4R68A

Lactate dehydrogenase in complex with inhibitor compound 31
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
total genus 115
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r68A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r68A02
2IZZA 1SBYA 4E2ZA 3MJEA 1UUFA 2LDBA 3ZN2A 3CEAA 4M89A 5A9RA 1LA2A 3ZWBA 2VYVD 1AN9A 3CKYA 4DC1A 1UXKA 4ZA2A 4XR4A 2VHZA 2EGGA 2P91A 3IIEA 3QQPA 4I8XA 3K73O 3RD5A 5IJZA 4CLOB 4R68A 1LC3A 5L7YA 3GMSA 1SNYA 1GZ4A 2WMDA 2I76A 3GFBA 1SB8A 1MFZA 3PJDA 4TRJA 1T2DA 4Z9FA 5EMHA 4FGWA 4UEJA 4BO8A 3EGOA 4PLFA 4WOKA 4R1TA 5KWEA 2PD4A 3HFSA 1EVYA 1PEDA 2AG8A 1MP0A 2Y0EA 1YBAA 3KO8A 1U3TA 2WSBA 4KQWA 4IQ0A 4LGVA 1T2CA 2Q2QA 2UAGA 4BUCA 4CMKA 2DPHA 2HKIA 4OXYA 1FK8A 5IG2A 5KVSA 3DFUA 2ZCUA 1ISIA 8ADHA 2B5WA 4CM9A 1NQ5A 2GRAA 3VZPA 4Z0PA 1L1FA 1ENYA 2W8ZA 1RYDA 2GZ1A 4IXTA 2ZB8A 4L8VA 3TFQA 4HNHA 4OO3A 3ROMA 2X0NA 2AQ8A 4BKQA 8LDHA 1EK6A 1N1GA 2DFDA 2PZKA 1V0JA 1DPGA 2GD1O 3IMFA 4YAJA 1CQIA 4YT8A 1O5IA 1P9LA 3KOUA 4Z9YA 3W8DA 3JQCA 3EY4A 1D1SA 4GLOA 5LCXA 5F21A 1M2WA 4J6FA 1KEWA 4CMAA 3ZHZA 1SEVA 4BKOA 5ITWA 4W9NC 2ZYDA 3QVOA 2DLDA 4CM1A 4YJDA 4NBWA 2DBZA 4C4OA 1FMCA 1HSOA 4DPMA 3BTSA 2EP7A 5A3VA 3OETA 3Q2IA 3ZWNA 4BNKA 5BQFA 5KJ6A 3JQEA 2O48X 3NTQA 4MIOA 4PLWA 4UUNA 5DT9A 2PGLA 3OFSA 5DF1A 2OZPA 3Q11A 1E1NA 5AXBA 4E3ZA 1JKJA 2E6UX 3OJ0A 4L75A 3PI7A 3UHAA 2PH5A 1SCUA 4Y6PA 3ZWAA 1PJTA 4ROSA 2WEKA 1XSEA 3S2FA 1NWHA 1P33A 1PQUA 2QQ5A 4F3YA 4IDGA 4GLLA 1HE5A 3VZQA 2IYPA 2OO5A 4W6ZA 2Q50A 5JS6A 1HE4A 3DL2A 3JQ7A 3OJFA 1GTMA 1SZJG 4K6CA 4XWYA 1J49A 3ASUA 4BNGA 1D1TA 2CVOA 1TB4A 2FHSA 1HDZA 5CHEA 3NGXA 4CLHA 3PQFA 1HYHA 2H63A 2G76A 1EQ2A 2Q3EA 3HDYA 1WAMA 2CZCA 2VCYA 4PLVA 3GC6A 2XXBA 4B3HA 4HFMA 2Y0CA 3H5AA 4DA9A 4YA6A 5ILOA 1P3DA 3FNFA 3FWZA 5EQDA 2X7HA 4NPCA 1YOVA 2YHUA 3OIDA 3HDJA 3PLNA 4AJEA 5TLSA 1PJLA 2VUSA 4BQPA 1LDGA 4MVJD 2IRWA 4U0KA 5T8KC 4C7KA 2NQ8A 3EVNA 5B37A 3M1LA 4IMRA 4NU5A 1BGVA 2CF5A 3AJRA 2BD0A 2X5KO 1A7KA 3C7CB 1WZIA 1LDEA 3GT0A 3JCZA 1KC1A 2VNAA 3KLPX 1HDYA 3RUFA 1NR7A 1UAYA 4BQRA 4CR8A 2Q2WA 4R4JA 5BT9A 4QEDA 4W82A 4CM4A 3NT4A 3OJLA 1EFLA 4ZQEA 4BVAA 3K6JA 2Y1GA 2NVBA 4FQ8A 3R3SA 1DFGA 3MJVA 1GYPA 3H2ZA 1I36A 2I66A 4P4LA 1XG5A 3HWRA 3TFOA 2HMWA 2JCYA 4BOYA 3I9OA 4ALJA 1I8TA 4XA8A 3PPIA 1J0XO 3B1FA 3SEFA 1BG6A 1EVIA 1O94A 2WD7B 1BMDA 4BNFA 2QHXA 3OSUA 1ZCJA 4H3VA 2R00A 1PWXA 2ZJ1A 1P1JA 1B26A 2I9PA 1E6EA 3H9UA 1H2HA 2J8ZA 3U5TA 4NG5A 4GX5A 3EDMA 4YRAA 2BI8A 1P31A 4J7UA 5FF9A 3HHPA 4CV3A 1U7TA 2Y0DA 4OIMA 1UAGA 1Y8RB 1GQYA 4ZN6A 3M6IA 1PJ4A 4D43A 3CE6A 1PS9A 3OEYA 4LVCA 4AJ1A 5C7IO 2P9EA 1C14A 1DRUA 3WBFA 2H1SA 4A0SA 3RAJA 1NQTA 4NU6A 4W4TA 4XJSA 3NUGA 1Q1NA 3PWZA 4W99A 1DRVA 4CQMB 1JLLA 5CDTA 1HRDA 5I7VA 2X58A 2DVMA 3JQBC 4WUVA 3ANNA 4OQYA 3QE3A 2EW2A 3OQBA 2YUTA 3MJTA 4L9RA 2I67A 3PIDA 4DIBA 5L4NA 4MKRA 1UZMA 3VAZA 5G4LA 1JVSA 1ZMOA 3D3WB 3D5QA 1GEEA 4DQUA 2FR1A 4MKZA 3L6DA 3WR5A 4RPLA 4ZQHA 5DN9A 1KS9A 3WTCA 3ZWCA 4IMPA 3AOGA 4C7JA 5JCJD 3FTPA 3P2OA 5TQVA 4NZ9A 3MWDB 4AJNA 3KRTA 2QG4A 3SLKA 2P4HX 3CXRA 3OMLA 4J0FA 4JBHA 3VPFA 4B7UA 5HRUA 1C1XA 3QLJA 2X86A 2G5CA 4J0EA 4U7WA 3K9QO 1ORRA 1XKQA 2B5VA 2J3JA 5DBGA 2GNAA 3WG9A 3WMWA 5C3MA 2Q1UA 4AJOA 1SOVA 4EI2A 1PIWA 3OM9A 1OOEA 3HJAA 5MDHA 3FR7A 4MVJP 1Q0QA 4Z0HO 4QO7A 1DEHA 2FWMX 3VVCA 2BKAA 1UP4A 3NX4A 2E4AA 3N74A 2PV7A 4I5EA 3DBRA 4MVJE 2DUWA 2UUPA 3JQ7B 5DDIP 2EXXA 4TVBA 5JMWA 3TPCA 2EKPA 1N2SA 1ZVMA 3W8FA 2D4AA 3FNGA 1QSGA 4M86A 4NQZA 4NBVA 4Z3KA 1HLDA 3ICCA 5DNAA 5AXDA 1LRJA 2ZB3A 3FR8A 2W2KA 1KY4A 2VWPA 3DZIA 2VT2A 3U09A 1JU9A 1G6KA 4PFJA 3QVWA 2CF6A 4INAA 3ZNOA 5GZ6A 5G2OA 4BNZA 2TMGA 5EERA 1YJQA 4FBGA 3VH2A 3EZLA 2ZTMA 3GA0A 5HM8A 3RFTA 4GPD1 2VNSA 1YL7A 5CEEA 4KWIA 3TDKA 2GN6A 1N9GB 4XDYA 1CIVA 2GN9A 1SEPA 3U62A 3G49A 3WNQA 4IDFA 4YDRA 1K2WA 3WSVA 3UH1A 4WCFA 3ITDA 3IL2A 1CJCA 4L0QA 1ZK3A 1KVQA 3IJRA 2QZ9A 4FW8A 4CMHA 1B8UA 5ENVA 1TT7A 3UW3A 4J91A 1TEHA 3UAGA 5IDXA 3AK4A 3ZU4A 2Q1TA 3AM5A 1V3VA 1B14A 1DHRA 4J43A 4YJFA 4YT4A 1S7CA 4BNTA 4RORA 4ZVVA 3GLQA 4E2YA 2JFHA 4I1IA 4B3IA 2RHCA 3Q3CA 5B4TA 4TRNA 5L51A 1X7DA 1ULUA 1PQPA 1NP3A 1P45A 2IZ1A 3ZNNA 4DWVA 1FDWA 3ONFA 1VL6A 3UCXA 1VKNA 2Z1MA 5AQ1A 1Z45A 4RPKA 4BGUA 1YB1A 2PH3A 4IBOA 4NJMA 4ALLA 5JCJA 4D3SA 4RJTA 4BHTA 3CZMA 3PWSA 4XCVA 4EJMA 4IGFA 3K2EA 3KYCA 1YBMA 3DAFA 4TRRA 4R3NA 1F12A 3JQGB 5BR7A 2G17A 2XAAA 5L7TA 1LU9A 2FRDA 1PGOA 3H9QA 4FPXA 3QWAA 1O95A 2X22A 3AUUA 5BSFA 3AWDA 3SVTA 2B0JA 3IUSA 1UDCA 2HLPA 3IJPA 1JTVA 2EEZA 2BFMA 2X0IA 4FR5A 4GQAA 4RF5A 4YVFA 1PL7A 4I08A 1E5QA 3EAGA 2O7SA 2VTEA 4P4GA 3ASVA 3E5RA 2JFFA 4JLWA 2J3IA 1O0SA 1O8CA 2RHRA 3TZCA 3OEWA 5A04A 2CVQA 1Y5RA 3KEQA 3SX2A 1F06A 3NJ8A 3QV1A 3WGTA 2BGKA 3ABIA 3HDHA 3H3FA 3DB2A 2Y68A 2HAEA 3WGZA 3VH3A 3ZZNA 1MXHA 3NDIA 2O3JA 1ENPA 3ROQA 3RU7A 3GUYA 5I7SA 4NBRA 1E1MA 3ZWPA 1K5HA 1LSSA 2GR9A 2Y1EA 2F00A 4MIEA 4MP8A 3L4BC 4XX0A 2JCXA 3K5PA 1XU9A 5IF3A 2OOSA 3E6AA 3I6QA 4TWRA 1NPTO 5KIAA 2C59A 3F46A 1YVEI 3W4IA 3TWOA 3KM0A 5L4LA 4XQCA 4F45A 4CMJA 4Z0TA 2P5UA 1XQ1A 3WLEA 4EDFA 1WMAA 2EF1A 2RIRA 4ND5A 4BKPA 3ON5A 3UN1A 3WBBA 3QWIA 2YDXA 1TI7A 1FDUA 4TZKA 1H6AA 2OBNA 3QY9A 4WCDA 4YJHB 4AL4A 1YWGO 2E82A 4D42A 1Q7CA 3EMKA 1ADGA 4JXKA 1I33A 1YDEA 4XYLA 5I9LA 4WLOA 5DZSA 4UVDA 3NDRA 2B69A 3LC7O 3OA2A 1U3WA 4ND3A 3M2PA 4E30A 4K28A 2WD8A 3FPLA 4L76A 2A35A 3C24A 3GNTA 1NASA 3KYDA 4RCVA 4ZRNA 3GDOA 4RF3A 1HZJA 5TJHA 4WEOA 1NM5A 4Q3DA 3TNLA 4D0RA 3KBOA 2CY0A 1N7GA 4U8GA 3QJ5A 3BMOA 5A05A 4KDFA 3WMXA 5T67A 3CPSA 4NK5A 1DSSG 1DIHA 2NTVA 3H7AA 2DBVO 3L77A 4WLNA 1OZAA 3W1VA 4G81A 4OJNA 2ZQYA 3D3EA 3RU9A 1ZSVA 1E1KA 1ZK4A 3HB5X 4LMRA 4XZ3A 1HYEA 3L6EA 5KVQA 3QVXA 4MDHA 1JKIA 4JK3A 4RPJA 3QIVA 1AUPA 4UEOA 2OXIA 1M6HA 3GZNA 3JYQA 4XGKA 4YEDA 5EJ2A 3BMQB 3RBZA 1OBFO 4LW8A 1V8BA 3AOEC 1F8GA 1ONOA 4GMFA 5G0SA 4JGBA 3TF5A 4AJ2A 3E03A 2X8LA 4PG6A 1YB5A 3FBTA 2OL4A 2H9IA 3RFXA 2CD9A 1DLIA 3HFGA 5ER9A 1W8DA 2FMUA 1LNQA 3OH8A 4IDEA 5G0WA 3RSHA 4UUPA 1IZ9A 3AUSA 4FN4A 4OMUA 3ZH2A 4J2OA 4O5OA 1T2AA 2B4QA 4BNHA 4IGEA 5JYEA 4UVIA 3BHIA 4TSKA 1P1KA 5JO0A 2Z95A 1JW9B 1N92A 2I99A 4N5LA 3DZBA 3F4BA 4DC0A 3GVPA 4CUZA 1ISMA 1NQAO 3GHHA 3KTDA 1WDLA 3ONDA 4A26A 3ZWVA 4XB2A 4AJJA 4X54A 3FBGA 3WYEA 4XRGA 3GVIA 5GZ3A 3S8MA 2IEDA 3AY7A 4JROA 4B79A 1PZGA 5IZCA 4IDDA 4M54A 1PJ3A 4PLTA 4QQRA 3UUWA 1R0SA 4BO5A 2DU8A 3JQFA 2Y67A 3JQAB 3AU9A 4RLHA 4RLSA 1XHLA 1HTBA 3HADA 2FSVA 4K9DA 4E5NA 3AY3A 3P5SA 1UXIA 4CM6A 2RH8A 3PHJA 1NR1A 3GGOA 3GZNB 1K0UA 4FFMA 2B83A 1JVBA 4UUMA 5F3RA 3KSZO 2O2YA 5BNTA 3ICPA 1GUYA 4YR9A 2J5QA 1G0OA 3GRKA 3NJ4A 4DYDA 1DHTA 3AOEA 1ZJYA 4PLYA 1RJWA 5CG1A 2WYVA 3D0OA 3ZWYA 3Q9UA 2V7PA 4G5HA 3VDRA 1MV8A 2HSDA 3RC9A 4BIIA 1HDRA 1ID1A 3K30A 1B8PA 1LQUA 1PX0A 4IUYA 2DPGA 4PLGA 4GGPA 1IPFA 4W7HA 3ZDFA 3PFWO 2Y99A 5JAZA 3R1IA 2CUKA 1DDOA 2JAHA 1UXHA 4CPDA 4TKMA 4EZBA 4CLDA 2Z1NA 1VL8A 3FNEA 1CEQA 4M55A 3S1LA 3P7MA 4UEKA 4Q3BA 1U4OA 4MPDA 3HUDA 5A9TA 3PQEA 3LSYA 2NLOA 5FFFA 2I3GA 2AE1A 5JE8A 3I1JA 1GYRA 2A9FA 3ANMA 4GL4A 1B8VA 3PJFA 3OQ1A 2HO5A 1JAYA 1FDVA 1V35A 3DBHA 4ZQFA 1NYTA 5KCZA 3LT4A 2B36A 2OHXA 3IC5A 2VHXA 2FZWA 1LRLA 4RZIA 4UVGA 2EJVA 1E3JA 2VWQA 3MOGA 5DP2A 5KNLA 1GY8A 4J9VA 4IIUA 3ZWXA 3RBVA 5L9AA 3KYBA 5TRTA 4A27A 3DBHB 2DT5A 1J4AA 1LDMA 2O3RA 3NRCA 3FRJA 4Q3NA 1MC5A 3FHLA 2PGDA 2QRKA 2W2LA 2FP4A 2GN8A 4EYEA 1CWUA 1DB3A 3K92A 4K6FA 1PWZA 3A28A 4W7IA 2DAPA 3T7EA 4OQZA 4FDAA 3DHNA 3I9LA 3R3JA 4M49A 5ADHA 2EW8A 4KTVE 1P74A 4JNKA 1P77A 4NI5A 3VZRA 3P19A 3PXXA 5AYVA 1Q7GA 3WIDA 2EGHA 3LLSA 5T6BA 1HDCA 2J6IA 1Z73A 1QXSA 1F17A 3A4VA 1LX6A 3BMNA 4RF4A 2OP1A 3EC7A 3N58A 3Q0EA 3ZU5A 3ONEA 1GZ3A 4OM8A 1BW9A 3ZWOA 1E7RA 5DULA 1U9JA 4IDCA 3WYBA 3C8MA 3ZCXA 5CDSA 1WPQA 4O1MA 5TJ9A 4FB5A 4YT5A 3ITKA 3O8QA 1KVSA 3ETEA 1QV6A 1XEAA 4EEZA 4N5NA 4QUKA 4IJKA 1MGOA 5DOZA 4J2HA 1ZO8A 5IAAA 1PJSA 2Q4EA 1YOVB 2VZ9A 4CL8A 4N18A 2BHLA 3NDJA 4GI2A 4CUKA 1EMDA 2GLXA 1VKOA 3ZI0A 3QWHA 2C29D 2BGMA 5A9SA 4BGEA 4UVEA 3WFIA 1QYCA 4DXHA 2HQ1A 2FPPA 4FFPA 1U5CA 4BO1A 3DZFA 4EUEA 2YV3A 5DCWA 2DTEA 3F5SA 4L4XA 4P8RA 3VH4A 1ONPA 2VHYA 4BNVA 1U4SA 2F1KA 4QO8A 4QECA 4AFNA 1M67A 4M87A 4NBUA 4ONEA 1BDMA 1ZSYA 4MVJI 2ZB4A 3JQ9C 1IY8A 3JQ6A 2OFPA 4NBTA 3W4KA 2AQHA 1U3UA 3KSUA 4R01A 1HE3A 1WZEA 3ZWMA 4KMSA 5CPFA 1JKFA 1U2DA 3I9MA 4YCAA 5THQA 2FZEA 4PGFA 5U4QA 4P38A 2QRJA 4E2WA 4BKRA 3D5TA 3WOHA 3ZV3A 1OAAA 1K6XA 4CM8A 3LYLA 3JQBA 1LSOA 1OC2A 3EHEA 3GQVA 3PEFA 3DZHA 3DC2A 4HFJA 2OBYA 4WPGA 4Y6SA 2VUUA 4MVJM 3PYLA 1KVUA 1U3VA 4ALMA 1U7HA 5TT0A 4RO0A 2VYVA 3CUKA 3PZBA 3RROA 4M8SA 4FGSA 2AMFA 4DVJA 2GPTA 1IUKA 1N8KA 3CIFA 4RQTA 2J5RA 3LDHA 3VDQA 2JKVA 3A06A 4JBIA 2I5PO 1IYZA 5C37A 2X5JO 3X2FA 3Q9NA 1EVJA 2GO1A 1O9BA 2YHIA 3DFZA 3D4OA 3F1KA 1ZXLA 3AY6A 2RBEA 1F0YA 3UXYA 4E2XA 3TSCA 1HZZA 2C07A 1YQXA 1W0CA 3V2HA 5T64A 3G3EA 5BSGA 4BO9A 2EV9A 1KOLA 4KQXA 4YACA 3MWEB 3U4CA 4BO3A 4NHEA 3BMOB 2BF7A 1ZK2A 3VOSA 2FPIA 4A73A 1G0NA 2RH4A 5IZ4A 3VTFA 5CP8A 2H6EA 3PDJA 2O23A 3Q6IA 1W4ZA 1WDKA 3C1TA 1YBVA 1XU7A 1I2ZA 3GG2A 1QKIA 3F47A 4NDNE 4E5YA 4U6SA 1FDTA 1J5PA 4HFNA 4DUPA 4Y98A 1E0DA 3JYOA 1Y81A 3OHSX 2QYSA 3H9GA 2OP0A 1AXEA 1U8FO 2VZ8A 5DP1A 2O50A 1NTOA 4EUHA 3PIIA 2VWHA 3ZWWA 2CFCA 4CMEA 3JSAA 3KEOA 2GSDA 3E8XA 4RGBA 1U5AA 1E7WA 2BH9A 4Q39A 1X1EA 1YONA 4GMGA 1HDGO 5DOVA 2NADA 2I65A 5FEUA 3QA9A 4YJGA 5JXWA 5GZ1A 3QSGA 4ESOA 4FJ2A 1GYQA 3OIFA 2WD7A 4GBJA 1NAHA 3I5MA 3WWYA 3O8QB 5L4SA 1EE9A 1HL3A 2WWRA 1Z75A 1I3KA 1WLYA 4XKJA 5ER6A 1TT5A 3WS7A 5A1TA 5JC8A 3FTNA 1VPDA 3I4FA 3ETDA 3ADPA 3PJEA 1P1IA 3PRJA 4J3FA 5COBA 1LQTA 3WGHA 2YFHA 3WTBA 1NFFA 3JQ8A 3VPHA 1E1LA 1XDWA 3CH6A 3VPGA 4BMVA 5IN4A 5JDCA 1XGKA 4RDHA 3NAQA 4RVGA 3TJRA 3ROPA 3RJ9A 3U9LA 1X14A 3GH3A 1YH3A 2D5AA 3MJSA 1L7EA 4XJTA 2W90A 3BTUA 3E9MA 3G17A 4GWGA 4R41A 4B8WA 3DHYA 4WASA 2VQ3A 2JD2A 3PVZA 4MVJH 3BHMA 3GN1A 4N7RA 4IPTA 3RUIA 4DL9A 2B35A 1KY5A 3FSRA 3GEDA 1DJNA 3DMYA 1R4MA 4J9UE 3IOYA 3M1AA 5KJCA 5MGBA 1H9AA 2X9NA 3OIGA 4JBGA 1ZIDA 2VN8A 4CMEC 4ZQGA 4HP8A 4IS3A 4WE3A 1PZFA 3WB9A 3AI2A 3GY0A 4R69A 2RAFA 2ZQZA 4Z3DA 5G4KB 1X15A 2PLAA 1GQ2A 4MVJF 2PNFA 1ZXBA 1R0KA 3F5QA 1GPDG 3VKUA 1KEVA 3GN2A 2Q1WA 5KVVA 2HMVA 5HA5A 4IZIA 1LDBA 3LC2O 4AJHA 1VM6A 1R4NA 2NU8A 4XIYA 3TN7A 3A9WA 4CLRA 2POQX 3CMCO 2HMUA 3H4VA 1P1FA 1JWBB 4P22A 3DOOA 1I3MA 3ULKA 2GUGA 1I0ZA 2QRLA 1EK5A 3SLGA 3UGKA 1IZ0A 1IHYA 4CLXA 4PLHA 3NT2A 1A5ZA 4OL9A 4EBFA 2DM6A 3I6IA 1PU2A 2Y93A 4D46A 1YRLA 1DIGA 4U0JA 4DIFA 4WK6A 2E37A 2VTDA 3KV3O 1EBUA 3N7UA 2UYYA 4BNUA 3CZRA 2OORA 2VUTA 5IN5A 2NTJA 1YQGA 3QWFA 4CR7A 4CV0A 1OMOA 1R4MB 1YL6A 3OICA 4E31A 3O26A 2AEFA 1LJ8A 4MJLA 1KERA 3FF4A 3R0IA 4PN3A 2BI7A 5JAMA 3BZUA 4EJ6A 2UUOA 4WNIA 2EJWA 1PJ2A 1RWBA 1UXGA 3RQSA 5TC4A 1U28A 2C5AA 7ADHA 4CM4B 1H6CA 1V6AA 4UVHA 4BO7A 5K6AC 3LK7A 2ZCVA 5EPOA 2D59A 2DTXA 3CSDA 3DMTA 3K31A 2DBRA 4BB5A 3OJOA 1A4UA 3VPXA 5JY6A 3V1YA 3DTYA 2JHFA 4ZRMA 4DLLA 4IQGA 1ZZEA 4IJUA 3QW2A 4OAQA 4FJ0A 3IP3A 4EGFA 2C7GA 1PL6A 1LBEA 3NEPX 1ULSA 5KJFA 5DCUA 4JN6B 4ND2A 1GDHA 3ZU2A 5AOVA 2C0CA 4A03A 1G1AA 2AG5A 4A5OA 3H65A 1VRWA 1E5LA 1BTOA 3WFJA 1LLQA 2EKQA 5DBFA 1CQJA 3BXXA 4Y9DA 1PR9A 1U2GA 4CJXA 4J4HA 1YGYA 3FD8A 3K96A 4HNGA 2AHRA 4JP3A 4MKXA 4PG4A 5TF4A 2WJPA 4W9NA 1LI4A 1DFIA 3JYPA 3BHJA 3DEYX 3GEMA 1SMKA 1MA0A 2IXAA 1I30A 5HTOA 3TZ6A 3TRIA 1YS4A 2O7QA 2CDCA 2FR8A 2NWQA 3MJCA 3LU1A 3RI3A 4GSLA 5HS6A 2IZ0A 3DMTC 5ICSA 4D3FA 2YV2A 4CLRB 4IZHA 2X23A 1CERA 1YJ8A 4AJKA 4E21A 3BMQA 1LC0A 4E13A 1R15A 3WWZA 4YWJA 3GDGA 4PLCA 1QLHA 5IZCC 3MOIA 4J1NA 3SJ7A 5A4DA 3FWNA 2Y66A 1IOLA 1O89A 4HFRA 2Z5LA 3JD3A 3ENNA 2AQIA 3OBBA 5HBRA 1RPNA 3E82A 5L53A 1Y7TA 4DRYA 3B6ZA 2ET6A 2IODA 5AXCA 3A14A 3TZHA 2Y1FA 3Q2KA 5I9MA 3NTOA 5A3JA 3S55A 1VJ0A 4GX1A 2C20A 2QZZA 3HB4X 3ZGYA 5CDGA 3GVXA 1WMBA 1IL0A 3GAFA 2DBQA 1ZK1A 3GPIA 4P4NA 3BAZA 1B2LA 1P1RA 1CF2O 4PCVA 3DONA 3BMNB 3RC7A 5EINA 5I8WA 1Y5MA 2PWZA 4Y8VA 5F1OA 5JAIA 4LRTB 2X9GA 4J7CA 3T4EA 4XQGA 4WOJA 2PK3A 1MG0A 1OI7A 2J3HA 4FFLA 5COAA 3ZV5A 1QLJA 3RWBA 2ILTA 1PGJA 1CRWG 1B3RA 3JQAA 1V3TA 2BELA 3DHEA 5AVOA 5JFOA 1EBFA 4LSMA 1VSVA 2ZK7A 5I7FA 5L45A 1BSVA 4E33A 4L4SA 5TT1A 4RZHA 2NVUB 3D7LA 1PR3A 2OMEA 3ZW9A 3LT1A 4IQ8A 5JO9A 2DTDA 1IHXA 3AFNA 4XYEA 2PTGA 3L9WA 1VJTA 1WXDA 4PIVA 1MFPA 1BWSA 1N9GA 1NHGA 1XLTA 3INGA 4E32A 4TROA 4FSHA 1J6UA 1XIVA 3PDUA 3ZHXA 1CETA 4OXKA 2VWGA 3ZNPA 1BRMA 2NTNA 2P9GA 3U4DA 1VL0A 2HK7A 5ITVA 4A7PA 3A1NA 1NFRA 5T8KA 2R2GA 1UJMA 1LUAA 2R00C 3EUWA 1B15A 5EN4A 3FN4A 5T57A 3PHIA 1QR6A 1X7HA 2JD0A 3Q1LA 1ADFA 1HT0A 4MIYA 1YKFA 4CM5A 5IFLA 1EZ4A 4DPKA 1HE2A 5EESA 1VE9A 3O4RA 4XQEA 4HKTA 1V9LA 1H6BA 1IB6A 1ZSNA 1ZK0A 2NNLD 4DTIA 3JD2A 2GF2A 5TGDA 4DMMA 1GD1O 1EUDA 3JD1A 3JQAD 4QFDA 4IY1A 1YB4A 4AJIA 3O9ZA 4IJVA 2HUNA 1PJQA 3GDFA 3KVOA 3EW7A 4IDBA 3DTTA 2NACA 3BMCB 4XB1A 4HADA 4FIZA 1E3WA 4WNCA 4JJIA 3FI9A 1ZBQA 3UICA 1DC6A 3ZV6A 1T2EA 4ID9A 3JQGA 4E12A 1K6JA 1HSZA 1HDXA 2C7VA 3C1OA 4PG7A 4ALIA 3B20A 4BNWA 2YDYA 4MOWA 1GADO 4B3JA 1DXYA 3QWBA 4PRKA 2YV1A 1AXGA 1ZFNA 5T5QA 4PLPA 3MZ0A 3ENKA 2NSDA 3DOCA 2YYYA 1ISGA 4AG3A 2PKQP 2O4CA 3GR6A 4DPLA 3OA0A 1Z74A 1NVTA 2IXBA 2YJZA 4Y6RA 3T4XA 5F5NA 4XIJA 4J4TA 2HCTA 4XQ9A 3I9KA 3UCFA 2O3SA 3COSA 2PKQO 2D8AA 3PFFA 4NJMB 2IYOA 3U4HA 4QTZA 3GG9A 3I3OA 4WLVA 2X6TA 4EJ0A 4D0SA 4I9HA 3V2GA 4PRLA 1XCBA 4GSKA 2EP5A 3DBVO 4TZTA 2ZIZA 1UDBA 3B1KA 3NKLA 4IJWA 5B4UA 4NH4A 2Y1OA 1PGNA 2VYNA 2EWMA 4LSWA 3RKUA 2A4KA 1WVGA 2ZTUA 4RQUA 1PJCA 3M2TA 4WEQA 1ZEJA 4R16A 2NVUA 3PGJA 4CV2A 1V3UA 1T26A 4NNJA 3ANLA 1YQDA 5LC1A 4PZDA 1FJHA 3WGQA 1DAOA 2QYTA 4LISA 4R54A 4HV4A 4D44A 4J7XA 3JTMA 3WQQA 5GMOA 2J5KA 2V6MA 2P2SA 2ZB7A 4FJ1A 1A7AA 1NFQA 4OSOA 1GU7A 4EUFA 4A10A 1LLCA 1E77A 2PD3A 4FCCA 1U8XX 3L07A 5F1KA 1CYDA 1DLJA 1GV0A 4YAEA 1DIBA 5G4KA 4BO0A 1I2BA 5C7OO 2G0TA 4TMFA 1C0IA 2C5EA 1I5RA 3OECA 2Q46A 4K1LA 1QYWA 4ALKA 2NQTA 4J16A 2AXQA 3VHRA 1Q0LA 1AE1A 2PFGA 1R6DA 1Y9AA 3JQ9A 4NR0A 3WGOA 5ILGA 5KTKA 2VRCD 1RM3A 4I5FA 4LRSB 1SC6A 3MTJA 1IPEA 3F1LA 1NPYA 4NIMA 4DMLA 1A71A 1LSJA 4RPGA 3RUHA 1T25A 2G82A 1R16A 4JJFA 4I5GA 1YO6A 4BL5A 1H5QA 3BTVA 3EYWA 4DBVO 3ETGA 3GFGA 2IEBA 4WKGA 3IDSA 5JCXA 3LVFO 2V65A 3H2SA 2X4GA 1M6WA 1DAPA 4CUJA 3GUCA 5HS4A 3DZJA 4O59O 3X2EA 5JAQA 4CLEA 1VJ1A 4RV9A 3E5MA 3OP4A 1B7GO 1PZEA 2HK8A 1DRWA 1SPXA 1QRRA 3KXDA 4GVXA 2AW5A 1M75A 3BIOA 4D79A 4IIVA 2C54A 1GCUA 5LDHA 3G1UA 4OKNA 3H9EO 1C3VA 3DQPA 4TKLA 1X0VA 3S2IA 1LLUA 1A4IA 3RVDA 4BNXA 2VHVA 4KTTE 3DAGA 1QYXA 1ZEMA 1NXQA 3FNHA 3W6UA 1BVRA 4Z9XA 4J1QA 1HWYA 2O2SA 4WCFC 2ZJ0A 5EL0A 1XR3A 1ADCA 3UFXA 2A94A 4JIGA 3ORFA 5KKAA 4YYZA 3DDNA 4KOAA 3AM3A 2ZTLA 1L7DA 3JQ8B 5BSEA 2D5CA 4AICA 1I3NA 2C2XA 2YFQA 5FWNA 7MDHA 4IS2A 2SCUA 3QRWA 4J1TA 4XYMA 3E48A 1LXCA 2ZATA 4F46A 1EE2A 3MTGA 4MVJG 3UCEA 4XYBA 2ZYAA 1QYVA 5FYDA 1PQWA 1ZH8A 4PLZA 4U6QA 2ZYGA 1TVEA 2P68A 3GHYA 3ZNQA 2HRZA 3JYLA 5CPBA 3D4NA 2GN4A 3SC4A 5TIIA 1C1DB 5JPIA 3JD4A 2PGJA 4CMIA 4KUHA 4UAGA 4U5QA 2Q45A 4E5PA 3I52A 3WNVA 3KSDO 3PQDA 4M1QA 1SB9A 1AHHA 3GF4A 5JMPA 3GNQA 3LT2A 2XOXA 2BMAA 2XF8A 4G2NA 2C2YA 1NQOA 1XA0A 1YXMA 3P2YA 3RCBA 2D2IA 4JCOA 3UVEA 4UUOA 5I8ZA 1EEHA 2HMSA 3GGPA 2GCGA 4I9NA 4YTEA 4NFYA 5L95A 4FS3A 4KUGA 1KC3A 4WLEA 1BVUA 1QYDA 1M66A 1E6WA 4OGWA 4MVJA 9LDTA 4ILKA 1JA9A 4UREA 2VOEA 1X1TA 2AE2A 3NT5A 4AVYA 4H16A 5KKCA 5C5IA 1E7MA 4H15A 3D1LA 1KEUA 2HU2A 3KB6A 1D4FA 4JP2A 1ZNQO 3LF1A 2IE0A 1PJBA 4HY3A 3CTMA 3KLMX 2C82A 4ZICA 2P5YA 2WM3A 3L4BA 4B4UA 1RM5A 3HNPA 3W4JA 4E4YA 1Y8QA 3IUPA 3V1UA 3LZ6A 4I5DA 4RVSA 1R37A 4MO2A 2HDHA 5JDCC 1N1EA 3L6OO 3GRPA 1SAYA 3C3XA 3C7DB 4OOEA 1GUZA 2DUUA 4B7XA 1YL5A 3AUAA 2WYUA 1UDAA 2VRBA 2X9VA 5K0ZA 1E3IA 1ENOA 1MUUA 1ISFA 2UDPA 2VOJA 3RUCA 3PJGA 5DBIA 1E7QA 4IXWA 4YJFB 4QSMA 3G1TA 2PZMA 1EVZA 3HDQA 5U1PA 1B3BA 1C0LA 4CQLA 2FOIA 1E7SA 3GOHA 2HK9A 4UULA 1BXKA 1LDNA 2I3AA 4II3A 1PS8A 1N5DA 3PK0A 4J4BA 5KOIA 3EVTA 4OYRA 3HE3A 3TL2A 1A9ZA 1YE3A 1H94A 2CDAA 3SBOA 1F8FA 4BNMA 5ICMA 1KIFA 5CEJA 1JQBA 5J23A 4LK3A 1UZNA 4Y67A 1RM4A 4B8ZA 5JYDA 3OQ6A 2TMDA 2VZ0A 4BV8A 3RFVA 5CFZA 1E3EA 1Y9EA 4PVCA 4R9RA 3PTZA 3ZHYA 1JWAB 2O4UX 3EK2A 3U49A 1I01A 1T4BA 4OXNA 2BFOA 2Q2VA 1N7HA 5JW6A 4ZU3A 5IXSA 3LT0A 3AW9A 4LMPA 5COQA 4IDAA 1QG6A 3UKOA 3DBLB 4DLAA 3KETA 2YY7A 1MLDA 4YQZA 3WJAA 3NYWA 1GAEO 4XYGA 4Q3AA 4PZCA 1BXGB 5A9SB 5H82A 1UP7A 3B1JA 3O38A 4YAGA 4L74A 5U9CA 2Y1DA 1P0CA 1T1RA 4FFOA 2CMDA 2XPCA 4NK4A 1BDBA 4XDZA 5EIOA 4EITA 1DJQA 3NV9A 3JQFC 1D7OA 4AJPA 1QORA 5G0VA 4Q3EA 1LDYA 4A2CA 2UVDA 3I83A 4J1SA 4D7AA 3LLVA 3B70A 1JDJA 4CV1A 5ENDA 4WLUA 4WLFA 3V2UA 1TXGA 4J49A 2YW9A 4AJ4A 3IS3A 3JD0A 1MX3A 3E9QA 4Q3CA 3WICA 4II2A 1GUFA 1NX6A 4BGVA 3F3SA 1ZKMA 3L0DA 5CEFA 4BKUA 4JJGA 2CDBA 2E49A 2J3KA 3D3WA 4PVDA 3DO5A 3G0OA 3GEGA 4R51A 1EUZA 1LSUA 3GAZA 4O0LA 3BMCA 4BO4A 3GPDG 2YQ4A 1LEHA 1Q7BA 4KDEA 1LRKA 1Z82A 3PLRA 4OSPA 4GAEA 4EW6A 1YDWA 4HBGA 4R5HA 4RVDA 5H81A 3LC1O 1VC2A 4XR9A 1RYEA 3HN7A 4DREA 2AQKA 4D3DA 1MC4A 4XEHA 2Q49A 2FY8A 1GL3A 4K26A 3KHUA 2DC1A 4YJHA 2AEMA 3FCOA 3OF2A 3OJEA 1BHSA 3WQRA 3GNSA 2E48A 2WE8A 3KUXA 3TZQA 2CVZA 1NNUA 2I6TA 1NPDA 1VLLA 1D8AA 4OH1A 1FXSA 3F4LA 3VTZA 1S6YA 3DOJA 4YPOA 3I9JA 1GEGA 4IINA 3VZSA 3G79A 3K8ZA 5G0TA 4H7PA 1MG5A 5JDIC 3RUEA 4MP6A 1RKXA 1W73A 2FSSA 5H83A 4DYVA 1C0KA 3PZRA 3DAPA 4HX5A 4IM7A 1UXJA 2PZLA 3MJ4A 3DWFA 1DC3A 1NAIA 4NFHA 1E6UA 4RVFA 4DBZA 1P0FA 1GQQA 1SOWA 5K9ZA 4LCJA 2EHDA 2PD6A 3PGXA 4N5MA 5IDQA 3L9XA 1PZHA 3MCVA 2BFPA 1TA4A 4ITUA 2AEJA 5CAEA 5B4VA 2GDZA 1E3WB 3QHAA 2Q99A 3QP9A 1AHIA 3DXFA 4JQCA 1DBVO 1CDOA 3DR3A 1DC4A 3ADOA 1FDSA 5G0UA 4HXYA 1FF9A 1K3TA 3RASA 4NJOA 3TL3A 1E3LA 1OC4A 1NHWA 1XWFA 1HKUA 1Z7BA 1P44A 1UP6A 1E7YA 2NU6A 3C1AA 4YAIA 3RKRA 4CQMA 2W98A 1PGPA 5F5LA 4HWKA 4DIOA 1RM0A 3GVCA 3PHGA 5L3ZA 3E1KA 1BXZA 3BYZA 5KVCA 1Y6JA 4YBZA 3RBXA 1H2BA 2Y1CA 1HF3A 5AXAA 1ZW1A 2B37A 3LF2A 1NBOA 4F6CA 5JDIA 1R0LA 1ML3A 2Y05A 3IQDB 2NVWA 1IE3A 1F14A 4PZEA 4TVOA 5TNXA 2DFVA 4R5MA 4CM8B 4YB8A 4LVUA 1DO8A 3JV7A 2WDZA 2V6GA 3L4SO 2NU9A 3V8BA 1OFGA 4YRDA 5IDYA 4FFRA 4YRBA 4QFCA 1Z6ZA 3H5NA 1SO8A 4E5KA 4XGNA 2PY6A 1I32A 5FI3A 2PA3A 2X5OA 2V6BA 4FOSA 1WDMA 3F6YA 2R6JA 2D0IA 2P9CA 3U0BA 3WGGA 1WNTA 2FN7A 4BNLA 3CINA 4KP7A 2FPGA 1JN0A 1MB4A 1H6DA 2X0RA 2YZ7A 1ZMTA 5A03A 2PZJA 3RUDA 5B1YA 1GCOA 2BFAA 4RL6A 2EG9A 2LDXA 5A5EA 1KETA 3K2BA 2P4QA 2VT3A 4GKBA 1JAXA 2ZKLA 4Q9NA 2YHIB 4TQGA 4BGIA 4LN1A 1Y1PA 3SXPA 1R66A 4BNIA 1LTHR 3HQ4O 2Q4BA 2RCYA 2HJSA 1DIAA 2Q1SA 5JLAA 4E5MA 4BNJA 1KBZA 5I7EA 4BO2A 1TLTA 4NFSA 3BA1A 4URFA 1QV7A 3TQHA 1AGNA 3E9NA 4YT2A 4KUEA 1T1SA 2A92A 3VH1A 2QIOA 4HUJA 1ENZA 2O3QA 3STHA 1H93A 3S2GA 4ZGWA 5JBIA 3RC2A 4MINA 5DCYA 5TS3A 5LDGA 4FC7A 4PG8A 3SJUA 3PYMA 1B16A 4NMHA 2O3UA 4R1NA 2O3TA 2YQ5A 1Q0HA 1W6UA 1PS0A 3C7AA 4WGGA 4YQYA 2AA3A 1UH5A 5TSDA 4DLBA 1DFHA 3WLFA 1IULA 4O6VA 2NV6A 3R6DA 3ST7A 2H5LA 4RVHA 1ZUD1 3BTOA 4WCFB 3WYCA 3W6ZA 2X0JA 3H5RA 4RPHA 1KVRA 1XQ6A 5CDUA 4WJZA 6ADHA 3F9IA 4KWHA 3U4IA 5CDYA 1ONNA 2EERA 4N54A 3WIEA 2DKNA 4DQXA 2JCVA 1ARZA 4G65A 1P1HA 4FOOA 1Z7EA 1H9BA 3WGYA 3H6KA 3TOZA 2B4RO 3NTRA 3ZV4A 3HG7A 2JHGA 1GFSA 4CMGA 2JD1A 3PWKA 4GWKA 3WX0A 2GYYA 2WYWA 4CQLB 4CL3A 2NU7A 4L4RA 3S2EA 3U3XA 4CODB 4RF2A 1EDOA 3GGGA 1HXHA 3W8EA 3KYCB 5F1PA 5I9NA 2JAPA 2VRCA 1KVTA 3AFMA 1R12A 2D1YA 2WTBA 5EQFA 3V5NA 2BRUA 4CMBA 5IXYA 4OHUA 2ZTVA 1T4DA 4BNNA 3HZZA 4EEXA 3PHHA 3DZGA 3RIHA 2HMTA 4J90A 2CNBA 3QVTA 3AI1A 3PP8A 2HJRA 3C85A 4XD2A 4BS9A 2OUIA 3WQSB 3ZHBA 2GZ2A 2VHWA 2QW8A 4RDIA 4CM3A 4AJLA 3KZVA 1Y8RA 3O03A 4GH5A 1I10A 5FI5A 3UOGA 1H0KA 3WXBA 4CR6A 2EKLA 5C7LO 4B4WA 4B4OA 1T2FA 1ZJZA 3PHLA 3DBLA 3IKTA 5JC1A 4R3WA 2GASA 2PR2A 3WDSA 2GZ3A 4TRMA 3ZU3A 2D3TA 4E0BA 3RJ5A 2GERA 4JX8A 3V1TC 1TT5B 4I9UA 1BW9B 2JL1A 4GGOA 5KJ1A 4GX2A 4OOFA 1LLDA 1U1IA 2EIHA 2W4QA 4WECA 4PG5A 4ND1A 2VYND 5KJEA 3CMMA 5IDWA 1QP8A 3D64A 5BNIA 3HN2A 5L40A 3EZYA 3I4CA 1X7GA 1K6IA 2BLLA 2W2KB 1PL8A 1I2CA 4KZPA 4XGIA 3WGIA 1DC5A 1I24A 1R4NB 1O6ZA 2GGSA 3E18A 5GY7A 3UF0A 1PGQA 1C1DA 3H8VA 3HSKA 4OKIA 3AI3A 4B7CA 4BV9A 1NVMB 1GZ6A 2IDZA 1A27A 3ZW8A 6LDHA 1C1XB 1HYGA 4BO6A 4XRRA 2XXJA 4FFNA 3INRA 4Z6KA 3I9NA 1GR0A 1M76A 2G1UA 4R1UA 1HETA 3JQDA 4ALNA 4QXMA 5A5FA 4BB6A 3WJ7A 1DIRA 1A9YA 5CG2A 3GK3A 3GVHA 5B12A 3D4PA 5ES3A 4ZJUA 1HLPA 1X13A 3ROKA 4CQMD 1EFKA 4BNYA 3T7CA 1XELA 3IP1A 1T24A 2BGLA 2NUAA 3DBRB 3KYDB 4F6LA 2B4TO 4YJGB 5A06A 2OGUA 1B0AA 1NVGA 5THKA 3VPSA 1ADBA 4CM7A 4QT0A 1Q2XA 4GKVA 1K89A 1E92A 3H3JA 2NM0A 2PKRA 3GMDA 4FD3A 3VKVA 1EUCA 1WP4A 1HDOA 1E3SA 1D3AA 4QX6A 3VVBA 1ISHA 1XYGA 3QVSA 4B4VA 1UZLA 3RUAA 1QMGA 1EDZA 1Y8QB 4BMSA 5JSFA 2HRBA 3IAHA 3NGLA 2QX7A 4E6PA 2FR0A 4YAKA 1X0XA 4CLOA 4S1VA 1MXFA 5HWSA 4L73A 2X1HA 3SC6A 4GVLA 4CMCA 3RC1A 3IKVA 4DQVA 5BSHA 1HEUA 3AM4A 1WW8A 3AU8A 2WE7A 1UR5A 4RVUA 4YXFA 1ISJA 4CMIB 1KEPA 3I23A 3MEQA 4R1SA 5BNFA 3DZKA 3WSWA 2DQ4A 1PSDA 1DOHA 4ZD6A 5A02A 1BXGA 2JJYA 1PTJA 4D45A 3GZ4A 3TZKA 5K6AA 4O63O 1I3LA 4ZQBA 2W2LD 1C0PA 1GPJA 1NWCA 4CM9D 1GV1A 1EQUA 1VSUA 4FC6A 4S3MA 2V6FA 3TOXA 3LQFA 1KYQA 4ZHSA 2CSUA 3FPCA 5JY1A 3PYXA 4ND4A 1VI2A 4R9SA 3AUTA 5TX7A 9LDBA 5L7WA 4GX0A 4DGSA 4MP3A 3INTA 4BMNA 3VC7A 2UV8A 2JFGA 4LCEA 1A72A 3JYNA 3H9JA 5JNLA 1WWKA 4D41A
chains in the Genus database with same CATH superfamily
2IZZA 1SBYA 2A0XA 3JZAA 4NP6A 2C2ZA 2E3JA 2R96A 3LMKA 3CEAA 3HGMA 2XZPA 4DIMA 3EF1A 1N2HA 2AUTA 2H29A 3NTLA 5ALPA 3D7RA 3CPEA 1L1RA 1W5EA 4JJEA 4RTKA 4OI1A 3TAXA 5ALUA 1UXKA 4ZA2A 4JYPA 4QBTA 1JBQA 2VHZA 3ZHQA 2P0EA 2PZEA 1JWLA 2EGGA 1SUCA 3MFYA 3REFA 2ESRA 1SOMA 2Q6KA 3AKCA 3GLVA 3K73O 4HWRA 3RD5A 5IJZA 3V3KA 2AX4A 2AT1A 1WMFA 4KBYA 4QQKA 2BLNA 2M6RA 5EIAA 1E3QA 1GZ4A 1SNYA 4MLCA 2I76A 4RNDB 5CM8B 1SB8A 2PWBA 4JT9A 3PC2A 1MFZA 3PJDA 4JOCA 2JK0A 3CWCA 4X8HA 4ZEWA 1T2DA 5FOWA 4FGWA 3K0FA 4MZXA 1B1AA 3LQ2A 4OQQA 2DXIA 4IDPA 4PEVA 2OCKA 1ZL2A 5ICCA 3I62A 2JATA 4QLOA 3PDIB 4KQWA 2Y0EA 1U3TA 2WSBA 1FP4A 3CFYA 1Y34E 2P8JA 2Q2QA 2UAGA 5UKDA 1QG2A 3VU8A 3PBKA 1FK8A 3WO0A 5IG2A 4QE3A 2EFYA 1L8QA 2A1TR 4R7TA 5KOHB 1Y98A 2WYIA 1BKDR 4I4TF 4JQOA 4QYTA 4BCDA 3VZPA 4Z0PA 1L1FA 3AR8A 3QLEA 4ABYA 1DT5A 3KCNA 4KLCA 2NUPB 4IXTA 5GINE 1JRLA 1KJ9A 3E5HA 2A1TS 3GT4A 3E5NA 2GETA 3S2SA 1RCFA 1B1CA 1J9GA 1ELOA 1V3QE 1IZYA 2GUWA 2G9QA 2DFDA 1XF9A 2VXOA 3HKEA 4G37A 4TKZA 3ZQ4A 2I9KA 3DYVA 3MGBA 1GTSA 3IMFA 2GEVA 1CQIA 1FFXA 3D8SA 4QG7A 2MR5A 1P9LA 3KOUA 4GDFA 1S01A 4HDKB 4OQNA 3EY4A 2ZYTX 3HB7A 5ALYA 4K6OA 4LKOA 4EP1A 3KQTA 4BKOA 2O6LA 1X39A 3AXSA 5JZVA 4R8MA 1JFVA 2C5GA 2VH2A 2H18A 4CM1A 4KO4S 4OBEA 5C2JB 3BD8A 5LLDA 1AO3A 4DV4B 4KQHA 4Z9AA 3BTSA 2EP7A 2BUAA 1YKSA 1CQPA 1TQHA 3JAKB 3O4JA 4M7OA 5K3FA 1DGQA 3T5TA 4H08A 1CHNA 1P5HA 1TU4A 4ENUA 4RXUA 1IN4A 1CNFA 3FVQA 5LMCA 2QTWB 1RQXA 1RWXA 5DT9A 3U4QA 4MYSA 3FOFC 2WTNA 2DFPA 5AXBA 1GN8A 3OJ0A 2QTMA 2RDMA 2K6GA 3N2EA 3RSZA 4OD0A 3I1FA 3LTEA 4D0LB 1SCUA 3DP7A 4UAUA 1B6GA 3OPVA 5ES4B 2ISQA 3T4UA 3L4EA 1PJTA 1Y7PA 3JATB 4TTRA 3S2FA 1DTEA 4ANFA 5AW7A 1P33A 4TVKA 2JDID 2R6AA 4GLLA 3IQHX 3KUUA 4AYTA 2IYPA 2DHQA 2OO5A 4PAOA 5ICFA 4CNQA 2JRCA 4PFQA 1SCUB 1HE4A 2ZBPA 1LGYA 3DL2A 3OJFA 1XCPA 2PIDA 1TK9A 3GXOA 2CJXA 1XXHE 3FWYA 4IIXA 1D1TA 1U7UA 2O14A 3UT5B 1SBQA 4PCUA 4CLHA 5DXFA 1HYHA 1I7NA 1MQ9A 1W76A 5AIAA 5K0GA 1TD9A 1JG6A 2V4ZA 2XWQA 3A9TA 4BFZA 3A2KA 2Q4RA 1O96B 2B21A 4AI6A 2Q5FA 3FNFA 1IHOA 3FWZA 3S28A 1CZNA 4AT1A 4AJEA 4H31A 1SCBA 3E7PA 3OEHD 2QBYA 4QATA 3E27A 3PKZA 4JEIA 5K0NA 4C7KA 3KBBA 2XB9A 2IH4A 1UWLA 2GJ9A 4P83A 1ZNZA 4G63A 5FLKA 4I8IA 2QX4A 2V9ZA 4TN5A 4F5ZA 3M6LA 1H2FA 4MJXA 1IPHA 2QN6A 1NMSA 2CL6X 3L06A 3EBOA 1QAQA 1WZIA 3JCZA 1JILA 3TX2A 1TLFA 4XCXA 3AHHA 4K81B 4NU0A 2ANBA 2BBTA 4R05A 1RHUA 5H68A 1JS1X 5DEIA 2D2FA 1OPXA 5EJ6A 1GRRA 2Q2WA 3CT6A 4M1ZA 1N1MA 4FYIA 5BT9A 5B1IA 4W82A 4CM4A 3EG9A 1QE0A 3OJLA 1EFLA 2Y1GA 2W9XA 4FQ8A 3SIXA 5GADl 1UBUS 5J4HA 2IUYA 3MJVA 4ZC1A 1ZWKA 4CT5A 4DR3B 3NUQA 3T3NA 1WHTA 2C9CA 3GJSA 4EG4A 4Y1GA 1XCJA 1WE2A 1XG5A 2WAAA 3TFOA 3DNMA 2JCYA 5HOEA 2B9VA 3GJ5A 3WL8A 4HBZA 3LXRA 2MT9A 4KMOA 2Z3WA 4H9GA 4U2GA 3FPFA 4DC9A 2RK4A 3NFRA 4PE5B 4ALJA 2YS7A 1OYOA 4WACA 1C3OA 3SEFA 2ZBEA 1VI6A 1BG6A 1LK0A 1R5NA 4PQGA 1EFPB 3L7BA 4BYGA 3G13A 4H3VA 1BZYA 1RWVA 1UKEA 5KTYA 1TA9A 1UOOA 2V7WA 4MSUA 3DE7X 1PWXA 2REXB 2ZJ1A 3CNLA 1C3EA 3ZGXA 4EIWA 1PYGA 1B26A 4KXFB 2AR7A 4DCNA 1XALA 2Z6VA 2I9PA 3L3BA 1H2HA 2J8ZA 1AURA 3U5TA 4P4SA 4P98A 3QFFA 4R9NA 4U4AA 1WXWA 4G07A 4YCBA 2Y0DA 4OLFA 4Y2UA 3KIPA 2GF0A 4ZN6A 4R6XA 1SKMA 2JI6A 2WIAA 2WKSA 1MU0A 1C9DB 2MYUA 4P31A 1NVVR 2CFIA 1PUJA 1N5RA 2FI1A 1QRTA 3UGJA 2X1LA 1C14A 1UEJA 2DFTA 1GAWA 1RWNA 4K3VA 3RAJA 4NU6A 4W4TA 3S2ZA 1J5XA 1JZQA 3EFOA 4BMDA 3FF1A 5CDTA 1U9IA 2PSEA 1VLQA 1XP8A 2P3OA 3G2MA 3H2YA 5AKGA 3ANNA 1PQ4A 2WV7A 1L1QA 1W44A 3Q3JB 3HGQA 2DUNA 5C0OE 4DNXA 5KWSA 3OQBA 4U9UA 2QORA 2R1VA 4DIDA 4ZU6X 3EEYA 3OZXA 5JXIA 2F6RA 5DKFA 1H1DA 4I50B 4OBXA 3AIMA 1JVSA 2A3NA 2Y92A 4HUTA 3G2NA 3C41J 5KSOA 2X5NA 4JGGA 4ZQHA 4YUVA 3WR5A 3ZWCA 3WTCA 3LV8A 1DQYA 5EHQA 3QI7A 1KI8A 2L69A 2ODQA 4P81A 5TQVA 1CEYA 4KRYA 2QL9A 4IIJF 1KZYC 2QYOA 2OHGA 3G8AA 3KRTA 5HMLA 3BCHA 3CW8X 2ZRMA 4I50A 3OMLA 5ICEA 1T9GS 4MR7A 1IRXA 1M7BA 3HJBA 1NLUA 1PW7A 2N1MA 2QD3A 3DFMA 3KQPA 4J0EA 2ZU0C 1ORRA 1XKQA 5EZYF 2B5VA 2XCIA 2J3JA 5DBGA 3FPEA 1VE3A 3WMWA 4ZJYA 2DFKB 3SC3A 4WXHA 1SOVA 1TADA 3F74A 3OM9A 4D9CA 3M4XA 5MDHA 4MGEA 1YFZA 2Q6IA 4XFDA 4F38A 3FR7A 4NOLA 2I71A 1ETUA 1Q0QA 2EHJA 3MGKA 2ZWMA 4JDPA 4TS9A 4GE0A 3OMXA 1UP4A 1V5GA 2ZZNA 4HWTA 1HZZC 2DQYA 4LOLA 2IFTA 3A6GA 5EIFA 3FSGD 1E4OA 4JUDX 2I4TA 2X8JA 3EVBA 5EJFA 1L5OA 1N5LA 5GIOE 3KSBC 2WJ4A 3QX7A 4DANA 4GR4A 2F3PA 2DUWA 5JD5A 4UOQA 2EXXA 3SEZA 4CEJA 4PZUA 3GLSA 5JMWA 5IJXA 2D4AA 1DG9A 1QSGA 4MCIA 2NUTB 5K3CA 4ZEXA 1FFAA 3QJYA 4X66B 4NQZA 4TSFD 3VNBA 4LF7B 3EWIA 4MUBA 4NBVA 2YXDA 1AS2A 2IYYA 5ED0A 1B42A 4QJ4A 1K5PA 1JHQA 4LPKA 5DNAA 3UJPA 3NFYA 5AM2A 9MHTA 5H9VA 1KY4A 1IN8A 3A70A 3O8BA 3C6XA 2OZVA 3DZIA 2ODPA 3QVWA 1SUAA 2CF6A 4RIFA 4Q4HA 4KREA 3O8RA 4OG2A 1RRCA 3VH2A 4BJ6A 3EZLA 5HM8A 2AEEA 2A9QA 1DWUA 4TX1A 5EXEA 3ESQA 3DE3X 2CJWA 4OP3A 4R0VA 5DGDA 1TUBA 3TDKA 2I7VA 4ESHA 2PPVA 2C1XA 2HQRA 3N87A 3EUEA 3O84A 2BFCA 1PR0A 1QB8A 2JGNA 3G49A 3LY7A 3P9YA 4IVQA 1FNSA 4L2IB 2BJHA 3IT1A 4IDFA 3W5CA 1OWOA 1GXSA 2K7FA 1G18A 1K2WA 3PPYA 4JY7A 2IC5A 3KHTA 4WCFA 1RYBA 3ITDA 4O4IA 4C3OB 1NW7A 2A5JA 4ZZ0A 3D0QA 5KOYA 2C58A 3UW3A 2RH5A 4OFBA 3AM5A 3VR3A 3EARA 4UHBA 1P2TA 1V3VA 3IBYA 4MK4A 1B14A 4NEGA 3CGWA 5AVZA 3ITNA 4J43A 3BIJA 4YT4A 5C5DA 1JHDA 1S7CA 2PX6A 1J2RA 4RACA 5HGXA 4PNZA 4E2YA 3KWJA 3GLQA 1D1QA 4AUNA 1XXHA 4IRUB 3KYJB 2BZGA 3Q3CA 4TRNA 4UATA 3CA8A 1XEWY 4MS4A 2WYHA 4W5JA 2OHVA 1DBIA 4LI3X 4OQPA 3PEWA 1EKXA 5KB3A 3OZBA 2EEPA 2ECQA 2QPAA 2UYGA 2FV8A 3C8DA 3IR7A 2QAGB 4X7PA 2PRSA 2M6KA 1AH2A 1VL6A 4GSYA 2V4MA 2OBFA 5FBZA 5AQ1A 3KJGA 4MVCA 4RPKA 4OI2A 5C7YA 1EU1A 2WHQA 4IBOA 4NJMA 4QM7A 4CVNA 3D8BA 3CZMA 1V1RA 3ZGZA 1R3UA 4EJMA 4Q6WA 4WAUA 3DAFA 1IATA 4TRRA 5T3YA 4R3NA 1F12A 1FMTA 2H16A 3C3PA 3U3ZA 4EPVA 2XRMA 2G17A 1H2WA 2XAAA 4X60A 5AM0A 2FRDA 1E4YA 3QKWA 1R6AA 4FPXA 2BFEB 2WF9A 3AUUA 4P08A 3CCFA 1DX4A 4WBSA 1T1GA 4ERXA 1K8RA 4WA7A 1UDCA 2B4KA 2HLPA 4FR5A 1BXRA 4MMZB 3M5PA 4I0WB 5JVDB 2TMYA 3LP6A 2XX3A 4J1TC 4I08A 5FUMA 1X38A 1TQ8A 3H11A 1MBZA 3LPMA 4GI3A 5CX1B 2I7XA 1M34A 1XLUA 1RPTA 3HHEA 1IBCA 4MV6A 3ASVA 4YCDA 4OB7A 4AS3A 5AI0A 2FVYA 3NGMA 3BH0A 4RH3A 3TGLA 2C4WA 4JLWA 3BJEA 4ZV9A 3VBCA 4BKMA 1PN3A 1Z62A 3OEWA 1SRRA 5J2TA 1YR9A 3HI6A 3E9RA 4HQNA 5JCOC 4JJ6A 1EFRA 3ZXYA 3SX2A 3QV1A 3NUZA 3WGTA 4CKBB 3HDHA 5IVDA 4B84A 4B2YA 2HAEA 3WGZA 3VH3A 3ZZNA 3TNYA 3NDIA 2O3JA 1D03A 2HNAA 3ANXA 4X63A 3RU7A 3TTWA 4ARIA 4NBRA 4MA5A 1V8OA 1N2JA 3V7FA 1KZ9A 3MT8A 4FKZA 5K4GA 1R9NA 4BQQA 1OGIA 4D4KA 3K5PA 1AKTA 1N6IA 2EL9A 3EXG1 3E6AA 3I6QA 1XZGA 3KQNA 3F46A 2QUKA 3GFVA 2H4WA 4L50A 2NV2B 3W4IA 2X77A 2YOHA 2IF2A 3ZZUA 4UTVA 2OOKA 1ZA1A 2B8TA 4Y6QA 1VMIA 5A5DA 5L4LA 1VYVA 2VG8A 3CUWA 3BIWA 4OV6B 4YX9A 1RZUA 4I4IA 3WC4A 2X2FA 5BW6B 1EBBA 1Z07A 3H5OA 5AKHA 4GMHA 2P9FA 1V5EA 4ND5A 4DV6B 1QFXA 3ON5A 4P54A 3WBBA 3QWIA 1AHPA 5A5VA 1TI7A 2DWCA 2WFLA 4Q3LA 1PR1A 3THRA 1HK7A 4TZKA 2V7QD 4ZHQB 1H6AA 1GKLA 3C5EA 3DUWA 2OBNA 3A27A 3QY9A 4D42A 1YAJA 3VNUA 1GXSB 5AJYA 3SGLA 1SU7A 3WISA 1Q7CA 2BSAA 4N4AA 5K2OA 3RARA 3BE6A 1D0VA 2I2WA 4AZWA 3WWDA 4RPCA 4WLOA 4ZYZA 4RABA 3DTVB 3IB3A 3KR0A 3LPDA 1Q21A 3LHIA 2B69A 3LC7O 2KBFA 4ND3A 1Y3IA 3M2PA 4UNQA 2D2VA 3FPLA 4K2AA 4AJ9A 4LHZA 3TNFA 5FA6A 2A35A 3PVCA 2FPSA 4FNOA 4GI1A 4RD1A 5EE9A 1N78A 3OT5A 4MW9A 2WA1A 4OHPA 4RF3A 4DDUA 3EXEA 2QL7A 2QRPA 3HCFA 4ZCMA 1HLFA 1WTCA 3PUVA 1NM5A 3HV0A 2Z4RA 5DLPA 4D0RA 5LP6B 3C6BA 3KBOA 2A2ZA 4KH1A 1N7GA 4LZOA 5CA1A 1MIOA 4U8GA 1FJGB 3HJHA 3D6TB 2C1ZA 3VSEA 3QOFA 3CPSA 5F76A 5AOAA 1DIHA 2ETVA 4G85A 5I8PA 5AESA 1QYIA 4WLNA 3W1VA 4G81A 3AXTA 1UCFA 3JR7A 1XTRA 2W8BB 1ZSVA 3C6QA 1E1KA 2F1HA 5D00A 3HB5X 1THZA 1QKKA 1HYEA 4LMRA 2Q6TA 1G2IA 5ALEA 3QIVA 2OKGA 1NN5A 4I4CA 2P65A 4UEOA 2OXIA 4YEDA 3ROEA 1QNFA 2OAP1 3EASA 4LW8A 2HZBA 4TUYA 3AOEC 2DR2A 1ONOA 1CRZA 4GMFA 5G0SA 5EKTA 1U5BB 4BAUA 2CGEA 3JZFA 4LI0A 4OREX 4AJ2A 2IPAB 3H8SA 1IY2A 1G2OA 5LYJF 2JLZA 4O1IA 3OM8A 1AUOA 1SVMA 2OL4A 1Z4LA 4N3BA 4U2FA 3RFXA 3UJ3X 5JRDS 1D1PA 4C7XA 4EG8A 1MVOA 4NXMB 1DLIA 3LHKA 4I3FA 4IICA 1JHOA 5ER9A 5I9IA 2FG6C 4QUIA 1LNQA 3ICQB 4B3GA 5G0WA 3P96A 3ZY2A 4DRXA 1IZ9A 3AUSA 4FN4A 1NN1A 4OMUA 4J2OA 3AL3A 1T2AA 2WUGA 4O5OA 2K4MA 4EW1A 5MFZA 4BNHA 3G7UA 4IGEA 3GRFA 4OHWA 3BHIA 1XQVA 2IHVA 3E9DA 4M21A 1GFWA 4QARA 1N92A 4N5LA 1H5NA 4NG4A 4B73A 1OA0A 5CW2A 4DC0A 3BICA 2PEZA 4D96A 1W581 2SBTA 1B6RA 2NVOA 5IYZF 3KTDA 1QH8A 3LUJA 4LZJA 3TQRA 4EJSB 5G1NA 4KN5A 1HM5A 2PL3A 3UKJA 4AJJA 1DTSA 1Q1QA 4C08A 2AN5A 3DAHA 1U8ZA 4Y6GB 4HAVA 3DZCA 5B2ZA 4QDXA 1PZGA 3FX2A 3G0IA 4IDDA 2WU3A 3HKBA 3SXJA 5B58C 4Z1OA 3C8ZA 4F3NA 3ANYB 5HFNA 2XB8A 3AU9A 4ID3A 5FPTA 4RLHA 1UBHS 2XTAA 3G9XA 1XHLA 1NBEA 2BKVA 3IOBA 3TOSA 5C1OA 3GI1A 4YAUA 1UQTA 5BSMA 3BWYA 1NYLA 3BJMA 3P5SA 2W4IA 5ECGC 1ODCA 3G0GA 3V4FA 1AK1A 3MTBA 3LD9A 3PHJA 3GGOA 4BWGA 3Q87B 1DXOA 1JVBA 1FP1D 3AR5A 3N8GA 4B87A 2OBMA 5F3RA 3KSZO 4N0PA 1SXPA 1BQEA 1GUYA 2CLLB 4YR9A 1DO2A 3CB4A 3LCVB 4DDHA 3VDNB 5DSTA 2XRZA 3A05A 2D7CA 4MUKA 1Z0DA 3AOEA 1C1YA 5DHSA 4DABA 3LOPA 4PLYA 2FN3A 1EGMB 1FRNA 3OPNA 3D3KA 3D0OA 2BMWA 2VH1A 5E9JA 3KLOA 4LJ8A 4FN5A 4QHYA 1HDRA 3ABZA 1D6MA 3DWEX 2ST1A 3B9BA 2F8TA 1LQUA 3JASB 3D8HA 2VDUE 3LM8A 5FWDA 1FPMA 2ASVA 2DPGA 3UG6A 1Q5PA 1JDSA 5C8VA 4GGPA 4H3KB 3X1WA 2QJTA 3WSTA 4EW2A 3KKQA 3GEHA 4KR2A 1PAUA 1E6CA 2Y99A 4LHXA 2VPPA 2CUKA 2JAHA 2Q9UA 3LRTA 3NIFB 3LPCA 3Q85A 4TKMA 1V9SA 5E7JA 4CLDA 1I3CA 1CEQA 3IIMA 1X9IA 3GLGB 3WRWA 2P2YA 5LP6A 1RRVA 1YS6A 1U0SY 2P1RA 2QXYA 1T0IA 2QUHA 3SZGA 4N40A 3LSYA 2NLOA 5FFFA 5EHIA 1UBCA 2AE1A 3D2LA 3TRKA 4B6RA 1Z5WA 1GYRA 2YV4A 1T5HX 4PPFA 4QGAA 1B8VA 4U2DA 1Y3BE 5FHRA 3TEJA 1JAYA 3IEUA 2OCGA 4K9MA 3M4YA 2WAYA 4ZQFA 1E3TA 1R0CA 3EVGA 3ZDYB 4D0NA 4BQEA 3UQYS 3I01A 3STYA 5F52A 5HKOA 4KK3A 3IC5A 2Y77A 2O7RA 2OHFA 4WESA 2C4MA 2PRYA 1FOEB 2H0QA 2WNIA 1GVNB 2Q0QA 2P5TB 1K7EB 2QD4A 3LGSA 2G0AA 2OYSA 3FH0A 4L78A 3OQIB 4EY4A 1SK9A 4QQFA 3IE0A 1TUEA 1WQ3A 4JOQA 1SUPA 2MSKA 2BGWA 3KYBA 4H0NA 1LLFA 3EXIA 4A27A 1Y4SA 1LDMA 2C9DA 2O3RA 3DMPA 2VNKA 3FHLA 1JDTA 2FZ4A 2GN8A 2PBRA 1DB3A 2J3DA 4K6FA 2OK7A 4OGLA 3V8EA 1TVKA 5BV1A 1V4BA 5ECWA 3A28A 4D4LA 2V9PA 2VXCA 5LJIA 5JXHA 2ZSJA 2A9JA 5EWMB 5JNTA 1FYEA 5EEGA 1ECJA 2LE0A 4G0ZA 3I9LA 1CSEE 2G4LA 3M1YA 3QLTA 1P74A 2DLNA 4KTVE 4C5BA 2O8CB 3PXXA 1VKZA 5BORA 2IQIA 4FCTA 4G0WA 1P6QA 3PX2A 2ZE8A 4A0FA 5K6TA 1JB9A 3QVMA 5T6BA 2JLYA 4DA4A 1Y6ZA 3BMNA 1R8JA 5E9AA 2ZROA 1WW2A 4UBJA 3GH1A 2P6PA 1R5BA 3HBMA 2N0SA 5DMHA 1KARA 5FFNA 3N58A 3Q0EA 5BN5B 4EKIA 4PZYA 4OM8A 1L7RA 5E6UA 1E7RA 5EJIA 4YS6A 5DU2A 4QEKA 3LUCA 2QRGA 1DJOA 3O2NA 2YASA 5AQEA 3WYBA 1I4OA 4E03A 3QMPA 3GLGE 1WUTA 4FB5A 3EPLA 1JPVA 4B40A 1P2VA 1QHNA 3SDBA 2IHZA 2C96A 4RFVA 1OYWA 2VDRB 3UJBA 5DHUA 1PZNA 3RSFA 3M49A 5ADVA 2QRNA 1ZO8A 3HU3A 4HI0E 3A0RB 4YBRA 1YZUA 5CAEB 5LR6A 2VEOA 3L7KA 4N18A 1U0EA 3CLUC 4R2XA 4OHXA 2O8EA 3VR6D 1EMDA 3GFPA 4C0JA 4BGEA 1I5EA 4UVEA 1UAAA 1QYCA 1Z17A 2X15A 1MEJA 1ZX1A 1VTKA 4FFPA 4FT2A 2Z09A 4BE7B 4DCCA 3DZFA 4EUEA 3IOEA 4FIDA 2ZITA 5JROA 1MJGA 1QUFA 1IJFA 2XGGA 3JALB 4GHWA 2C2KA 3R4VA 4TLBA 1YUBA 3UY4A 3HBLA 3ZVRA 4PFKA 5A3RA 5CVVA 2TS1A 5CVJA 3RRFA 2XADA 2ZR7A 1NF8A 1F2TB 1MB3A 2VHYA 4BNVA 4IHKA 2F1KA 4JENA 1XEFA 4CKEB 4QO8A 1YCFA 5JTUA 3TW8B 2B7LA 1M67A 2QP3A 1SBCA 4M87A 4NBUA 5ALFA 1UKAA 4AYXA 3URKA 5D85A 4IEIA 4UCWA 3K70D 2W2XA 1SVKA 4KO1S 5FBKA 4BMZA 1HE3A 3P9SA 2XMZA 2QW1A 3A6JA 3CNBA 1K66A 1WZEA 2ORIA 3KG2A 3R3UA 4KMSA 4N49A 1VCHA 5CPFA 3A6KA 3ZWMA 2ODEA 3K0SA 1SBIA 3TAUA 3N6VA 2J7PA 5BRAA 3TW8A 4PGFA 1T13A 4JBLA 2IQ5A 4GPBA 1RRPA 4Z4HA 5EHZA 2WVGA 3D5TA 1FU8A 1OAAA 3LYLA 3JQBA 4QOIA 3TLXA 4M83A 3D5EA 5DE3A 5K8JB 4OPMA 5K4AA 5HCUA 3OQMA 3IUMA 1XZDA 3K05A 4F8JA 1Q7RA 1UJ2A 2WWWA 3O7MA 3HR4A 3MPOA 1E5XA 1E8MA 4MVJM 2KLBA 5E1OA 3VOBA 4GP7A 1U3VA 1GG8A 4HH4A 4H18A 1HE1C 4G0OA 5TT0A 3M6XA 3PZBA 4AMZA 1J24A 1ODKA 1PFWA 4N3NA 2Y1WA 4HD8A 4R7GA 4DY4A 1CJTC 1GTL1 3DF9A 3I5UA 3L7AA 2BEJA 1WXQA 2YJNA 2OV6A 4L9WA 1YK0A 2QTRA 3ADBA 2AB0A 2J5RA 3LDHA 4JOSA 2AHOA 4UHFA 3TXYA 1FBNA 3VDQA 2JKVA 4JBIA 3NM5A 1ND5A 2I5PO 4LJ9A 1GDDA 1EAYA 1SVIA 2J09A 3KJEA 3HVUA 1Y4ZA 3IQEA 1Z6AA 1ACMA 3DWGA 1O77A 2BPOA 2R7KA 2IOQA 3EXAA 2NV0A 3X1KA 4ZT4A 3D4OA 4HEA6 2Z3VA 4HCJA 4BLOA 3IAS1 2Q3MA 2C7RA 4YAOA 2BR4A 1J39A 2C07A 5LA6F 2P2DA 4CDGA 3VBEA 2C3YA 4HLDA 4EMSA 3V2HA 4FHCA 2PMDA 1F8YA 3G3EA 4S24A 3EGVA 5BSGA 1VBKA 3DPIA 2C5HA 4KQXA 3U4CA 3I30X 4BO3A 3TYXA 2CJFA 2ZUUA 1ZK2A 3O8OA 5IKXA 1Y1RA 1E20A 1G0NA 4A73A 4BMOB 4EI8A 4AM8A 5T7BA 3K0BA 2A3RA 2H6EA 2TECE 3CUTA 4FGKA 2KJQA 1NU6A 4JUBA 4HAWA 1FNDA 2OGSA 3PUZA 5AJUA 4HVLA 1I2ZA 5KNCH 1QKIA 3BVPA 3ETLA 3PNMA 3F47A 4MDFA 2E4UA 2R2AA 4NMLA 5LQUA 1PT8A 3DLCA 1Z6TA 4AY2A 4HQKA 4A0GA 1P39A 3KT0A 4X41A 1RXSA 1DUIA 3P0HA 1GR1A 5AI5A 5K3BA 1Y81A 1DEXA 1QO0D 2FMXA 1CR6A 2Z43A 3NBKA 1T4MA 4OKSA 4Z99A 4FCWA 3HBAA 3OZRA 5F7XA 3ZXUB 4DLZA 4EUHA 1DTWB 1L5YA 5FWXA 2IYTA 2VWHA 2V8BA 2UUCB 1WL8A 1XNHA 3K0FB 4YV0A 4ZYUA 4KW7A 1U5AA 1Z29A 1EHIA 2VK2A 1BD4A 4XOUA 3H1AA 4LJSA 1NJFA 4MUFA 5HCNA 3ZJ5A 2V1UA 3KT8A 5FEUA 4I50F 3E9EA 4NARA 2J0UB 1R9GA 3L82B 4S1PA 3NWOA 3U3RA 3OWOA 4PNPA 4X00A 1R6VA 2GESA 3OIFA 5HQ3A 5AVVA 1NAHA 3I5MA 4JUIA 3O8QB 1C50A 5REQB 2WWRA 4XX0B 3DCNA 3HABA 3T9AA 1TT5A 1NJ1A 3PFNA 4HB4A 1QVRA 3AUJB 3FTNA 4JBNA 2J0UA 1C4KA 1E2HA 5JAHA 1EG2A 3U0VA 3ETDA 1O6GA 1N7JA 3V1MA 3PRJA 3L8GA 5AW9A 3F9RA 2J07A 5HQ3B 4RKWA 4KXXA 1XFDA 4N9WA 1E1LA 1U7XA 1XDWA 4R81A 1FE8A 3RVOA 1NVWQ 4AMGA 1E2MA 2N46A 1HLGA 2JAUA 5FPKA 5DLQC 4ZYLA 2IOFA 1XGKA 2ECKA 3HACA 4EYSA 4RVGA 1Z63A 1I4EB 3K9CA 3ROPA 2B4AA 3WHLA 5HSGA 3OHMA 4L3OA 1ZMBA 1MT0A 5IJ0B 5HIMA 4Z4QA 1OT3A 3MJSA 2ZJFA 1L7EA 3HV2A 3E9MA 4XJTA 3JAKA 1XP5A 4Y1RA 3TLZA 4TTTS 3JVUA 4BFLA 1IXSB 4DJJA 4WY2A 4IUCS 5ESRA 4X1IB 2AIRA 5C1IA 1WCIA 1KY5A 3IPXA 3QFRA 4M1MA 2YTZA 2R1VB 2DLCX 1DJNA 3WQHA 1R4MA 5MGBA 1YZQA 2FW8A 3L02A 3M1AA 3I01M 5DW0A 3MJDA 3AL2A 4I4LA 1IQ0A 2QSJA 4TMTA 4IS3A 4WE3A 4V1CA 1JL3A 3NBYC 1CQZA 2GZAA 2WABA 3AI2A 3GY0A 5J2TF 4X1IA 2RAFA 2YHAA 4WV3A 1SHJA 2NU8B 4YXWD 2PLAA 2IH2A 1T4CA 4M99A 3ECAA 4YRSA 5H8WA 3VKUA 2O0HA 2X13A 3GN2A 4YRFA 5IEJA 1ADJA 2QEQA 1X7XB 3O75A 3KOWA 5HK8A 5DTRA 1MQ8B 2YFKA 3JARA 4LQ4A 3W5JA 1LZKA 4KE9A 2B2XA 1IN6A 1R4NA 1RQRA 1CP2A 3FHCB 3EGWA 2NU8A 1T8PA 4TYWA 2HADA 1DBRA 2HFJA 2HMUA 1T4CB 1YZVA 3FROA 1TECE 2QD5A 3A6EA 3DL7A 1L7VC 2ARKA 1NVBA 4KAFA 1XL1A 3TVYA 1Z22A 2JNWA 4CQNA 3HEAA 2XOEA 3PFGA 4ADSG 2O0JA 3K1TA 3ULKA 3VX3A 1ZA2A 4WN3A 4HLCA 2PIAA 1IHYA 3L40A 3RF6A 4CLXA 2FRDC 4CTMA 1H2YA 4AG6A 1UMBA 3QFHA 3I6IA 2Y93A 3CRQA 4CCYB 2G1PA 4ZAVA 1T43A 1G5TA 4LDJA 2FDCA 1VPVA 1OWMA 2OLKA 4EPRA 2UYYA 4F3CA 4E14A 1U2GC 1E1RA 5DLYA 1W4BA 1SN7A 3NEYA 3IUNA 3H87A 2BMFA 3K0KA 5D1NA 5AK3A 1PT7A 2NTJA 2AFVA 4WXYB 3N8HA 1BCRB 5EP4A 2RGAA 3OICA 1P29A 2AJBA 2GFQA 1GGNA 2AEFA 4KK4A 3L7YA 5DTJA 1KP2A 2A5FA 2E2WA 3KAJA 4HR7A 1NXPA 3S68A 2E6KA 3NOQA 1MTZA 2EJWA 1Y3HA 2QY9A 2X2OA 5EI5A 1IEVA 2TYSB 2ZSDA 5EJ4A 1I7QB 1TMYA 4IXDA 3CX4A 3NORA 4UASA 1YK1A 3MPUA 4RMJA 3L8MA 3VX4A 4CM4B 1DX9A 1RFLA 3K9WA 3O2JA 4UVHA 1ZM9A 2YUIA 3W79A 5EPOA 5HG0A 2D59A 3QUTA 5INTA 4LOJA 1X7WB 1XEWX 3WGVA 3OJOA 4MKHA 3T9BA 4KHZA 1A4UA 3V1YA 1KYIA 1BC5A 1CR1A 3DTYA 1GPAA 1RXEA 1XEXB 3BOSA 4DLLA 3QKSB 4Q9KA 5LBIA 4G4SP 5K8LA 4G0NA 1RYMA 1ZONA 2RK6A 4RDXA 3C39A 4O4IB 3RF7A 2XMCA 2V98A 1Z2OX 1VLJA 1UFVA 3GGJA 3AIIA 2AVNA 3NEPX 1KI4A 4M0EA 1CJVC 3WIVA 4JN6B 1GDHA 3B1XA 2QTVB 4TUYF 5AOVA 2YVLA 2CLDX 2C0CA 5KQRA 1VLHA 2BEUA 2FLWA 4Y3UA 4CL0A 2F3TA 3N8KA 4D9FA 4DQ0A 2AG5A 4ZCTA 5J43A 4HDMB 5KTNA 1CYEA 4LJKA 1JLMA 1N36B 5CFMA 2IPOA 1NE7A 2ZIEA 1VRWA 3R41A 1P81A 2ZE6A 1E5LA 1N6NA 1NE2A 3WFJA 2KWIA 3CRRA 1OSNA 4FMCB 1WOMA 3UEOA 1U2GA 3ROTA 3U81A 4BFUA 2X4LA 4JLVA 4C0WA 4CJXA 3DE1X 3R3WA 1PBTA 5JV5A 4J4HA 3UFXB 1PDOA 1YGYA 3FD8A 4IOLA 1P4GA 4OXIA 3FCSB 3IODA 1QGUA 2H8GA 4R8RA 1XRQA 5TMDA 4JP3A 5DISB 3N2KB 2WUWE 5A6SA 3J7AC 4QXRA 1UEIA 1T8RA 3EFOB 4W9NA 1U04A 2E1PA 1LI4A 3GEMA 4CGZA 1UOPA 1XKLA 4HRAA 1GITA 2W2PA 1MA0A 2IXAA 4ER7A 4PYJA 3COJA 3H8JA 5CUQA 2ZI4A 3TZ6A 4LX8A 3AO0B 3A26A 2CDCA 3REGA 3MHTA 2B7BA 2FR8A 1QIHA 4NATA 3MJCA 4LX0A 3UXEA 5JHHB 5K8CA 2H00A 5HS6A 5ICSA 1GPWB 2H9AA 3R0XA 3W1EA 2D00A 5BVHA 3B3GA 1KI6A 3RTBA 4ESEA 2WKPA 4EATA 2Y1KA 2YBDA 3UWPA 2SECE 4E21A 1GA1A 5HEKA 4ZCRA 3ACBA 3ZBTA 3WDMA 2XYQA 1IVYA 3WWZA 2J5XA 4C0QC 2BGTA 3GDGA 3I8XA 1NRJB 1KL7A 4FR0A 4J1NA 3R7BA 5KSWB 4MRPA 3SJ7A 4CF5A 1DPFA 1F1JA 1YJAA 3FWNA 4J0KA 4M1SA 1F3OA 3OTGA 4YJKA 2IZ6A 2Q62A 3I2FA 1Z7WA 3ENNA 2AQIA 3JD3A 1NXVA 4IHJF 4LJYA 3VRHA 2BMDA 4IWXA 3JAMA 3K0CA 5L53A 3TZLA 4HLUC 5CXXA 4DRYA 2QNRA 3H2JA 5AXCA 1FC0A 2OQVA 3Q2KA 3T38A 5FV4A 4IFTA 1XZIA 2H1WA 4KIGA 3Q8XB 4G8DA 4GX1A 3SI7A 4E11A 1C80A 3ICWA 4UQPA 1Z7GA 3RYHA 1RJDA 2HNBA 3B60A 2JANA 2WVHA 3F0TA 5CDGA 5HHTA 3GAFA 5K0TA 1AMUA 1ZK1A 3B3JA 1B2LA 4EB0A 1CF2O 4O3MA 4EHHA 1J90A 3NRJA 5I8WA 4FXOA 4XWAA 5BUSA 1PVDA 5LD2C 1IQRA 1GRQA 3HCBA 2R8PA 4GECA 4FHZA 4XQGA 5H59A 3CNNA 2PK3A 3FYSA 1ABFA 1A5BB 1R0BA 1HEIA 3BQMB 3FPBA 3IQFA 4MRRA 4MV1A 2JFNA 5COAA 2ZWIA 5KAPA 1WU8A 3KZ1E 4J94A 3T35A 1XJQA 3INNA 3SHTA 2CNWD 4E3WA 2ZI9A 3IFSA 5IM5A 1SQGA 4JI5B 4JUAA 3DEJA 5I7FA 4DWOA 1GL7A 1E9SA 2I8CA 2Q5HA 2ZE5A 3FPJA 4QDJA 3D7LA 3KKZA 1N0IA 4QGBA 2FSVC 3GFTA 2NVUB 4OHFA 2QL6A 3LA8A 1IG3A 5HX7A 2ZG6A 4ZI7A 5DASA 2EBHX 5EVCA 1P62B 4C4SA 1ZJWA 1NZFA 3DTVA 4FOPA 4EY8A 1XRJA 2A1IA 2NTEA 4RS3A 1RLUA 4TROA 4JL8A 1XIVA 4DTCA 2JLWA 5K8VA 1EXWA 2PYDA 2ZVQX 2GCPA 4GZ3A 3CYFA 2WWFA 2I6FA 1V47A 3BK7A 1BRMA 3ZNPA 3BWXA 3PE4A 2QM3A 2NTNA 2P9GA 3EHDA 3WI7A 4ATNA 1VL0A 5LP1A 1A1VA 2BDUA 3P27A 5T8KA 2FP4B 2R00C 3QYJA 3Q41A 3PSAA 5EN4A 5AT1A 3FN4A 2WW8A 2Y3IA 3Q1LA 1QGUB 1BN7A 1SBNE 4AWXA 4HMQA 1AG9A 4CM5A 1NVDA 1EZ4A 2ODBA 3ENQA 5BN3A 1AUVA 5F21A 3I64A 1N7IA 1W19A 4B83A 2JFUA 2O57A 3ZVLA 4ENRA 1IB6A 1WCV1 1YMVA 1ZK0A 4NE9A 5TGDA 4FCVA 2WJVA 2V0CA 4RK5A 4TTAA 4DMMA 4YMTA 3JD1A 5IH7A 1S9DA 2VJLA 1D4OA 3OESA 4ACBA 2OXRA 2I22A 3IA7A 4UBIA 4IRXA 1SUIA 2QQGA 3HBFA 3KLNA 5I4BA 3P9XA 2HU7A 2NACA 4WK2B 2VA9A 1ZH4A 3I39X 1EQAA 3BFXA 3C5WP 4HADA 4FIZA 4A9AA 1LKZA 3BZBA 2VDJA 2HU5A 4WNCA 1ZBQA 5F12A 3SG0A 3ZV6A 2PTHA 4G09A 1L5HB 2OZLB 3O8NA 2QU8A 4E12A 5K3AA 3TTXA 2C7VA 4C7MA 5K09A 4GPAA 1NP7A 3NIWA 1EX7A 2MYNA 2QKYA 2MHCA 3OFJA 3U7IA 5L3VA 3GZTB 4D3XA 1NZJA 2QWXA 2I4RA 4MOWA 1WF3A 3I2GA 4D9HA 2AR9A 4P32A 3WADA 4WGFA 16PKA 1S2DA 2YV1A 3GLRA 2XVZA 2XWJI 4Y7DA 4I6GA 3TG8A 4XVRA 3K09C 3VKHA 3MZ0A 5BRNA 2NSDA 1KK2A 3DOCA 2YYYA 3KKOA 2OMKA 3TS1A 2R60A 4F1JA 2O4CA 2OK8A 3OF3A 2XIJA 2ZRIA 3L2OB 1F6BA 3P2KA 1X1SA 4XIJA 2VT7A 4J4TA 4X64B 4F5DA 2JJ1D 1T2NA 1OX4B 4C1BA 2PKQO 3OG9A 2WUVA 2IHBA 2IYOA 2AYZA 4PAWA 4QTZA 1OPRA 4ZO7A 4FZ5A 4WLVA 4JI4B 4CT4B 4EJ0A 4ZYYA 1ATIA 3V2GA 4DG9A 4KYIB 4PRLA 4LJ7A 4R2WA 5CGQB 5CVUA 1EUDB 4C2UA 1Z2NX 2REBA 3DHVA 4O4LF 3D6JA 4DSNA 4RMGA 3RYFB 3B1KA 3NKLA 5B4UA 1IAVA 2QUIA 4GYYA 3QUCA 4RK0A 2Y1OA 5TQ0B 4QFMA 3DLHA 1P9RA 4TS1A 2EWMA 3OFNA 3RKUA 2PVCA 3EVAA 4RQUA 2XITA 3M2TA 2ZULA 3FTQA 4MB2A 3KV1A 4CGYA 5EP3A 4R16A 2C3OA 2NVUA 4GQBA 1PG2A 1X92A 1Z7YA 1UJBA 2G08A 4NNJA 2PBFA 4Z4CA 3UJAA 4H6PA 3ANLA 3LH5A 1C7ZA 4HAXA 4HL6A 3DV2A 1Q44A 4RE6A 4R54A 3QGMA 1WZCA 1YDGA 4D44A 4HV4A 2ODTX 5JVDF 1JT2A 3KWMA 5AHKA 1USUA 2PUVA 5AK4A 1C9MA 1VP9A 1ZM3A 5SY9A 3UWMA 4OSOA 2OAQ1 2PX5A