;  3M7D A;  1JRP A;  5AM0 A;  4NLB A;  4ELT A;  2KHV A;  1FIQ A;  2DPI A;  5KT4 A;  2ZJ8 A;  1J2N A;  1ZQV A;  5KFM A;  1BVS A;  5J2K A;  5GTI U;  2KFN A;  4B9V A;  4DQI A;  1R8C A;  4QWE A;  1MQ3 A;  3EPG A;  2JZB B;  4EX6 A;  4PL2 A;  3NVZ A;  3C5G A;  1EXN A;  2RP5 A;  7ICT A;  1IXR A;  9ICQ A;  2KMD A;  2P35 A;  5AK5 A;  4KMO B;  9ICF A;  3NVV A;  3ISB A;  3PW4 A;  1RG6 A;  1JAJ A;  1U49 A;  3QUT A;  1BNO A;  5CB1 A;  3PW7 A;  1RXW A;  4F3O A;  4RQN A;  3OHB A;  1TAM A;  2G5H B;  5T14 A;  3ZDA A;  2K60 A;  4DOA A;  4Y2S A;  4EEK A;  5ALW A;  2DFL A;  4DL4 A;  3UQ2 A;  4O69 A;  2KKP A;  4P4O A;  9ICN A;  3OSP A;  4F4X A;  2P6U A;  4BDP A;  4WC0 A;  4RU9 A;  3BQ0 A;  3ZD9 A;  2PFN A;  3C23 A;  4QIW F;  4X4N A;  2BCV A;  1ZRM A;  4X4T A;  9ICI A;  4ACO A;  2EZX A;  5F9L A;  4DLG A;  3SV4 A;  2E3T A;  5AM4 A;  4J9N A;  4PGX A;  4ED1 A;  1ZQT A;  4O3S A;  4OJ6 A;  3RJE A;  2F8L A;  2NRW A;  1ZQJ A;  1MIV A;  2IUB A;  3WK9 A;  3WKD A;  1SKW A;  5ALO A;  2KIW A;  5HP4 A;  3G6Y A;  4F93 B;  3T5J A;  2C2R A;  4OJ5 A;  4NM1 A;  2H3Q A;  4F50 A;  5DED A;  1QTM A;  1ZQY A;  2C2E A;  1OU5 A;  4GFJ A;  4IL6 U;  2NO5 A;  5DBC A;  3HIL A;  5B5E U;  3OVB A;  1TV9 A;  4EED A;  4MF8 A;  4UAT A;  1Q79 A;  1SKS A;  2HCF A;  2D3D A;  1DK3 A;  1ZQK A;  1UEV A;  4ED7 A;  3ALR A;  5KFC A;  2H3V A;  1MSW D;  2MA1 A;  5EE9 A;  2DQN B;  3TAP A;  2Q0Z X;  4P0P A;  4DFK A;  1ECW A;  1Q46 A;  5JTI A;  2ALZ A;  5D61 A;  3JPO A;  5HRF A;  3M8R A;  3G6V A;  4RWP A;  3D2N A;  1MIW A;  5AKE A;  2A1A A;  4NLK A;  5J0W A;  3CNH A;  1AQ6 A;  3DV9 A;  1VLB A;  5KNI A;  1WWU A;  5KFU A;  5KFB A;  3QUQ A;  2KV2 A;  2HBJ A;  5AI8 A;  3V6K A;  1RDF A;  1ARO P;  2W7P A;  5AM3 A;  1N62 A;  1BPZ A;  3OSN A;  1ZQQ A;  5ALN A;  3PMN A;  5F9N A;  5HRD A;  2E1F A;  5HRE A;  2IHN A;  2VA2 A;  5KAI U;  2ODG A;  4PHE A;  5GTH U;  5KFD A;  4C7Z A;  9ICX A;  2QAR A;  4BXO A;  5CFS A;  7ICL A;  3K1Z A;  5ALP A;  2LYB A;  5DDY A;  4O5C A;  1IM4 A;  4TQR A;  2GA9 D;  5ALI A;  3CW2 C;  3TAD A;  4ED8 A;  3PX0 A;  1QSL A;  2UVV A;  3Q8M A;  4YMM A;  4TQS A;  2HMX A;  5J0Y A;  1YLQ A;  5JUM A;  3KTQ A;  2W3R A;  4KLJ A;  3RB0 A;  2AQ4 A;  2ISP A;  3HW8 A;  3ZDE A;  1CEZ A;  4K99 A;  4UAY A;  2PMZ C;  4XJE A;  5D63 A;  4WCW A;  5KAF U;  3GIL A;  1WCN A;  2HHX A;  2CRX A;  1COK A;  5KFV A;  3KHG A;  8ICN A;  2HHV A;  5BOL A;  3SZ2 A;  4X4V A;  1KLN A;  1BPD A;  2YB1 A;  5J2C A;  3WFP A;  3T5H A;  1PK1 A;  3H7I A;  3PR4 A;  4GXI A;  2HHU A;  2YX8 A;  2ZTC A;  4IR1 A;  2HN1 A;  3Q8K A;  2XIC A;  4I2D A;  4UB1 A;  4K4I A;  4Y2V A;  2IMW P;  5DB9 A;  2EAO A;  3LQC B;  1BGX T;  1ZQM A;  4UB2 A;  4IRC A;  1WYG A;  2F1I A;  4M6W A;  3F5A A;  4CRX A;  4M6W B;  3RJF A;  3QNM A;  3E2E A;  2W9C B;  2W11 A;  2KHQ A;  1OW5 A;  1Z4O A;  2ZHB A;  3RJK A;  1O08 A;  3HX0 A;  2FDR A;  2W9B A;  4AYB C;  4PHA A;  2XGP A;  2W9B B;  4J9O A;  4UAS A;  1KQQ A;  4IQT A;  3MC1 A;  3AU6 A;  4QWA A;  2LM1 A;  4E0D A;  3SMV A;  3CRX A;  4IS7 A;  1PK3 A;  1KNY A;  1KSP A;  1ZQE A;  4RWN A;  7ICE A;  2ISO A;  5KFR A;  2Y0S F;  3N7P D;  3AEV A;  3K1R B;  2JEI A;  3ED5 A;  4I29 A;  1S10 A;  2LI6 A;  3ER9 B;  1NKB A;  3FYH A;  2KSO A;  2FPL A;  1CI4 A;  4EZ6 A;  4YMN A;  4EEY A;  3C28 A;  1ZQZ A;  4Q8E A;  4BWJ A;  4DSI A;  8ICB A;  4J9L A;  2DL0 A;  2PFQ A;  1S77 D;  1BNP A;  2RHF A;  5HRH A;  1DK2 A;  2CXY A;  5KFA A;  1D8Y A;  4MHV A;  4JLZ A;  2NRK A;  4R65 A;  1XSN A;  4MFA A;  1A0P A;  5HHH A;  4JK1 A;  1ZQX A;  5DQG A;  5B3P A;  3RH6 A;  3UXP A;  2V4R A;  2PXI A;  3H8W A;  3BDP A;  5AM1 A;  3BQ7 A;  1Z3E B;  4X0A A;  4ECX A;  1BPE A;  4C8K A;  1ZQO A;  2P6R A;  4UB8 U;  4ATB A;  4K4G A;  3JCF A;  3WKE A;  3IG5 A;  4QZI A;  3Q8L A;  3LWM A;  2ZXI A;  5KG5 A;  2HHW A;  4DOB A;  2E8M A;  2KE7 A;  3RF9 A;  4Q45 A;  2ZIX B;  4PZO A;  2A1J A;  3MR6 A;  7ICO A;  5AI6 A;  3JPP A;  1KEJ A;  2W3S A;  1NJW A;  8ICA A;  2MAX A;  1N56 A;  3IHQ B;  4M2Y A;  9ICO A;  1S0V A;  5CFU A;  4KLD A;  2EAM A;  4F5P A;  3PW2 A;  5DLF A;  4KTQ A;  4GXJ A;  3TKA A;  1X66 A;  4KLS A;  5AKI A;  1JX4 A;  4O6A A;  2W04 A;  1V85 A;  3ERC C;  1F44 A;  1SV0 A;  4Z6F A;  2RDI A;  2KZM A;  3WK8 A;  1LKY B;  2AU0 A;  4RQ2 A;  2XY7 A;  1UQV A;  4UAR A;  1FO4 A;  5KG6 A;  4KLL A;  4ELV A;  3KBB A;  2F1J A;  1X42 A;  3BS5 B;  4QZ9 A;  2DR5 A;  5IIO A;  3QYP A;  2IOF K;  4NKU A;  4P0Q A;  3RRH A;  3PSF A;  5EWG A;  2MRL A;  1UPH A;  2FPK A;  4F91 B;  2JRZ A;  1XWL A;  3SYZ A;  3PX4 A;  4DFJ A;  2BQU A;  3PZP A;  4DL3 A;  4ECS A;  5AI5 A;  4AP9 A;  3SD7 A;  5EE1 A;  4NXX A;  5DGA A;  2UVW A;  3F2B A;  9ICE A;  1SGG A;  1XC9 A;  2W43 A;  3AQM A;  3ONN A;  3WK5 A;  1PVR A;  4Y2Y A;  4KLT A;  1UEU A;  4QZ8 A;  1LB2 B;  1KRP A;  4I2I A;  3Q8R B;  4WJ3 B;  4UQG A;  2ZH7 A;  2DPJ A;  4FZL A;  4F4K A;  4XQ8 A;  4RT3 A;  4AT9 A;  4M5D A;  1V4A A;  2H5X A;  2EH9 A;  1TK5 A;  1L3U A;  2D6F C;  2DR8 A;  3TAD C;  1IV8 A;  1U45 A;  2ZH5 A;  4EBK A;  3UXN A;  4EEL A;  4JV1 A;  2WHE A;  3L4P A;  5KFY A;  3V72 A;  1Y88 A;  4DFD A;  1ZXI A;  1WWV A;  4P4M A;  4OJP A;  3H39 A;  3N97 B;  1HJP A;  8ICS A;  4K4H A;  4QWB A;  4FH5 A;  2B0C A;  2DF4 B;  4ECQ A;  3PX6 A;  1ZQH A;  1NJX A;  3I28 A;  2XI9 A;  2EWR A;  1SZH A;  2B56 A;  2LHT A;  1CUK A;  3BQT A;  4O3M A;  4C80 A;  4X0B A;  5B66 U;  9ICK A;  1X6I A;  4TUQ A;  1DRG A;  3D2S A;  4JUZ A;  5DKW A;  2H3F A;  2XC9 A;  4JB3 A;  3HWT A;  8ICL A;  3MFI A;  4OJL A;  3IP4 B;  4EBC A;  2ZJA A;  1L7M A;  2CN1 A;  4C7Y A;  5D4B A;  1Z00 B;  5DB6 A;  2KNJ A;  5CRX A;  1CRX A;  5HRL A;  1TK0 A;  7ICF A;  2QB1 A;  1NI3 A;  4B9U A;  4ECT A;  5J2A A;  4F5R A;  4RQ6 A;  3RR7 A;  1X2I A;  3A0H U;  3KOO A;  3H40 A;  1T7P A;  2EZZ A;  2IOF A;  3M9M B;  2ZIW B;  4IG8 A;  4FZN A;  4NXZ A;  4K9A A;  3D6J A;  5F3X B;  5J2J A;  2YB4 A;  3WKC A;  7ICQ A;  1L7N A;  1NK8 A;  3ORY A;  7ICU A;  5J0U A;  4JWN A;  4KN7 A;  1ZQW A;  5J0P A;  5ALJ A;  4FS2 A;  2I9G A;  4DF4 A;  5J2I A;  5CHG A;  4IR9 A;  2ZG6 A;  1ZD3 A;  2XY6 A;  1NK7 A;  3J81 j;  4QZD A;  3O0F A;  5ALZ A;  2KVC A;  3K4G A;  5J0Q A;  1FA0 A;  4WC6 A;  1ZYQ A;  2WF9 A;  8ICJ A;  1S0M A;  4G9B A;  3TAC B;  1NKE A;  5DBB A;  4RQ1 A;  5ALR A;  1JQR A;  2LM4 A;  1H38 A;  4O9M A;  3LYS A;  4NKT A;  2QB0 A;  5AIA A;  5HR6 A;  4U7C A;  1L8L A;  5JU5 A;  2XGQ A;  3H38 A;  2PI5 A;  1BPB A;  4WBZ A;  2K4P A;  3NKU A;  5E79 U;  5AI4 A;  1IIP A;  1S8O A;  8ICC A;  3AL0 B;  4AT8 A;  1PUZ A;  5AI9 A;  2W03 A;  2F1H A;  4PJ0 U;  1KW4 A;  4PGQ A;  7ICH A;  4PGY A;  1JN3 A;  4RT2 A;  2ZTD A;  2F44 A;  4CF3 A;  2YQE A;  2ZH6 A;  5KT5 A;  4I2F A;  4UAU A;  3ZDC A;  1JAL A;  4NXW A;  2XY5 A;  2HSZ A;  4RQ3 A;  1R8B A;  1VJ7 A;  4EEB A;  4TUR A;  1XSL A;  2DWQ A;  3GIK A;  5F2V O;  4K9B A;  3BZK A;  4ED3 A;  4C8O A;  2W55 A;  9ICC A;  3ZI4 A;  4CF4 A;  2O5A A;  2KK0 A;  1XS9 D;  9ICS A;  5HRI A;  8ICF A;  2PI4 A;  3FAH A;  3ZD8 A;  1RPL A;  4QNL A;  5HC9 A;  2B6G A;  4NLG A;  4J9M A;  5ALF A;  1X9X A;  2ZH3 A;  1L7O A;  3GIM A;  1A76 A;  2A19 A;  4YVZ A;  4CNQ A;  4DQQ A;  4DFM A;  4PZN A;  1SV0 C;  1DXS A;  1F0M A;  1NK4 A;  3E0F A;  3NVW A;  1MA7 A;  2J6T A;  1K5O A;  3GZF A;  4M9J A;  3C1Z A;  2B51 A;  2M0N A;  2BDU A;  3UPS A;  4HYK A;  4UAV A;  2YY6 A;  2F76 X;  3QXG A;  4O0I A;  2FMS A;  3A0B U;  3MR2 A;  1JMS A;  4RPZ A;  1F5S A;  2AQ0 A;  2BQ3 A;  1XU4 A;  5ALS A;  4B9M A;  1L8O A;  2ZJ5 A;  8ICO A;  1C7Y A;  4YQW A;  1R89 A;  4ICA A;  2R8K A;  4Y2T A;  2ZIV A;  1J97 A;  5J0O A;  2KIV A;  2DKZ A;  3UQ0 A;  2KOB A;  3RB6 A;  2RFF A;  4AT7 A;  4YR2 A;  2FLP A;  1SIJ A;  4UAZ A;  3IG8 A;  3WFO A;  1S0N A;  3NGD A;  4RNO A;  3ETL A;  8ICE A;  4P0P B;  1RM6 C;  2WF7 A;  3I76 A;  1HUZ A;  2KD1 A;  3UXO A;  5J8Y A;  4DSK A;  1ZQ1 C;  4UBC A;  3MDA A;  5DG7 A;  4I2B A;  4LEW A;  5HRG A;  3SI8 A;  5C0Y A;  5KFL A;  5HNK A;  3UMB A;  3CP8 A;  3EZ5 A;  3KD3 A;  3V7K A;  2CPR A;  5KTQ A;  2Z7J A;  5J0T A;  5EWF A;  2LMR A;  4JMU A;  4ZOH C;  2FPM A;  3NUQ A;  4DL5 A;  2BPF A;  8ICY A;  2XID A;  5JRT A;  3TAQ A;  4GXK A;  1LVH A;  4OCZ A;  2R8J A;  2BCU A;  2YMM A;  2VAN A;  1SL1 A;  2Y9U A;  4LVS A;  3B0X A;  3N7S C;  3GII A;  5KFE A;  1ZQN A;  4Y2X A;  4M9L A;  3EPI A;  4FFD A;  2JEG A;  4KLO A;  4EZ9 A;  2QAR B;  3AQF A;  3HP6 A;  4BXO B;  2JR5 A;  3HKZ F;  3HJ4 A;  3TAR A;  3HJ1 A;  1X6J A;  3HJE A;  2DKX A;  3C18 A;  3KHH A;  4GC7 A;  2K8A A;  1XSP A;  1YT3 A;  1Z19 A;  2ZUC A;  2IHM A;  4NV0 A;  4QZF A;  5KFO A;  4NJ8 A;  3PW5 A;  2H3I A;  5KG0 A;  4MFC A;  1B22 A;  5IIN A;  2W9M A;  4FO1 A;  4YXM A;  3OV7 A;  5ALT A;  1QQ7 A;  4J9R A;  4EBD A;  2PFO A;  1NZB A;  1UT8 A;  3MAB A;  4FS1 A;  2R8H A;  5AKL A;  4O3R A;  4RZR A;  1XO0 A;  3U26 A;  1RYS A;  2FLL A;  1WG8 A;  4M47 A;  5D46 A;  3TFS A;  5J2D A;  1PK1 B;  4Y2R A;  5DG8 A;  4EGW A;  5TZV A;  2KFZ A;  5HML A;  1D8B A;  3C66 A;  3EYZ A;  3PO4 A;  4DSL A;  3NVO A;  2VA3 A;  3GFK B;  1ZQA A;  3EF2 A;  4MEX A;  1NJZ A;  3JPQ A;  9ICH A;  3QU5 A;  4EEN A;  2WB1 C;  4LZD A;  9ICM A;  3PHZ A;  3DEE A;  4RQ4 A;  4KLH A;  3MR5 A;  3L5K A;  4XQ7 A;  1UHU A;  1SB3 C;  1FFV A;  3THV A;  5AK3 A;  2XVT A;  5J2B A;  2EZY A;  4UBB A;  4A8E A;  3RBD A;  2ZH9 A;  2HVI A;  4FH3 A;  4BX9 C;  4J03 A;  2OXO A;  4M9N A;  5IIM A;  2GAF D;  2DRA A;  4F92 B;  4F5N A;  4BWM A;  4DWI A;  2RLT A;  4Z6C A;  4RQ7 A;  3RAQ A;  4C8L A;  5IIJ A;  3KZX A;  3SEN A;  4PL1 A;  3MFH A;  4P2H A;  2KSO B;  3AMZ A;  4Q44 A;  5CFT A;  2BHN A;  4YP3 A;  3LVV A;  4F2S A;  3B9J A;  4B9S A;  5KFN A;  4DF8 A;  2BDP A;  2MUT A;  1RYU A;  9ICW A;  4C8M A;  1L7P A;  3N28 A;  1QQ5 A;  4X4O A;  3OVA A;  2KZZ A;  5DG9 A;  4J9K A;  3QZ8 A;  4UD5 A;  3RJG A;  1MN8 A;  4Q43 A;  3ISD A;  3Q8Q B;  2GWS A;  4QZA A;  3LK9 A;  2ASD A;  5DEC A;  2NV3 A;  1TAU A;  3QU4 A;  4QWC A;  3S6J A;  1C20 A;  1SXE A;  2WAQ C;  2YML A;  2K4H A;  2F77 X;  1SWV A;  2IA6 A;  3PST A;  1SZP A;  1B4F A;  1VJ5 A;  4PHD A;  3LVW A;  1PVQ A;  1S9F A;  8ICK A;  3EWA A;  4OAH A;  4QZE A;  5L1I A;  1TE2 A;  3QE9 Y;  1TFY A;  4M9H A;  1ZRN A;  1M6Y A;  4KM5 A;  4EYH B;  4ATB B;  2KJ9 A; 
#chains in the Genus database with same CATH homology
 4X4N A;  1T3N A;  4KLU A;  2BCV A;  9ICL A;  1CUK A;  4XRH A;  4X4T A;  9ICI A;  3BQT A;  1NO5 A;  2BGW A;  4X0B A;  5F9L A;  4DLG A;  3SV4 A;  9ICK A;  3NTU A;  4DS4 A;  2A1J B;  4TUQ A;  4ED6 A;  2J6U A;  1BPX A;  5CJ7 A;  3PML A;  4JUZ A;  5DKW A;  4PGX A;  3JPT A;  5L1K A;  4J9N A;  4ED1 A;  4WC3 A;  1ZQT A;  4O3S A;  7ICI A;  2JEF A;  2XC9 A;  1TK8 A;  3RJE A;  4FO6 A;  3HWT A;  4UB4 A;  8ICL A;  4XA5 A;  2NRW A;  1L3S A;  4E8F A;  3MFI A;  5KFK A;  3BJY A;  1ZQJ A;  2IHM A;  3IM1 A;  1ZQC A;  7ICM A;  4X4R A;  4M0A A;  4YD2 A;  1MIV A;  4EBC A;  4MFF A;  4PHP A;  2ZJA A;  1L3V A;  5KT7 A;  2I1Q A;  5D4B A;  1Z00 B;  2UVR A;  3H8S A;  3AQL A;  1SKW A;  4ED0 A;  5DB6 A;  3PV8 A;  3RB4 A;  3AUO A;  5HP4 A;  1UA1 A;  3Q8P B;  3G6Y A;  5HRL A;  1TK0 A;  7ICF A;  5III A;  1RXV A;  3PR5 B;  4F93 B;  3T5J A;  4ECT A;  4B9U A;  3OUY A;  2C2R A;  4WC2 A;  5J2A A;  4DSJ A;  1ZQF A;  1X9W A;  4F5R A;  1L3T A;  2M2V A;  4RQ6 A;  1NK6 A;  1X2I A;  3RR7 A;  4NM1 A;  3H40 A;  4ECZ A;  7ICG A;  4F50 A;  1T7P A;  5DED A;  1QTM A;  1ZQY A;  4S3N A;  3M9M B;  4DSE A;  1JIH A;  1TAQ A;  5IIK A;  3V7J A;  4IG8 A;  1S97 A;  4NXZ A;  5CA7 A;  5KFJ A;  4DQR A;  2C2E A;  4J9P A;  4RQ5 A;  1OU5 A;  5J2J A;  3M9N B;  4WBY A;  5DBC A;  4YR0 A;  3GV5 B;  5KG1 A;  7ICQ A;  3OVB A;  1ZQB A;  3L9D A;  1TV9 A;  4X4Q A;  1UET A;  8ICM A;  3WFS C;  1NK8 A;  3ORY A;  4MF8 A;  2W9A A;  3RJJ A;  7ICU A;  1Q79 A;  3ZDB A;  1SKS A;  5J0U A;  2ZUB A;  4JWN A;  8ICZ A;  5J0X A;  4KN7 A;  1ZQW A;  2KN7 A;  5J0P A;  4FS2 A;  1ZQK A;  2I9G A;  2W9C A;  1DK3 A;  3OJS A;  1ZQG A;  4YFK A;  4DQS A;  4DOC A;  4ED7 A;  1UEV A;  1V9P A;  4DF4 A;  5KFC A;  5J2I A;  4R8U A;  5CHG A;  4IR9 A;  1MSW D;  3H4D A;  1NK7 A;  2XY6 A;  4NM2 A;  5HHI A;  3RTV A;  4QZD A;  3UPQ A;  3RJI A;  4RWQ A;  3RRG A;  4QZB A;  5L9X A;  4B9L A;  9ICG A;  3K4G A;  3TI0 A;  5DDM A;  5J0Q A;  3C2L A;  4QZG A;  4I2A A;  2V9W A;  1FA0 A;  1ZJN A;  4WC6 A;  1ZYQ A;  3TAP A;  2Q0Z X;  3RH5 A;  8ICJ A;  4DFK A;  1S0M A;  3LWL A;  4IRK A;  2ALZ A;  2C28 A;  5KFS A;  3JPO A;  7ICV A;  3SV3 A;  1NKE A;  3M8R A;  5DBB A;  5HRF A;  3G6V A;  4FBU A;  4RQ1 A;  4Q8F A;  4EP7 A;  4RWP A;  2KZ3 A;  1JQR A;  4ECR A;  4LZG A;  1H38 A;  4F8R A;  4O9M A;  2AJQ A;  4NKT A;  2MUT B;  3AQN A;  1MIW A;  3RH4 A;  3M9O B;  1XO1 A;  2PFP A;  1PX5 A;  2DR7 A;  2XGQ A;  3H38 A;  4NLK A;  4BGD A;  3MBY A;  5J0W A;  1BPB A;  2PI5 A;  4MF2 A;  8ICT A;  1TFW A;  4M04 A;  5KFB A;  5KFU A;  3JPN A;  4WBZ A;  4DEZ A;  3PVX A;  5J0R A;  2BCS A;  1MIY A;  4ECV A;  1L5U A;  4QZC A;  3V6K A;  1NKC A;  8ICX A;  3FDS A;  1ARO P;  4ELU A;  2Y1I A;  8ICC A;  4O3N A;  5KG7 A;  2AGP A;  3PO5 A;  4YMO A;  3C2K A;  4UD4 A;  4AT9 B;  4AT8 A;  1VFG A;  1BPZ A;  5KFH A;  3OSN A;  3PW0 A;  2F1H A;  1HUO A;  3GQC A;  1ZQQ A;  3PMN A;  4WC4 A;  4PGQ A;  4FHX A;  7ICH A;  5HR9 A;  5F9N A;  5HRD A;  2UVU A;  5HRE A;  2IHN A;  1KFS A;  4DL7 A;  3V6J A;  4PGY A;  1JN3 A;  4RT2 A;  2ZTD A;  2VA2 A;  2KP7 A;  3N4M B;  2C2D A;  3HT3 A;  3HIY A;  5CWR A;  4PHE A;  3GDX A;  2M9N A;  2ZH6 A;  5KT5 A;  4I2F A;  5KFD A;  3ZDC A;  8ICU A;  1JXE A;  4PPX A;  4ECY A;  2XY5 A;  9ICX A;  4YN4 A;  4RQ8 A;  3GIJ A;  1S0O A;  4RQ3 A;  3WFQ E;  4BXO A;  4Z6E A;  9ICV A;  2XCP A;  3HPO A;  1R8B A;  7ICL A;  4F4W A;  2ZHA A;  3H4B A;  1VJ7 A;  5DDY A;  4O5C A;  1IM4 A;  4TQR A;  4TUR A;  1XSL A;  1NK5 A;  4ED8 A;  3PX0 A;  1QSL A;  2HHQ A;  4E7X A;  2UVV A;  2HHS A;  3Q8M A;  4QWD A;  4KLE A;  3GIK A;  4ZH4 A;  4YMM A;  4F4Z A;  4KLG A;  7ICK A;  5F2V O;  4ED3 A;  3QEA Z;  4C8O A;  1R8A A;  4QW9 A;  4TQS A;  9ICC A;  5J0Y A;  1YLQ A;  1U9L A;  5DLG A;  5JUM A;  5KFT A;  4J9Q A;  2R8G A;  3KTQ A;  3RB0 A;  2AQ4 A;  5CR0 A;  1XS9 D;  2ISP A;  5J0S A;  3HW8 A;  1MQ2 A;  2HHT A;  4YCX A;  9ICS A;  2DRB A;  3ZDE A;  1CEZ A;  8ICF A;  5HRI A;  2PI4 A;  4UAY A;  3ZD8 A;  3RR8 A;  2V4Q A;  4WC7 A;  4RUC A;  4WCW A;  1RPL A;  3GIL A;  1T4G A;  2J6S A;  9ICA A;  4M9G A;  5HC9 A;  2M2W A;  4RWO A;  1WCN A;  2HHX A;  4NLG A;  1QLN A;  2DVI A;  2LYH A;  3RAX A;  4J9M A;  5KFV A;  3WFO A;  2W8L A;  4Z6D A;  2ZH3 A;  4IQV A;  4O3O A;  3KHG A;  1UA0 A;  3GIM A;  2BCR A;  1A76 A;  8ICN A;  5DQI A;  4YVZ A;  4DQQ A;  4NLN A;  2HHV A;  4FHW A;  4DFM A;  5BOL A;  3SZ2 A;  4X4V A;  1KLN A;  1BPD A;  8ICH A;  1NK4 A;  5J2C A;  3WFP A;  4QW8 A;  3T5H A;  5L1L A;  3H7I A;  3PR4 A;  4GXI A;  2J6T A;  3OUY B;  4M9J A;  2HHU A;  2ZTC A;  4IR1 A;  2KZZ A;  3C1Z A;  5DQH A;  4JWM A;  4IRD A;  5DB8 A;  2O1P A;  3C21 A;  4I2J A;  2AGQ A;  3Q8K A;  3H3A A;  1TFY A;  3UPS A;  4I2D A;  4ECU A;  4DFP A;  4HYK A;  4UB1 A;  5J2E A;  4K4I A;  1KTQ A;  4RQ0 A;  4F2R A;  4O0I A;  4TUS A;  2IMW P;  2FMS A;  5DB9 A;  9ICP A;  3LQC B;  1SL0 A;  2KTQ A;  3MR2 A;  1JMS A;  4RPZ A;  1BGX T;  1NJY A;  1ZQM A;  2AQ0 A;  2BQ3 A;  1XU4 A;  4B9M A;  4UB2 A;  5HRK A;  2ZJ5 A;  8ICO A;  1C7Y A;  4YQW A;  4IRC A;  1R89 A;  8ICQ A;  2R8K A;  2F1I A;  4M6W A;  1BPY A;  2BCQ A;  1KFD A;  1QSY A;  3T5L A;  4M6W B;  4RUA A;  1ZQD A;  3RJF A;  4O5E A;  3E2E A;  2W9C B;  8ICV A;  4XUS A;  3BQ2 A;  4WC1 A;  5EOZ A;  2ZUD A;  3V7L A;  2NRV A;  4X4S A;  5J0O A;  4YD1 A;  1TVA A;  4R8U B;  4KIT B;  2ZHB A;  3RJK A;  3UQ0 A;  5D49 A;  3OHA A;  3RB6 A;  2BE3 A;  4B9T A;  3HX0 A;  4YR2 A;  4DL2 A;  2W9B A;  2FLP A;  3EW9 A;  4UAZ A;  2RFF A;  4AT7 A;  4GC6 A;  4PHA A;  3B0Y A;  4DL6 A;  2XGP A;  2W9B B;  3T5K A;  4J9O A;  1S0N A;  4KLQ A;  4UAW A;  2VA8 A;  4RNO A;  5KFZ A;  3NGD A;  3M8S A;  3ETL A;  8ICE A;  4IQT A;  2NRT A;  3PY8 A;  4DQP A;  4KMU A;  3AU6 A;  1U47 A;  1D9F A;  1HUZ A;  4QWA A;  3MGI A;  4E0D A;  4RPX A;  3H8J A;  2BPC A;  3UXO A;  4I27 A;  4DSK A;  4FHV A;  1KNY A;  1COO A;  5KT3 A;  1KSP A;  1ZQE A;  1DOQ A;  4UBC A;  1RYR A;  4RWN A;  4RNM A;  3MDA A;  2ISO A;  7ICE A;  5KFR A;  5DG7 A;  4I2B A;  4R63 A;  3SI8 A;  1NK0 A;  5KFL A;  5HNK A;  1ZQR A;  5HRG A;  2JEI A;  1Q78 A;  4I2H A;  3EZ5 A;  4I29 A;  3V7K A;  1KDH A;  5KTQ A;  4F5O A;  3QEB Z;  1S10 A;  3JPR A;  4FHY A;  2BR0 A;  2JZB A;  3FYH A;  1NKB A;  5J0T A;  4NY8 A;  5J2G A;  2FPL A;  5EWF A;  4DSF A;  1X9S A;  1ZQI A;  4EZ6 A;  4KLI A;  2FPM A;  4DL5 A;  4NLZ A;  4EYI B;  5KT2 A;  4YMN A;  2BPF A;  3TAQ A;  8ICY A;  4AT8 B;  4GXK A;  4EEY A;  2AGO A;  7ICJ A;  1UT5 A;  1ZQZ A;  3KHL A;  5HMM A;  4Q8E A;  4BWJ A;  3JYY A;  2Y1J A;  4DSI A;  8ICB A;  2R8J A;  2BCU A;  5J2H A;  4J9L A;  2VAN A;  2ASL A;  1SL1 A;  2JEJ A;  4DO9 A;  2PFQ A;  4LVS A;  1S77 D;  4JV0 A;  1BNP A;  3TFR A;  3B0X A;  4UB5 A;  3H37 A;  5HRH A;  9ICR A;  1DK2 A;  3GII A;  3LDA A;  3KHR A;  4JV2 A;  5KFA A;  5KFE A;  1ZQN A;  1D8Y A;  2HVH A;  4WC5 A;  4M9L A;  2NRK A;  3EPI A;  2M2T A;  2JEG A;  4KLO A;  1RZT A;  4R64 A;  4EZ9 A;  3HP6 A;  2B21 A;  4R65 A;  3OGU A;  4F5Q A;  4BXO B;  4X4U A;  5DBA A;  5J29 A;  4LT6 A;  1XSN A;  4EBJ A;  3MDC A;  5KFI A;  4MFA A;  1D9D A;  3HJ4 A;  1U48 A;  3TAR A;  5HHH A;  3HJ1 A;  4JK1 A;  1ZQX A;  5DQG A;  2NRX A;  3RH6 A;  3UXP A;  2V4R A;  3C18 A;  1D8L A;  3KHH A;  3H8W A;  2PXI A;  4GC7 A;  3BDP A;  2P66 A;  1XSP A;  3QZ7 A;  8ICR A;  2XCA A;  1Z3E B;  4QZH A;  4G3I A;  1A77 A;  4KN4 A;  4DLE A;  4X0A A;  2W8K A;  2ZUC A;  4ECX A;  4IQU A;  3PNC A;  3RBE A;  4PH5 A;  4QZF A;  1BPE A;  3Q8S B;  3BQ1 A;  5KFO A;  1T8E A;  4B9N A;  3PW5 A;  5KG0 A;  1ZQO A;  1ZQS A;  1ZQP A;  2P6R A;  5IIN A;  2W9M A;  5DB7 A;  3ISC A;  1N48 A;  4RPY A;  4MFC A;  4TUP A;  4ATB A;  4K4G A;  4YXM A;  1QSS A;  3OV7 A;  4J9R A;  5KFQ A;  4QZI A;  4FBT A;  4EBD A;  2PFO A;  4YG2 A;  3Q8L A;  3LWM A;  5KG5 A;  2HHW A;  1UT8 A;  3MR3 A;  2O5A A;  1ZQU A;  3MAB A;  3JPS A;  4FS1 A;  2R8H A;  3K75 D;  1U4B A;  1ZQH A;  3OVS A;  4DOB A;  1DGS A;  4Q45 A;  4RZR A;  4O3R A;  1RYS A;  2ZTE A;  2A1J A;  2FLL A;  5BOM A;  9ICU A;  3MR6 A;  7ICO A;  7ICS A;  4R66 A;  3JPP A;  3GV7 B;  5J2F A;  1KEJ A;  1ZQL A;  4I2E A;  4M47 A;  5D46 A;  5KG3 A;  2ASJ A;  3T3F A;  1NJW A;  4IQW A;  3TFS A;  2MAX A;  1N56 A;  4GLX A;  8ICA A;  9ICB A;  5J2D A;  1NK9 A;  1WCL A;  3IHQ B;  5DG8 A;  5KG4 A;  4M2Y A;  2BPG A;  9ICO A;  5TZV A;  1PZN A;  2OWO A;  5HML A;  1S0V A;  4O3P A;  2HW3 A;  2KFZ A;  2PBE A;  3C66 A;  7ICN A;  1X9M A;  4J9S A;  2HHP A;  3EYZ A;  3PO4 A;  4DSL A;  3OJU A;  4KLD A;  1S76 D;  4F5P A;  3PW2 A;  5DLF A;  4KTQ A;  1Z00 A;  4GXJ A;  4I2G A;  5KFF A;  2VA3 A;  3GFK B;  2FMQ A;  4KLS A;  1TFR A;  1ZQA A;  2ZH2 A;  4X5V A;  3ZDD A;  2WTF A;  1JX4 A;  3WFR E;  2R8I A;  4MEX A;  1TKD A;  2ZH1 A;  1NJZ A;  4KLM A;  1K1Q A;  3JPQ A;  2ID1 A;  9ICH A;  5DGB A;  4Z6F A;  2RDI A;  8ICG A;  4RNN A;  4LZD A;  2KZM A;  1B43 A;  9ICM A;  4KLH A;  4RQ4 A;  2AU0 A;  4I28 A;  4RQ2 A;  4YR3 A;  3MR5 A;  1K1S A;  3G6X A;  3RB3 A;  1LV5 A;  9ICT A;  2XY7 A;  2C22 A;  5KFP A;  4XQ7 A;  5KFX A;  4KLF A;  5KG6 A;  2XO7 A;  4ECW A;  3RJH A;  4KLL A;  3THV A;  5CP2 A;  4ELV A;  3TQ1 A;  2F1J A;  4C8N A;  2NRZ A;  4I2C A;  5J2B A;  5HRB A;  5C5J A;  4UBB A;  4MEY A;  8ICW A;  3RBD A;  1NOM A;  4AT7 B;  2ZH9 A;  2HVI A;  3C2M A;  3TAN A;  1WOT A;  4FH3 A;  4QZ9 A;  2DR5 A;  5IIO A;  5KFW A;  4NKU A;  4ELT A;  5KT6 A;  3RRH A;  5EWG A;  2DPI A;  2FPK A;  2IBK A;  4CCH A;  4M9N A;  4YXJ A;  4F91 B;  5KT4 A;  4P4P A;  1XWL A;  3AQK A;  2ZJ8 A;  5IIM A;  2M2U A;  3SYZ A;  3PX4 A;  1ZQV A;  5KFM A;  4DFJ A;  2DRA A;  4F92 B;  3MGH A;  2BKE A;  4F5N A;  2BQU A;  1BVS A;  4DL3 A;  4BWM A;  4DWI A;  4ECS A;  4Z6C A;  5J2K A;  7ICP A;  4RQ7 A;  2KFN A;  4B9V A;  4DQI A;  1R8C A;  4QWE A;  3RAQ A;  1MQ3 A;  3C5F A;  3EPG A;  5IIJ A;  4C8L A;  4FHP A;  3MFH A;  4DS5 A;  5DGA A;  2JZB B;  4P2H A;  2UVW A;  4Q44 A;  4O5K A;  1NZP A;  3C5G A;  2BHN A;  1EXN A;  4YP3 A;  4F2S A;  4B9S A;  9ICE A;  2Q66 A;  5KFN A;  4DF8 A;  7ICT A;  2BDP A;  1IXR A;  1XC9 A;  9ICQ A;  2MUT A;  3AQM A;  5IIL A;  9ICW A;  5KG2 A;  4KLT A;  9ICF A;  1UEU A;  5BPC A;  4QZ8 A;  3ISB A;  4C8M A;  2ZH4 A;  3PW4 A;  1ZJM A;  1LB2 B;  4O3Q A;  1KRP A;  3AU2 A;  4I2I A;  8ICI A;  4X4O A;  9ICJ A;  1JAJ A;  3OVA A;  1U49 A;  3Q8R B;  5DG9 A;  4KLJ A;  4UQG A;  4J9K A;  2BQR A;  2DPJ A;  5CB1 A;  4F4K A;  1BNO A;  4C8K A;  2FMP A;  2ZH7 A;  3PW7 A;  5EWE A;  3QZ8 A;  3V6H A;  4UD5 A;  3RJG A;  1JXL A;  4Q43 A;  8ICP A;  1KFT A;  4XQ8 A;  4RT3 A;  1RXW A;  3ISD A;  4F3O A;  3Q8Q B;  2GWS A;  5KFG A;  7ICR A;  3OHB A;  4QZA A;  4M5D A;  1V4A A;  4AT9 A;  3LK9 A;  2H5X A;  2ASD A;  5DEC A;  1TK5 A;  1TAU A;  1SL2 A;  1L3U A;  3ZDA A;  1F5A A;  4QWC A;  2DR8 A;  3JZ0 A;  4DOA A;  1U45 A;  4ED2 A;  4EBK A;  1SKR A;  2ZH5 A;  2IA6 A;  1SZP A;  3UXN A;  4JV1 A;  3GV8 B;  1B22 A;  2DFL A;  4PHD A;  5KFY A;  3V72 A;  3NYB A;  4E80 A;  1Y88 A;  4EBE A;  2RDJ A;  4DL4 A;  2FLN A;  1S9F A;  3UQ2 A;  1ZET A;  4X4P A;  2DR9 A;  4P4M A;  4P4O A;  4UB3 A;  1MC8 A;  3H39 A;  8ICK A;  4F4Y A;  9ICN A;  3EWA A;  3N97 B;  1HJP A;  4QZE A;  5L1I A;  2P6U A;  4F4X A;  4QWB A;  3QE9 Y;  3OSP A;  4BDP A;  4K4H A;  4M9H A;  8ICS A;  4ECQ A;  4FH5 A;  4WC0 A;  3C1Y A;  4RU9 A;  3BQ0 A;  5L1J A;  3ZD9 A;  2ATL A;  3C23 A;  2PFN A;  4EYH B;  3PX6 A;  1NJX A;  4ATB B;  2ZH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...