4R68A

Lactate dehydrogenase in complex with inhibitor compound 31
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r68A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r68A02
1QORA 2HMSA 5IDQA 3KSZO 4IM7A 2WE8A 4BO2A 3BYZA 3OA2A 1PX0A 3M2PA 4XYGA 3PLRA 4IMRA 1GUFA 2B36A 1TLTA 3DQPA 4BB6A 5B4VA 2DKNA 4RLSA 3FR8A 3ZWCA 5DP2A 3CEAA 3AU9A 1ULUA 5LCXA 4NU6A 4PZCA 1DJQA 3C7AA 2IZ0A 4NQZA 1PSDA 2X9VA 4GGPA 2B5WA 4CM8B 3VKUA 5BR7A 3QLJA 2PWZA 2ZYAA 1C1DA 1Z7BA 4FOSA 4EZBA 4ND5A 4MVJM 4NJMB 1T24A 4LRTB 4YT2A 1ZXLA 2Q1TA 3OHSX 3KVOA 1T1SA 1JDJA 1ENZA 4WCDA 4YTEA 3RUHA 3WGQA 2RCYA 4WKGA 4R3NA 1LLCA 2I99A 2QG4A 4RO0A 3SLKA 3PLNA 3PGJA 2Z1MA 4N5LA 4NR0A 1QYWA 1XYGA 3DHEA 1JKFA 5IN5A 3BZUA 1YQGA 1HE2A 2GSDA 1P1RA 1EQ2A 3WQSB 3O4RA 2AQIA 5I9LA 2G76A 2RH4A 1GV0A 3ZHYA 1X7GA 2VZ9A 1IL0A 1HF3A 1D8AA 2XXBA 1MGOA 2FN7A 1E3JA 4I5EA 1E3LA 2BMAA 4BNKA 1HTBA 3F5QA 4AJIA 4RPKA 5F1PA 3DFUA 3KM0A 4FN4A 3H9QA 1VM6A 5B37A 2NTJA 2R00A 5T8KA 2LDBA 3WYEA 4BO7A 4BVAA 1GEGA 3WGHA 2Q49A 3AU8A 2PZJA 3ZN2A 1C0IA 4ND4A 3FWNA 2PGJA 1XA0A 3OH8A 3JQDA 4CPDA 3OETA 4FC6A 2VYNA 3SX2A 3VH2A 2GZ3A 1ZJZA 2DBZA 4B79A 1MXFA 3BHJA 3UH1A 1SCUA 2EP7A 1VJ1A 5TS3A 3DONA 4PLPA 1H2BA 1E7RA 2UUPA 4O63O 5F1KA 3H2SA 5JDIC 5KWEA 3COSA 2C7GA 1MG0A 1IHXA 2JD0A 2PZLA 1U4SA 2EF1A 4CLRA 5DP1A 3U9LA 4TMFA 1LA2A 1GPDG 3F47A 1WDLA 3ZWAA 2WE7A 2IYPA 4IDEA 4UVGA 1CIVA 5KVQA 1R4NA 1RYEA 4PLTA 1MP0A 2ZJ0A 1V3UA 2YV3A 1N8KA 4Z9YA 1EBUA 4C7JA 2DPHA 3AUTA 1HL3A 4B7UA 3RC7A 4FFMA 1Z82A 4FFRA 1PJ3A 3NGLA 3P2OA 1QYVA 4HY3A 4GLLA 4EUHA 2EGHA 2GZ1A 4J9UE 3L4BA 3JQBA 4BGEA 4J90A 4UAGA 4XZ3A 2D8AA 2ZIZA 3DHNA 1ZK4A 1D4FA 3D3WB 3DAFA 4CJXA 1PU2A 1MLDA 3RSHA 1EVZA 4PLCA 3JD4A 3HDJA 4CODB 4EI2A 1NPTO 4R9RA 3A1NA 3KB6A 5CAEA 1ZH8A 5L51A 4JP3A 3KOUA 2G17A 4XCVA 2YQ5A 3AI3A 2W8ZA 2YV1A 4HX5A 2Q2QA 2FPIA 3FPLA 4Z3DA 3FTPA 2ZQZA 4GX0A 3VZRA 1R0LA 1RWBA 5I9NA 3I6IA 3EC7A 2VOJA 4BQPA 4P8RA 1B14A 4BS9A 5U1PA 3W6ZA 3E82A 3TOXA 3K92A 3F4LA 1CJCA 4OMUA 1DDOA 2GF2A 1Z6ZA 3DEYX 4B3IA 3SVTA 1DIGA 4DVJA 4D44A 3GPDG 4ZQGA 5G0TA 2IXBA 3D3EA 3QVTA 1C1DB 2DBQA 3FCOA 2VCYA 3LSYA 2IXAA 1GY8A 4IUYA 2UVDA 4Y67A 3AW9A 5TJ9A 4MVJD 5A9TA 3T7CA 4MP8A 4PG7A 3ZNOA 4XB1A 1EUCA 3LZ6A 1Y1PA 3ZU2A 2I3AA 4JBHA 1YJQA 1VSVA 4ONEA 3E9NA 4FCCA 2B4QA 4D3FA 3I9KA 5I7VA 1XIVA 5A05A 5K0ZA 4L4RA 1N1GA 2X0JA 2FR8A 2ZYGA 1HZZA 2X5JO 4JROA 5AXAA 2QHXA 3VPGA 5KVVA 1UXJA 4Q3NA 3S2IA 3ZNQA 1QSGA 4GX2A 3W4IA 2C07A 3KEQA 1I3LA 3HB5X 3FR7A 3DTYA 5AXCA 1LJ8A 3ZW9A 3HFGA 3KLPX 3RIHA 3GC6A 2AEJA 3U09A 5FEUA 4GL4A 4BO6A 5GZ1A 3VVBA 4ALKA 2PKQP 2X0NA 2ZTVA 3ZW8A 4Z3KA 3JTMA 2GCGA 4L73A 1JQBA 3ZGYA 4PLZA 3JQ8A 3QQPA 2AE1A 5KKAA 3WICA 4WLFA 1YXMA 3EAGA 4YACA 2RBEA 1BHSA 4NFSA 4L8VA 1KEPA 3C7CB 2JAPA 2OFPA 4Z9FA 4IS3A 4CLRB 2A92A 2VN8A 2RH8A 1C1XA 3FNHA 4OSOA 3ORFA 2BKAA 3D64A 4JLWA 4CR6A 5FI3A 3LC2O 3UGKA 1HLPA 1UJMA 4N7RA 2QZZA 4R54A 2Y99A 1U5CA 3MCVA 1Z7EA 1R4NB 3OQ6A 4ITUA 3RROA 2NU6A 5L7YA 1ZSVA 2WYUA 1MC4A 3GUYA 3P2YA 1WMBA 2HJRA 4WLVA 5ICSA 4RVSA 3TL3A 3WWYA 2V65A 2ZTUA 1J5PA 4E4YA 3RBVA 1KVQA 1LTHR 4JGBA 4L4SA 3NGXA 1MXHA 4M55A 1MUUA 3PJGA 5JMWA 2OL4A 3IDSA 5I7EA 4PVCA 1YB5A 4KUEA 2Y1GA 1HSZA 1MFPA 2VHWA 5KNLA 4GWGA 1ISGA 3ROPA 3DFZA 3K31A 1E1KA 1GCUA 3B70A 1OC4A 1Q0HA 2CUKA 3Q2IA 3G1UA 2BRUA 1LQUA 1ML3A 1U3VA 1LLDA 2PGLA 3W4KA 4EGFA 4YRBA 1E0DA 4O0LA 4R3WA 4DMMA 3PDJA 3BMCA 5EMHA 2GYYA 3F46A 3ONDA 1H93A 4PGFA 1PR3A 2JCXA 4J1NA 4MOWA 1IPFA 1Y5MA 3A06A 1PJLA 2EW8A 4NG5A 1I24A 4BO0A 3GUCA 1PWZA 2DT5A 4M54A 3BXXA 1TA4A 3MJEA 5EL0A 1I2BA 1E92A 1GAEO 2BFOA 1PL7A 1X7HA 4IQGA 4UEKA 3JQAA 3HE3A 2NM0A 5KVSA 1DO8A 5EESA 3IP1A 1AN9A 1U8FO 1JKJA 1T1RA 3G79A 2CMDA 2P9GA 4S1VA 3VDRA 3WBFA 2I3GA 3AK4A 3ZWXA 4B4OA 3NRCA 5TF4A 5G4KA 3WTCA 4BNUA 3PWKA 5BNTA 1DC5A 2Y0EA 3GVPA 4DBZA 3GDOA 4TRRA 3K30A 5CFZA 4XIYA 3DDNA 1PR9A 2GUGA 4LCJA 1DXYA 3C3XA 5C7IO 1J4AA 4RPHA 2G1UA 5CEEA 1E6EA 3ENKA 4M8SA 4OGWA 4YQZA 5MDHA 2R2GA 1X15A 1YDEA 3WBBA 4IDGA 3I9NA 4KWHA 4MKZA 3ZH2A 3AM5A 1VJTA 1D7OA 2G5CA 2VNSA 4BUCA 2NNLD 3QIVA 2I5PO 2IDZA 2O2YA 2Q1UA 2O3RA 3L9XA 1U7HA 4EJMA 3H5RA 4XGNA 2H9IA 4B7XA 2C54A 2P9CA 3OIDA 5G0WA 2VT3A 2E82A 1DIBA 3EZYA 3VPSA 2GN4A 3OEYA 1CYDA 3O26A 3RUAA 5DZSA 2V6FA 4MP6A 3DXFA 4J2OA 5T67A 3KUXA 1O9BA 3T4EA 3S2FA 4Y6PA 2OHXA 5T57A 4JX8A 1VLLA 3RFTA 4IJKA 4DRYA 1DLJA 4HFRA 2XXJA 2HDHA 4J3FA 3JQ8B 1ZK3A 1DAPA 2F1KA 3P19A 1H0KA 3H9JA 1I32A 4XQEA 4AJHA 4H7PA 3MOGA 4BL5A 1B3RA 1LDBA 2PA3A 1C1XB 2HU2A 4B3JA 4RJTA 2CVZA 2DTEA 3GH3A 4EEXA 3DMYA 4QO7A 2X5KO 4K1LA 2D0IA 3GGOA 2I65A 3QJ5A 1N2SA 1WZIA 4PLYA 4UEJA 2FP4A 2VUTA 1ZBQA 3DZBA 4DIBA 3LT1A 1I2CA 1P1JA 3AUAA 1NASA 1YQXA 4J7UA 1SB9A 3NYWA 1GCOA 1K2WA 3JYLA 2W2KA 2NTVA 2YFHA 3VPXA 2YW9A 1UUFA 1HYGA 1N5DA 4OXYA 4PLHA 3JQ9C 4RCVA 4XYBA 2AG8A 3RUDA 2C82A 2IRWA 8ADHA 4RPGA 2C7VA 2OBYA 2Y05A 2O4CA 1SMKA 3CUKA 5JDCA 1XLTA 3KLMX 4W99A 3BMCB 3ZHZA 5T5QA 4CMJA 1NP3A 1O95A 2POQX 3HNPA 3PTZA 4QFCA 1L1FA 3AOEA 5IAAA 1NHGA 4BNMA 4IY1A 3IL2A 4NNJA 3PQFA 4BIIA 4ZHSA 3S1LA 2J6IA 1ZEJA 2NUAA 4BNWA 4AJOA 3HDYA 2B4TO 3FNEA 3NV9A 5ER9A 1F8FA 2PD3A 2YY7A 4R1TA 2BGKA 3JQAB 2AA3A 3AI2A 4KUGA 1B7GO 1X0VA 4GVXA 4CM9D 4D43A 4E3ZA 3DC2A 1P9LA 2OP0A 3CH6A 3WX0A 2FPGA 2HMTA 2PGDA 4KDEA 1JVSA 3JYOA 2HMVA 5G4KB 4FOOA 4N18A 4QQRA 3EUWA 4OAQA 4IJWA 1SC6A 1DRVA 3KHUA 1C0PA 3DBHB 1M76A 4QUKA 5KJFA 3E48A 2YFQA 4JP2A 1F17A 1KY4A 1HWYA 1HXHA 4I5DA 4YRDA 4E0BA 2Q99A 2FZEA 1I01A 2DTDA 2XPCA 1EVIA 1ZSNA 2E48A 2VUSA 2ZYDA 1BW9A 1S7CA 4I5GA 1BGVA 1AXEA 4OHUA 4W7HA 4YWJA 4Z6KA 5I8ZA 4KWIA 3EY4A 3H9UA 3GT0A 3KYBA 1RPNA 3L07A 4NJOA 2YQ4A 4IDDA 3E5RA 3HDHA 1I2ZA 3RI3A 4F45A 4XYMA 1EE2A 4MIEA 4KDFA 4IZHA 1QLJA 4D41A 1OI7A 3K5PA 1P33A 4NBRA 5JAIA 2HSDA 4FBGA 4L9RA 4CQMD 4TQGA 2ZTLA 1A4UA 4D45A 1Q7CA 4J1SA 2IYOA 3BTSA 3IQDB 4DLBA 4P4NA 1LI4A 1RKXA 1HDOA 2DPGA 3GR6A 3HFSA 5A1TA 2C5EA 1UDAA 2UV8A 3TN7A 3QA9A 4ROSA 1IULA 4ZU3A 4AJLA 4BHTA 5A3JA 5IG2A 1JVBA 2CVQA 2YJZA 1ISMA 3NAQA 4F6CA 4FIZA 4NI5A 5GZ3A 3H9EO 5KJCA 1P74A 2JCVA 1YL7A 4PZDA 3WR5A 1F8GA 1G0OA 1XSEA 1VL0A 3ZWWA 5CDSA 5JYDA 2V6MA 3ZU4A 3DBLA 4BNNA 5CDTA 3I9JA 4JNKA 4RDHA 2EJVA 1QRRA 2GNAA 1LSUA 1Q0LA 3R3JA 3W6UA 4CM5A 1IHYA 4NBWA 1K6XA 2IE0A 5CDUA 1WXDA 3RFXA 2EV9A 3NUGA 3PI7A 4QSMA 4BO4A 1ZK0A 1NFFA 1E3IA 2O7SA 3TZCA 3E9MA 1P1HA 1FDSA 3O9ZA 2W2KB 1EDZA 1ZZEA 2R6JA 2X6TA 2HMUA 2DVMA 3FBTA 3TRIA 4G2NA 4N5NA 1XQ6A 3ZWMA 4BNJA 1U9JA 1Y8QA 3I3OA 1J0XO 1RJWA 2O4UX 1P77A 2BGLA 3TDKA 1FDVA 3GFGA 5AXDA 4DWVA 4RDIA 4D0RA 1E1MA 4OM8A 4BV9A 2Y1DA 5TNXA 3JQCA 3BMNA 5JDIA 3S8MA 1U2GA 3FWZA 1YONA 3MWEB 1PJBA 4J2HA 4Q39A 4WLEA 2NADA 4XGIA 1ENPA 3L4SO 4TZKA 2X0IA 3KSUA 2PH5A 3KEOA 2WD7A 4RV9A 4WE3A 5A04A 2TMGA 3PHIA 4WUVA 2J5KA 3PZRA 4WCFA 5BSGA 2J5RA 2WYWA 4FDAA 1IZ0A 3KRTA 3EW7A 1WP4A 5IXSA 5DBIA 3LC7O 3VH4A 4PVDA 4E6PA 1T4DA 3RC1A 4O59O 1Z74A 4FGSA 1B16A 2GASA 1U5AA 2ET6A 2YHUA 4FD3A 2CDAA 3WGOA 3SJ7A 2D5CA 2QQ5A 1VJ0A 1U2DA 1ADBA 3C85A 2JD1A 4Y9DA 4YAEA 4J91A 1BRMA 1Q1NA 4FS3A 3PJDA 1FMCA 4IXTA 4GMGA 2BH9A 4DQXA 1OOEA 4TVOA 5JO0A 4XRGA 3GZNA 3RUEA 5BSHA 3FNGA 4LW8A 1MV8A 1GZ6A 1CQIA 4MPDA 2H5LA 5HRUA 1EMDA 1BW9B 4BKOA 1ENYA 4A10A 5L95A 3DAGA 5TC4A 3WYCA 2J3KA 3FN4A 1ZJYA 1ZVMA 7ADHA 8LDHA 3PJEA 7MDHA 2RIRA 4DLLA 5B4TA 1O8CA 4PG5A 4JJGA 3U5TA 2PLAA 1XU7A 3LT0A 3PJFA 4HWKA 1TI7A 2DBRA 3ASUA 4OL9A 4QTZA 2QZ9A 4H16A 5DDIP 4ZVVA 4LGVA 2FOIA 3ONFA 3ZI0A 4CM7A 4RORA 5TJHA 2PK3A 3ASVA 1PJTA 1C14A 4ID9A 4XYEA 2CF5A 2D59A 3AOGA 3G17A 4MIYA 1U3UA 3UN1A 4B8ZA 4R1SA 3S2GA 1UZMA 4U6SA 3VOSA 1RM5A 5JCJD 1TB4A 4GKVA 3FI9A 2UUOA 4DPLA 1CDOA 1JW9B 5COBA 2TMDA 3DBLB 4NK4A 3BTUA 1U3TA 2CDCA 1P1FA 3JYQA 4RVDA 5THQA 2VTDA 3ZZNA 4K9DA 2EP5A 3ZHBA 1YVEI 4HNHA 3NX4A 1NM5A 1XELA 2DC1A 2GD1O 3U62A 1PGPA 4G65A 5EQDA 3WJAA 2D2IA 1B8UA 4MVJI 1DFHA 4KZPA 4S3MA 2LDXA 3RC9A 3X2EA 1Y6JA 4OJNA 4J6FA 3VH3A 4I8XA 4R5MA 1IB6A 5GMOA 1JA9A 1GYQA 2BGMA 3GEDA 4WPGA 4Q3CA 1UR5A 2VNAA 1ZW1A 1Y8QB 2EERA 5LC1A 4I9UA 1RYDA 4I08A 3EDMA 3HJAA 2E49A 3PVZA 3R0IA 1ZK2A 1ONPA 1O5IA 4DC1A 2FSVA 3BMNB 3P5SA 1YKFA 4AJ4A 1HSOA 1EDOA 5L53A 1LC0A 4XDYA 4A0SA 1T2DA 4IDBA 1QKIA 3F9IA 2WD7B 3L0DA 1W4ZA 2QIOA 4H3VA 2NU9A 3N74A 3VHRA 4R4JA 4WCFB 4DPMA 2BFMA 4CV0A 2HAEA 3HB4X 4I5FA 4KTVE 4UVHA 5I7SA 5GY7A 1VPDA 1XHLA 1EK5A 4XQ9A 5ENVA 2P5UA 1AGNA 1G0NA 3CSDA 3AFMA 4NBTA 2OBNA 2JCYA 5G2OA 1PZFA 1NNUA 2I76A 2J3IA 3QP9A 3A28A 1E7MA 3OFSA 3IMFA 3OMLA 5DF1A 5JFOA 2B83A 2C2XA 3JSAA 4KQXA 4CV1A 4E33A 5TQVA 2D3TA 1QV7A 1LC3A 4R51A 3WGZA 1QG6A 2CF6A 4DXHA 1E3SA 1PJ4A 4XQCA 5DBFA 3GZNB 2BD0A 1PS0A 2H6EA 3E6AA 3I9LA 4PLGA 1KEVA 3WSWA 4YAGA 5U9CA 4W82A 4P4LA 3BTVA 1V35A 3JQFC 4NH4A 4CMEC 1GD1O 4GGOA 2Q2WA 5EJ2A 1JLLA 4RF5A 4LN1A 3PP8A 3WLFA 5IZ4A 1PS9A 3I1JA 3OIFA 1DHTA 4IJVA 1AUPA 5I7FA 5IXYA 4B4WA 1W0CA 4PLFA 1FK8A 3IKVA 2NVBA 3C24A 4WECA 4EJ6A 3NDIA 3TL2A 3UCEA 1MC5A 4OQZA 4BNFA 4YJHA 3ADPA 4CM3A 4J4BA 1E7SA 2X5OA 5EERA 3JYNA 3CINA 4IGEA 2H63A 4N5MA 4EUEA 4GAEA 3D7LA 2IZ1A 1R0SA 4XEHA 3DAPA 2UAGA 3BMOA 5CP8A 1UAGA 4DPKA 1KEWA 1DRUA 3HADA 5CDYA 5DCWA 3STHA 3C8MA 4U8GA 3M1AA 1ZUD1 5HWSA 1VL6A 3KYCA 2WDZA 2P91A 3I4CA 1N92A 2AHRA 4IJUA 3ON5A 4CM4A 4PG6A 5A9SA 4RPLA 4J4HA 2IZZA 4DIFA 2ZB4A 1B15A 1A7KA 3IP3A 2WMDA 1TXGA 3CXRA 2Y93A 3BIOA 5ILGA 5ITVA 3PQEA 2VWQA 1F14A 1K0UA 1WVGA 1ZCJA 1ZSYA 3G0OA 3NTOA 3GLQA 3QW2A 1V3VA 1K3TA 1P1KA 1RM0A 3V1UA 3NJ4A 1Y9AA 1WW8A 1NBOA 4Y6RA 4NMHA 1YH3A 4J49A 4BNZA 4CLXA 3TZ6A 5F1OA 2J8ZA 4DYVA 2X7HA 1PQWA 4GVLA 2Z1NA 3GEGA 3WG9A 3WGTA 5JXWA 3PK0A 4R69A 2YV2A 2PNFA 1I30A 1ZNQO 4WLNA 4UEOA 4RPJA 3UCXA 4A03A 1DLIA 1BVRA 3RD5A 3LT4A 3NT5A 2W98A 5I8WA 3E03A 4GI2A 1YJ8A 1KYQA 1NYTA 2JAHA 4WNCA 3ZWBA 1PEDA 5BQFA 1YGYA 3KSDO 1ENOA 3UKOA 3FPCA 2A35A 3AI1A 5CEJA 2J3JA 3GA0A 4YYZA 1I33A 5EINA 4R1NA 3IUSA 1NQAO 1O6ZA 3JQ9A 1NQ5A 2QRJA 3GN2A 3GFBA 1KBZA 4IMPA 3TF5A 2FRDA 3NTRA 2NVWA 4ZRMA 2VHZA 3L6DA 2RHRA 1BG6A 1NR1A 3TQHA 2VHXA 4E12A 4QO8A 1U7TA 2CZCA 2X1HA 3WIDA 2Y1FA 1E3EA 4HADA 4TRMA 3O8QA 1T2CA 4BMVA 3KXDA 1ZMOA 3VPFA 3DOJA 3SEFA 3LLSA 3JYPA 2WEKA 4L74A 5B4UA 2JD2A 2AQKA 5IDXA 2RHCA 3H7AA 2GN9A 1CERA 4FFOA 3SXPA 5IN4A 4JJFA 5C3MA 2PFGA 3X2FA 4YJHB 4GQAA 4OIMA 3ZNNA 4MVJF 1XR3A 1DPGA 2BI7A 3N58A 4MVJH 1M6WA 4Q3EA 3E18A 4R5HA 4Z0PA 1S6YA 1K89A 3UFXA 1RM4A 4BNIA 1YBMA 5F5NA 2PTGA 5JAQA 3BMOB 4X54A 4A5OA 4EW6A 3B6ZA 1BXGA 1ADCA 4YAJA 2C0CA 5K6AA 4GSKA 4BKPA 1C0LA 4RVHA 1UXHA 5F3RA 4C4OA 2JFHA 3KYCB 1LEHA 1HDRA 2UYYA 3E1KA 2E37A 1NXQA 2VTEA 4TWRA 1I3MA 4QT0A 4CM4B 4W9NC 5A9SB 2JHGA 1SO8A 3NT2A 1LSOA 2NU8A 2EKLA 3QVOA 4CUJA 5TRTA 3S55A 3RJ5A 2GN6A 2NACA 4GSLA 1DB3A 3L4BC 2B5VA 3JQBC 1ZMTA 2QRLA 1EUDA 4IQ0A 4EJ0A 1DC3A 3PDUA 1B2LA 1ISIA 3LK7A 3BAZA 3RCBA 3V2UA 4PG4A 4OH1A 3WMWA 3Q0EA 5KOIA 3GMDA 1PZHA 3GRKA 2FMUA 1B3BA 2EHDA 5ILOA 3I4FA 3MJVA 2QW8A 5JAZA 4XGKA 4XQGA 4LMRA 2RAFA 3BA1A 1D1SA 1TEHA 4TRNA 1L7EA 2DUWA 4WNIA 1IPEA 1F0YA 1HT0A 1HZJA 3CE6A 4CLOA 1I5RA 2CDBA 3RU9A 1IUKA 1PJCA 3K2EA 3DBRA 1R37A 3QY9A 1NTOA 2VYVD 1MG5A 3DB2A 2NWQA 3ETEA 2EXXA 2JHFA 2O48X 2X9GA 3GZ4A 1C0KA 3TZKA 1DIRA 1A27A 5CPFA 3WQQA 3DMTC 4RVUA 1KVUA 1NPYA 3GHYA 2FR1A 3G1TA 3PYMA 3GMSA 4F46A 5AOVA 5TSDA 3PYXA 1DFGA 1WDKA 3IUPA 1KVTA 1DRWA 2B37A 4E5PA 3DZKA 4A26A 1NVTA 4CR7A 1PWXA 2C20A 3RJ9A 1H6AA 6ADHA 4YCAA 4P38A 3I52A 3LVFO 2F00A 4GMFA 3LF1A 2X22A 4AJKA 3WFIA 1UP6A 3O8QB 4YAKA 1Q7BA 1Y8RA 2DUUA 4RF2A 3F1KA 1XU9A 4IGFA 3I5MA 4D46A 3GK3A 4EITA 4NU5A 3M1LA 2OMEA 3GNTA 4WEOA 4IPTA 4J43A 2NSDA 4Q9NA 4JXKA 1OAAA 3GVXA 4PRLA 4BKUA 5U4QA 2XOXA 2AG5A 3ETDA 3QE3A 2PD4A 5F21A 3ZDFA 1NX6A 3F3SA 4BNVA 4FQ8A 1XQ1A 4UULA 3K2BA 1V0JA 3ZU5A 2JFGA 3ULKA 5COQA 3RUFA 3WGIA 5JS6A 1PGQA 3G3EA 1Y5RA 2BF7A 4K6FA 3LF2A 3H65A 5A5FA 1O89A 5KKCA 3H8VA 3LU1A 3V2HA 3W8EA 1LLQA 4FJ1A 4GWKA 1PJQA 4TVBA 1MB4A 3MJSA 1E5LA 1N9GA 1BXGB 1KS9A 3Q11A 4HFNA 4AJJA 1IYZA 1GFSA 3JQAD 5JO9A 1ZXBA 3MEQA 1MFZA 3CKYA 2V6BA 1LLUA 2FWMX 3ZWPA 3CMMA 4OXNA 4R01A 4XJTA 4GBJA 4RGBA 2JJYA 2PZMA 4XD2A 4MINA 2ZJ1A 3E5MA 3ZWYA 3B1FA 3RKRA 3A14A 4IIVA 3UAGA 4CLDA 2DTXA 4II2A 4WLUA 3H3FA 3NDJA 5L3ZA 3PPIA 4I1IA 1Q7GA 1VKOA 3MTJA 2X4GA 3QVWA 4CV2A 1PQPA 1VL8A 3DTTA 3W4JA 5L4NA 3WQRA 5MGBA 1ULSA 4CLEA 4ZQFA 3QWBA 4WLOA 5HTOA 5TX7A 4FB5A 4OKIA 3VTFA 3JD0A 5DCUA 4TKLA 4BQRA 3PFWO 5BSEA 4E2XA 1KETA 1OMOA 1R6DA 3JQ7A 1NQTA 3TSCA 3PHJA 3L6EA 1XKQA 1N7HA 3E8XA 1EEHA 4DTIA 4FPXA 4LVUA 4CM6A 2AEFA 1GQQA 1X1EA 2BLLA 2FR0A 4E30A 2W90A 3QWHA 4CLOB 5I9MA 1MX3A 4J16A 3DBRB 1GUZA 3GEMA 2ZTMA 3LQFA 3R3SA 1EZ4A 5HM8A 3GGGA 2VOEA 5C37A 1DHRA 1A71A 5C5IA 4RZHA 5ITWA 4E2WA 3H9GA 5EN4A 2P9EA 3IJRA 4OYRA 2ILTA 4M1QA 5T6BA 1CEQA 2GRAA 2ZCUA 4R68A 4UUMA 2HCTA 2VQ3A 4MKRA 2PZKA 4E32A 5CHEA 3B20A 3EVTA 2P68A 4ALNA 2YZ7A 3INTA 3KBOA 3K6JA 1CETA 3IJPA 5KJ1A 2Q2VA 4HFJA 3T4XA 3EHEA 1B26A 3MZ0A 4IQ8A 4L75A 4JIGA 1Y8RB 1BXZA 1M75A 2Q1SA 1B0AA 5DCYA 4ZA2A 2ZATA 4J0EA 2ZB7A 3WGYA 3ABIA 2G82A 3I6QA 2JFFA 1H94A 1E6WA 3C1AA 4NPCA 4TSKA 2QX7A 3OF2A 3DBVO 4DL9A 3UUWA 3JQ6A 2OZPA 4FFPA 1XGKA 3GY0A 3JV7A 2O3TA 1LQTA 3ROQA 3VZSA 1JKIA 4MKXA 2Q4EA 3N7UA 4NFYA 3WDSA 1WDMA 2A4KA 3F1LA 3ZWNA 5ICMA 4PG8A 3MOIA 4MJLA 3HHPA 3ZV3A 3ZV5A 4EYEA 2DAPA 1PQUA 3BTOA 5KCZA 4BO9A 1KERA 3WGGA 1N9GB 3WTBA 1GV1A 4JCOA 3R6DA 1ARZA 4NBUA 1NWHA 5BSFA 1KC3A 1Y9EA 2D4AA 4CMEA 2ZK7A 1UDBA 1E5QA 2OGUA 2Q50A 1Q2XA 3QVSA 4WOJA 5FFFA 4EBFA 4OOFA 1R4MA 1BDMA 1WZEA 1ZO8A 4DREA 2O50A 3HDQA 3UOGA 4YQYA 3LLVA 2HLPA 1A7AA 3ANLA 3HWRA 4BOYA 2FY8A 1NR7A 1ZKMA 2P5YA 1YL6A 4AL4A 2VHVA 3UVEA 5IFLA 1R15A 4JN6B 3U4DA 1OFGA 3OSUA 3M2TA 1UAYA 4FR5A 2VRBA 3L77A 4URFA 5TT0A 1TT7A 3GPIA 1XWFA 5G0UA 1EBFA 5BNFA 3IC5A 4I9HA 5JDCC 3JQ7B 5AQ1A 1ISHA 3IAHA 5A9RA 3DL2A 1PTJA 3KV3O 3LYLA 3C1OA 1HEUA 2GR9A 4YB8A 4DC0A 2WJPA 3AOEC 1CWUA 1MA0A 4XIJA 1KC1A 5IZCC 5EQFA 4YR9A 5AVOA 3VKVA 3QWFA 4Z0HO 4YAIA 3HUDA 2CNBA 2FZWA 3L6OO 4IIUA 1W8DA 4CMIA 4EEZA 4BNXA 4XWYA 1GPJA 5A02A 2HK8A 1YOVA 2CFCA 4PZEA 3VDQA 1WNTA 3WFJA 4CMCA 1LDNA 3RBZA 1I3KA 5T64A 5G4LA 1R0KA 5C7OO 3GGPA 5B12A 3JQGA 1SPXA 3PFFA 4YA6A 5JPIA 1YDWA 4YJFA 2OP1A 1NFRA 2EW2A 1HE4A 1Z75A 4A73A 4CMAA 2AE2A 1J49A 3WNVA 1EK6A 1H5QA 1YB4A 3TZQA 1U3WA 3HG7A 4YXFA 3FD8A 4D79A 3OIGA 2IEBA 3ZWOA 5ADHA 5L7WA 3I9MA 3WXBA 4WEQA 5LDGA 1V6AA 2EGGA 3CZMA 3DZIA 5EPOA 3O03A 4XKJA 1E77A 3NJ8A 3JD3A 2FPPA 3INRA 1Y81A 2W2LD 3EGOA 4HFMA 5BT9A 2E4AA 3CTMA 4CQLA 4HV4A 1Z45A 1QYDA 1AHHA 1JWAB 2HK9A 3U0BA 2X86A 3UW3A 4Z0TA 5KVCA 3ETGA 1A5ZA 3VTZA 3MJCA 4II3A 1HKUA 3OA0A 3WB9A 1NVGA 1GTMA 2DLDA 4BNGA 4CMBA 1R12A 1ZFNA 4RF4A 1DJNA 2OOSA 5JLAA 2NTNA 2ZCVA 1HRDA 5DT9A 4ND1A 4DLAA 4WK6A 4P4GA 3K73O 3VVCA 1AXGA 2Y0CA 2X9NA 2EWMA 4WASA 5HA5A 3ZHXA 1PJ2A 1TVEA 4MVJA 3AY6A 3F6YA 1Z73A 4XB2A 3MJ4A 1TT5A 4W6ZA 4UUOA 1LRLA 1NHWA 3HN7A 3HN2A 5COAA 4ZQEA 3CPSA 1JTVA 4ALJA 5F5LA 1A9YA 1I10A 4IBOA 1BXKA 1PL8A 1R4MB 3EZLA 4YT4A 2HMWA 1PS8A 2WYVA 4BO3A 1A9ZA 1SBYA 4ZICA 5JAMA 5FWNA 1X7DA 1I8TA 4ALMA 3CMCO 1ISJA 4O5OA 3GDGA 4WJZA 4ILKA 4ND3A 4PIVA 2GDZA 1PL6A 2VRCD 5L4SA 3QSGA 4J0FA 1H6BA 4GH5A 3FHLA 4K28A 3KO8A 4NIMA 3P7MA 3IS3A 4DBVO 2QYSA 3Q9UA 4Q3AA 1P1IA 4Y6SA 4U6QA 5A5EA 1V9LA 2HJSA 4YPOA 4RLHA 3QWIA 4DUPA 1QYCA 4C7KA 2Z95A 4E5KA 2GPTA 1HLDA 4AG3A 1NAIA 4ALLA 5AXBA 1SB8A 1AE1A 4HKTA 3DO5A 1SZJG 4QXMA 1UP4A 4ZQBA 4B8WA 2DFDA 1EFKA 4BO5A 2GLXA 2V6GA 3OM9A 4NFHA 1LRJA 5CG2A 5C7LO 2YHIA 4RQUA 3SC6A 4CMIB 5JE8A 3PGXA 4WCFC 4W9NA 1P0FA 1YOVB 4IDCA 5KTKA 3AJRA 5K9ZA 1T25A 4KOAA 4J7CA 1YBAA 4Q3BA 4BNYA 4UREA 3DZJA 3E9QA 5CEFA 3RU7A 4BGIA 1YQDA 1HDZA 1UP7A 2XF8A 4OQYA 2VT2A 1LSSA 5IDYA 1I36A 4U0KA 3OJEA 2GN8A 2J5QA 4RF3A 3JQGB 4ZGWA 4W4TA 1EQUA 3ICCA 1ZIDA 4YJFB 1ZEMA 5AYVA 3AFNA 3TNLA 1GZ4A 3PHHA 4PLVA 4BV8A 2EJWA 4NBVA 1GADO 1N1EA 1IY8A 4HUJA 1BDBA 2EEZA 4XYLA 1QYXA 3WJ7A 2EKPA 1DIHA 4A7PA 1NFQA 4CLHA 4CMKA 1KY5A 3D4NA 3RQSA 3INGA 1HDCA 2X58A 4O1MA 5CPBA 3H3JA 1GUYA 2NU7A 1A4IA 1G1AA 2GGSA 4CQLB 1E7YA 3QVXA 4JJIA 3K9QO 5IJZA 2EG9A 1G6KA 2Y1OA 2VZ0A 3ITKA 4YVFA 3DOCA 3B1KA 4HNGA 2GZ2A 3U3XA 1EFLA 3WSVA 1EVJA 3VC7A 3DMTA 3S2EA 2PD6A 1QXSA 4IDFA 4Q3DA 1WLYA 4LSMA 1WWKA 1CF2O 3JQEA 4MVJE 1Y7TA 2Y0DA 3DR3A 1QMGA 1K5HA 3W8DA 2PKRA 5H83A 2SCUA 3RBXA 3TFQA 4A27A 1LUAA 1NAHA 4E2YA 1E1LA 2I66A 2I6TA 3DZGA 4L0QA 2Q1WA 3UCFA 1U28A 2O3SA 3VH1A 3B1JA 1M67A 1R16A 1LDMA 1YE3A 2B69A 4PRKA 4U7WA 5HS6A 4BKRA 4CMHA 4LRSB 1LXCA 1UZNA 3L9WA 1SOVA 4PLWA 2C2YA 3OQ1A 4CV3A 4XJSA 3RUCA 4D0SA 1LSJA 1KEUA 4N54A 4ZJUA 5LDHA 1T2AA 1TT5B 2C5AA 1IE3A 2EKQA 1GDHA 5ES3A 4HXYA 4AJEA 4DMLA 4LCEA 2W4QA 3ADOA 4IXWA 3HQ4O 3CIFA 5A06A 2VYND 4RQTA 1HYHA 1YBVA 3GRPA 4DA9A 4UVIA 3GVIA 4FGWA 2CSUA 3OJLA 5G0VA 4P22A 4YBZA 4HBGA 2JKVA 4TZTA 3QV1A 3AWDA 1GYRA 4Z9XA 5TLSA 4QX6A 3GAZA 2Y1EA 2P4QA 2X0RA 2YYYA 4HP8A 4IINA 3JD2A 3QWAA 1GZ3A 3WYBA 3PZBA 1YO6A 3I83A 3GG9A 3SBOA 3WOHA 2PR2A 4E21A 2VUUA 4E2ZA 2VYVA 3LDHA 1PJSA 1U1IA 2DFVA 2QRKA 4MIOA 3WWZA 1DAOA 1WMAA 4JK3A 3TOZA 4I9NA 1F06A 4H15A 1SOWA 2AW5A 1BVUA 3PQDA 1YL5A 4DGSA 3H2ZA 3RASA 4G5HA 1BSVA 3MTGA 1FDWA 4OOEA 3GHHA 2IEDA 2HK7A 4TKMA 1GR0A 2YHIB 2VWHA 2DM6A 4BNTA 1LU9A 2O3UA 4D3SA 4EDFA 1PGNA 5T8KC 2R00C 4TROA 3D4PA 2AEMA 1E7WA 3F5SA 3UHAA 1I3NA 1X13A 3F4BA 3I23A 4CL8A 2CD9A 2WWRA 1FDUA 2NVUA 3C7DB 1LDEA 1LDGA 4AJ2A 1E3WA 4O6VA 4FJ0A 4A2CA 4UVEA 3AM3A 4IDAA 1VC2A 2BELA 2O7QA 4GKBA 1HDXA 1D3AA 2Y68A 3W1VA 4U0JA 5DNAA 4LK3A 1U8XX 2CY0A 2FHSA 2PY6A 1YB1A 3AM4A 1UXIA 2AQ8A 3OBBA 4DYDA 4E5YA 1FDTA 1R66A 6LDHA 1NPDA 3ST7A 3A4VA 3ZWVA 1XDWA 1X1TA 1OBFO 2GO1A 1SNYA 3PXXA 3IKTA 5FF9A 1GQ2A 3GQVA 1V8BA 4XRRA 3DWFA 3PHGA 3ZNPA 2B4RO 4ZRNA 4BNLA 5KJEA 2B35A 3WS7A 3HZZA 3DZFA 3ONEA 1DOHA 3D4OA 1LBEA 2YDXA 2C29D 3FRJA 3H5NA 4F3YA 4CM9A 3OEWA 3ZV6A 3RC2A 1ADGA 4MP3A 1N7GA 2NV6A 2AXQA 2E6UX 3LC1O 2PKQO 4IS2A 5B1YA 3ITDA 3DBHA 1DSSG 4GLOA 3ROKA 1F12A 2DBVO 4AJNA 3NDRA 2D1YA 3ENNA 3TPCA 3AY3A 4PN3A 5BNIA 1WPQA 5J23A 3GVHA 1FXSA 1UH5A 2B0JA 2VWPA 3ZU3A 1CQJA 1JAXA 1WAMA 3SJUA 5JW6A 1PIWA 3O38A 4R1UA 3QHAA 2O3QA 3WMXA 1PGJA 3K8ZA 4AICA 3NTQA 2OORA 4XR4A 4B4UA 2YUTA 1UXKA 2UDPA 4JQCA 1K6JA 4E31A 3LT2A 4KP7A 1VKNA 1I0ZA 2Z5LA 4QECA 4KTTE 4M49A 1GU7A 1O94A 5KIAA 4ND2A 4YJDA 4CQMA 2P2SA 3CZRA 1GEEA 4WOKA 5KJ6A 5CG1A 2Y66A 5L7TA 1IOLA 5JY6A 4QFDA 5GZ6A 3OECA 1ID1A 3JCZA 4LMPA 3HSKA 1B8PA 1HETA 4BO8A 3FNFA 1FF9A 1SAYA 2WM3A 5HS4A 1ZK1A 4YJGA 4NDNE 2OO5A 4BMSA 3EYWA 3V1TC 3VPHA 3GNQA 1UXGA 1W6UA 3PHLA 4BGVA 4M87A 1XCBA 4WGGA 2X8LA 3Q3CA 5H81A 1CRWG 1P44A 1DC6A 2Q46A 1H6DA 5L40A 3GVCA 3RAJA 3KTDA 4L4XA 3GDFA 3Q6IA 4G81A 4RVGA 1D1TA 1YWGO 4CUKA 2AMFA 9LDTA 2DQ4A 3I9OA 2NQ8A 3SC4A 1EE9A 4E13A 5DOZA 3PYLA 1GYPA 4BMNA 2ZQYA 4PCVA 3D5TA 2NVUB 1V3TA 3T7EA 1E3WB 1T4BA 2WSBA 1L7DA 1T2EA 1W73A 4MDHA 3UXYA 3V1YA 3IIEA 1ONOA 2VZ8A 2HKIA 3MJTA 2G0TA 3ANMA 3PIIA 1A72A 1PGOA 1QLHA 3MWDB 2XAAA 4MO2A 5TGDA 5JC8A 1M6HA 2FSSA 4RVFA 5CDGA 4L76A 3WNQA 3V2GA 5A3VA 3PIDA 2VWGA 4GPD1 3M6IA 1YS4A 1YRLA 2BFAA 3BHIA 2NQTA 1UDCA 1HDYA 4UVDA 5IZCA 3W8FA 3KYDA 4R16A 2ZB8A 3A9WA 4KUHA 4FJ2A 1J6UA 1NVMB 4ALIA 4E5MA 2V7PA 1M2WA 2X23A 3KZVA 4FFNA 2OXIA 3VAZA 4D7AA 1PZGA 2O2SA 5THKA 4M86A 4UUNA 5HBRA 2HUNA 3UICA 1E6UA 1T2FA 4XX0A 9LDBA 3NT4A 1Q0QA 1E7QA 5JSFA 4B7CA 1VI2A 4BB5A 4DQVA 3EMKA 4ZQHA 4KMSA 1BMDA 3BMQA 4Y8VA 4J1QA 3OQBA 5G0SA 2A9FA 1ISFA 1HE5A 2I67A 4JBIA 4CR8A 2Q45A 5JY1A 2H1SA 4K26A 1ADFA 4R9SA 1DBVO 4CUZA 1H9BA 3SLGA 2Y1CA 2O23A 3TJRA 3D5QA 4D42A 4B4VA 4YT8A 1JN0A 4M89A 1H2HA 3AY7A 4GX5A 2GERA 4UUPA 5K6AC 3PWZA 4ZD6A 1HYEA 5DOVA 4QEDA 3RUIA 4EUFA 4OO3A 4F6LA 1XEAA 2ZB3A 4IZIA 3ROMA 1LNQA 1EVYA 3GG2A 3GOHA 4YEDA 1KVSA 2O3JA 5JMPA 1AHIA 2I9PA 3V8BA 1H6CA 3FF4A 2Q4BA 1OC2A 2AQHA 4D3DA 1LRKA 3C1TA 3H5AA 2EIHA 4RZIA 4CQMB 4XR9A 3JD1A 2Y67A 3Q2KA 4B3HA 2BFPA 3TFOA 3V5NA 3KETA 1PZEA 4BKQA 1VSUA 4FSHA 3TZHA 1P45A 2OUIA 3OJFA 3GAFA 3H6KA 3DOOA 5IDWA 4DQUA 4BGUA 4YRAA 4YJGB 2PH3A 3FBGA 5JCJA 1HE3A 1SEPA 2J3HA 2YDYA 5L9AA 5FI5A 3RWBA 3OICA 4AFNA 1UZLA 1DIAA 4AJ1A 4NZ9A 4Y98A 3ZV4A 3R1IA 1VE9A 4AVYA 3Q1LA 3ANNA 1FJHA 1X0XA 3VZPA 1LDYA 3DZHA 3U4IA 4E5NA 2ZKLA 4ZN6A 1HDGO 2A94A 1B8VA 4KQWA 3RVDA 4CM8A 4J4TA 3U4CA 3PWSA 4NJMA 2QYTA 2W2LA 3PEFA 3IOYA 1QV6A 4J9VA 5EIOA 3GN1A 1RM3A 4MVJP 4GX1A 5DN9A 3OP4A 1M66A 3OJOA 4CMGA 5JBIA 2PV7A 3DHYA 4FW8A 3VZQA 1KVRA 3WIEA 4U5QA 4RL6A 5H82A 4BO1A 5A03A 1DFIA 3JQFA 1NQOA 4LISA 4JBGA 4ESOA 1ORRA 4XDZA 2DU8A 3FSRA 4LSWA 3ICPA 1JWBB 1ONNA 2HO5A 4FC7A 1JAYA 3NKLA 4CL3A 1IZ9A 3GF4A 3KYDB 3EVNA 4OSPA 1K6IA 5ENDA 4J1TA 1BTOA 5JC1A 1E1NA 2HQ1A 4R41A 1P3DA 1VRWA 1BWSA 4OKNA 1NWCA 1DEHA 4XA8A 4NHEA 5TIIA 1O0SA 4W7IA 1C3VA 4CM1A 4OXKA 2JL1A 1KIFA 3NEPX 3BMQB 4INAA 2WD8A 2Q3EA 3TWOA 1GL3A 2BHLA 3BHMA 3WLEA 3D1LA 1T26A 5DBGA 1H9AA 4YT5A 1KOLA 4DIOA 5FYDA 3RFVA 5TT1A 3PRJA 4LVCA 1P0CA 2VRCA 1SEVA 3EK2A 1JU9A 1GQYA 2C59A 1EUZA 3FTNA 1X14A 2CVOA 3U49A 3AUSA 5ER6A 5A4DA 3ZCXA 1OZAA 2P4HX 1QR6A 4K6CA 5JYEA 3G49A 4AJPA 4PFJA 5IF3A 3OJ0A 2VHYA 5DULA 1DC4A 3Q9NA 3QRWA 5JNLA 5L45A 1P31A 4MVJG 1LX6A 2WTBA 3GNSA 4TRJA 5L4LA 4BNHA 4NK5A 3D3WA 3UF0A 4J7XA 1U4OA 2BI8A 3D0OA 2NLOA 1XG5A 5JCXA 2HRZA 2IODA 3AUUA 3U4HA 4YDRA 1QP8A 3K96A 4FFLA 3H4VA 2D5AA 2HRBA 3RKUA
chains in the Genus database with same CATH superfamily
4MGEA 3PC6A 4HQNA 1YK1A 1T8TA 1IMJA 1ESCA 2HMSA 3PT9A 4KI7A 4RM3A 4M9QA 3SX0A 3EQZA 4AY6A 4ZVKA 3EPHA 2CXUA 3BYZA 3OA2A 2C58A 2Q3DA 3TI7A 3PUZA 1WXXA 5AKJA 1WCXA 4RLSA 3OQIB 4UFOA 3U44B 4Y2SA 3FR8A 3EH2A 4ZYZA 5DP2A 3CEAA 3CZAA 3BILA 4MRNA 2QVBA 1DJQA 2P2GA 1U63A 5GJWC 4BAGA 1NDUA 1NKVA 2WHXA 1N2CE 1SM4A 1XTPA 4OUDA 1G4AE 4CM8B 4BCBA 4E15A 5BR7A 1UDXA 2HY7A 3KK0A 4FOSA 1V5GA 2DYKA 3ZCQA 3CG0A 4NJMB 4ETMA 1KDOA 721PA 5GV7A 4YT2A 5CX4A 1XL1A 1ZXLA 2GK3A 4C6RA 3OHSX 3KVOA 4X1KB 1T1SA 5LJLA 1ENZA 1U8CB 3I58A 1SBIA 4WNAA 1C50A 2RCYA 2D2VA 4KPGA 2I99A 1OBCA 3A7DA 4R3NA 4GOND 3I64A 3PLNA 3LVBA 4NR0A 1QYWA 4ZEVA 4GPIB 1ESNA 2C84A 2XEXA 4TTSA 3NAMA 4Y1EA 2O8VA 1YQGA 2D5IA 2X8AA 2ZPTX 3L06A 3GBSA 3R0JA 4MUJA 4U9IS 4TWIA 3SHWA 1CTQA 4C7VA 4ENVA 3O4RA 2VVTA 2G76A 4D57A 3QXSA 3IA7A 4JR0A 2RH4A 1GV0A 1U65A 3K0BA 4NCIA 1Y33E 4F06A 5A62A 1PD0A 2B2NA 1NIJA 2AZMA 2VF5X 3N07A 4I50A 3RAGA 4AO8A 4LKOA 3TCXB 3HBAA 4N3NA 4A0GA 4G1UC 4X24A 4JL6A 4RADA 4RPKA 3RSGA 5BYKA 1PVVA 1SVSA 3IFSA 2SKDA 3C8DA 4NS1A 4JOBA 1TZ2A 5B37A 5HP4A 2NTJA 4BO7A 1VIMA 2LDBA 4TOIA 3WGHA 3AU8A 4ZMBA 4OBEA 1RAIA 1TM7E 2KX7A 2Q9CA 2PGJA 4I8IA 4ND4A 4RH0A 3U17A 3I42A 3IULA 2QN7A 3ZCUA 3W04A 3G6KA 2MSEB 1M3SA 1OH6A 1HI9A 2PUGA 4R9UC 2HA4A 2GTPA 3AEUB 2DBZA 3RVBA 4B79A 1MXFA 1U8ZA 1J97A 1SCUA 1TZJA 2IK8A 4IOKA 2W6JA 3DONA 4PLPA 5F1KA 2A30A 1FDIA 3D0QA 3UMCA 5E6RB 3KC2A 2NO5A 4FLEA 3U6KA 5B53A 1H4TA 3Q6NA 3PUXA 4K6OA 3WYGA 3T94A 4CLRA 4KBYA 4URHA 3FMPB 1Y1SA 1R0WA 1GTRA 1U3CA 3U9LA 1LA2A 1OWPA 4I55B 1QH8B 1ZQ9A 2XXAB 4FYJA 1JHOA 1NF9A 2WE7A 2IYPA 5FTKA 3CRW1 1CS0B 1CIVA 2XDQA 2ZJ0A 1L9XA 3TLJA 4DNQA 1NW6A 1N8KA 3PVSA 4YX9A 1EBUA 4UTRA 3BDVA 4R05A 1YSCA 5H0IA 2YWFA 3RRYA 3WKDA 4B7UA 4ZI7B 3AUXA 4FFRA 4GF5A 4UHEA 2XMQA 4YJ2A 3P2OA 2H1OA 3LUPA 3CNBA 2DB3A 1P72A 2DPYA 2EGHA 3A9SA 4J9UE 5EHQA 3PC7A 2ZI9A 3GJXC 4KQJA 3EISA 4IICA 5B1EA 1J99A 3OKCA 3K9CA 4G37A 1A69A 1EXMA 4J90A 4PAMA 4RJJA 4UAGA 4XZ3A 4C7MA 3WGUA 3B9PA 3HVRA 1O6CA 3NHRA 3VKFA 3VU9B 4E5DA 5F76A 2LCQA 3HDVA 4QUJA 3DAFA 1Y3AA 4HPJB 4CRWB 4CJXA 1HORA 1PU2A 1YZFA 2AN1A 3Q7RA 1AA6A 2JGKA 1VGQA 4URXR 3DD1A 2HUPA 2OZVA 5AK5A 3QE4A 1XNGA 3HDJA 4CZ2A 4R9RA 3KB6A 3KPVA 2IH2A 5L51A 3KOUA 2FPPB 3F6CA 4MV3A 4XCVA 5K3AA 4DKXA 5HE8A 2WMYA 1P0PA 4JI2B 5F2EA 3RBAA 1T3SA 2PLFA 2C1ZA 4L9SA 4BN0A 4B3CA 3DCJA 1NQVA 3VZRA 1C3XA 1R0LA 1RWBA 3OLYA 4LDAA 2HSJA 2YWXA 3EC7A 2HCRA 2JC3A 4G8JA 4DR3B 2BSQA 4BQPA 4P8RA 5TF0A 4BS9A 5CM9C 1OFIA 1XAJA 3B1YA 3IT0A 3REFA 3T95A 3MW8A 1MTZA 2IW1A 3QYJA 4U3JB 2GF2A 2V7QD 3D3NA 4M1KA 2Z9DA 2OM2A 3DEYX 1R18A 4OUDB 4GE3A 1L6RA 3FYTA 3GPDG 4I2NA 4KO3S 4O2AF 2ZSJA 5DKFA 1GAJA 3HCRA 1CXZA 3G9QA 2VCYA 4N39A 4QXOA 2XIJA 2XWPA 3GLSA 1Q1ZA 2R96A 2Y92A 3TECE 3DKPA 2QD2A 3AW9A 5HDQA 5FA5A 4WNAB 3AHEA 5A9TA 3T7CA 1Y1PA 3CO5A 2C4MA 3N2IA 4F56A 1YCFA 2JLWA 2ZDGA 1E4OA 4ONEA 3E9NA 4OBXA 5ICGA 5G41A 1NOJA 2BJWA 5AD1A 1VPWA 5I7VA 2WP8J 1TM1E 1BO6A 1RCUA 2JIBA 2NPOA 3DVRX 1BHO1 3CUTA 3HCNA 3WJ2A 3KQTA 1C7IA 1G55A 1JSCA 1G9SA 1K7SN 1TCUA 1X1QA 3EZNA 2PWPA 4GZ3A 4I50B 1MA3A 3LO8A 4XVRA 5KVVA 2W83A 4Y2HA 4NYJQ 3L82B 2XKBA 5AESA 3VNUA 3OJWA 2EX4A 1P19A 3AHIA 2M1XA 2C07A 1S8NA 3KEQA 1I3LA 1TAQA 1UBHS 4QPDA 3C39A 1NUPA 3DTYA 1EFUA 4MVXA 2J7PA 2PTHA 3DUFA 3KLPX 3RIHA 4M1TA 3GC6A 2QK4A 5ESXA 2WLTA 3EJWA 1YQTA 5I48A 1BA3A 4A1OA 4GL4A 2AUMA 4QDTA 1AQIA 2H0AA 4ALKA 3ANSA 4ZCPA 2X0NA 2ZTVA 1ZPDA 3KXPA 3ZW8A 2ZM6B 2FW9A 4O4IF 3C41J 1OXVA 1JQBA 1O96A 1FEZA 1SCUB 1PWYE 2HBZA 3JQ8A 4JEMA 3RS4A 3ZGYA 4QE3A 5J4HA 4RTSA 5C1DA 3DE0X 2QSZA 4P86A 2RBEA 2IS6A 4IZ6A 4O4LF 4L8VA 1KEPA 1UPBA 2JAPA 2OFPA 5KTTA 3ZDQA 4IS3A 4LXGA 4NF2A 4CLRB 5JCZA 2JGDB 1QQTA 2VN8A 3SKVA 4DCGA 2H7YA 1W5EA 4OSOA 4EFLA 4C3ZA 5L6MB 4CR6A 2GCOA 5FI3A 4HXGA 2IHNA 1HLPA 1D03A 1NBMA 2FXIA 4N7RA 4RLFA 2Y99A 3IR6A 2Z4TA 1Z37A 4ITUA 1ZJ6A 3PEWA 3L7LA 2NU6A 1JXMA 4MDFA 1KTVA 2IYAA 3O0DA 3O2NA 4QGBA 5L7YA 2H4XA 2I1LA 2WYUA 3ZY2A 3H5TA 4H1VA 4DR5B 2GESA 3VR6A 1WMBA 3AXTA 3WLNA 3T1TA 3K0CA 2V65A 2NT3A 1J5PA 4J3JA 2AN5A 4AP5A 4B2PA 1THGA 4YJ2B 1LTHR 4JGBA 4L4SA 4LF8B 1ZAKA 1MXHA 3W5AA 5DYGA 5JJKA 3OZBA 5F35A 3PJGA 2GPJA 3I53A 5SZKB 3Q8KA 1YHYA 5F23A 2OC9A 2VPXA 2Y1GA 1MFPA 3OOHA 2GAJA 5KNLA 3K0SA 1ISGA 4F8EA 4HYEA 3QXGA 3I1FA 1V5FA 1Q1BA 4LXHA 3UC5A 2OHFA 3DFZA 4E88A 3Q2IA 4LTNA 1EH5A 1KEZA 3G1UA 5PGMA 3R3UA 2PPVA 3CY6A 4YECA 3SBDA 2PGLA 4EGFA 5KNBH 3ZTTA 5AM1A 1XMJA 2WHRA 3BMCA 4GD3Q 4GPBA 3ETJA 5FT9A 5JV5A 1W4CA 4MOWA 3WDKA 1P4HA 3EAQA 3LECA 2FSUA 4ZQIA 3ENVA 1V25A 1Y5MA 3MT7A 5CTJA 5EHZA 4R1LA 2QLBA 3U0VA 5ALYA 4NG5A 2ZS8A 1ZDMA 2A5DA 3M4NA 4LBVA 3DWGA 4KIJA 1D2GA 1UOOA 3HJCA 4X1OA 5FUVA 5I7UA 1CUIA 1XL0A 3G2NA 5EL0A 1WBJB 2BL4A 5JI2E 1PL7A 4NBSA 5A1JA 4KN9S 3NFRA 1T0PA 1X7HA 3TE6A 1T43A 3GJYA 4V24A 3LKVA 4ENRA 4N65A 5KVSA 2OHGA 1CNFA 5JD3A 1QUFA 1NN3A 1SVNA 2HU8A 2PAAA 1JKJA 1T1RA 2AEEA 2GPNA 4R31A 4YRKA 5I7HA 2RSLA 4S1VA 2XDAA 3W1WA 4COOA 4IH4A 4B4OA 5G4KA 3WTCA 3PWKA 4KYVA 2YNMD 5K1ZA 3DXYA 2Y0EA 3AHDA 3GVPA 3GDOA 5CFZA 3K30A 3CF4G 3G8BA 4J7AA 2GUGA 4MAFA 3C3XA 2VEDA 2VSQA 1J4AA 2A1IA 2LWIA 4B6SA 3MINA 3C48A 3DJFA 4Z8YA 3L4JA 2ZS9A 4M8SA 4MUMA 4YQZA 5MDHA 1YDEA 3B5JA 3AM5A 2ZRDA 2C8KA 2G5CA 1WQ3A 3LUFA 1LJLA 4BUCA 2NNLD 3LA6A 4I66A 2VBGA 3L0IB 3SHOA 1NMYA 5BV0A 3L9XA 1L6IA 2M32A 1U7HA 4UM9D 1E66A 2HWWA 4IIBA 1JJVA 3H5RA 2DWCA 1D6JA 4MVYA 5FD8A 4B7XA 1T6XA 3OIDA 1USWA 3L6BA 1DAEA 3ODPA 3K6SA 2D6FA 4CT0A 2O8CA 2GF0A 2MYPA 2RAPA 2XMRA 3LQKA 3P2MA 3UT6A 1IY1A 3LRTA 1H65A 3ZDXB 1F2DA 1CYDA 1OBOA 3ZCVA 3RUAA 2J07A 4MP6A 4GECA 4EEKA 2VQEB 3BGDA 4UD6A 3DUFB 2VDMB 3G2IA 3F6EX 3KUXA 1P61B 1KH2A 1S1CA 2BBTA 4G4GA 3AP2A 2OHXA 3RREA 4JX8A 1WPRA 3RFTA 2H1IA 4IJKA 3U4QA 5EJ7A 1G8AA 4DRYA 3NEJA 4YCBA 1L5VA 1JH8A 1OWLA 4MPJA 1O96B 5HJ2A 3IRUA 4M0DA 2Z6AA 1XHEA 2IOFK 3JQ8B 2NSLA 5AJVB 3BE4A 2WSMA 2CGEA 5E1MA 4XQEA 1LVUA 2ACVA 1A5AB 1URPA 2YC4C 3NYIA 4JOQA 1XQXA 1ZRMA 5TMEA 1U28C 4BL5A 3BIWA 3R8FA 4JC5A 2G9VA 1YR3A 3EVEA 3EQ7A 3U2QA 3T1HB 2GCOB 1G4HA 1MRSA 1K0FA 3DMYA 4EKDA 2X5KO 2IYTA 3DUWA 1RMQA 2D0IA 3ZJ5A 3TRFA 9ATCA 4UEJA 3DLPX 3QJ5A 2ZUSA 2NU6B 5AWFC 4F2DA 1E63A 2C4UA 2FP4A 2IT1A 2XSZA 2ZI7A 3KCNA 2AI2A 2VA9A 3B6KA 3RJTA 1KJQA 3TQQA 1IEVA 1UL1X 5JIBA 2Z0MA 3S28A 4PQEA 4DIBA 2C9ZA 1QIJA 3J7TA 1J9ZA 1NASA 1T0IA 4GBMA 3IILA 3HO1A 5BW6B 2A7QA 3OQMA 1NDHA 3HEAA 3OEHA 4A16A 1K2WA 3JYLA 3A1SA 4XWTA 2JK0A 3DAOA 3TEMA 1QAOA 5HJ5A 3ELDA 5B36A 3VPXA 1M7HA 4V1CI 5EI5A 3BF8A 3NBKA 2YQZA 3A31A 4OXYA 3BH0A 4H9GA 3F6PA 4MICA 4OP3A 4PLHA 4RCVA 3SYKA 3UV7A 3RUDA 2C82A 3O4VA 4IKOA 1CQXA 1QLWA 2CHUA 1EZ1A 2PMWB 5ESDA 3B53X 5KEIA 1V3QE 2FW0A 2C7VA 1P9OA 1ZUWA 1N7IA 1PVDA 1SMKA 3CUKA 4Q00A 4HTAA 4ZCQA 2AZTA 3ZHZA 3OX1A 3BMCB 1RS0A 4TLAA 1QH9A 3CRMA 1GPMA 4QELA 5AH0A 3ZLJA 4QXPA 2I34A 2R79A 3CNLA 4FHZA 3K20A 3GJZA 4BNMA 2C4TA 4IY1A 4PYLA 4RKYA 4ZJYA 3A1EA 3S1LA 5K5EA 1WD7A 4F4UA 1BMFD 4FDLA 4BNWA 3RTCA 4AJOA 3GAMA 2B4TO 3NV9A 2IF0A 1BCRA 1N2BA 1ELOA 5CFOA 3FFXA 2YRXA 2BGKA 3HMKA 4CCYA 1GTG1 3ACCA 4TXNA 5ESRA 4QOHA 2MTBA 1YIDA 4H1UA 4KUGA 1JKJB 3MRTA 3WKCA 3UBMA 4JWTA 1Q91A 2D7CA 3V4LA 3DC2A 1P9LA 1Z7GA 1J1ZA 3CR3C 3E7FA 3DMFA 5G4KB 2IXGA 4E1BA 5EUMA 3D4LA 3EUWA 4BB0A 4MKGA 3AUJB 4IX9A 3UW1A 4BVKA 1U6IA 4ESVA 1MW8X 2C5BA 3T0GA 5I5GA 3RS9A 4ER7A 2BGRA 3MBIA 3DBHB 4JBWA 4QFBA 4B5KA 4YRMA 1RXVA 3BSYA 3MINB 1I1OA 3E48A 4QLOA 3ZG6A 4IJ6A 5TARA 1F17A 4Z53A 1SD2A 2UZ3A 5YASA 3EULA 1BA2A 1PQ4A 4YRDA 3RK4A 2Q99A 1QWSA 3QUSA 4E0BA 3L8CA 3R75A 2OO3A 3HCFA 4QVGA 2WLSA 2F2TA 2QN6A 3AHFA 1BGWA 5LIPA 1H4QA 1KO4A 2OZKA 1AK1A 1BGVA 2I29A 1P5RA 4EMSA 4KWIA 5C7YA 5EE5B 3DKIA 3LCUA 4FFWA 3F7MA 1PHRA 3D7NA 2AJLI 4NJOA 3IUMA 3K1TA 2ZRHA 1G291 1H0HA 2WVHA 3I32A 3I8OA 1T2VA 3JZDA 4IDDA 4K03A 3T3GA 1NVVQ 4DRZA 1XCMA 4P3XA 4QOFA 3BWVA 3SMQA 2AJ8A 3K6SB 2Z9CA 2O8CB 5MN6A 2H11A 4PSDA 3ZWDA 1PV4A 1YVDA 3A2KA 1ZMBA 3DL4A 1XZFA 4JZYA 3V4ZA 2CLKB 2ZJ6A 4BFVA 1NDQA 1CHDA 4FBGA 4F11A 2RB4A 2E3JA 2SKCA 4CKWA 1DKUA 5JCPA 2GXAA 4OHYA 4MNTA 4M0UA 1AH2A 1HDOA 1OYVA 3HFSA 4JKYA 5A1TA 4Q15A 3OI7A 3U4QB 4G0NA 4A2QA 4ZU3A 4QKQA 2GX6A 4RK7A 5IG2A 4Z9BA 1PDOA 4F2HA 1JVBA 3NHYA 2VPZA 4TS9A 3H1AA 5IBCA 3AF4A 4OY3A 1P74A 2HXYA 2JCVA 3ED5A 1L4BA 1G0OA 1TECE 1LI7A 2XZPA 3D6UA 3ND8A 3WR5A 1WRBA 5CDSA 2JAQA 2V6MA 4JFAA 3DBLA 1GVNB 1XOIA 4JI8B 4M2LA 4OLJA 5CLHA 3C5EA 1G4UR 3FOAA 3RKSA 3ZDAA 2WFMA 2FPLA 2WILA 4RETA 3SYLA 1WL8A 3AVOA 3UMYA 2PUAA 1QRRA 2GNAA 2HJVA 4D3ZA 1FVHA 3W6UA 4CM5A 1OU0A 2A8YA 2FP4B 2QXTA 4G9BA 4AO7A 1YCHA 2E21A 4C4RA 1PJZA 1W6RA 2XWBF 3BZBA 3IQHX 1N7JA 1WEHA 5A3RA 1JHRA 2B8WA 3DFMA 3BGVA 2ISCA 2ODTX 1S8AA 1E3IA 3GJ0A 5BV8A 1YRBA 3E9MA 3T5GA 3TZCA 1ZZGA 1JIUA 3O9ZA 1EDZA 1ZD8A 2R6JA 2X6TA 1OY1A 4TT3D 1KAHA 4Z6KA 2ZSIA 4MUEA 2WF9A 2NSJA 3QF4A 4G2NA 4N5NA 1L4MA 1XQ6A 4BNJA 5BUZA 3H2YA 4A8HA 4EPYA 3ZEAA 2Q5EA 1UFQA 2JIMA 4K0RA 4L4UA 2VHCA 1GSOA 4B4KA 1C7ZA 1P77A 3M5CA 2COKA 4EY3A 3QH4A 4FK8A 5F4BA 3VNQA 4AU1A 1SA0A 1E1MA 3S99A 2I8AA 4RA9A 2H2GA 2Y1DA 5K3DA 4ZO6A 2BCJQ 3VOSA 1L5WA 1GG9A 3DNMA 4FFSA 4HLNA 1CF9A 4Q39A 2NADA 4FKZA 3EIHA 3L4SO 4B74A 4UMVA 1S8OA 4CHTA 2ISQA 4WE3A 4G5YA 1N25A 3O0TA 5GGXA 4DT1A 2XTAA 4WBXC 4WUVA 4ZAFA 2O07A 3PZRA 4DEYA 5BSGA 2J5RA 4CWAA 1BCRB 3HFJA 4QPZA 1L4HA 4TV9F 3H5WA 3EE6A 4BLOA 1L2TA 1WP4A 4W9RA 3ER9A 3RC1A 4NNPA 2PS1A 1VHTA 2ZIXA 3C3BA 4ZPJA 1B16A 5L3RA 4BLRA 1U5AA 3AG6A 3WLQA 2HRDA 1YZKA 2CDAA 1RRGA 4HWSA 3WGOA 4L22A 1QRTA 2UUAB 2D5CA 3SZLA 1JHMA 3RAEC 3ADKA 4OHBA 2EQAA 1ADBA 1IAQA 3I6YA 3MUEA 4REMA 3W8RA 3C85A 4NATA 1X87A 1U0EA 2GA8A 4Y9DA 4LFCB 3KTFA 1Q1NA 4HQ0A 4TV8A 3QY0A 3PJDA 4GMGA 1WKCA 2BH9A 1QVAA 2G70A 1OQAA 2LUOA 4C29A 1NYQA 4CQJA 5EQTA 2QI9F 2YR0A 4B7AA 2PX5A 4IHJF 5EE9A 5CDFA 3FNGA 3RUEA 2EZUA 4F4CA 4DCCA 4LW8A 4WQMA 3V32A 1A9SA 1MV8A 1GZ6A 3H05A 1NP7A 3QOXA 1CQIA 4JP5A 4K6KA 2H5LA 3IDOA 4O3FA 2P62A 3F98A 5HRUA 3HYRA 1BGXT 4A10A 4PC1A 3OVMA 1OLOA 3KDPA 3A70A 3BCHA 4F1JA 5TPWA 3O4HA 2VJAA 3FVVA 3K9GA 4K87A 4ARIA 1EVLA 5FOUA 3WJ1A 4Q1CA 4GE0A 4DLLA 3L49A 4ZT3A 5FJIA 3ZKWA 1O8CA 5B4TA 5FWYA 4PG5A 3H6HA 1HE1C 1X8LA 4GG1A 4R71A 1BX1A 2PLAA 2HBRA 2IL1A 2QL9A 1H2ZA 4HWKA 4S2EA 1T0BA 4WBNA 1KXZA 4OL9A 4Z4QA 1Z4NA 5K3CA 1B4DA 5IEJA 2VATA 4GZ5A 4EOGA 1J8DA 4CG0A 1GG5A 2VP6A 3B82A 1Q0UA 1VIAA 3KU1A 3IXLA 2Y1KA 2QENA 5ETJA 5AW5A 3S3TA 2FOIA 1GPKA 2VYQA 2XQKA 1B0UA 3UJ9A 4CKWB 2TS1A 1KSHA 1MH1A 1Q95A 2AFVA 3DOUA 3WB0A 2BW0A 4RORA 4CM7A 2JFOA 3P0IA 2CFSA 4OCZA 3IHTA 3L0YA 3ASVA 1PJTA 1C14A 3G17A 3GPCA 4MIYA 5JBNA 1U3UA 4ZEOA 2FEKA 3KJFA 2P9BA 2WUFA 2GETA 1HRKA 1UZMA 3L7MA 1U3DA 2FN8A 5DGDA 1TB4A 3M82A 2GB4A 4GKVA 3FI9A 2DCUA 3OU2A 5AOCA 2IUYA 5TR9A 3SYRA 4DPLA 1JW9B 3BD7A 3VNAA 4AN4A 4R9VA 5HRAA 3EVZA 3DBLB 3AIMA 3FYDA 2PLWA 4KQEA 1UMKA 3GUZA 4UPDA 1M0SA 2P4EA 3BTUA 4NONA 2W6NA 3Q8WA 3EGEA 3M5DA 5THQA 2GFHA 2FEOA 3MJRA 5HE9A 4BJ6A 2HEGA 3W6PA 3GRCA 2PCLA 1YVEI 4W63A 3W3ZB 1ZVQA 3LKBA 4MSUA 1SU4A 4ACAA 5A3QA 1DKPA 5TQ2A 3VR2D 2BV3A 5FFNA 3FDJA 4OJTA 2IUUA 1DFHA 1J24A 1Y1LA 2JJMA 3RC9A 4CYMA 5KYUA 3X2EA 3SCZA 2Q29A 4P53A 1LPBB 4PYRA 3GEDA 4WPGA 3IVCA 1EFPA 4RKEA 3QF4B 4KFCA 4OQPA 1ZW1A 3OD1A 2Q9AA 1UMDB 1VPTA 2WG1A 3GJ4A 2PH7A 2I33A 1PKEA 2EERA 5LC1A 1R9GA 3H1PA 4LY9A 1QE0A 3SE7A 3OJCA 3HJAA 1SA0B 2E49A 1ZJ5A 2I22A 3G7NA 1ZK2A 2WRZA 1YE8A 2Q0XA 3A0RB 3ORSA 4RA9B 1RZRD 1X38A 4JVOA 3D7KA 2JJ2D 1YKFA 5JSHA 2WHQA 2PLRA 4D9BA 1WXIA 5EIAA 1E2PA 3IUQA 3URMA 4B33A 1CYEA 2YMLA 1Y4DE 4C2AA 3BRSA 3LC0A 4UOQA 4L08A 4OGFA 3F9IA 1DAMA 2WJVA 1QPGA 4OVKA 2C3MA 4G07A 4JCCA 1M8FA 4DT1B 2YJTD 1CQZA 1W4ZA 4H3VA 5MHTA 2B4KA 1OZHA 4LJRA 1VBNA 3NPAA 4DPMA 2BFMA 5FLEX 1HFEL 3HB4X 4I5FA 5J3JA 1EUQA 4BVBA 3BFXA 4F3KA 1VPDA 1FXUA 1MJHA 1XHLA 4TLBA 2IOYA 3OUZA 1KAQA 2P5UA 4FM9A 2ZIXB 3I6ZA 3MXTA 3ZJ4A 3LLCA 1SZPA 7REQA 1BD4A 4RMNA 1NNUA 2C88A 2ZR0A 2AMJA 1E7MA 3DB1A 3OMLA 3T0FA 1E79A 5JNUA 4ENQA 2WIBA 4NQRA 4XVHA 1AC5A 2C2XA 3JSAA 2R4UA 4CV1A 2XB4A 1L7BA 4DFDA 5IH3A 3HKCA 4TV8B 2DKOA 4DXAA 4KSBA 5EKSA 4GKAA 2CF6A 1E3SA 1H1TA 1PJ4A 5FORA 1Q3TA 1BQEA 1T36A 2BD0A 2QM3A 1CEYA 2WY2D 2GZAA 4JKIA 4EW1A 3FB4A 4KXFB 1GQSA 1CQIB 4AKHA 4QU8A 4YAGA 1NXSA 2VH5R 5U9CA 3BL8A 2I9KA 2ECOA 3AHCA 4EG0A 1AD2A 2FPOA 5HG0A 1NNI1 4QBKA 4JEIA 3BTVA 1V35A 4O1IA 5TPWB 1XZPA 4RSHA 1RI2A 2V5VA 1K4MA 5EJ2A 2Q2WA 2V6IA 3BCUA 5AOAA 3AJ9A 4ERNA 5IZ4A 1U0GA 1CIJA 2IHKA 3TH5A 4A91A 2F43A 3ZKWB 2OWDA 4P36A 1V8FA 2PU5A 1CUDA 1ZH6A 5FWYB 1C4XA 1PV2A 1P7VA 1DHTA 4IJVA 1X7XA 1F60A 1SIWA 2XW6A 4ENSA 4B4WA 1W0CA 4WBNB 3N6XA 3IKMB 3QU2A 1Z4KA 3KKMA 4R6XA 4C4AA 4EJ6A 5KZMB 2VP4A 3TL2A 4Q9IA 3AR8A 2W6MA 1MC5A 2GCNA 1PT6A 2CMHA 3ADPA 4FGZA 1PN3A 1WW3A 4DWJA 1GSIA 4XVUA 2PJRA 5FIUA 3A6KA 13PKA 4EFKA 1P60A 2REOA 1D2HA 1DI0A 5DFAA 4GOKA 4C01A 4UOZA 3AFGA 3P4XA 4H3KB 4M0CA 4GAEA 2IZ1A 3OF3A 3O5AA 4XEHA 1WUHS 3TS1A 4JD5A 4Q16A 3AVWA 3MQFA 4BEWA 3OTOB 3E2IA 1UAGA 4PHHA 2JFYA 1DRUA 2M6RA 3TE7A 1V96A 5CDYA 3QU5A 3KSBC 2HC9A 1C30A 1SULA 1U0TA 2XHEA 4M0FA 4U8GA 2REQA 3JZAA 3I8SA 4IJ5A 4TYNA 4KIFA 5HWSA 1VL6A 3OAAD 4IHKA 4CGZA 2AG6A 3G0BA 1KYTA 1GQOA 1T6BY 2A84A 5K0CA 2ZXUA 2AHRA 4RENA 3G0CA 5BOSB 5TQ2B 3ON5A 1X1AA 1B8OA 4KB5A 5A9SA 1T8UA 4RPLA 1Z68A 2B98A 3IAS1 4HN2A 2IZZA 4TWBA 2RFLA 3R5HA 1PDVA 4JA0A 5JNRA 5KYUB 3UK0A 4OP2A 2Q8QA 4QUBA 4A23A 2I7XA 2WMDA 1EFPB 1Q1GA 3D2CA 2HWYA 1NX9A 4X62B 1VXRA 1Y7HA 5DI9A 4DM4A 1ETUA 1QNFA 1WVGA 4EGSA 4N7JA 4EVIA 2ZM5A 1DBSA 3KZNA 3PFCA 4EWLA 5A0VA 3QW2A 1WOYA 1V3VA 3Q98A 2OB2A 1PUXA 1P1KA 1MVLA 3O91A 3NJ4A 1ONSA 3WWPA 4J49A 1OU4A 3GRUA 2WWYA 1H05A 1P4AA 1I4DD 4MR8A 5F1OA 2PZEA 5MF6A 4QM7A 4HPXB 3ZWWA 1L3CA 4IQ4A 5D8DA 1SBQA 3GEGA 3MM4A 4U7TB 3WG9A 4UE2A 2QLNA 2FZLA 4R69A 2WKQA 2YV2A 2B4YA 2QRUA 3FOWA 3Q2OA 3TXAA 4ADSG 2M6SA 3AVYA 2ECPA 2Z6UA 2W2NA 4B17A 1Y63A 3K0HA 4JU8A 4A03A 1ZOOA 3A2NA 1RKUA 1T9GS 4XTCS 1KJIA 2DECA 2DUNA 3IAS6 3FPFA 1TPZA 3S8EA 3ZWBA 5BQFA 1PEDA 5JTUA 2FVXA 2ZCJA 1P2UA 1ZNXA 5KAMA 1GILA 3FPCA 1J1UA 2A35A 1TUIA 2J3JA 3GA0A 1GPYA 5FXMA 4MKHA 4B2YA 4OEHA 4UU8A 7REQB 1T34A 4AS2A 5EP4A 3K71B 4TPKA 4HAYA 3ZVLA 5T4EA 1RIFA 4EHAA 4AKGA 4R1NA 3V7NA 3LL7A 3P4UA 3G68A 4PN7A 3F5FA 2QQEA 1A8QA 1N57A 3GFBA 1Q6ZA 2CWDA 4IMPA 4Q6WA 2FRDA 3VR3D 4QYMA 3GA5A 4JUAA 4AK9A 3LBIA 1JFSA 2BM8A 3L6DA 2H4HA 4WERA 1T36B 1NSYA 4XAQA 2W9XA 3QUQA 3V46A 4QO8A 2X1HA 3P9IA 1OZGA 4JT2A 1G3RA 2VJYA 3IX7A 3UO8B 5LWQA 4NEQA 1T2CA 2ONYA 1F0KA 1TYDE 3MBOA 5E1OA 1OKKD 1XNQB 1L5QA 1MNAA 2NUPA 2X1MA 1D1QA 1H2RS 1ZMOA 3EPRA 2HA6A 2P5SA 4D96A 3IQXA 4AT1A 3JU3A 3RSLA 3BB4A 3SEFA 3OFNA 4JSYA 2WEKA 2F43B 3NOOA 4C0XA 2G88A 1EFVA 3ABSB 4LOKA 2GN9A 1X7XB 3LPAA 5FTNA 3K6KA 4R2JA 2UZ0A 3E61A 3T4PA 4WADA 821PA 1Y3HA 3OUUA 4OI2A 4AG6A 5IJ9A 1XVLA 3DOFA 4ER5A 4MYDA 3X2FA 1AMNA 1PNQA 4F8YA 5IP5A 3SFVA 5T7BA 4QVIA 4GQAA 4M0LA 1DTSA 2I7DA 1USKA 2HM7A 2IIBA 2XNJA 4JJ4A 2PUDA 1XR3A 3E84A 3N58A 5DXJA 1ESEA 1YS2X 3LDGA 4FOLA 3M9LA 3ACBA 4H1TA 1M8PA 3BGSA 2CJPA 1S6YA 3EVFA 1TQHA 1D2CA 5AW4A 1QCYA 2RGXA 3NS7A 5EIWA 4S24A 1YBMA 1M5UA 4B6RA 4OFWA 2C4KA 2PTGA 5JAQA 2FTKE 4R1QA 1M1XB 1Y7PA 4HQRA 4JYBA 2ZRMA 2XJ9A 4M21A 3B6ZA 4X85A 1BXGA 3PUYA 1ADCA 4YAJA 5IBRA 2ZR8A 5F51A 2IV2X 1NR5A 4GSKA 1C30B 1KO7A 4NABA 2B1JA 3OCJA 2O6HA 3VR5D 2REQB 3ONVA 4RVHA 4RWEA 4XQ0A 4BKPA 1O6GA 2J5BA 5FR2A 2BKXA 1HDRA 2FSPA 5J59A 1G8SA 1R5BA 4J8PA 4Q01A 1R9JA 3HO8A 3K16A 2VJBA 1U1CA 2EW1A 1VIVA 2VTEA 4RJ2A 4QT0A 3F3MA 4XUDA 5A9SB 4Z4IA 2E89A 2RGWA 3F74A 4P54A 2WM9B 1L7RA 1LSOA 1A8PA 1Y48E 2QG9A 4O33A 1WF3A 5TRTA 1DTWA 1GNSA 4AX4A 1NJSA 4RS4A 2R60A 2R44A 3AERA 2G1KA 4GLJA 3PKJA 1Y82A 1VYVA 2QRLA 1UBGA 4N6OA 4HGOA 1EUDA 2B9EA 3VXKA 2QTFA 2QEQA 3KLOA 3O1LA 1FUUA 1G20E 1B2LA 5KUTA 1ST3A 1CDDA 4CKEA 5JH7F 2HH9A 4OQMA 2J0EA 5K03A 3TBFA 5IPFA 1XAGA 4ND8B 3Q0EA 4MR8B 3RFFA 2FQ1A 3GRKA 3IPAA 4LG1A 5ILOA 1MPTA 2CLIB 3DDUA 3I28A 4HXFB 4N0EA 1CJTC 5F12A 2OV6A 2VFAA 4LMRA 1GN9A 5CYPA 4CTOA 4A6XA 3QKSA 4MDEA 4MR7A 2JFVA 2DUWA 4MI6A 4TRNA 4F5YA 1F0YA 4KVGA 1HZJA 3CE6A 3QA3E 3RIGA 2CDBA 1IUKA 3TTTA 2ODEA 3I01M 3QY9A 1USIA 2KMLA 1X2EA 1FRZA 4UUQA 2A9PA 4MGZR 1RLJA 2X9GA 1FRNA 4M98A 2P2LA 5DN6A 1DIRA 3TZKA 3CZQA 3WHLA 2XZLA 1K8QA 3DMTC 2BFFA 1KVUA 1FNBA 1NPYA 4K8OA 3G1TA 1T8PA 1NUAA 5TSDA 2BEJA 2IP2A 3TLAA 2Y9MB 5I7AA 1KI9A 1YJCA 2L42A 4O1HA 1DRWA 4KV9A 3RU3A 2ODQA 3C3DA 1KKMA 3FJOA 4JLAA 4M22A 4DADA 2ZUEA 1C7EA 2PMBA 3KPYA 2AYXA 2AGVA 1MW9X 1PWXA 2CK3A 1H6AA 3GFRA 4HNSA 3RJ9A 3S68A 4YCAA 4Q66C 2W6ID 3U39A 3K2IA 3OO1A 3WNCA 3VJRA 1UJ5A 4GMFA 5FWXA 4JBNA 4MLPA 2WSSD 2P78A 3EY9A 1G8JA 1GZ5A 5H70A 2Y3IA 5C8XA 5FA6A 2PSSA 4YAKA 3VI4B 1Q7BA 1LCIA 1QS0A 1Y8RA 2F1HA 3F1KA 1QFYA 2NUPB 1MOPA 2B61A 4EITA 1G2IA 1G98A 5EXPA 2OMEA 4HMQA 3WIBA 2F1JA 2GT1A 3VPBA 4NMLA 4D9KA 4MLCA 2Q3LA 4EY4A 4FGJA 1OAAA 3GVXA 5I7RA 4URVR 4BKUA 1EFVB 1YFZA 3FPGA 5U4QA 3RYCA 3KL4A 1E1QA 3IBYA 3ETDA 2PD4A 3RHFA 3RYIA 3KOWA 2AYYA 4P3NA 1HFWA 1TZBA 5IJ9B 4BNVA 5DBHX 3X43A 1N2HA 1KYWA 3IB3A 3MLEA 5ALVA 4PR3A 2H18A 4M1YA 4OQLA 1ZIXA 2O8BA 4Z86A 3QM1A 3ULKA 3DYIA 3FPBA 3OZTA 3WGIA 3H3XA 1PGQA 3G3EA 2PCJA 4QREA 5DGTA 3ESQA 4GYYA 2G8NA 1GPUA 3H99A 3X1JA 2IDJA 1J2EA 2IVZA 2XECA 4LHWA 2JIZD 1JH9A 3LU1A 3V2HA 1QG4A 1S9DA 4ZO7A 1XEWX 3M9XA 3P0JA 4L0CA 3U19A 1WXHA 5DM2A 1N9GA 1BXGB 1KS9A 3Q11A 4HFNA 2IUEA 2H59A 1YZNA 1GFSA 4P80A 4C0JA 1JG6A 1ZXBA 3MEQA 2DP4E 3NLLA 4DNFA 1W52X 4A0FA 1RNLA 1SD5A 2MSLA 1N6LA 3D5EA 3DLTA 4OXNA 4CKBA 2GEBA 3PEYA 3SICE 3F4KA 4XD2A 1U9ZA 4MINA 3V8EA 3H18A 1SWVA 4TXMA 2J9YB 4WOCA 3ZWYA 5LDDC 3A14A 4IIVA 3ABOB 3AVUA 1RRPA 1W96A 4R98A 3BIJA 3X1DA 2IS1A 5C32A 4WLUA 3H3FA 3NDJA 1EX1A 1ZN9A 1DTWB 3PNVA 4WZZA 4EIWA 1Q7GA 3SVLA 4DQKA 4IIEA 2X4GA 3WLMA 3AERB 1A8SA 1PQPA 1W76A 5BPHA 3UJNA 1A2KC 2JZNA 3W4JA 2CHFA 1E2BA 4C4TA 5MGBA 5C2JB 3UMGA 1ULSA 2ZTSA 5I6DA 4AZWA 1FVOA 3OE5A 4ZQFA 2UXCB 3QWBA 1EUDB 3A3YA 2NPIA 4WLOA 3ZDEA 4LF6B 3NM6B 4LJ4A 1SXHA 4N9WA 4FB5A 3NPMA 4YCDA 4TN1A 3SKYA 1PQYA 3GRFA 4CKEB 3JD0A 4MPTA 3TMAA 2HK6A 3O8RA 1IXYA 3PFWO 5BSEA 4E2XA 2HX1A 1KETA 2OD9A 1OMOA 1GCGA 3CA8A 1IATA 4K6MA 3ABZA 4RJLA 5JMOA 1ECJA 1OGYA 4EB0A 2P3OA 1NZFA 3CLKA 3MYRA 1KJ9A 4G0YA 1VYHA 4EHNA 2QT1A 3RYTC 1YBHA 4DTIA 4FPXA 4US0R 1LQ2A 5HUQA 3QKSB 4MR7B 5J1SB 4TX1A 4E30A 2I4LA 1OYWA 1YI8A 3EIQA 3RVQA 4DW8A 2XNKA 5EKUA 3PGMA 2VDQB 1GUZA 4IW3B 2YOGA 4AIRA 4KIUA 4OJMX 4Q7LA 1VL5A 3LQFA 3UPTA 1EZ4A 2JI7A 5J4KA 2VOEA 4YO8A 1KJNA 2R6FA 3ORHA 5C37A 1VBFA 1A71A 4UM8B 3V8QA 2HQRA 3G7SA 2JLBA 2BFFB 3ZBTA 3IV9A 2I7VA 3VVLA 2FCRA 5ITWA 3ESDA 2ORYA 3B12A 5ALJA 4G2TA 4ZAZA 4LYYA 1FY2A 2R6DA 2ENWA 4OYRA 4PX2A 4BTEA 2VJQA 2Q1YA 2G1JA 4UAJA 3UAXA 4H1WA 2A9OA 2PL1A 2HYIC 4ZKEA 3IPCA 3PC8A 1SKBA 4MKRA 3QUAA 4LJLA 3DEFA 3TIVA 1J8VA 4RY2A 2VHUA 3B20A 1U0LA 3PA6A 3INTA 2I4RA 5FWXB 3X1ZA 4OMFG 2PO7A 2Q2VA 2X2FA 3C15C 3T4XA 3CB2A 3DKRA 5TPZD 2PSHA 1P0QA 3OCWA 1HYQA 2B8TA 3G8AA 1RWOA 2RHHA 4JIGA 1Y8RB 4WY5A 1QS0B 1BXZA 1KZGB 1PHPA 1PUJA 1B0AA 1G6Q1 5DCYA 4CKXA 2B21A 2ZATA 1Q1AA 4F4IA 4NHOA 1E94E 4ZVPA 1D4ZA 3Q0IA 4HLDA 4AWXA 4BMXA 3AR5A 4LSZA 1WHSA 4F86A 4JKOA 1GNTA 1E6WA 3AVXA 1ZU5A 3TRHA 2Q7XA 1CZNA 3RYCB 2PUTA 2ZPAA 2IUTA 1H2AS 4AKSA 4DL9A 4BEVA 2AR9A 3UUWA 2OZPA 2P4UA 3RYIB 4EKGA 1PT5A 4ED9A 1JJIA 3Q7SA 5BT8A 3GY0A 1E1RD 1T6ZA 2O3TA 3CN9A 5LA6A 3W34A 5FTLA 4MKXA 4NFYA 1C2YA 1KYIA 3UUEA 2O8BB 1WDMA 1WEKA 4EKNB 3HM9A 3IAXA 4UTZA