4R68A

Lactate dehydrogenase in complex with inhibitor compound 31
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
total genus 115
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r68A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r68A02
4M8SA 1IULA 2FPGA 1XU7A 3F4BA 3MWDB 3WBFA 2H1SA 4F46A 5A04A 2AMFA 3VH1A 4XRGA 3HE3A 3U4DA 2B0JA 4GI2A 1T25A 4ZD6A 2GYYA 3S8MA 4UEKA 4S3MA 2GN8A 3L77A 4RDIA 1U3VA 1ZXLA 1EK5A 2JJYA 5IXYA 1QV6A 4BNJA 5L3ZA 2VWHA 5B4UA 1BG6A 4AL4A 4HFRA 3AU9A 4DVJA 3HDYA 5BSGA 5JMPA 1NTOA 4YR9A 4YDRA 4YYZA 4R3WA 1PL6A 1F8GA 1MB4A 2X5JO 4RVDA 4OXNA 4XEHA 2X9GA 1DBVO 1EFKA 4NPCA 4CLDA 4J4TA 1E1KA 3OBBA 1ML3A 3KV3O 4CQMD 3EVTA 5TIIA 5JY6A 4HP8A 2HQ1A 4CMEA 2P5UA 4II2A 2BFMA 4E6PA 2ZK7A 4NK5A 4I08A 1VLLA 4FB5A 5EQDA 2CVZA 1AHHA 2VTEA 1HDZA 2WYWA 3O9ZA 1P44A 1C1XB 4YQYA 3T4EA 1HEUA 3GEMA 3QVXA 3K6JA 3TN7A 1E7WA 3PHJA 5HM8A 4N54A 4Q39A 5JAMA 2O4CA 4GGOA 3OJOA 1ONPA 5JO9A 4OJNA 1ONNA 3NV9A 1EMDA 4O6VA 2HJRA 5DCUA 4ND3A 4MVJH 4ALLA 3B20A 3I52A 3LQFA 2CVQA 5F21A 3KVOA 3PTZA 2YDYA 2C20A 3KSUA 3SJUA 3KO8A 1E3IA 1YH3A 2UUOA 5DOVA 1HXHA 4A73A 1LDBA 1XU9A 2OO5A 2PGJA 3JCZA 4NZ9A 2DKNA 3DFUA 4B8WA 1NYTA 1AHIA 4MIYA 4P4LA 1EFLA 4XYMA 1NQTA 4TQGA 2R00C 5FYDA 1R0LA 4XWYA 4EJ6A 3RC7A 1MLDA 3PXXA 4GVLA 4U0KA 2X0IA 2WDZA 1U1IA 3SVTA 3H65A 3PPIA 9LDTA 3DB2A 3GDGA 3IKVA 2VUSA 3L9XA 3BTVA 2GZ1A 4TRJA 2IZ1A 1NASA 4CM4A 4HBGA 3ZW9A 1MGOA 3WXBA 3N58A 4YT4A 3U4CA 5L7YA 3WNVA 3FWZA 4NDNE 3LT0A 4JBIA 1ZK4A 3ASUA 3BHMA 3ENNA 4GLOA 4Z9XA 4D45A 3K30A 2FOIA 2GRAA 3RUIA 4OSPA 4WOKA 1VSUA 3P2YA 4BO9A 4LSWA 3LVFO 5IZCC 1HDCA 2PKQP 3NDRA 2QYTA 1K2WA 1T2DA 3W4KA 1N2SA 4IUYA 3UHAA 1DFHA 1PZEA 2HMTA 3WYCA 4ZICA 1DAOA 2P4QA 2HUNA 2X4GA 3AUAA 1YS4A 4YCAA 4Q3DA 4ROSA 4ZQHA 1NP3A 5ER6A 1W0CA 4J2OA 2B36A 4R4JA 1BMDA 3OIGA 5KKAA 3U09A 1ZSYA 5CDTA 5BR7A 1ZK1A 2FY8A 1CRWG 5F1OA 5L53A 4ZA2A 3PI7A 4FBGA 3AU8A 4OKNA 5DP2A 3W4IA 4GWKA 3ZN2A 4CMGA 2VUUA 4FFPA 1TVEA 2AW5A 1PWZA 2HKIA 3A28A 2DBRA 3IP1A 2QRJA 4Q3EA 3WIEA 5KVSA 4LGVA 3W8FA 5BSHA 2ZYAA 4XDYA 5LDHA 3OIFA 5FFFA 1EE2A 1DSSG 1XDWA 3QY9A 1DEHA 4BOYA 4E3ZA 1Q7GA 2EHDA 2HO5A 2XOXA 2IXAA 2NTJA 3I6IA 4JJIA 2O3TA 5TQVA 4BNVA 1I0ZA 5AXBA 1VJ1A 3G1TA 1NHGA 3LZ6A 3RU9A 4G5HA 3E9MA 4J9UE 4FC6A 4J90A 2FZEA 1FDTA 1KVQA 1R0SA 3BAZA 2W8ZA 4AJLA 3SC4A 1JTVA 2Q1WA 5FWNA 3EY4A 2OXIA 3BXXA 1DOHA 2NNLD 2J5KA 4O59O 1E3EA 4KDEA 3TRIA 3I9JA 4R3NA 4BGIA 5IN4A 3GH3A 2NLOA 4IDDA 4II3A 4AJ1A 2D1YA 4JN6B 3ZWNA 5C7OO 3WFIA 3WSWA 3S1LA 3L6OO 3R3JA 5HS6A 5LDGA 5JMWA 1ISGA 4CUKA 1E7YA 3BMCA 4DIOA 3JD3A 4RPJA 5K0ZA 2UYYA 3C8MA 4GGPA 1YDWA 1ZEJA 4OYRA 5B4VA 5JCJD 3SLGA 1K6IA 5TJ9A 4P38A 1KY5A 2FR1A 1CETA 4DLAA 3QP9A 4ILKA 1IHXA 2J3JA 2V7PA 3ZU2A 4Y8VA 3MCVA 1ZNQO 4QUKA 5GZ3A 4XGIA 3ROMA 3U3XA 2R2GA 4CLRB 3A4VA 3STHA 1V3VA 5A1TA 4AJ2A 1YRLA 3LT4A 5AYVA 1N5DA 3JQDA 2VT3A 3MOGA 4ZVVA 2HMSA 3S2IA 2A94A 1KEPA 2BD0A 1I33A 2DTXA 3AWDA 3M2PA 2I67A 1LU9A 4JK3A 1I2BA 2P5YA 1O9BA 4R68A 4R9SA 3VZPA 1HDYA 3GVHA 1V3UA 1JVSA 3VAZA 4YT2A 4ZGWA 4OOFA 2PGLA 4B3IA 1GY8A 3GVXA 4DBVO 1HYEA 4BNUA 5LCXA 4B79A 1H0KA 1M2WA 1K5HA 4AJEA 1HDGO 3EAGA 4IDBA 3QJ5A 1NVMB 2GNAA 3IUSA 2GPTA 4C7KA 4W9NC 3GZNA 2VHXA 3E5RA 4GQAA 5CG2A 3MJ4A 2DU8A 3ZH2A 2DUUA 1N7HA 3O8QB 4I5DA 1YBAA 3E82A 1I2CA 1NVTA 3PQFA 4EYEA 4ZQEA 5TT1A 4BKPA 1LEHA 1PZHA 2RH8A 5T6BA 2QQ5A 1LDGA 2QRKA 4BKRA 3HG7A 2ILTA 3EW7A 3P19A 4PLVA 4QFCA 5TGDA 5KNLA 3ZWMA 1B3RA 2YYYA 3KYCA 4UUMA 1F0YA 2CD9A 4L4SA 4NBUA 3DR3A 1NR7A 2O23A 3UXYA 1UZMA 3FRJA 4FN4A 2JFGA 2JKVA 1LDMA 3RFXA 3DZGA 3JTMA 3WX0A 4BHTA 4CMJA 4XGKA 2VOEA 3DMYA 2GN6A 1DPGA 2QRLA 1UP7A 2NVUB 3L0DA 3QSGA 3PJFA 3L4BA 3ZGYA 4LCEA 3AY3A 1L1FA 1UAYA 3K31A 4WCFB 3OFSA 3RIHA 1U2GA 3ROKA 3ZWYA 4DGSA 3RJ5A 1E77A 1V0JA 4FQ8A 4GVXA 4IJVA 3RVDA 5A03A 1QYCA 4MIEA 4NH4A 3HN2A 1LQTA 3DZBA 3GMDA 1NPTO 1CDOA 2V6FA 3QVOA 1Y9EA 4RZIA 3NDIA 1LDEA 4PCVA 1HLPA 4Q3AA 3NGLA 3ZDFA 3G1UA 4CM3A 3DBHB 4KWIA 3VH4A 3X2FA 2OP1A 1HE2A 4R1NA 4O63O 5DULA 2VNAA 1YJ8A 2DTDA 3GZNB 3TZQA 4QT0A 1UDAA 3BTSA 4DA9A 1ISJA 3F4LA 3WYBA 5JE8A 1VE9A 1DB3A 4EUEA 1P1KA 1ZK3A 3ITDA 4TRRA 4BNIA 3CZRA 1A72A 1GU7A 1YBVA 4XB1A 3FWNA 4U6SA 2A92A 1Q1NA 1VM6A 3ADPA 4LN1A 4PLWA 1C0IA 1QR6A 4FS3A 4WASA 3RI3A 1A4IA 1R12A 2Q2QA 1ZUD1 3H5RA 5FEUA 4FFLA 3FBTA 4BO4A 1B14A 4ZQFA 3IDSA 1D1SA 4HADA 1TLTA 1R37A 3AW9A 4YTEA 1DXYA 5C7LO 1JW9B 5T5QA 5JAIA 4BO8A 1X15A 1LXCA 1T26A 2BH9A 3EHEA 1UH5A 2X1HA 3BZUA 4YRDA 3WGTA 4DMLA 3ZWWA 4GAEA 3JQFA 2RCYA 1U9JA 4DIBA 1K6JA 4BNZA 3JQAB 3AFNA 5TX7A 4CM4B 4YT8A 3KOUA 3GEDA 4WLUA 4YXFA 2YHUA 4MKZA 3MTGA 1OFGA 4H3VA 4WJZA 3WGGA 2X5OA 1ZSVA 2FPIA 2XAAA 1H93A 5MGBA 4RQTA 2OMEA 3G0OA 3I1JA 4G2NA 4IZHA 1PL7A 3RSHA 2Q45A 3M1LA 1RYDA 4C4OA 3INRA 3RBZA 3H9QA 4JLWA 4H16A 4TSKA 4NBVA 4ZJUA 4IY1A 5ICSA 4BNYA 3FNEA 2EKLA 2V6MA 3PRJA 2X23A 2LDBA 3DC2A 1I8TA 3MOIA 4MKXA 3UUWA 3G17A 5F3RA 1E7MA 4WCDA 5THQA 3ETEA 4BNHA 1A5ZA 3EVNA 4XGNA 4NG5A 2A9FA 1MG5A 4BL5A 1U2DA 4UAGA 1E3WA 1P9LA 1U3WA 4MVJM 5EQFA 1E6EA 4GLLA 4LRSB 4QSMA 3RJ9A 4OSOA 2P9GA 1Z6ZA 3IQDB 1FDVA 1GEEA 4CM8B 5KJCA 4CM9A 3DBRB 3DHYA 2I9PA 2XPCA 2UVDA 3EZYA 3GY0A 3DMTA 2EW2A 3HB5X 3QHAA 2Q3EA 3F5QA 2VNSA 3ASVA 5TRTA 3RBXA 1HDOA 3PWSA 4RL6A 3ZV5A 1DAPA 3I4FA 1KEVA 4MJLA 2W2LD 4U0JA 1I3MA 5FI3A 2I65A 4MVJD 4OOEA 4FC7A 2C7VA 2IEBA 1ULSA 1HSZA 2ZIZA 3HDJA 1SB9A 3JSAA 1PS0A 1YWGO 4XD2A 4TRNA 1E92A 1Y8RB 1XHLA 2FP4A 3C85A 1Z75A 3Q3CA 2YFQA 4WLVA 3JQBA 3K9QO 4B7CA 1NVGA 1IZ9A 1IHYA 2DM6A 3M2TA 4KUHA 4RF2A 4CLXA 4R5MA 3V2GA 3H9GA 4YJFB 3F1LA 3NJ4A 2J6IA 5HS4A 1UXIA 2GUGA 3BMQA 3WNQA 4YB8A 3KEQA 1XGKA 1E7QA 3HN7A 4YJDA 1CWUA 3I9LA 3P5SA 4TROA 1BSVA 2ZCUA 3RAJA 5TNXA 1MV8A 1ZK0A 1DIHA 5CEJA 3ZHYA 1KERA 1YOVB 4Q3NA 4DQXA 2BI7A 1LA2A 2IZZA 2P4HX 1KEUA 5AXCA 4B4OA 4CR8A 4J4HA 2WWRA 4CR7A 3LSYA 1HL3A 5AOVA 1NBOA 1SCUA 3KB6A 1GV0A 5CDYA 5KIAA 3LC7O 1QKIA 4MP6A 1CIVA 3X2EA 1QRRA 3EUWA 4B4UA 3OQBA 2G82A 4IJKA 2G76A 1LDNA 2JAPA 3NJ8A 1KYQA 1E5QA 3R0IA 3JYOA 4QECA 3KLPX 3I3OA 4TKMA 2QW8A 3ZCXA 5JC8A 3UGKA 1IY8A 5JY1A 1O94A 4DQVA 3FTNA 2Y1OA 2OZPA 4ESOA 3DAFA 4UUNA 3GGPA 5EN4A 5DF1A 1RYEA 1LUAA 2D3TA 5BT9A 1WDKA 4AJNA 5IG2A 3MJSA 3F1KA 4PRKA 2BMAA 3NT2A 3H6KA 1PJTA 2Y0CA 1X14A 4Y9DA 4E2WA 4EUHA 3I9MA 2HMVA 4CLOA 2PK3A 4E33A 1TT7A 2X0JA 1SOWA 1XYGA 2FR8A 3VH2A 4CL3A 4GL4A 5CFZA 2O3JA 2NVWA 2UUPA 4YJHA 5A9SA 1XQ6A 3IAHA 4OH1A 4QO7A 1DO8A 4LMRA 1WMBA 1WP4A 4F6CA 1HE5A 1EVYA 3OICA 2DLDA 1PGPA 3E6AA 3ANMA 1HTBA 2CDAA 3D7LA 1HDXA 1YB5A 2B4TO 3F46A 3RFTA 1OZAA 4OQYA 4I9HA 1RM5A 2VRCD 4PVDA 4AICA 3G79A 4XQGA 2HJSA 4YJFA 3OIDA 4IIUA 3UKOA 4NFYA 1E0DA 4K9DA 5T57A 5IDXA 5JYEA 4FJ0A 3PYXA 2RBEA 1SZJG 2GR9A 3BTUA 1WW8A 3E9QA 1E7RA 3EGOA 2VZ9A 2PKRA 4AJKA 4E0BA 1NXQA 3PGXA 1P3DA 2Q1SA 4CMIB 1FK8A 3IJPA 1DHTA 4PLZA 4M86A 2CMDA 2RIRA 4WCFA 2IODA 3BA1A 4YAKA 3HHPA 2ZQZA 1LRKA 3NT5A 1H6DA 1BWSA 2G1UA 3GPDG 4OMUA 1P1HA 2NTVA 2A4KA 1KVUA 4J6FA 3UH1A 3JQ9A 3NT4A 4NR0A 3QVWA 4R1UA 3VTZA 2I3GA 3CPSA 1SB8A 4E4YA 1NX6A 1O0SA 3DO5A 4NU6A 1A7KA 2O3QA 3E8XA 3GG2A 1PJCA 3PWZA 1HYHA 2E82A 2EJWA 1XELA 1SAYA 3FBGA 1WVGA 2IE0A 3MJVA 5CG1A 1PWXA 4HNHA 3TWOA 2WTBA 4TZTA 1LC3A 5G0TA 2ZB8A 3KEOA 2PFGA 2DFVA 1T1RA 3GFGA 2AHRA 3WYEA 3Q9NA 3WLEA 3L4BC 1YGYA 4J0FA 3VPGA 4DL9A 3WSVA 1Z82A 1RKXA 5ICMA 2X0NA 5TLSA 1Q0HA 2ZJ1A 1NFFA 1T2AA 2ZATA 4FOSA 3QLJA 3B70A 4R5HA 4NHEA 1B0AA 1I3NA 2D5CA 1I36A 1LLCA 1RM4A 2YV2A 4ND5A 1U4SA 1JKJA 3ADOA 3GRKA 5A9RA 3DDNA 3FSRA 1LTHR 2E48A 2HU2A 4RO0A 1EBFA 3CEAA 1QSGA 3DZHA 3K92A 4J49A 4E2ZA 4XX0A 2XF8A 3GVIA 3EMKA 3RKUA 3RU7A 1ENZA 1E6UA 4CM6A 5ITWA 3JQ9C 4PLHA 2PH3A 1EQ2A 3LC1O 4W99A 5ENVA 4D44A 2BRUA 3AY7A 3ENKA 3JYLA 1A7AA 2CY0A 2PZJA 1W8DA 4BNTA 1G6KA 1YBMA 2Z1NA 1EZ4A 2BFPA 2JFFA 5EESA 3DWFA 4RPKA 3MJCA 2OBNA 4CM8A 2HK7A 3H7AA 5TS3A 3DBRA 4BQRA 3AI2A 1I24A 3T7CA 3UCEA 1EEHA 1T4DA 3QVSA 4UVGA 5JXWA 4JIGA 1D3AA 1C0KA 1M66A 4IDFA 3UF0A 2DBVO 2O7SA 1X7HA 1MFPA 1YXMA 2DPGA 3PWKA 2NVBA 4D7AA 5C37A 3GNSA 5IZCA 2Y66A 4BS9A 2WYVA 1Y8QB 1ZMOA 3ORFA 4Q9NA 3FN4A 3DL2A 3WWYA 3PHLA 3LLVA 5F5LA 4R1SA 3SBOA 5GZ6A 1DHRA 1HZJA 2YQ4A 1XWFA 2Y93A 4R1TA 2C07A 1NWHA 1YQGA 1EVZA 3L07A 1Z73A 2Z95A 1VKOA 3CMCO 3OH8A 1QXSA 3RBVA 1Z74A 2HDHA 2HSDA 4NU5A 3WGOA 3A1NA 1P33A 4U5QA 3H3FA 2VRCA 2Q4EA 2BLLA 4I9UA 2IZ0A 4UVHA 1MFZA 5LC1A 4EGFA 2GZ2A 5KVCA 5K6AA 2Q99A 1NAIA 3KHUA 4ALJA 5JW6A 3E18A 3RUDA 2ZTLA 1XG5A 2F1KA 4A2CA 2Q4BA 4I9NA 4RV9A 1JAXA 2G0TA 1TT5B 3K2BA 2PD4A 5TT0A 3DBLA 1U4OA 3C1TA 2J3KA 4WGGA 5F1PA 1RWBA 1YQXA 1M75A 1PJLA 1ZMTA 1S7CA 2D4AA 3RQSA 1QMGA 1XKQA 2B4QA 2OFPA 5CHEA 1ZBQA 5L95A 3GLQA 4CMBA 4XA8A 3RUHA 2DFDA 2X86A 4FFNA 4UUOA 5F1KA 1LSOA 4CUZA 5KOIA 3DTYA 5ITVA 4PFJA 4XDZA 1IOLA 1M76A 1YOVA 3PLRA 4R51A 3PLNA 5CAEA 1U8XX 1LSUA 1KIFA 1BTOA 4I5FA 4EUFA 4AJ4A 5BQFA 1G0NA 3ZU5A 4EI2A 1YB1A 4A10A 2OP0A 3ICPA 3JQFC 1W6UA 3WMXA 1BVRA 4PLYA 4Y6PA 3WIDA 3JQ8A 5BSFA 2Y1GA 3D4NA 3I9OA 3VPFA 1QORA 3ETDA 2VWGA 3PGJA 4RDHA 4Y98A 3DBHA 3WBBA 3UCFA 5KVQA 4XIYA 2PZKA 3I23A 5I9LA 1KVTA 1R4NB 4GSLA 2VZ0A 3R6DA 4Y6SA 4CQLB 5K6AC 2NTNA 5BNFA 4BO7A 4HNGA 4E5YA 1GCUA 1H6AA 1R4MA 1V8BA 4BO0A 2FMUA 3BHJA 3WOHA 3IP3A 1F06A 1VRWA 2EGGA 4PZEA 1M6WA 1WWKA 1VSVA 2J3HA 3ANNA 1DC5A 1A9YA 1A4UA 3AI3A 1W73A 3E03A 5KTKA 1K6XA 1WNTA 3GPIA 2P2SA 2WD7A 4J1TA 1W4ZA 5BSEA 5H83A 5KJ1A 4IZIA 4DWVA 2BI8A 3DBLB 2AE2A 1H2BA 4YVFA 3OJLA 1PQUA 4DYDA 5CDUA 1L7DA 4XR9A 3GG9A 2RHCA 3D3WB 4LCJA 1ISHA 3HZZA 1JWBB 2AG8A 1QYXA 5B1YA 3TDKA 3JQAA 4UEJA 1DDOA 4Z0TA 1PJBA 5AVOA 4BGVA 1BDBA 3DZIA 4OM8A 4J0EA 3LK7A 1JQBA 4J1QA 4AJPA 4GX5A 3E48A 3VH3A 4E2XA 1U8FO 3DXFA 4FFOA 3WGZA 1JA9A 2VHWA 1HSOA 4NMHA 2NU6A 3F47A 4HFJA 4JJFA 4OHUA 3ZV4A 5G0VA 4A03A 3D4OA 3JV7A 3VZQA 2NSDA 3JQGA 1U28A 1EQUA 3GFBA 1IPEA 1X1TA 3JQ8B 4MO2A 4IXTA 1UXJA 3FR8A 1JN0A 4ZN6A 3TL3A 2GERA 2YV3A 1PR9A 4UVEA 1LSSA 4QQRA 1KVSA 4CMEC 4DBZA 2D0IA 4AVYA 1B7GO 1LLDA 2C5AA 1R16A 2DAPA 4DQUA 1D1TA 4P22A 4R9RA 2Y0DA 4H7PA 5EIOA 3S2EA 3BYZA 5JFOA 4MDHA 2AEMA 3PK0A 2EKQA 5DBFA 2CSUA 2W2KB 5COAA 4CLEA 2Z1MA 3OSUA 2P9EA 1DRWA 4WLFA 4E31A 2YJZA 3FPLA 5CEEA 2B5VA 3JD0A 5IDQA 4F45A 4KOAA 3ST7A 5G4LA 3LT2A 1GCOA 1HF3A 3HWRA 3JQ6A 3H5NA 3F3SA 1E6WA 1GPDG 4XQ9A 4BB5A 1ZH8A 1AGNA 1X13A 1XSEA 2TMGA 4RF5A 4JQCA 2Y1FA 3WGQA 3GAFA 3ZHBA 1SPXA 3JYQA 3TJRA 4W82A 2WE7A 4BNXA 1R6DA 1V35A 4FCCA 3TOXA 2EJVA 5A05A 2VHYA 3UN1A 5HRUA 1A27A 3I6QA 1GAEO 1AUPA 3JQGB 2HLPA 3WDSA 5L51A 4GBJA 1IE3A 5JS6A 4YT5A 3UICA 5B12A 4ZRNA 5EMHA 4J16A 3QWAA 1NQ5A 4DTIA 1KBZA 1OC2A 3CTMA 3FPCA 4MP3A 2PD3A 4UEOA 3ITKA 3UOGA 1FMCA 4LRTB 4FPXA 5B37A 2EP5A 1GTMA 1P74A 3NYWA 4H15A 4IS2A 4R41A 3NEPX 3PJDA 4M89A 3EK2A 5T8KA 4WUVA 2HRZA 2YY7A 3QVTA 4ITUA 2BGKA 1OOEA 3ZWOA 4NFHA 1UP4A 3HADA 1VL6A 4RVSA 2O3UA 4IDCA 4W7IA 2X0RA 3JQEA 1EUCA 1NWCA 3NTOA 1VPDA 1U3UA 4ND4A 4J7XA 3C7AA 4YRAA 4NJOA 2OUIA 2A35A 1ULUA 4TVBA 1GYRA 2NWQA 4MPDA 2BF7A 1FDSA 3PIDA 4XJTA 3ZV3A 4HV4A 3HDHA 2Q2WA 3PQDA 1KS9A 1XLTA 2PZMA 1PZGA 3FR7A 3OHSX 2G5CA 5HTOA 4CV0A 2WMDA 4ZU3A 3D4PA 7MDHA 2Z5LA 5EINA 4RLHA 5DOZA 3HFGA 4D0SA 1GUZA 1BXGA 3WFJA 1PL8A 3TZ6A 1DRVA 1DFIA 2EV9A 3WR5A 1BXZA 9LDBA 3MEQA 1V6AA 3TF5A 4YJHB 2PA3A 5A9SB 3JYNA 4B8ZA 1T2EA 3LYLA 1P31A 2ZTMA 1LBEA 2BHLA 2JCXA 3V5NA 3U9LA 5A5EA 1KEWA 4ZHSA 2O2YA 1FDWA 2V6BA 1MX3A 1Y5MA 2Y1EA 3GRPA 3N7UA 4N5NA 4BNFA 3PYLA 1NHWA 4IMPA 2PR2A 3UW3A 1PTJA 4B4WA 2DVMA 3KRTA 3ZWPA 1T2CA 3K2EA 1GFSA 1UZNA 3RKRA 2TMDA 1VI2A 4YACA 1LDYA 3LDHA 4CMIA 2YW9A 1BGVA 3AJRA 1A9ZA 2J3IA 1TB4A 4OXYA 1I3KA 4XIJA 3H2SA 4Z0HO 3B1JA 5T64A 1BVUA 4DPLA 1QP8A 1B8UA 4MINA 4PRLA 4RF4A 3FHLA 3WLFA 4EEZA 3JD2A 1H5QA 1IB6A 3FTPA 2NU9A 2OL4A 3VVBA 4PG7A 2EG9A 1QLHA 3MTJA 2X58A 4K28A 4XYGA 3H5AA 2VZ8A 3ROPA 4RVUA 1WAMA 1VKNA 2Y1CA 3RWBA 8ADHA 1EBUA 1NM5A 3OA0A 1T4BA 3VTFA 1MUUA 4PG6A 1I30A 3PYMA 3ZWCA 3GGGA 3DBVO 4OQZA 4HKTA 2Q1UA 3VPXA 3ZU4A 1YDEA 4WPGA 4W7HA 5KJFA 2GZ3A 2R00A 4A26A 4GPD1 1R4NA 4I1IA 3QA9A 4AFNA 5EERA 1JWAB 1UJMA 3HJAA 3INGA 3JD4A 3VKVA 2VQ3A 1PS8A 3P2OA 4OGWA 2I6TA 3ZNNA 5A3JA 2I5PO 3Q2KA 5JSFA 1R4MB 1NPDA 4BMVA 1BW9A 1HETA 2WEKA 1N7GA 3AUTA 1R0KA 2VYND 1I32A 5FF9A 1ADFA 1YL6A 3DHNA 1HRDA 3D3WA 2GF2A 1LC0A 3IL2A 2JHGA 4YA6A 3IMFA 3OA2A 3CKYA 1PIWA 4GKBA 4IDGA 2O50A 5IDWA 4W9NA 1BXGB 3FF4A 3IS3A 3TZCA 4EDFA 3LF2A 4CM7A 4XYLA 5C3MA 1H6CA 3NTQA 1C3VA 1E5LA 5L9AA 2WJPA 4MVJI 2XXBA 5GMOA 3KM0A 3D3EA 3U0BA 3PHHA 1RM3A 1C0PA 1D4FA 1NR1A 1F14A 3JD1A 4L8VA 5TF4A 3D64A 3LC2O 4BNLA 1GYPA 4IQ0A 3HSKA 1VJTA 1ZVMA 4JP3A 3SC6A 5K9ZA 2GSDA 1EDOA 4PGFA 1FJHA 2PGDA 3D1LA 2NU8A 4NJMB 1IL0A 3H8VA 4EEXA 3DZFA 5COQA 1ZFNA 2LDXA 5BNIA 1M67A 2BGLA 2QX7A 5KCZA 3K8ZA 2JCVA 1E3LA 3JQCA 1E1NA 4LW8A 5ILOA 2Q1TA 4K6CA 3WG9A 3C7DB 3OEYA 1DC4A 2C29D 4J7UA 4ND2A 4YRBA 3ON5A 5F5NA 1M6HA 2EWMA 3ZHXA 3W8DA 3KETA 3ZU3A 1LSJA 2B69A 4BO6A 3AM4A 3V1UA 2Q50A 3OETA 4J3FA 4GSKA 3DZJA 4M49A 2JHFA 4J2HA 1PZFA 4ND1A 2OBYA 4QTZA 4X54A 4BO1A 1A71A 3Q2IA 4F6LA 1YE3A 4TMFA 2HK8A 4KDFA 4B7UA 2O4UX 3QRWA 3ZNPA 5JDIA 3L4SO 1UXHA 4FJ1A 4U8GA 1HLDA 1P1JA 4D0RA 1IPFA 3TQHA 3ZWAA 4NBTA 2V65A 2O7QA 2NUAA 1K89A 5JAQA 3OMLA 2C7GA 3B6ZA 1PGOA 4L75A 4D79A 2C54A 3TPCA 1WZEA 3GT0A 4J4BA 5CDGA 4CJXA 4YEDA 4Y6RA 3G49A 1ENOA 1D8AA 4IM7A 2AG5A 1B8VA 4J9VA 4Q3CA 4BKOA 3L9WA 1J6UA 4MOWA 4OO3A 1O6ZA 5GZ1A 1J49A 1PR3A 3DOOA 4NJMA 1AN9A 1JLLA 4R01A 4LVUA 2E4AA 5A02A 1B8PA 3H2ZA 1SEVA 1P1RA 4UULA 2PKQO 3BMNB 3M1AA 3H3JA 4XRRA 3W4JA 3PZRA 4JJGA 2BGMA 1WDLA 4FW8A 4DREA 1YL5A 2UDPA 3OEWA 4WEOA 4WK6A 1MA0A 4BV9A 1SNYA 4DC1A 3R1IA 1XR3A 3GNQA 2IDZA 4PIVA 3OQ1A 2WD8A 1H9AA 3F6YA 2PNFA 4BNGA 1X0XA 2BFOA 1PJ2A 4JGBA 4RPHA 4WNCA 3WGYA 4ZRMA 2W4QA 4B3HA 5L7TA 2VHVA 2VN8A 1NAHA 2VOJA 2H5LA 2RH4A 2ZTVA 4NBRA 4YBZA 2AEJA 3RUCA 2DC1A 2B37A 4DIFA 1AXEA 1ADCA 4LK3A 3ONEA 3PHGA 3PJGA 4JXKA 3PDUA 1JVBA 5CPBA 3V1TC 5EPOA 3H9UA 2EP7A 5CP8A 3PP8A 5TSDA 4BO5A 4LVCA 1GQ2A 1CF2O 2V6GA 3ETGA 1PJ3A 3VZRA 3KYBA 1X7DA 4YPOA 3K5PA 4CL8A 3GVPA 1GADO 4NFSA 3O8QA 4YWJA 3JQ7B 4PN3A 4MVJP 4K1LA 5A5FA 3AM5A 2J5QA 4LSMA 2VYNA 3QWBA 4JBGA 3K96A 4WLOA 2CVOA 4D42A 4RF3A 2EKPA 4ALKA 3WB9A 1DC3A 3FCOA 2JAHA 2QIOA 3WJ7A 3ZW8A 1Q0QA 5JC1A 1J4AA 3GDOA 2AA3A 4URFA 2IXBA 2G17A 3F5SA 4J7CA 5JDIC 5JYDA 1CQIA 3CZMA 4O5OA 2CDCA 3GK3A 4BB6A 1GDHA 1UDBA 1BHSA 2AQ8A 4QO8A 4FSHA 4C7JA 5KWEA 4BGUA 4NNJA 1DIAA 3TOZA 2C59A 4GMFA 4GMGA 4PG5A 2EW8A 5G2OA 2NVUA 3IKTA 4KQWA 1RPNA 2ET6A 4Q3BA 3QV1A 1DRUA 4PZCA 3DHEA 4MVJE 5I7FA 3PQEA 4I5GA 3Q0EA 1CYDA 3Q9UA 1VL0A 1XQ1A 3H4VA 3QWIA 5KVVA 2VYVA 5I7SA 2GD1O 4BNMA 1C0LA 4HX5A 5JO0A 2P91A 2GCGA 2FR0A 3ABIA 1Y9AA 1DFGA 1GQYA 1MG0A 1ZEMA 1LI4A 2VWPA 2O3RA 2NACA 1SOVA 1ENYA 1Q7BA 2BFAA 1WPQA 2IYPA 4OKIA 3UVEA 1PQWA 3ZNOA 3ZWBA 4D3SA 4DMMA 4EW6A 2GN9A 4GWGA 5DCWA 2HAEA 4L4RA 3VPHA 5L7WA 2W90A 2Y68A 3AK4A 1XEAA 4E5NA 4FGWA 1ZK2A 4M54A 3DZKA 3P7MA 3PDJA 3MWEB 3AUSA 4R16A 4S1VA 4XYBA 3WICA 2JCYA 5DT9A 1DLIA 1PGNA 3AY6A 4IGFA 4CMCA 3B1KA 4AJJA 3HFSA 1ID1A 3UCXA 4MP8A 4PLGA 3SEFA 4BVAA 4Z9YA 1YL7A 2ZCVA 1V3TA 1YQDA 4CMHA 2VCYA 5DCYA 1EK6A 1E7SA 4HUJA 4FOOA 4NBWA 2FRDA 4E32A 2FSVA 4A7PA 1BXKA 4A27A 2NU7A 4L74A 4XYEA 2VYVD 1SEPA 5I8ZA 3TL2A 4UVIA 1Q7CA 1BRMA 2GO1A 4N5LA 1VJ0A 1WLYA 2WSBA 3JQ7A 2RAFA 4KWHA 4GKVA 4MKRA 1JKFA 1PGQA 4PLCA 3W6UA 3DOJA 1QYVA 4HWKA 3DONA 6LDHA 4AJHA 4FR5A 2GDZA 4AJOA 1ISMA 1NPYA 3V1YA 3EYWA 4OL9A 4DPKA 2PZLA 3C1OA 1GL3A 2DTEA 2HRBA 4N5MA 3C1AA 4L9RA 1P0CA 1GUFA 4JBHA 3CH6A 1X7GA 1HYGA 2VRBA 3BMQB 1KC1A 1WZIA 1SO8A 1YO6A 3A06A 3GQVA 1LQUA 4WEQA 1G1AA 2X8LA 2ZB7A 3W6ZA 3HNPA 4NK4A 1GR0A 4ALMA 4ZQBA 3NDJA 4N18A 2IEDA 4UVDA 4DRYA 5DNAA 5JDCA 2Y0EA 4CM5A 1JU9A 1MC4A 1K0UA 4XB2A 2CNBA 4G65A 4B3JA 3C24A 3PVZA 3U62A 1P45A 1YB4A 5JAZA 1BDMA 5DN9A 3QQPA 5KKCA 3CXRA 2X6TA 3TNLA 2I3AA 3PFWO 4XQCA 2DUWA 3INTA 4J91A 4K26A 2NQ8A 1XIVA 4YAIA 4P4GA 1P1IA 2PLAA 2C2YA 3SJ7A 3OQ6A 5HA5A 4DPMA 3GHYA 4Z6KA 4OXKA 1I01A 2E6UX 2YV1A 2P68A 1ZJZA 4Z9FA 2HMUA 4IQ8A 4O0LA 1TEHA 3EC7A 2BELA 2PH5A 3D0OA 2GASA 4M87A 3PZBA 4BNKA 3VPSA 2W2LA 1Y1PA 2C82A 2JL1A 3NGXA 3O38A 3DAGA 3K73O 3AI1A 2YHIB 4RGBA 3VVCA 4RPLA 4E30A 4RCVA 1PEDA 5G0UA 1DJQA 4WNIA 1RM0A 2EERA 4FFMA 3VDRA 2B35A 4TZKA 5T67A 3GUCA 1DLJA 2FPPA 1ARZA 1YVEI 3TFQA 3WMWA 2AXQA 4CPDA 4CMKA 3O4RA 5MDHA 4E5PA 3ULKA 4Z3KA 3BMOB 2DBQA 5TJHA 2NQTA 3I83A 5DDIP 3SLKA 4U7WA 1EUDA 1D7OA 4A0SA 3L6DA 1VL8A 1J5PA 1GUYA 4CV2A 3AOGA 1TXGA 2JFHA 2O48X 4BO3A 3E9NA 3KTDA 1OC4A 3C7CB 2QG4A 3JQAD 5BNTA 3GMSA 3RC1A 1N8KA 3QW2A 4PLTA 5IFLA 2FN7A 2H9IA 2VHZA 3NX4A 5KJ6A 4E12A 1YONA 3R3SA 1E1MA 1NQOA 1QG6A 1SBYA 1B3BA 1LNQA 5KJEA 5AXAA 3DTTA 4R54A 3IC5A 3OP4A 1MC5A 4CODB 1C14A 1N9GA 3AOEA 2PWZA 4DLLA 1ZXBA 1ISFA 1R15A 2QZ9A 3B1FA 1E3JA 4K6FA 4BNNA 4CLRA 1FF9A 1CQJA 4IJWA 1HE3A 5IXSA 1DC6A 3GN2A 3PIIA 4PG4A 1R66A 4RORA 2AQIA 1CJCA 4CV1A 2UV8A 2YZ7A 2JD0A 1Y7TA 1B16A 1LRJA 3MJEA 2CDBA 4P4NA 1ZO8A 4IBOA 2P9CA 2R6JA 1U7TA 3M6IA 1O95A 3I5MA 2YHIA 2YDXA 1LJ8A 2X9NA 1U5CA 1EUZA 2D8AA 4Y67A 4ZQGA 2C0CA 1EE9A 4B7XA 3OJEA 4ONEA 4IINA 1ORRA 1HKUA 1LLUA 4KTTE 4E21A 1EVIA 3HQ4O 1AXGA 3UFXA 5U1PA 1J0XO 4AG3A 3KBOA 1H9BA 1PJQA 4F3YA 1B15A 1U3TA 5FI5A 2ZYGA 3C3XA 4WCFC 3RD5A 3IUPA 3KYDA 1UZLA 4WECA 3RCBA 1X1EA 1BW9B 2GLXA 3CIFA 2WM3A 3E1KA 4L73A 4XZ3A 1Z7EA 1ZZEA 3QE3A 4EITA 4PLPA 1GQQA 1Y8RA 4EZBA 5AQ1A 5TC4A 4ALIA 1GV1A 4CV3A 4OAQA 4CUJA 3A14A 5U4QA 3U4HA 1MP0A 2FHSA 5GY7A 3ZV6A 4PZDA 3BMOA 1IZ0A 3RC2A 5ADHA 4JCOA 1V9LA 1OI7A 1Y5RA 4EBFA 1XA0A 4RVHA 3TSCA 1T24A 3I9KA 4YAEA 1DJNA 1UUFA 2F00A 1IYZA 3E5MA 4KZPA 2AEFA 2X5KO 4BUCA 2Y1DA 1N9GB 3F9IA 3WS7A 1N1EA 1ENPA 3U4IA 2OHXA 7ADHA 1P1FA 4WLNA 4DC0A 4Z0PA 3WQSB 2X22A 3HDQA 2SCUA 4P8RA 1KETA 1N92A 2NADA 2IYOA 2CF6A 4CMAA 5A4DA 1U5AA 2I76A 3GOHA 4E5KA 3IOYA 3DAPA 3A9WA 1CERA 4J1SA 3EZLA 3GNTA 3WGIA 3GDFA 3GEGA 3O26A 3RC9A 3GA0A 4E5MA 5COBA 1ONOA 5A06A 4BKUA 5J23A 2AE1A 1KC3A 4J43A 1ZKMA 3LF1A 4W6ZA 1P77A 3PHIA 4FGSA 1Y6JA 4XKJA 1G0OA 2ZQYA 4RQUA 5H82A 4QX6A 3TFOA 3OM9A 1EVJA 3OECA 1DIRA 2HMWA 2JD2A 1LX6A 1QLJA 4E2YA 1ISIA 3GR6A 1Y8QA 5T8KC 4AJIA 3H9JA 3RFVA 1KY4A 3JYPA 2B83A 4YJGB 1NFRA 2X9VA 4D3DA 3DOCA 1LRLA 3FNHA 4KUEA 4BIIA 2VWQA 1KVRA 2Q46A 2I66A 1N1GA 3CUKA 3W8EA 3COSA 3IJRA 4ID9A 4YQZA 4G81A 3ZWVA 2YQ5A 1AE1A 3FNFA 2WD7B 4TWRA 4PLFA 3CMMA 3SX2A 2J5RA 4QFDA 3LLSA 5IJZA 3PFFA 4NQZA 3KUXA 5CEFA 3WQQA 1E3SA 2XXJA 4I5EA 3FNGA 2YUTA 3CE6A 4KTVE 2FZWA 5I8WA 2PTGA 5CPFA 4LISA 3VHRA 3NTRA 3O03A 4WOJA 3NAQA 5JPIA 5H81A 1CEQA 1T1SA 1NQAO 3GC6A 2Y99A 4CM9D 1TT5A 1Y81A 4OIMA 3S2GA 1MXHA 1PSDA 2I99A 1O5IA 2CUKA 2ZKLA 5DBIA 3AFMA 3G3EA 5C5IA 2B4RO 4WLEA 3BTOA 4KP7A 1B2LA 5G4KA 2EF1A 3PJEA 4JP2A 3T4XA 3H9EO 4CM1A 3QWFA 4GH5A 2ZB3A 5B4TA 2DPHA 5I9MA 4IDAA 4UUPA 3ONDA 4TVOA 4NIMA 4KUGA 3QWHA 3VKUA 5THKA 2IRWA 4M55A 4LMPA 1X0VA 5IN5A 3VZSA 3UAGA 3HUDA 1TA4A 3FD8A 3IIEA 4KQXA 3V8BA 1DIBA 2FWMX 4U6QA 4EJ0A 3V2HA 2QHXA 4YAGA 5IDYA 1E3WB 4L4XA 4BMSA 5CDSA 4IJUA 1OMOA 1YKFA 1TI7A 3Q6IA 3WWZA 4BMNA 5L40A 4RLSA 4CQMA 4YJGA 1DIGA 3WJAA 1H94A 1C1XA 3DQPA 5DP1A 1KOLA 4N7RA 2W2KA 4QEDA 2PV7A 3DFZA 4GX2A 5I7EA 1I5RA 5A3VA 3GVCA 1UP6A 5IZ4A 1E1LA 2C5EA 2AQHA 3GUYA 5L4NA 1JKIA 4M1QA 4A5OA 3DEYX 3KXDA 1F8FA 2E37A 5ILGA 4FJ2A 2O2SA 3OJFA 3ROQA 1PJ4A 2D59A 2VT2A 2CZCA 3U5TA 4RJTA 4R69A 3GZ4A 2HK9A 4L0QA 2BKAA 4TKLA 2D2IA 1FDUA 1ZW1A 4EJMA 2EXXA 4IXWA 1K3TA 3KYCB 1WDMA 1ZCJA 4GX1A 3TZHA 6ADHA 1JDJA 1ZSNA 2ZYDA 1ZIDA 3AUUA 2UAGA 4W4TA 4RZHA 5HBRA 5G0SA 1GZ4A 1Q0LA 1HT0A 1P0FA 5A9TA 5G4KB 3RASA 5HWSA 5EJ2A 3WTCA 4RPGA 4XCVA 2OOSA 1OAAA 1SC6A 1O89A 3KSDO 4IQGA 4L76A 3ZZNA 5ENDA 3TZKA 1HZZA 4XQEA 5ES3A 4MIOA 4BV8A 4IS3A 3I4CA 3JQBC 4KMSA 3D5QA 4Z3DA 1PX0A 3GF4A 2Q49A 5EL0A 1OBFO 3Q1LA 4QXMA 3MZ0A 5U9CA 4NI5A 2JD1A 2VTDA 3HB4X 1C1DB 3S55A 1HWYA 1U7HA 4MVJG 4J1NA 3LU1A 1I2ZA 2ZB4A 1Q2XA 1PU2A 4PVCA 3ZI0A 4BO2A 1WMAA 2C2XA 1SMKA 3RUAA 2YFHA 4O1MA 2AQKA 3BHIA 1GZ3A 3RUEA 3OJ0A 2WYUA 4D3FA 1WXDA 4IPTA 1H2HA 2D5AA 5JNLA 2EEZA 1UR5A 1GZ6A 1GPJA 5ER9A 2EGHA 1UDCA 1O8CA 3NKLA 3CINA 4D46A 1I10A 4CQLA 3CSDA 3VC7A 3W1VA 1PGJA 4BNWA 1ZJYA 1EDZA 4CQMB 1Z7BA 2Y67A 2OORA 2WE8A 3GGOA 4RVFA 5JDCC 3RROA 2H63A 2ZJ0A 1Z45A 3FI9A 4CLOB 5AXDA 1VC2A 1PJSA 1ADGA 3Q11A 4XR4A 3T7EA 3KZVA 4DLBA 4HFNA 2H6EA 1YJQA 4JX8A 5JCXA 2OGUA 3PEFA 2CF5A 4GX0A 4JROA 3ICCA 5JLAA 3KYDB 3WQRA 4YAJA 4HXYA 3AM3A 3ZHZA 4IGEA 1I3LA 1NFQA 3GN1A 2PY6A 1PQPA 4B4VA 3S2FA 3EDMA 1XCBA 4FIZA 4I8XA 3VOSA 4FD3A 3OF2A 3ZNQA 2QYSA 5I7VA 1LLQA 1GYQA 2HCTA 2Y05A 8LDHA 1QV7A 3I9NA 4CLHA 2GN4A 5I9NA 2CFCA 1NNUA 4INAA 4DYVA 4BQPA 4BKQA 4HFMA 3V2UA 3KSZO 4DUPA 5DZSA 5JBIA 4ALNA 5L4SA 3NRCA 1L7EA 2O3SA 1QYDA 2ZTUA 3BMCB 3BMNA 3VDQA 4D43A 2B5WA 4PG8A 1UXGA 4JNKA 2X7HA 2RHRA 2GGSA 1PS9A 5DBGA 1HDRA 4IIVA 3ZWXA 1UAGA 1FXSA 1GEGA 5IAAA 3ANLA 1JAYA 1S6YA 4E13A 3LT1A 1F12A 2VUTA 3GHHA 2PD6A 5L45A 2FSSA 5L4LA 4MVJA 3MJTA 1H6BA 2DT5A 2QZZA 3ONFA 1F17A 1UXKA 4WE3A 4CR6A 4DXHA 1C1DA 1QYWA 2Q2VA 4FFRA 1IUKA 4BGEA 1GD1O 2NV6A 4UREA 3WGHA 5IF3A 4HY3A 1T2FA 4D41A 3KLMX 3BIOA 5JCJA 2DBZA 3GAZA 3N74A 1RJWA 4WKGA 4IDEA 1MXFA 4XJSA 4IMRA 3SXPA 2J8ZA 5C7IO 4MVJF 2EIHA 3U49A 1ADBA 1B26A 2DQ4A 3QIVA 2E49A 3RUFA 5G0WA 2W98A 3WTBA 1HE4A 3AOEC 4FDAA 4RVGA 2NM0A 3D5TA 2POQX 3NUGA 3DMTC 3L6EA 4TRMA
chains in the Genus database with same CATH superfamily
3LL4A 1QOQB 1Z0IA 3AEKA 3CGWA 1YZHA 3GDWA 2WMYA 1Z26A 1DO2A 3V1MA 3WBFA 5H0IA 5EJ8A 3B60A 3HACA 3MHTA 1O4VA 5I48A 2O6LA 4N65A 3GRYA 5EWMB 4ZD6A 1FFEA 4Y1FA 5B58T 1JG2A 2Y9PB 1R27A 1LTQA 1RKUA 1WUIS 1ZXLA 2H4WA 3L77A 4PINA 2EZUA 3DMRA 4RDIA 4X7PA 5CX1B 2JJYA 4EFMA 2ZQ5A 4BNJA 4RKFA 5L3ZA 3U6BA 4U7DA 1YI8A 5TQ2A 3PSAA 4GDMA 5K03A 1OILA 1UBJS 1PAUA 1L5RA 1BG6A 3HUUA 4HYEA 3G7NA 4NAUA 1GGKA 3DBIA 3JX9A 3Q7IA 10MHA 5I3CA 2BR5A 4CKYA 2QJTA 4DUGA 4IV0A 4EW1A 1ZD8A 3V6MA 4YDRA 4YR9A 3KZXA 1JV2B 1C3EA 2X9GA 5ITSA 4N6OA 2VJMB 4XB6B 1VJGA 2R5WA 1H4VB 4CQMD 2QA5A 2VHUA 3OZVA 2PT7A 4HP8A 2LD4A 2X0KA 1M83A 1K4YA 2G9QA 3ICEA 4J0KA 4HF7A 3DE7X 2CDRA 1UODA 1MMFB 1L7VC 1HQYE 2BFMA 3Q88A 1NBMA 2VXYA 5JQGF 4O5AA 4UNIA 1VLLA 1I6WA 3H7IA 4G8CA 3UB3A 2HDNB 1XCMA 1L8XA 2QT0A 4G1VA 4N1AA 2ZJOA 1W5BA 2FJPA 3U3MA 3O9ZA 4HB3A 2DULA 3R3UA 1JE1A 1FYWA 4F06A 1HEUA 3GEMA 4TYNA 2YBEA 3BGSA 3K0HA 4IH4A 4EW3A 2YRWA 3VX3A 2NQ2C 2VJBA 3INYA 1JDUA 3K9HA 1ONPA 4GGOA 3EVEA 4JJKA 4M98A 4OJNA 4OP3A 4DQDA 4B4KA 4X1YA 5I5EA 5KTSA 2P6UA 4OREX 3VI3B 2HJHA 3CYFA 4MQBA 4TTIA 4MVJH 4WK6A 1MX5A 3ZJYA 2G06A 4LZPA 2BSQA 3FPKA 3I52A 2CVQA 2QTGA 5F21A 1G7RA 1ZQ1A 1U8TA 5J58A 4MUKA 4R7TA 3RPEA 4C3VA 3L7MA 2R85A 5DOVA 1SIWA 1X8XA 2RKOA 1M8PA 1OX4B 2JH9A 1XU9A 3TCKA 4ZVLA 2LCQA 3TTVA 2HQOA 2PGJA 4INPA 9ATCA 2H4YA 3DFUA 4MIYA 1AHIA 3C2QA 1UKYA 1EFLA 4MPTA 5B3JA 3RM3A 3CN7A 2RC6A 3MTDA 3N8GA 2OWDA 4X93A 4MS1A 5FYDA 1R0LA 4I4TF 4Q15A 4X95A 4XWYA 2SKCA 4YMTA 4KR2A 3PXXA 4GVLA 3EBPA 4U0KA 2X0IA 4DQ0A 2RJNA 3HCDA 1NXXA 4BPBA 3OIYA 4JV5B 3EQ2A 2V7GA 3G6KA 1W52X 2ENUA 3GDGA 4B0OA 2FZLA 2YJGA 5IFKA 1Z2AA 2IX9A 3IKVA 4YRFA 5LXTF 2P9JA 1XRNA 4XUDA 1L4HA 2D3WA 3EGEA 4PAOA 1NASA 4IIJF 4HBGA 1ZJ4A 3CLSC 1NT2A 4L5AA 4P54A 4YT4A 3LDAA 5AI6A 4LC1A 4N6NA 3EXFA 4UUBA 4NDNE 2UXCB 3U3KA 2IYTA 3BHMA 4JC5A 4D45A 2QOEA 4EJFA 2FOIA 2RHMA 1O9GA 4UXHA 3VSBA 4NCJA 3QELB 1WB5A 4WOKA 5HFNA 3EX7C 3E70C 3LVFO 2B3DA 3IQZA 3MRTA 2H06A 5EE1A 1OFUX 2A57A 1HDCA 4GP7A 1DWOA 4KQGA 4D98A 1Q7TA 1XOIA 2G72A 5KCMA 4IUYA 4NE2A 1DFHA 1NZDA 3AV0B 4LE0A 3UHAA 3WYCA 1JLSA 2P4QA 2QTAA 5DYTA 2VDMB 2X4GA 1YS4A 2F4NA 3MINB 4W63A 2QUKA 3RS0A 1ZH2A 5TVGA 1JZTA 4J2OA 2QDXA 3EEFA 4E7PA 2A78A 4P92A 4Q1BA 4GRIA 3TXXA 4DWWA 1H5UA 3G82C 1WETA 2CJWB 3SEZA 5AQEA 3G9ZA 1CRWG 1I51A 4FBMA 4PS1A 4CYMA 1APBA 5IEJA 2P3SA 3DV0A 5LBUA 1RWNA 1JFFA 2L42A 3N1UA 4FFPA 4V0RA 5J4LA 2AW5A 5KC8A 1PWZA 3VKHA 1O5TA 1PJ8A 2MWMA 2QRJA 1DDIA 3WIEA 4ZTUB 1CHNA 1RYYA 3AZPA 3IHLA 1P0MA 1XV5A 3DMHA 4RFLA 3AHIA 3EDOA 3VDMA 3VR4A 3RAPR 3W8FA 5BSHA 2ORED 2ZYAA 1AD2A 3I42A 4H0FA 2RI6A 4NRDA 4XDYA 5DLEA 5IH3A 1A98A 1QTNA 3I72A 2PQMA 4JI3B 2QX4A 3ZHTA 4E3ZA 2Z98A 1Q7GA 5BN4B 1N4AA 4Y0NA 1H8HD 1DUIA 3AEZA 4ZVNA 4D82A 2NTJA 2JATA 2YFYA 4LY9A 4NZPA 5J2UA 5JJCA 3GCGA 4QVIA 5LP1A 3AEXA 3LKBA 3NH6A 2OB1A 5BMOA 2WVAA 3THWA 3G1TA 3LZ6A 4G5HA 3E9MA 2FZEA 3DLPX 1KVQA 1Q1BA 1R0SA 1E0JA 2Y92A 1TKCA 1WQ1R 3QFRA 5EFOA 3ZEIA 1XT6A 4AYTA 3QUAA 4O4LA 4PU0A 2XNHA 4RKEA 1S3IA 2V0NA 2JBAB 1BH2A 5KSZA 3VO1A 3BXXA 3JRNA 4O59O 4N8SA 4NEGA 4FE7A 1T36B 1G8GA 1XLUA 4IIDA 4D56A 1GO2A 1WMEA 2QE6A 4AJ1A 1S9DA 3MWFA 3W7AA 4JN6B 5C7OO 2A0YA 2G1PA 4QM6A 3R3JA 5HS6A 5JMWA 5FUVA 1FSZA 5LWHA 3BMCA 1JAHA 3UK6A 4BUJA 1JKXA 2V9ZA 5BSTA 5CT9A 4EA7A 5K0ZA 3VJKA 2P9FA 4GGPA 5B4VA 1ZEJA 4EY8A 1X86B 4ZVPA 3IVCA 1CJSA 3X1YA 1K6IA 2A5GA 2ZE8A 2ZRJA 1QIKA 1W5SA 4Y2UA 2OPHA 4P38A 3VNVA 4L8LA 2QMQA 1CETA 5HE8A 4JBWA 5LSAA 3D3JA 3S99A 4FB4A 4RA9B 1H3FA 1C0EA 1DKQA 3TLMA 1U04A 4EO7A 2R1TA 2V7PA 4Y8VA 5KAPA 3MCVA 1ZNQO 5DJ5A 5B57C 5KNBD 3UT5A 3OAAD 4U9HS 1SZCA 3D4LA 3U3XA 1MHPA 4V24A 3A4VA 2DOKA 2YMPA 3STHA 1V3VA 5A1TA 4KAFA 1DC8A 5GVSA 4LJLA 4R1MA 3FKSD 1AURA 4YDHB 2VT3A 1M5RA 1XHEA 3MOGA 4JBNA 2Y1LA 3CLRC 3S2IA 1GLGA 4CU2A 4OFBA 2FZCA 3DDCA 2I67A 4O8CA 3FZNA 4QRHA 2P5YA 2JZOA 2ZG6A 1O9BA 5DM70 3WP0A 1YR6A 3H8SA 1XNQB 1A8SA 1LCIA 2XZPA 4HT3B 1I9GA 4HEA6 4TV9B 3FPBA 2PRKA 3RF7A 1DP4A 1LKZA 1E9RA 3GLIE 1U2TA 2XDQB 4YT2A 4GDFA 1UMCA 4B3IA 4PQEA 4HZIA 4DBVO 3NI2A 4K7JA 1HYEA 1NSYA 3NQ41 3O2QB 1XCJA 1TCBA 3X2FA 1K5HA 3L82B 3BH7A 4IDBA 2JFVA 1NVMB 2GNAA 1NATA 3M6LA 2GPTA 1FRQA 4KN5A 4LI0A 1Z5PA 3CURA 2GVNA 4V2IA 2DU8A 4AWAA 2H3EA 2WWGA 5EEHA 2CZGA 2Q07A 4I5DA 2F2TA 1YBAA 2O06A 4JL6A 4JZKA 3T9CA 3TSWA 2PKEA 1NVTA 1NOKA 5JS8A 4WZBB 1T0JB 5TE9A 2JLWA 4BKPA 1LEHA 2D4HA 2GZSA 3BERA 3CXUA 1PZHA 2RH8A 4PW0A 4TXHA 3ROZA 2VAWA 4EKDA 3SVLA 1U7OA 2ILTA 2BP7A 4H7KA 4HGQA 2WU8A 3E3MA 2OFOA 3KYCA 2XHEA 2XMQA 1I7LA 2SKEA 2CD9A 4RH3A 3RS4A 5JXJA 1DTEA 4WWHA 3DR3A 1NR7A 1UKVY 3EZGA 2QGFA 4TQAA 3ZXYA 4UTNA 5LNK6 4FN4A 2IZ5A 3RT1A 5FHRA 2WTNA 5F7OA 3D6HA 6GPBA 3DT9A 2DB3A 3WK9A 4ZJYA 4YRZA 4O4IB 1VOTA 4CMJA 4UBIA 4B40A 3DVAA 3K70D 1TW2A 1VI6A 2WHPB 2GN6A 3L7AA 3QSGA 4PSDA 2OC4A 3PJFA 2I22A 3EGXA 3K09A 2RK4A 3AFGA 5TQ0B 4RMGA 3AY3A 1UAYA 3K31A 3LDGA 2YXNA 3BCSA 4WCFB 5CAEB 1UJ2A 2ODBA 2RI1A 3RJ5A 4YREA 4DADA 2B7CA 4GVXA 1XL1A 3C3YA 1C3OA 4CL2A 1QYCA 4MW0A 4JAVC 1ECGA 4NH4A 4X66B 1S8FA 4I4TB 3DZBA 3PNPA 4BQFA 1ODSA 3ZVLA 4OHWA 3R6LA 1G3IA 2CXXA 3ZXSA 4RZIA 4PGHA 2J0QA 3K3PA 5H70A 2AFIB 1JJVA 3OLYA 1LDEA 4PCVA 1KZ1A 2JIZD 5G1OA 1HLPA 4Q3AA 3NGLA 4WV3A 3ZDFA 4IWNA 4LJ6A 3W06A 4GZ5A 1RP1A 1DQPA 3QLTA 3DBHB 2CLCX 1VYHA 3A36A 2OP1A 1HT1E 3N6RA 1OI3A 4R2JA 4UCWA 4Z99A 2FOLA 5FTJA 4AP9A 2VNAA 1OROA 2VP9A 1YJ8A 3IKMB 4N48A 2DTDA 4EGQA 1XFDA 2CLHB 1VG9B 2FRXA 3GZNB 4QT0A 3TZQA 1UDAA 2Q1YA 2NYRA 3D8UA 1PUIA 1F60A 2BOVA 3OPNA 2VJLA 4NXMB 4TRRA 2CXQA 4FGLA 5ALNA 4FKMA 4ZZ0A 3CZRA 2VK4A 3DHVA 1AMNA 1A72A 3PPXA 3FWNA 1CJTC 4BRWA 4FX5A 3F6CA 3OZ7A 1KMHA 4X6UA 5CUQA 4PLWA 1C0IA 5HOQA 4WASA 2ZAMA 3BRSA 4HLUC 3T3NA 1N8TA 1VIYA 2G0AA 2IP4A 2Y1WA 4FU0A 5HFAA 3F6EX 1N6HA 3VV2A 5FEUA 1TEZA 5F2KA 3IDSA 1PHPA 2D2FA 4HADA 4D8TA 1KK2A 3AW9A 1R7RA 3S1SA 1Q7EA 1RJ9A 2EWWA 2EZ9A 1WULS 2MR5A 3I04M 4KLNA 2XUFA 4UAVA 3D2CA 1GFWA 5K8CA 1JW9B 5T5QA 1R3DA 1I0IA 2GB4A 4YRDA 3LY9A 4TTJA 3EHEA 4C76A 1TMYA 3BZUA 4FNMA 1Q92A 2ZWVA 4GAEA 3SMVA 1P7WA 1OD6A 2HV8A 4WKCA 1T3HA 1NIJA 5J5AA 3WLHA 4BQQA 3ANYB 2NO5A 5IP5A 4BJ1A 4DIBA 1C4OA 1OLXB 3JR7A 1CFJA 4NARA 4BNZA 4FTWA 1O6GA 1FOEB 1U0RA 3RRXA 3ZCRA 3KOUA 5EKXA 1IDN1 2J0EA 2BGTA 4H3VA 1OFGA 4DILA 1VI5A 2IIQA 1L5HB 2X5OA 3PT5A 5B3AA 1A9XA 1IWPB 3I2YX 4RQTA 5DWVA 3P45A 1MR3F 3G0OA 1I4LD 4G2NA 4H2DA 4OI1A 3RSHA 4LRUA 3V00A 1E3TA 3M1LA 1RYDA 1KZ4A 1XVIA 3TB4A 1UKBA 3SPXA 4QUBA 5TMDA 4OU5A 1NE7A 3E27A 1RQ7A 1RZRD 5ICSA 4BNYA 3ID6C 5DI3A 2V6MA 4AMYA 1A97A 4TWJA 1GAWA 5JVDF 2LDBA 1SFRA 1ESNA 1Y89A 3DC2A 2NSHA 2FUG1 4MHOA 3MOIA 2VQFB 2PO7A 5I4KA 1J5EB 1I7DA 2F8MA 3FNRA 5HR5A 4Q9AA 1VGQA 5CNKA 1DAHA 5FD8A 1XZCA 2VDLB 2PA0A 2BCJQ 1UBLS 5CM8B 3TD2A 2OCPA 1E63A 1Q15A 1IMJA 1Z6PA 2E6KA 4BL5A 3QKRA 1E3WA 3PF8A 4Y2YA 4MVJM 5EQFA 4DLYA 4HN4B 3MWGA 4LRSB 4P3OA 3U1BA 1T3SA 4A3SA 1E1QD 3Q5GA 2JRCA 2P9GA 4OSOA 5LXTB 1CY1A 2YNMC 1CF9A 1O96A 3I1YA 3RU3A 2O8EA 4ZHQB 3PXDA 4BZZA 3DBRB 3DHYA 3H5OA 3ZTYA 3DLTA 2OG1A 3EZYA 4WRRA 3H17A 3DMTA 3K1YA 4QDTA 3HB5X 5GP1A 3U60B 2Q3EA 3F5QA 5KTRA 2XB4A 1CUDA 5TRTA 3U4QA 4HGZA 1USKA 4MV1A 3UANA 4V2UA 1C9DB 3PWSA 4QAJA 2CCJA 5FEMA 5HKLA 3MGBA 4RL6A 3AVWA 3I4FA 5C46F 1H2RS 3FLEA 4MJLA 3U3JA 1SC9A 2VDVE 4PZPA 5KQGA 2HIAA 2CKDA 5HMLA 5FWDA 3BXZA 3IO3A 3KVVA 4P7KA 6CHYA 2GX6A 1CB7A 2IEBA 3LGSA 3TSZA 4BQIA 3AJ8A 1G2PA 1V5GA 4YRCA 1SB9A 3JSAA 4B32A 3N3AC 2EX4A 1J0DA 2B98A 2XDWA 4GLFA 4HQKA 3QY0A 4L5IA 2O7NA 3OQOA 2C3YA 2COKA 3ILSA 3JRWA 3KKLA 5HNKA 4AZ0B 1P7YA 1NVGA 2O2EA 1IHYA 4KUHA 4Z54A 5EIEA 4R5MA 1T36A 3FYHA 3H9GA 3L02A 5TY0A 3F1LA 1DPFA 5HS4A 3HXLA 2MSEB 1KI6A 3WNZA 4H6XA 5JD5A 2JIOA 4LBVA 4LV5B 1TZ2A 3ER9A 1G2IA 2WM8A 3MW8A 4RENA 2W42A 1CQZA 2XMGA 2W2OA 1FA9A 2TYSB 1GZUA 2YYSA 2I6QA 3G2MA 4LPKA 3U0VA 3WK7A 1TF7A 1MIOB 2D6FA 1SD1A 1R3UA 3P5SA 4C14A 4ZZ2A 1V7QA 1NMXA 2P65A 4C4SA 2E4YA 1SUDA 2ZR0A 3PC6A 3R0XA 3GJQA 4NLLA 5TNXA 5ALWA 5JU6A 1RRFA 4EYOA 4Q3NA 1I9CA 4P32A 1I14A 3A0UA 4AUEA 4AULA 3QW4B 2J46A 2XWSA 1JQEA 4CR8A 3BB4A 2INGX 5CNMA 3RTCA 2OG2A 4NOLA 3VR1A 2DBYA 3LSYA 1EXDA 1Q1QA 3KDPA 4G85A 2YXBA 1NBOA 5AOVA 5K0CA 1GV0A 4JY7A 5CDYA 1EG7A 3LC7O 1V25A 2AD1A 2N42A 3H4IA 3X2EA 2YWGA 3H2IA 2HT1A 2OFXA 4BNDB 3OE7D 4GNRA 4IJKA 2K7FA 1G9XA 2VPXA 3ZD6A 2AOUB 4B7ZA 1ZU5A 4R3UC 4Z2AA 1FFXB 4W8GA 2ABWA 4AS3A 1G21A 1ZD9A 3FCXA 4F93B 3IPXA 4K9NA 3ZCXA 1UJ4A 2WNHA 4HVCA 4Z4EA 1IRXA 3A1CA 3GUUA 2PANA 3PICA 2XT6A 2Y1OA 3GI1A 1V45E 2G0NA 3HKCB 1PUJA 4ESOA 3DXXA 3DAFA 4UUNA 5EN4A 2D3TA 5IG2A 1OPXA 3GEHA 3MJSA 2PX8A 3Q5DA 3F1KA 1UT8A 3HLKA 4PQRA 1MJHA 4M1WA 3A04A 3H6KA 4PRKA 621PA 2JFYA 1JZQA 1PJTA 2O2HA 3HZRA 2Y0CA 1T10A 1EIWA 4MI9A 4EUHA 1CY4A 4KV9A 1W1UA 4HLCA 2O0LA 4MRSA 2HMVA 4QGGA 1W9HA 1C29B 5K4AA 3K70C 1HLFA 2XIJA 4LNUA 3AR7A 3OAAA 4R8SA 4C0KA 5JIBA 1R0WA 4ZT7A 1RRMA 3G0DA 3CVUA 1JFRA 1P2VA 2M1ZA 3OOEA 4RD6A 3W2EA 2EBHX 1SOWA 2PZEA 4GR9A 3VH2A 4CL3A 4FWTA 3BB3A 5CFZA 2NVWA 3VU9B 1MX9A 2UUPA 1GNLA 3FSEA 1FNNA 821PA 3IAHA 3ZDDA 3R6GA 4FD2A 4QO7A 4NVRA 1WMBA 1WP4A 2ZUDA 4CDNA 3BIJA 4UAUA 4KDRA 2R86A 1HE5A 2OV4A 3UWDA 3GDHA 2COEA 4A9AA 5AM2A 5B1IA 2XADA 2I29A 1UINA 4NENB 3D7LA 1FLDA 3H16A 5LYJF 4W1SA 3EEYA 1ABEA 4LECA 4RKRA 1XZPA 1RM5A 1Y1TA 2MYTA 2ZSFA 3KYJB 1PNQA 4HB4A 4I9HA 4INJA 4PVDA 4RPCA 2J87A 2WUVA 2MSLA 1KZGB 4XQGA 3VSEA 4MMXB 4NFYA 2CXSA 4Q93A 5TMPA 2NU6B 5JYEA 4TS9A 3VAYA 1WW8A 1E7RA 2NUPA 4K46A 1W5AA 2PKRA 3KC2A 2GTHA 4AJKA 4E0BA 1NXQA 2OXCA 4LFCB 1AVTA 1P3DA 2ODPA 4X1KA 3IJPA 1DHTA 4PLZA 4HMPA 4EKYA 2VP0A 4C07A 4EO4A 2D8MA 3LDUA 4QFBA 3QFHA 1BMFA 2RIRA 2V55B 5CJ2A 4WCFA 1FNSA 1Y63A 2IEAA 3BA1A 3R8XA 3WJ2A 5AKLA 5AFSA 3TAUA 3KAJA 2GJAA 2ZQZA 1QZZA 1YV9A 2P79A 4H08A 4L85A 3TH5A 2QX9A 3GPDG 4FZ5A 4GGMX 1P1HA 4HAOA 4MAAA 4BLRA 1YOBA 1FRFS 2A4KA 2NX2A 3LPAA 4EZEA 4KVZA 1P2SA 3JQPA 2QYHA 3UH1A 1U02A 3QVWA 4Q21A 3T6KA 3MVEA 4FXPA 2C2OA 4LRXA 3WQHA 3ANTA 1MNQA 3CPSA 1O08A 4EVIA 3L8ZA 1TO1E 1J9ZA 1O0SA 3ZGXA 1RTKA 1XZKA 3DO5A 421PA 1WU7A 4F7DA 1HYHA 3FNBA 3PQ6A 2EJWA 4AT1A 1B6TA 3FBGA 3BFJA 3MJVA 3O75A 4R31A 2XITA 3ZCUA 4M9SA 5CG1A 3OF3A 3IQFA 3IHWA 2OHHA 2X9LA 1RLOA 1IZZA 1SC3A 4OHXA 1LC3A 3I2IA 4H77A 4EARA 3A1FA 3C1UA 3OO1A 4PWYA 2PFGA 2W9XA 2QTMA 4MARA 1Z4LA 3GFGA 2AHRA 4DLUA 2IPOA 4BLQA 4HZGA 4AKGA 4Q3LA 3T52A 1SUCA 1J56A 3D3QA 1KRHA 3VYVA 4O08A 1RKXA 1UPXA 4OP1A 4PAMA 5TLSA 2PU5A 1DGQA 2QTVA 1EUYA 4MS3B 4HQNA 1NFFA 2QD4A 2QD5A 1UBNA 5D3QA 3RK4A 1FBTA 2X8WA 1QHIA 1Z4OA 1B8OA 1EPUA 1TUEA 3R9WA 1P91A 2AOXA 3HCWA 3KXKA 1XEWX 4HBZA 1H8HA 4TLAA 3A1UA 5LJLA 3CW2A 2YV2A 3NUQA 5GJWC 2C7PA 3OTWA 5D5PA 4L0CA 4EM6A 5JSZB 3QE0A 1BE0A 1JKJA 2O8CA 2Z5FA 2C8VA 4H6PA 1KAQA 3DDNA 2QPLA 1LTHR 2RJOA 1R0RE 1EBFA 1JHUA 1VPVA 3CEAA 3MBIA 1JR3D 3EQ8A 1HDEA 2EJBA 3D0QA 3TQSA 5DLDA 1CZHA 4E2ZA 3FOZA 1XRMA 3U16A 2XF8A 2I1VB 2PN1A 5ALJA 4NKRA 1E6UA 1WPXA 4PLHA 2QSJA 3LC1O 4F1KA 3LG2A 1H23A 3UT0A 1X9GA 3B51X 4OJQA 1K9SA 5C8YA 4BQSA 1FFAA 3DL0A 5JZOA 3GLGA 2CY0A 2ZI6A 3KX2A 3B5EA 1IN1A 2XQFA 4URWR 1JR6A 1R1DA 2RFLA 2XRMA 1E98A 3B82A 3HM9A 2FKNA 2JFFA 3D8TA 4N39A 2JKYA 3SE7A 2W6ZA 3UH0A 4E11A 2FHPA 3T8YA 5JD6A 3DWFA 3GGJA 1WXEA 1ZPDA 2JDID 2LBPA 3BQ9A 1FSSA 4YIHA 2Z56A 3H7AA 1BVHA 3W1WA 3AUYA 2F1RA 4JJZA 4BQRA 5A4JA 3UCEA 4IIGA 1EX1A 4QBHA 3PB3A 1TU4A 2NN3C 2YBDA 3DMNA 3QKSA 5H1YA 3CPEA 4KSBA 5HMMA 4QJ3A 1IG3A 3W3AH 3ORYA 4G4SO 1C0KA 3ZY3A 4EG5A 2O7SA 1X7HA 2VAVA 5ILOA 3PWKA 5AI8A 3GRRA 2YR0A 3VYTB 3PPYA 4BS9A 1WL8A 2ZYSA 1E8DA 2PL5A 1AT1A 1X8LA 2VH2A 3ESQA 4LXXA 2OCIA 1Y8QB 3ORFA 3Q3JB 4Q9NA 2YJ3A 1ZR2A 2Y6VA 2HNKA 1GR1A 5HJ7A 4Q4HA 2ZJ8A 5GZ6A 221PA 3HEAA 2YQ4A 5G53C 3KEGA 6REQA 1SCAA 1UCFA 5EIAA 2O5EA 1EVZA 3L07A 5T4FA 3TTWA 4BLPA 4IQFA 5M3BA 2BT4A 4D4HA 1QXSA 3HYTA 3ILHA 4HDRB 1UANA 3G7UA 1Z74A 3RWMB 4MULA 2AV6A 3SLRA 4QUDA 5KNCA 2HPAA 1P33A 2CWDA 4UVHA 5EQJB 2IZ0A 5LC1A 1P2TA 4EB0A 3N8KA 2Q99A 4ALJA 5EJGA 2J67A 3QYPA 4D92A 1LZKA 2OAQ1 1KMNA 4A2CA 1WMSA 1YR2A 4LJ9A 4UE2A 4YI3A 3SOZA 4GRDA 4C08A 2WF8A 3EFEA 4HEJA 1VPTA 4LXHA 4AY6A 5TT0A 4DIUA 3SS7X 4FYJA 2J3KA 3K09C 2JGJA 4EBBA 4UJ3A 4EHHA 4N0MA 1JEJA 4ILEA 1ZMTA 2MT9A 1S7CA 1XCOA 2YZ2A 5K0FA 5JD3A 5D3MB 4G0WA 2H4JA 3LHFA 1XKQA 1E9SA 1FVHA 2OFPA 3WI7A 5KNDH 3BXEA 5L95A 5TMEA 3EW9A 4BFYA 2DWUA 2X86A 3C15C 3ESBA 3AH8A 4Q1AA 3ORSA 5D6OA 2YOHA 3M4XA 1H05A 3HSYA 1PSWA 3NYQA 3OU7A 4PFJA 5DGHA 4XDZA 2WNIA 5AVJA 3JS5A 1LSUA 3UXMA 1BTOA 4GICA 5KDOA 3W2GA 5IAOA 3GCWA 4KBYA 1K3FA 1D1QA 2JK0A 3ZU5A 4B2LA 2BE9A 5AUPB 2HCBA 1BN7A 4TWIA 3KKQA 3L40A 2CWWA 3ICPA 3SKVA 3HO6A 3M82A 4JXXA 3A2LA 3L7LA 1IJBA 1FBNA 1FSGA 5JSUA 2IL1A 3EVAA 2RI0A 3WIDA 1WX1A 2GCOA 3H2JA 3QU9A 1N2CE 5JJKA 3EF1A 5JH7A 3PF9A 5AH0A 1QORA 3B6MA 1WOYA 1O0BA 4RDHA 4Y98A 2FSIA 3VPCA 3UCFA 3V9PA 2PZKA 5I9LA 1FFXA 4KYUA 2CV2A 4FKBA 1ODFA 2E3JA 4OQ4A 3BD6A 1QGUB 1N2GA 2QN3A 2P9BA 3T5PA 3R7BA 3CZ5A 1EFVB 1RAAA 4DVGA 5K6AC 3AUFA 3W3AA 3G8CA 1JIJA 1UJ6A 2V8OA 3C8DA 4BO7A 1NVFA 4E5YA 3IQIX 1IRIA 1V8BA 1H6AA 1R4MA 1C9KA 1RIIA 2FMUA 3IP3A 1F06A 1IJEA 2Z8YA 1VRWA 2EGGA 1M6WA 2VTBA 3MJFA 3HJFA 3ANNA 1A4UA 1Z37A 2ZRDA 5KTKA 1ZM4A 2ZULA 1AQUA 1EGQA 3GPIA 2W71A 2XYHA 4B0PA 1U8EA 4H3HB 3ETJA 2ZKIA 5INTA 3BOSA 5BSEA 5KJ1A 1NULA 2XGOA 3BX1A 4IJQA 4JB2A 1VJDA 3H2GA 1RPTA 3DBLB 2IS1A 1H2BA 2R7MA 5AOAA 4AP6A 3ZHQA 4EOGA 2C1ZA 4GR5A 5LLTA 2VK2A 2Q6IA 4FYYA 1CX9B 5GWXA 3GG9A 3T3IA 2W11A 2RHCA 2Q0HA 2WAYA 1CQWA 3HZZA 1GPBA 3T7KA 1USWA 3EWSA 4EHJA 1HQCA 2FRDC 4LNAA 4UEJA 5DKFA 3KSMA 1DDOA 3KBBA 4NPAA 1J00A 3ICVA 1MABB 1U98A 1ZGGA 1YGPA 2JI8A 4Q4LA 4TV8B 3NHSA 3QKWA 2WSSA 2CLSA 4YUXA 1J33A 1U8FO 5HG0A 3LX4A 3WGZA 3SWWA 1HSOA 2ODTX 1BOOA 2NU6A 4JJFA 1B43A 5B6PA 1QPZA 3MS7A 1AN0A 5JXIA 5DIZA 1SKQA 4NICA 3CCFA 4PTLA 3JQ8B 2VDNB 1KRWA 1UXJA 1QH1A 2IV2X 3W8RA 3BF8A 1CUXA 1B4DA 3ZLJA 3TL3A 4JSRA 3SKXA 1N5IA 2EJTA 2H57A 2HA5A 1G2OA 2YNMA 4X65B 1PR9A 1Y3HA 3L92A 4RA6A 4QUIA 2IS6A 1FP2A 1IATA 1NRXA 3E23A 4QQRA 3UJBA 5H9VA 4B3RB 3B38A 1JIKA 2AYXA 3THOA 2ZYRA 2DAPA 1R16A 1TZJA 3P9XA 4IVNA 4UXJA 4CG0A 4P22A 2TECE 1QQTA 3O3CA 1TFRA 2H1CA 2WU0A 4V1CB 1UPUA 3GMTA 4R9RA 3S2EA 2ZR7A 3FLMA 5AM0A 4I50F 3DWGA 1J2EA 4KX3A 3ZUGA 1OFTA 4BE7B 4W8OA 1KK1A 1XTTA 2CSUA 2FPKA 4QPPA 2RG1A 2C92A 5COAA 4K3VA 2QPTA 3OSUA 3EQ9A 3W2FA 2VDWA 2P9EA 1JEQA 1DRWA 1RQXA 2EGUA 4O4HB 5G40A 3O31A 4TMXA 4AF7A 3KFLA 4WLFA 3LOUA 4MW7A 2GFIA 4E5SA 2WUDA 1RI1A 3T0GA 1DTWA 1PNTA 5LA6A 4AIRA 1Q11A 2OXRA 1YFLA 4OVKA 2DQSA 1UM9A 2JEZA 2O0HA 4IQ4A 5HEKA 3SE0A 4KOAA 5E4JA 3LT2A 4XM0A 1GCOA 3HWRA 4PPNA 4G1MB 1I5OA 1C7QA 1QM5A 2PH1A 1FJGB 3PNQA 2QRHA 3RADC 4OB6A 1XDZA 1OA0A 1VKRA 2MMCA 4B84A 5LOVB 2PMBA 2IYRA 3AF4A 1JYEA 1L8OA 5D1HA 3QH4A 2Q6TA 1QWSA 1FJ2A 3ZWKA 1KAHA 2YJTD 1YBHA 3ZHBA 4JHXA 1SZDA 3T7TA 3JYQA 4JI6B 3HCPA 4I1YA 3RREA 3TJRA 4D9GA 3I62A 4MLZA 4MKFA 4JC0A 1NSTA 1SVIA 2OV1A 2ZITA 4P33A 5K51A 4DLWA 3VR6H 3TOXA 1NN5A 3FDJA 2VHYA 2IEYA 4US1R 2R8PA 1WD7A 3UN1A 1Z0SA 1A9RA 5HRUA 2JNWA 4MYRA 5E2BA 2A9KA 4UKDA 2LRHA 2KE5A 1D07A 4C3ZA 3JQGB 1DJLA 1XEXA 5JS6A 2TRSB 4V03A 3UICA 4TT3D 5EMHA 1VDMA 2WY2D 3ZIAD 4F3KA 2X77A 4KX5A 2V58A 5CT6A 3E8MA 2J6HA 3V8RA 1GP2A 1H2ZA 2C4NA 1IZ7A 3C16C 4MHTA 2WIDA 4KQHA 1QK5A 4RK4A 1FMCA 1SBCA 5P8WA 3ESZA 4FPXA 2NZXA 4IS2A 1P74A 3NYWA 4H15A 3CG0A 4K5QA 4ZT6A 1BN6A 3B1WA 3LNTA 1A5TA 3EF0A 2OOKA 3HUTA 3QXJA 2AL7A 3CVXA 1NI3A 1K98A 4WUVA 2VBCA 2WI8A 4CIWA 1VHDA 2HRZA 2IHTA 3AEYA 2BM1A 4TN5A 5LQKA 5CH3A 3DVSX 2OHOA 2GCEA 3P5BA 2BGKA 1OOEA 2LKCA 2WUEA 3ESAA 3HPQA 4H9GA 2GJ9A 2OFFA 3WBJA 2AKYA 4DV5B 1OXVA 3HADA 3HDVA 4L3WA 4I55A 5CDHA 2X0RA 3JQEA 3NTOA 4N3BA 4PSUA 4YP1A 1NJ2A 3U9TA 1PE0A 4WBSA 3C7AA 4BTLA 1W96A 2OUIA 3K9GA 4FMCB 2HWKA 4TVBA 5CVVA 5ALEA 5J63A 4A91A 5H68A 2HHHB 3HCOA 5K0TA 4XJTA 4TQ9A 3HDHA 2IPAB 3NAGA 4IVQA 1EQAA 1L3BA 2NZYA 2AJDA 3QPDA 2ORVA 521PA 4ENSA 5EUQB 5I7OA 2K7ZA 4KV7A 3RYIB 4KR7A 3BJZA 4ED9A 7MDHA 2VYQA 3UM9A 3AL3A 2J9RA 2ZRKA 4OXXA 2ES4A 2OV3A 3T5DA 1VG1A 4D0SA 4RTQA 5FBVB 1GUZA 4AO7A 1TZBA 1LB1B 1CP3A 3WFJA 1GTRA 2C61A 1TJNA 3AR5A 3DEFA 3TRJA 4KAJA 3WB2A 5AI0A 3O9MA 4LMAA 4HDQB 3HVIA 2RGGA 3SZUA 2DHCA 4NCNA 3SDBA 5CFRA 3PRHA 4BB9A 4OHVA 3JYNA 3TQIA 5D84A 4YCSA 4B8ZA 1RI3A 1T2EA 3C6YA 1P31A 4A2PA 3CS3A 2NAFA 4Y6QA 5I3ZA 1S0UA 5FYQA 1LBEA 2BHLA 3NXSA 5KVAA 3K70B 1IEVA 1FP4A 3LV8A 1RHJA 1KEWA 2GHRA 4QDOA 3PXGA 3TVYA 1N32B 2OHGA 4PIPA 3VYWA 2V7EA 1MX3A 1WMFA 3ZE1B 3PDIA 2Y1EA 1TQ4A 2B6HA 1GKKA 1JP7A 2DHRA 1M7BA 2CHVA 2VJMA 1VBNA 1NW5A 1A9SA 5J4YA 2R66A 3A4LA 3H87A 2VHJA 3CRQA 2WICA 5BN1A 1TUGA 1NHWA 4A0HA 3QVKA 1P5ZB 3ZIUA 1PTJA 5AW3A 5E1BA 1X42A 2I33A 4LOJA 2DVMA 2GM9A 4QJBA 3ZWPA 1PDOA 1X92A 3OI7A 3W6NA 2IXEA 1JIVA 1RABA 4AN4A 1PWHA 3OPMA 1WTAA 2O07A 1Z2OX 2ZBEA 2C9DA 3L6RA 3T3EA 3MMSA 2R5NA 2X13A 4PQGA 1DTSA 1W34A 1TB4A 2Z2IA 4PFKA 2P41A 3H2SA 4JODA 1L7QA 2QXYA 4F04A 1GXSB 4YLEA 4L27A 1WXXA 2Q8PA 4J1TC 4IIJB 4KXVA 4DPLA 4F5ZA 1QP8A 4MINA 1QRAA 1TZKA 1SK9A 4M0CA 3T99A 3OT1A 4EEZA 3ABQB 1T6YA 2Z58A 1V8OA 1G4HA 4MUMA 3MTJA 5CA1A 1Z2CA 3NOQA 5D7NA 5IKMA 2I3BA 4B6JA 1QIJA 2E87A 3RWBA 1HX7A 1VKNA 2BWJA 1NM5A 1YQTA 2JFBA 3K94A 3OA0A 2R1UA 4PV7A 2OCYC 5CLGA 3DV9A 4RYLA 1I30A 2EARA 5EOVA 1MJGA 4RZ2A 1NW9B 5I5GA 3ZWCA 3N2LA 1NUHA 3TE6A 2J0UA 4BLOA 3EGWA 3SX4A 1YACA 2BLNA 2H1IA 2GZ3A 5F4BA 1UPFA 5ALHA 1ZA2A 4ZVKA 1F8UA 1I4DD 4LF8B 3DB1A 4R2HA 5FWXB 1ETUA 3HJAA 2PSHA 3ROTA 1SIOA 2QXUA 3H0EA 1PS8A 1ONSA 2BMFA 2I6TA 4UTRA 5A3JA 2WAAA 3RRFA 3RSQA 4G1EB 1R4MB 1NPDA 3R9KA 5JSFA 1V26A 3UO8B 1K68A 4WH0A 1EWVA 2RGBA 3THXA 2JJ1A 2VYND 4C05A 1YL6A 2W43A 1L6RA 3MCWA 4PX9A 2GAOA 3D3WA 1R5NA 4QXQA 3FLBA 1TX4B 5KYNA 3U56A 2C9CA 1USIA 1UPAA 3QZUA 4TUYF 3IMFA 4YA6A 1IFXA 4OJMX 5IDWA 2PGOA 3DXZA 4FSDA 1BXGB 4W9NA 5TPWB 1TKAA 1XCLA 4DQKA 4E5VA 3IE1A 2I6FA 3M6VA 5GQSA 5A2QA 1K6EA 3FKQA 3UMRA 1T35A 1NMSA 2DFLA 3HBNA 4CM7A 4M37A 1H6CA 1W0KA 4HPWA 4IMIB 5FJJA 5ITZA 4RZUA 1UJNA 4WADA 4Z4IA 1DAMA 1FXWF 1C0PA 3Q41A 1FE8A 2CB9A 5TF4A 1UDRA 3LC2O 4BNLA 4LY3A 5FTNA 4IQ0A 4RTMA 4TUYA 1YJXA 1Z56C 3HSKA 3OUTA 4OAOA 1ZVMA 4QOEA 4L4YA 2HQSA 2A7XA 4B6RA 4M7PA 1OYYA 4LBZA 2A5JA 4KQJA 4PGFA 3T9FA 9MHTA 1DDGA 2PGDA 4AU1A 2OQIA 3F78A 5I9SA 1PR2A 1KSGA 1NN0A 1U11A 1M2OA 2B61A 5B1HA 5J5VA 5COQA 1IUNA 4EEXA 1RWWA 4YR7A 1G8AA 4M9XA 5BNIA 3MT9A 3RB8A 3GLHB 3K8ZA 2BJWA 4GKAA 4DUYB 3OF5A 5E4FA 1RWKA 3HA3A 4G5RA 2ZW9A 2RE8A 2UZ3A 2IZ7A 1K5GA 4K6CA 3OEYA 1M1XB 1PW5A 3ZX4A 2W22A 1QAQA 3DHWC 1RRGA 5FULA 1VPEA 5F7XA 4ACAA 5AP9A 3UA3A 5FNVA 4CF5A 3PKZA 4DG8A 3EJWA 5CH5A 2PX4A 2WJZB 3LOQA 1M6YA 1SA0B 3WO0A 2XLBA 3KETA 4BO6A 3JVEA 3AM4A 4YV7A 4CVNA 2Q50A 3WV4A 5GINE 4J3FA 3D7RA 5JAUA 2CDNA 2VH1A 3IAM1 3M5DA 1ZOIA 3DZJA 4UBLA 2JHFA 2X8AA 3F49S 2OBYA 4NH0A 3V1LA 3Q2IA 3P4YA 4R2KA 3G8DA 1CK4A 3MQ4A 3MUEA 2I2AA 1IBRA 4Z86A 5HUQA 5BYJA 3L1UA 4ZI5A 2JFOA 2VDWB 1DIOB 3ZWWA 1UXHA 2EW1A 1P60A 1P1JA 5FBZA 4NYJQ 4UNRA 3WFZA 3DP7A 2XE4A 4S1WA 3ZWAA 1IDOA 2PUHA 4XPIA 3DE3X 3IMKA 4LWOA 2NUAA 1MAVA 5CYGA 2HHLA 1DI0A 2FXIA 3OMLA 1FMFA 3NHRA 2C7GA 4JH0A 3GFTA 1P4RA 4IDOA 4D79A 2V7TA 3BD9A 4L75A 2KX7A 3UGTA 3THRA 4ZDJA 1Z5OA 4J4BA 3KQTA 5CDGA 2WSIA 1EFPA 1SK8A 3G49A 1D8AA 4OPMA 5KTPA 2GO7A 3QMPA 3RJZA 4IM7A 4Q0MA 1DQNA 2QNBA 5HOEA 1HG1A 4Q3CA 5JI3E 1J6UA 4ND6A 4OO3A 5GZ1A 3RVBA 3NJRA 1H0RA 3CSSA 5LUBA 4UMEA 4OX9Y 3L1JA 4D81A 3W5SA 1V8FA 1B23P 1Y4DE 1AN9A 3TOVA 4ER3A 2G25A