4R68A

Lactate dehydrogenase in complex with inhibitor compound 31
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r68A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r68A02
1NVMB 4EZBA 4DC0A 2IZ1A 1PL6A 2IRWA 3AW9A 4PZDA 3VDQA 3L6OO 2W8ZA 1KIFA 4LMRA 4ND4A 3SX2A 5JAQA 4E3ZA 4YAKA 1MFZA 3WYCA 1AXEA 3HHPA 5U4QA 2D4AA 1TT5B 3MJVA 1B0AA 3U0BA 3F5SA 3PLNA 4E2XA 1EVIA 2RHRA 1DO8A 2VOJA 1Y8QB 1LU9A 3MCVA 1E5QA 3WGGA 1EK5A 3C1OA 3WJAA 1CIVA 3B1FA 3RC9A 4ZQHA 1CETA 3W1VA 3ROQA 2BI7A 4R1UA 3P2OA 2X5JO 3HQ4O 1E1NA 3NAQA 3STHA 4GPD1 4J1NA 2X9NA 1YO6A 3H2SA 4JGBA 3KYDB 4PN3A 1XELA 5DZSA 3ZZNA 3GG2A 1PS9A 2XXJA 2EW8A 1PJ4A 2CD9A 4J4HA 5J23A 3WGHA 5K9ZA 5TJ9A 1HYHA 3WYEA 4R9SA 5L45A 4NNJA 2DBRA 1O89A 2Q50A 2VHYA 1QYDA 4RORA 4CV0A 1F0YA 5HA5A 1LSJA 5DOZA 1U8XX 2O23A 3E48A 3JD2A 2GASA 3RBVA 1NXQA 3I9OA 2X0JA 1ZJYA 1LSOA 1CDOA 2WWRA 2YQ4A 2YZ7A 4J3FA 3RUDA 3GEDA 2JHGA 5IZCC 4ZQGA 4WPGA 3HB5X 4FBGA 5JO0A 4CMEC 4JROA 4BIIA 1EFKA 5DN9A 1O6ZA 4XX0A 4N18A 4QO8A 3B1KA 3PYMA 4E32A 1LC3A 4XD2A 4NG5A 3RIHA 3IP3A 4MVJD 3ZCXA 5TX7A 4RVGA 1Q2XA 3HDYA 3GC6A 2G76A 4NPCA 3TQHA 2VT2A 5C7IO 2OUIA 3B1JA 4J4TA 5GMOA 2H1SA 4MVJM 2GSDA 3VPSA 3WTCA 2Y1GA 1N8KA 1PZHA 2ZB4A 3KM0A 4W9NA 3FPCA 2XXBA 5C7LO 2P4HX 3PQEA 4I5EA 5IAAA 3G17A 4CM8B 1ADBA 4LISA 2X86A 3R6DA 4MVJH 5F21A 2HMWA 1AHHA 1V3VA 3N74A 4AJHA 5TNXA 1NX6A 1MG0A 3K6JA 3ZGYA 4G81A 3U3XA 3KSZO 2YV3A 1MFPA 2O4CA 4WCDA 1KVQA 4WLNA 4E0BA 1YOVB 1JVSA 2BRUA 3E1KA 1WDMA 1H9AA 3PWZA 4CMBA 3VTFA 2WEKA 1LLUA 2B4TO 1QV6A 4RDIA 4JBIA 1KY5A 2X58A 5EERA 1CYDA 2UV8A 4JJGA 3BMNB 2W2KB 2HJRA 3PK0A 4JIGA 4R69A 3H5RA 3SC4A 3EGOA 4I5FA 4IDDA 4E5MA 5FFFA 1HL3A 2B0JA 4KUHA 3E82A 4GMFA 3A4VA 3PGXA 5AYVA 3MTJA 3RKRA 1AE1A 3SJUA 1YDEA 4B8WA 4RVFA 1U2GA 3B70A 3PWSA 2EP5A 3A06A 5A4DA 4IZHA 4ALMA 3OEYA 1QLHA 4PLTA 3PLRA 4RDHA 1E3JA 2ZB3A 3KETA 5DT9A 4YT4A 1EQUA 4G5HA 4TZKA 3Q1LA 4N5MA 2J5KA 4HFJA 4XGIA 1LDMA 1Y81A 1S6YA 3PJGA 5EESA 4AJOA 4KDFA 3AWDA 3PPIA 3DOCA 3HDQA 2V6MA 3D7LA 3KLMX 1M2WA 4J7UA 3HG7A 4X54A 1BGVA 2BI8A 3NGXA 2O3QA 2BLLA 1HDGO 1NR1A 4IMPA 4WGGA 3H7AA 4Q9NA 4W7HA 4EW6A 2GLXA 4IJUA 4OSPA 4CLHA 4FFLA 3ONEA 4FN4A 4BO0A 3L9WA 4RJTA 5IFLA 3JD1A 2ZTMA 5CDSA 3L4BC 1LLCA 1P1FA 4BO4A 1T2AA 5ILOA 1QV7A 4BKRA 4OM8A 1B2LA 1NBOA 3ZWCA 5IXSA 2R00C 3KHUA 2AQHA 4Z9XA 2NM0A 2NTJA 3S8MA 3ZW8A 3G1TA 1BXGA 1BWSA 5U1PA 1VI2A 1DAOA 1P0CA 1ZZEA 2FOIA 1L1FA 3WWZA 3M6IA 5CAEA 4DIBA 4R3NA 4CLRA 4J9UE 4NK4A 2P68A 3JQ9C 4OOFA 4W7IA 3I9NA 2F00A 4Y67A 1PQUA 3D3WA 3KEQA 3OECA 4E5KA 3OIFA 4YYZA 4CMHA 3PHHA 2Y1DA 3RI3A 3DOJA 4AJKA 4DXHA 1JAYA 5H81A 2C5AA 2AEFA 4CMCA 5G0WA 1R4NA 1G0OA 4IJKA 3QP9A 4XA8A 1EVZA 3QWAA 4WUVA 5U9CA 1VJ1A 2PY6A 5KJ1A 4GLLA 5CG1A 4UUPA 3I9MA 3WLFA 5HRUA 4Y8VA 5ILGA 4D3SA 1PR9A 3C8MA 1PU2A 5F1OA 2ZK7A 5G4KA 4JN6B 1LSSA 1A4IA 4CMJA 3NYWA 2AE2A 4P38A 3FTNA 1ULSA 1CF2O 2BFMA 3OP4A 4H3VA 1ZK3A 3EUWA 3RUHA 3LSYA 4RVUA 1T24A 3BMOB 3VPFA 4CLXA 4BNFA 1N7HA 1W0CA 1FDSA 4HP8A 2H5LA 4J49A 2PD3A 1ISJA 4BKQA 3D64A 3NT5A 4JP3A 1VC2A 2IODA 3JD4A 2G1UA 3K92A 3KRTA 5A5FA 3ORFA 1BXKA 3MTGA 3DZJA 2J5QA 3JYLA 4L4SA 1OAAA 4D44A 5L4LA 1DC6A 8LDHA 3WIDA 4IDCA 1BTOA 1TVEA 3KLPX 4WEOA 1M66A 4R54A 5I7FA 3RC1A 4QX6A 4E2ZA 4II2A 2EXXA 1N5DA 1I30A 2I5PO 3S55A 5I9LA 3GG9A 1D3AA 4IY1A 3IQDB 3FD8A 1FMCA 5L7YA 1X0XA 3LVFO 2HCTA 1O9BA 1LDBA 3BZUA 2E82A 2VZ0A 1PQWA 4GLOA 5DF1A 1GV1A 2I65A 4W4TA 4BO3A 4JX8A 5JC8A 3TZQA 2EKLA 2HSDA 5TT0A 1K0UA 3FNGA 1RPNA 4XWYA 1R12A 3OQBA 3IL2A 4YVFA 1KERA 1IUKA 4B4VA 2FR1A 4YQYA 1DIRA 2G82A 3TSCA 3JQ8B 3F46A 4GGOA 3ZWMA 4HV4A 1EEHA 2OP1A 1LC0A 3WG9A 1ONNA 2BH9A 3OJOA 5JLAA 2Z5LA 5AQ1A 1GEGA 2PV7A 3WGZA 3CUKA 3FNEA 2XOXA 4KOAA 4ND3A 5GZ1A 1LQTA 4BMSA 2OHXA 3EYWA 1TT5A 4E5YA 4MIEA 1Y1PA 5TLSA 2YV2A 4YACA 5DBGA 1HTBA 1ENYA 1Y8QA 2YUTA 1IHYA 4PRKA 1YL6A 4OL9A 2LDBA 1UXGA 3GH3A 1T2DA 4DC1A 3P2YA 3ZW9A 2R2GA 1NFFA 2GRAA 1R6DA 2J3IA 3CH6A 1LDGA 1X13A 2B36A 5CPBA 3COSA 2Y0EA 3DBHB 4ITUA 1E3SA 2OP0A 1GY8A 4RF3A 1M67A 3ENNA 1UJMA 4TSKA 5TS3A 2RCYA 1X7HA 4L76A 5IZ4A 2PGDA 4JBHA 4FDAA 3QW2A 3ZDFA 2FPIA 5A03A 3EZLA 3AI2A 2NUAA 3ZU3A 4NJMB 1LQUA 1FJHA 3U4DA 2PFGA 3ZNNA 4R1NA 2CUKA 1UR5A 4MVJP 3AUSA 9LDTA 4AG3A 2VQ3A 2V65A 4OIMA 1E3EA 3WNVA 4KWHA 3WQSB 1TT7A 1I33A 3IP1A 1Z73A 2AG8A 2V6FA 4W9NC 4Q3CA 4WCFB 1IOLA 4P4LA 1LDYA 2EGGA 3EHEA 4H7PA 3TJRA 4BNVA 3RWBA 3DFUA 2FP4A 3BMQB 4DIFA 4AJIA 5JSFA 3JTMA 5THKA 1XLTA 2Q2QA 1ISMA 3N7UA 4B4WA 4MKZA 2XAAA 2HK7A 4ZRNA 4PZEA 1R16A 4C7KA 5IZCA 4MIOA 1LRLA 4E2WA 3UGKA 5JDIA 1E6UA 4CMEA 1C0LA 4J0FA 1NM5A 2CF5A 5MGBA 4DWVA 1B8PA 3VZQA 4DRYA 4DTIA 3FBTA 2DFDA 1YKFA 2JFGA 3BHJA 2Y99A 4NBUA 1UAYA 1K89A 1H0KA 1KVSA 4PG7A 4GH5A 2JCVA 2R6JA 4PCVA 4L75A 2ET6A 4G2NA 4XYBA 3CXRA 4CM8A 4EJ6A 1P1IA 2NNLD 2FSVA 1O95A 4CMGA 4NDNE 2CZCA 3TNLA 4DUPA 1XYGA 3VKVA 1X1TA 4ESOA 4I5DA 4L73A 3F3SA 3ZU5A 1GZ6A 4KTVE 3NT2A 1GR0A 3F4BA 2Q1TA 1ADFA 4I8XA 4NH4A 3AY6A 4M54A 2VZ9A 5IN5A 3TFQA 3PP8A 4U5QA 1E3WA 1ZMTA 4YRDA 2FY8A 1E6EA 1UAGA 3C7AA 4FC7A 3TZCA 5CHEA 2O3TA 5LDHA 1HSOA 1DFGA 2I9PA 1GTMA 1NAHA 3DBVO 4KQWA 4U0JA 3OIGA 1K2WA 4OO3A 4PG5A 4S1VA 2JHFA 1U1IA 5IG2A 5AXDA 5A9SB 4QQRA 1I2ZA 1MP0A 5THQA 5I8WA 1R4MB 4A26A 4GSLA 4BGIA 4GGPA 2DAPA 3RAJA 4YT2A 3FNHA 1HWYA 3I3OA 4W82A 5DP2A 4CUJA 1H9BA 3K9QO 4YJHB 1NWHA 4AL4A 1DSSG 3I83A 4XKJA 3WJ7A 4NIMA 3ASUA 5EN4A 1XQ6A 2EKPA 3WXBA 1FDWA 4E30A 4BVAA 1H6BA 3AFMA 1P44A 2E4AA 2WD8A 1YB4A 4QECA 2GPTA 5C37A 5LC1A 5KVQA 3HUDA 3I23A 2C2XA 3I6IA 1JKIA 2HO5A 3TL3A 3GZ4A 1WXDA 4OKIA 2GUGA 4MVJI 1DHRA 2ZKLA 1Z45A 4EDFA 2IXAA 2Z95A 3GEGA 1F06A 4RPKA 4CLDA 3UAGA 1DPGA 2AG5A 4G65A 5CP8A 3U5TA 4FGSA 3CZMA 5HTOA 5JY1A 3HSKA 3IOYA 5G0UA 1ARZA 3JD0A 1FK8A 3DMYA 2C20A 4LRSB 3OF2A 4PLZA 1E7SA 1C1DB 1C0PA 4BNKA 1UDCA 3GVCA 4W99A 1T4DA 1T1RA 4ZU3A 3ULKA 2TMGA 1QORA 2EHDA 1ZKMA 4DPMA 4FGWA 3R3JA 3GGGA 4DREA 4YJFB 4PZCA 5IDQA 3CIFA 4IJWA 3QSGA 2D1YA 1O94A 2VHVA 3KUXA 3K30A 3LLVA 1UUFA 1DC3A 4DMLA 1SPXA 2HMTA 1HDYA 1V35A 4QXMA 5ENDA 3GN1A 3TF5A 2WYVA 3DTTA 2V7PA 2GN8A 2O7QA 5I9NA 3WBFA 2IE0A 4E4YA 3ZNOA 2YQ5A 2ZCUA 3ZNQA 1ISIA 4BS9A 1H6DA 3CMMA 2NU7A 3H3JA 3VZPA 5BR7A 2WYWA 3FSRA 1LI4A 1ADGA 2D5AA 2UUOA 4U8GA 3RVDA 2DTXA 3I4FA 3NTQA 1N1EA 3QRWA 2JFFA 1A27A 3HWRA 2VHZA 2X9GA 3UHAA 2AQKA 2NTVA 5TQVA 4CJXA 1NFRA 1T26A 1Q0LA 3INTA 4H16A 5DDIP 5H83A 1YQDA 4NBTA 1HEUA 3NV9A 1Q0QA 4IZIA 3JQBA 3EC7A 1A7AA 4ZA2A 3ZWWA 2VN8A 1DRVA 4YWJA 2DTDA 4PLYA 3D4PA 2QIOA 4TRRA 1I3NA 1J49A 3MJCA 2BELA 1OFGA 3WLEA 2WM3A 4J2HA 5G0VA 5DBFA 3C7CB 3C7DB 5FI3A 1JKFA 1X0VA 4IM7A 2VWGA 1SB8A 3MWEB 3CSDA 4XQCA 1MA0A 2RIRA 4TZTA 4K1LA 4EGFA 1XU7A 3WMWA 3NX4A 1P1RA 2GGSA 3KXDA 5CFZA 2P9EA 5L7WA 4LSMA 2CDCA 4NHEA 1B7GO 5CDTA 4NQZA 5JAMA 4YDRA 2CF6A 2Q1UA 5JBIA 1DLIA 1OC4A 4M8SA 4YB8A 1OI7A 1E6WA 3DL2A 3I4CA 1VSVA 4XDZA 4D3DA 3DZIA 3GNSA 4GX2A 3QE3A 4LK3A 5I8ZA 3ZV5A 2OBNA 1PJSA 3MOGA 4EUEA 5A9RA 2WD7B 4TQGA 3GGPA 1JW9B 5KNLA 1ZBQA 4PLGA 1ZMOA 3ZWOA 1FXSA 4YA6A 3QA9A 2A4KA 1ISHA 1U5CA 1JN0A 1A9ZA 3OHSX 3HFSA 1KEWA 3BAZA 3GHHA 4JLWA 2NVUB 3TPCA 3OFSA 3UCXA 4J43A 4Z9FA 4BNWA 1UDBA 1LNQA 3SJ7A 3RFVA 4A0SA 1PWXA 1QYCA 1ZUD1 3SLGA 5JFOA 1EBFA 4NMHA 3E5RA 3GVHA 1IULA 1NR7A 2CDBA 2X5KO 4L8VA 4QUKA 4U7WA 1I3KA 3ZWYA 1GV0A 2ZQYA 3C1AA 3TFOA 2HUNA 1CEQA 2NTNA 1JAXA 1LA2A 4MOWA 2X8LA 2A92A 4Y6SA 4PLHA 1GFSA 1B8VA 1F17A 4YTEA 4UEOA 3H5NA 2X22A 1T2CA 5JAIA 3S1LA 4GKVA 4CQLB 4EUHA 4RPGA 1EFLA 2V6BA 2GN6A 1PX0A 1CRWG 3JCZA 4UVIA 2ZYAA 1HXHA 2EF1A 2QHXA 2PGLA 3PYLA 5CDUA 2UAGA 2HRZA 2XPCA 2Q2WA 1FDTA 4Q3AA 4CLOB 1Z74A 3GZNB 5F5LA 2IEDA 1C0IA 1VJ0A 4OHUA 3JV7A 3JQGB 3ZWBA 5A3JA 4OQYA 3F6YA 1E7WA 4RLSA 3DBHA 3CINA 4BO9A 2AEJA 3CZRA 3P19A 3KYCB 5A9TA 4AJ4A 5H82A 1XU9A 3OJFA 1U5AA 3DBLA 3GA0A 3NTOA 1YQXA 4MKRA 1I3LA 5KKAA 2D59A 5JDIC 3VVBA 3QWHA 3AUUA 2DVMA 3V5NA 3BTVA 2QYTA 4XYEA 3ZWVA 4AJPA 3RBXA 3D4OA 1TA4A 2X6TA 3IDSA 4NFSA 1WAMA 1KYQA 4CUZA 1HE5A 1VL8A 2Y66A 4MVJE 4PVDA 4WCFA 3BHIA 4Y6PA 2BFAA 4HBGA 4OYRA 4DGSA 3H4VA 1DOHA 3B20A 1DIHA 1Z7BA 1PJ3A 2EV9A 2PH3A 3GVIA 4JBGA 1YONA 4Q3EA 5BNTA 1C3VA 4K6FA 3VPHA 3WBBA 4Y98A 2P9CA 3DMTA 5GY7A 3ANLA 3ENKA 4XDYA 1X14A 4NZ9A 4YBZA 3CE6A 3QVWA 4GKBA 1BXZA 1SZJG 1OBFO 3KBOA 1B15A 1PGJA 4J0EA 5FEUA 2RH8A 4ZQFA 1HT0A 1ZSNA 2Z1MA 4TVBA 1LBEA 1PZGA 5B12A 3JYNA 1IL0A 1ML3A 2GF2A 1NYTA 2Q1WA 3TZ6A 1V6AA 3ONDA 2AQIA 4D0RA 2HU2A 1WWKA 1UXKA 2JD2A 5AVOA 3V2UA 4AJEA 4RV9A 2O4UX 4YAEA 3PEFA 1W6UA 2VTEA 4PG8A 4M55A 1GPJA 4NBRA 2DBQA 2BF7A 4UEJA 5JNLA 3GK3A 4YQZA 5COAA 1BHSA 4BGUA 3JQDA 3H3FA 5F3RA 2O7SA 1UH5A 4FJ0A 4WOKA 4YJGA 4NJOA 7MDHA 3ICCA 3PDUA 4B7XA 4LW8A 4R16A 4B4OA 1F8FA 4CQMA 1MV8A 1EVYA 4XRRA 3BMCB 3ZWXA 1N7GA 2C7VA 4CM7A 3A14A 1PGPA 2GZ3A 1U7HA 3ROKA 3IC5A 1DRWA 4M1QA 5A9SA 2I67A 4I9UA 2FSSA 4XQ9A 5AOVA 3GY0A 5BSHA 3LT0A 3GPIA 3S2IA 3TDKA 1ZEMA 1FF9A 2BGMA 3D1LA 3KSUA 1T1SA 1D1TA 2ZB8A 4RCVA 2VRCD 2VTDA 3HZZA 1EK6A 4CMAA 1HDCA 1V9LA 3E5MA 2PD4A 5EPOA 2AMFA 2QYSA 1PJLA 3GPDG 3U4CA 1Q7BA 2AHRA 1J6UA 4IGEA 4Z3DA 5JCJD 1YL7A 4I9NA 4PLCA 1O5IA 3QQPA 4CM6A 3DC2A 1P0FA 3GUYA 4IINA 4BO8A 3ROMA 4P8RA 4PGFA 5IDXA 3BTSA 4HY3A 4DBVO 4K26A 4GWGA 4RZHA 5ER6A 3KSDO 4ZQBA 2AEMA 3K96A 1KVTA 3DWFA 4QFDA 5DCUA 1JDJA 2CY0A 4OKNA 2UYYA 1AN9A 3EMKA 4BHTA 3V2HA 4PLVA 3D0OA 2VYND 3A1NA 4MP3A 4KUEA 3INGA 4RF4A 3WB9A 3JQ7B 3QV1A 2ZQZA 3RROA 4CMIA 2JD0A 2JCYA 4IQ8A 3WOHA 5JXWA 2GZ2A 1G1AA 4CM9D 3GVPA 1O8CA 2NVWA 1PGNA 1IE3A 1U3VA 2I66A 4WLUA 3FN4A 4LGVA 1DDOA 1KC1A 3PYXA 2QRLA 3IMFA 4BNYA 1JQBA 1NQAO 2YY7A 2A94A 1YE3A 4DYDA 1DEHA 4UVEA 1FDUA 5IN4A 2X0IA 4YRAA 3AOEC 4PG4A 2FPGA 1HDRA 1UXJA 3JQBC 1UZNA 4BKOA 5IXYA 1WMAA 3SEFA 2X7HA 4YCAA 5BSGA 1XR3A 3DO5A 4U0KA 3TZHA 5KJFA 1ENPA 1V0JA 2X0NA 1D1SA 1SC6A 5A06A 5CEFA 1NVTA 2PH5A 3JQEA 3ZV3A 3DONA 4CL8A 5DCYA 2AXQA 2BFPA 2BGLA 5EMHA 1P1HA 2WYUA 3Q11A 3GNQA 3KO8A 2G0TA 4XYMA 4CODB 4RVSA 3OMLA 1PEDA 1BRMA 3ZHBA 4A5OA 1QMGA 3FBGA 4CLEA 3AOGA 4E33A 4J16A 3PI7A 4B7UA 5BSEA 1CWUA 4DBZA 1YQGA 2YV1A 4MVJA 3GUCA 4RVHA 4WOJA 4CV1A 6LDHA 1J4AA 1JVBA 2HMUA 3ZNPA 4AICA 2PTGA 4B79A 1QYVA 2VHWA 1AUPA 1YWGO 2IZ0A 4OSOA 1DB3A 4WEQA 1JA9A 2PKRA 3W8EA 3NDRA 4LSWA 3W6ZA 2EP7A 3ON5A 5TT1A 2RAFA 3QIVA 4R3WA 4JXKA 1ZNQO 4WLFA 1GYQA 4XCVA 4ND5A 3TOXA 4FCCA 4BO2A 1NPDA 5GZ6A 1HE2A 1E7MA 5L95A 1VKNA 2EKQA 4PFJA 4DQXA 3OBBA 3AM5A 1XKQA 5FF9A 3RCBA 3LC7O 1N1GA 4P4NA 4XRGA 1DLJA 2QG4A 2H9IA 1Q0HA 2NADA 4RL6A 3UXYA 1I2CA 2QW8A 3V8BA 3P7MA 3N58A 1E77A 1PJTA 3WNQA 2I3AA 3IJRA 1ZH8A 3GEMA 2X23A 4OMUA 2DPGA 4BNZA 1U3TA 3ETEA 5JC1A 2UUPA 4Z3KA 3M2PA 1ONPA 5K6AC 1GL3A 4BO1A 4ZD6A 5L40A 3NJ8A 1I5RA 3IKTA 3PWKA 5C7OO 1W8DA 3QJ5A 1SOWA 1YL5A 3AJRA 3VDRA 2P2SA 1HETA 1R15A 4PVCA 3PRJA 4R4JA 3D4NA 1CJCA 4R01A 3GR6A 4BL5A 2NQTA 1SBYA 5HWSA 1IYZA 4RF5A 4AVYA 3RUEA 4C7JA 2HK8A 4BO5A 4D42A 1Y6JA 4ZQEA 1XCBA 2EG9A 3IUSA 4GWKA 4PG6A 3OJEA 1XG5A 3I9JA 3M1AA 2C0CA 1GADO 2HLPA 1Z75A 5JMWA 5L51A 4GI2A 2E37A 3S2GA 5KJCA 3Q0EA 1C1XB 2Q46A 5DULA 1P3DA 3BXXA 2VUTA 4CR7A 4XJTA 1R0SA 1GUZA 1DRUA 5L4NA 3VZSA 2X5OA 1MC5A 4FB5A 3WGYA 1HZJA 4FW8A 4DVJA 1LDEA 4HNHA 1V3UA 1GEEA 2O2YA 3MJTA 4M87A 3WICA 3ZV6A 2PR2A 2Y1EA 2VUSA 1U3UA 3NTRA 2B35A 1B8UA 2EJVA 4CQLA 1DHTA 2Y68A 1Z7EA 3GT0A 4EITA 1WZIA 3WTBA 3KYDA 3RD5A 5JCJA 1YBMA 1UP7A 4XYGA 1YJ8A 4UVGA 1H94A 2D8AA 2ZCVA 2RHCA 1TB4A 3VH3A 3DZHA 5G0TA 2O2SA 3O26A 4BV9A 4CLOA 1T4BA 4OOEA 2J6IA 4WCFC 4XB2A 3K5PA 2JJYA 2VWHA 3JQGA 4EUFA 3EAGA 2DM6A 3FNFA 3S2EA 2AE1A 4MPDA 2Y67A 3KYCA 4L4XA 1U7TA 2C2YA 1B3BA 3DMTC 4BO7A 5BT9A 1EMDA 4PLPA 4FFMA 4F46A 5A3VA 3ZWNA 4XIJA 2O48X 1ZW1A 1GZ4A 2GD1O 3KVOA 1UP4A 1ZVMA 4FFRA 2D0IA 1P74A 1P45A 3GOHA 3L6EA 3K31A 1PR3A 3H65A 4O63O 4CL3A 4DQUA 4AJ1A 1T2FA 4DLAA 4E6PA 4RGBA 3NDJA 4GVLA 3H9JA 1IZ9A 4TVOA 4URFA 1H5QA 3WSVA 2FR0A 1F14A 2IXBA 3VC7A 1RM3A 1MLDA 2DU8A 3DAGA 2HJSA 2VCYA 1LRJA 5HBRA 1SB9A 1HE3A 4J1QA 4BNMA 3SXPA 5JPIA 3RJ5A 3AY3A 3DHNA 1BG6A 1PL8A 2DTEA 3E9NA 3PVZA 4XB1A 3DEYX 1Y9AA 1N92A 1GCUA 2ZIZA 4J1SA 4EEXA 5L9AA 3DZFA 3QVOA 2IYPA 1PJBA 3DR3A 2IZZA 3LQFA 1K6XA 4QFCA 5DNAA 1YOVA 3TZKA 4MP8A 3UICA 3TOZA 1P31A 1VJTA 2GR9A 3ANNA 5HS4A 2HMVA 3GDGA 3GDFA 4PLFA 2RBEA 3BMNA 2W2KA 5KCZA 3RASA 4IS3A 3L0DA 2Y1OA 3I1JA 5L53A 4A03A 4BKUA 4KZPA 2BHLA 4OXYA 5F1PA 4BNUA 4WLVA 4K28A 1MX3A 1YH3A 2HDHA 2OFPA 3VAZA 3JQCA 3PHJA 1DIGA 4BNIA 2PKQP 2Y1CA 1NFQA 2O3UA 2LDXA 4YAGA 4M89A 3GHYA 4YJDA 5HS6A 4EEZA 3FWZA 3UOGA 3BMCA 1L7DA 3PXXA 3NGLA 4GL4A 4ID9A 3UCFA 1H6AA 2QX7A 3PHIA 1QG6A 3Q9UA 4IPTA 2DPHA 4RZIA 4CUKA 5A05A 1CQJA 5DOVA 1I32A 1VE9A 4HWKA 2BMAA 5BQFA 1VKOA 2PWZA 2GN9A 1BW9B 4LVUA 2PZLA 1GQQA 4RPLA 5JMPA 3Q2KA 3QWBA 4RF2A 3H8VA 4YPOA 2CSUA 5JDCA 5C5IA 3L6DA 5BSFA 4B8ZA 5KVVA 3VPXA 4R41A 2P5UA 3IAHA 1GZ3A 3L4SO 4BO6A 4O5OA 9LDBA 1XHLA 2RH4A 1GDHA 1BVRA 1NPTO 3LF2A 2W4QA 4ND1A 3LZ6A 2B83A 2ZJ1A 3IS3A 4B3HA 2J5RA 3OSUA 5JO9A 4A10A 5ITVA 4XJSA 1I8TA 1IY8A 2NV6A 1EZ4A 1PL7A 2OZPA 4WK6A 2WJPA 1TI7A 2E48A 1HDZA 1VRWA 4AJ2A 1NVGA 4QSMA 1PGQA 5EIOA 3OIDA 2V6GA 2VYVD 3KEOA 5DP1A 1E1KA 2POQX 5AXBA 3PTZA 1E5LA 1PJQA 1UP6A 3GRKA 5CPFA 4UUOA 2YFQA 1GQYA 4UEKA 3TRIA 4IXTA 3PZBA 3ST7A 5C3MA 2PKQO 4QO7A 2Y93A 3JQAB 2G17A 5KVCA 5COQA 4F6CA 2FWMX 4DL9A 2QRJA 3FF4A 4IDGA 2YHIB 4D46A 2X4GA 1MGOA 3AI1A 4GMGA 1AGNA 1SOVA 5TC4A 2PK3A 3KZVA 1BXGB 4CMKA 1A72A 1HLPA 4ALKA 5IJZA 1QYXA 1RWBA 3CTMA 4A73A 2X1HA 3D5TA 2OORA 2IDZA 4LCEA 4B3JA 3U4IA 3ADPA 3H5AA 1L7EA 1PIWA 3G79A 4WLEA 5G0SA 2O3JA 2NLOA 2DKNA 4ND2A 1SEVA 1WP4A 3V1TC 1Q1NA 1ORRA 3PQFA 3ZI0A 4R5HA 3AOEA 4N5NA 5CDGA 2GERA 5TIIA 1E3LA 1PTJA 1V8BA 1Y9EA 4FOOA 1ZXBA 2VWQA 3ZU4A 3WWYA 3F4LA 1DAPA 2WE7A 2B5WA 2OBYA 5T8KA 4M86A 3RKUA 2EJWA 4FS3A 1LJ8A 3VH4A 1A9YA 4O6VA 3BMOA 3R3SA 3DBRB 4XGKA 4JQCA 1KVUA 2GCGA 3K2EA 3R0IA 1I3MA 1XSEA 3SC6A 3ANMA 1DIAA 4B3IA 2ZYGA 3ZN2A 4D45A 4FJ2A 1CQIA 1YVEI 4DMMA 2Q45A 2HRBA 4E12A 1LSUA 2ZB7A 1ZSYA 4HADA 4IDEA 2A35A 3I6QA 3QVSA 2Q4EA 3IJPA 3O9ZA 4TKMA 2FRDA 4GSKA 2PLAA 3UUWA 3CMCO 3QY9A 4DPLA 1VL6A 4RO0A 2YDXA 3IUPA 1E7QA 2EIHA 3KB6A 2YW9A 3NUGA 3H9GA 1H2HA 1R0LA 3OA2A 3GMDA 4HFMA 8ADHA 4R68A 5G4LA 3PFWO 5B37A 3ZH2A 3RFXA 1RKXA 1I24A 2AW5A 3IIEA 1ONOA 3S2FA 1GPDG 4XQGA 4D41A 4U6SA 1Y5RA 3P5SA 1WVGA 3JQFA 4UVHA 3NT4A 4CV2A 3V1UA 3SVTA 1ENZA 2PNFA 7ADHA 4F3YA 1NNUA 3JQ8A 2Q1SA 4RPJA 2HMSA 5K6AA 3DAFA 3HE3A 4OJNA 4Q3BA 3E18A 1ZIDA 4LRTB 1GYRA 3RUIA 4I08A 1IZ0A 1ZJZA 3A9WA 2JAHA 2VNSA 4I9HA 4Z0HO 3KTDA 4KTTE 3OM9A 1YJQA 2D2IA 4XYLA 4FOSA 5ER9A 5IDWA 1R66A 3TWOA 1HDOA 2FN7A 4DLLA 3O38A 3WSWA 3DQPA 4J7XA 3GVXA 1C1XA 4IDBA 3ITKA 1WMBA 1PZFA 3I52A 3E9QA 1GU7A 1X1EA 3MZ0A 1A7KA 3O8QB 4L9RA 1HSZA 3DTYA 3MWDB 3OICA 3OA0A 1HYEA 3UVEA 1RYDA 2YFHA 3Q6IA 3RFTA 4FC6A 3ASVA 3WGTA 4GX0A 4QEDA 3JQAD 3VTZA 4DA9A 2F1KA 3K2BA 5JCXA 5T6BA 3LF1A 4IUYA 3Q3CA 3GGOA 1F8GA 3EW7A 1KEPA 2Y0DA 4E31A 4S3MA 1M75A 1K3TA 2VUUA 3UN1A 2A9FA 1IPEA 3SLKA 1GCOA 1HZZA 2HQ1A 4BNGA 3E03A 4J90A 1GQ2A 2VYVA 1Z82A 3ZWAA 3MJEA 1VL0A 1ZCJA 1W4ZA 2DFVA 1EE2A 4NJMA 4WLOA 2I3GA 1I10A 5ICMA 5LCXA 3PIIA 3EVTA 3WR5A 1HYGA 3GAZA 4CM4B 2ZYDA 4MIYA 3FTPA 1HDXA 5HM8A 2NSDA 2SCUA 1HF3A 1KEVA 5JY6A 3WGOA 1QXSA 3RC7A 2DLDA 4UUMA 3W6UA 5ADHA 3BMQA 1Z6ZA 1LTHR 4P22A 5FYDA 1B3RA 1MG5A 2YYYA 3FPLA 3BA1A 4TRJA 4K6CA 3AUAA 1NHWA 4O0LA 5JW6A 1WPQA 3VZRA 3VH1A 2PZKA 3LK7A 1GUFA 2CVZA 5A02A 2C07A 5LDGA 4NFYA 3PHLA 4BB5A 5AXCA 1EQ2A 1N9GB 4TKLA 1PGOA 1YXMA 3NKLA 4BQPA 4IIUA 5IF3A 3V1YA 1E1MA 5I9MA 2NU9A 4MVJG 4ZICA 1EDOA 3X2EA 2H63A 4A27A 2IEBA 1U4OA 4N7RA 3WFIA 1DIBA 4WASA 1GAEO 3RUFA 4R1SA 3HDJA 4BNHA 3M1LA 4KUGA 2C29D 3F9IA 3PDJA 2HAEA 1T2EA 1DXYA 3NJ4A 2DUWA 2DQ4A 2EWMA 5CEEA 1QR6A 3OH8A 3PIDA 4FFNA 4L0QA 3UF0A 1B14A 1PJCA 3FHLA 3AU9A 4D0SA 5BNIA 1GYPA 2G5CA 4O59O 2GO1A 1ISGA 1UXHA 2J3KA 3EVNA 2NACA 1RM0A 3PJEA 1BDMA 1KVRA 4JCOA 3W4KA 2OMEA 4D3FA 4ROSA 3WX0A 4ONEA 5JS6A 2BKAA 3F1LA 2VRBA 1E3WB 2C7GA 4IJVA 1LLQA 3JYQA 2E49A 5JDCC 1V3TA 3ZHZA 2W2LD 4J9VA 3W4IA 4MP6A 4UUNA 5T67A 3GLQA 1KC3A 1R4MA 1ZK0A 4H15A 3NEPX 5K0ZA 4HFRA 3FI9A 1DJQA 2GDZA 2VNAA 2OOSA 2Z1NA 3CPSA 4YJHA 3WS7A 5TRTA 4IS2A 3PHGA 4NK5A 2PZJA 4GQAA 3IKVA 1WDLA 2CVQA 3PJFA 2PD6A 1PS8A 1QP8A 4RQUA 4YXFA 1MC4A 5FI5A 1EBUA 1BW9A 4UREA 5EQDA 5EINA 3RJ9A 4ZGWA 2VZ8A 4WECA 4BNJA 1NTOA 1YDWA 3QHAA 4MO2A 1JU9A 4B4UA 2B4QA 4E13A 3GF4A 1ZXLA 3H9UA 3AK4A 4ZN6A 4BNTA 2OGUA 4UAGA 1B16A 2BD0A 1LLDA 4J1TA 2NVBA 3OEWA 1C1DA 4XQEA 3JSAA 1A71A 3UW3A 2C54A 3T7CA 5KJEA 1X7GA 4AFNA 1P33A 1EUZA 3ONFA 4YJFA 1U3WA 2TMDA 5CEJA 3GAFA 1M6WA 4XGNA 2EW2A 4A7PA 5I7EA 3LC1O 1E0DA 3F1KA 4FFPA 3NDIA 3D5QA 1QLJA 3JQAA 2FR8A 4XEHA 1D8AA 2J3JA 2YHIA 6ADHA 1YBAA 4NFHA 1HLDA 2WSBA 4Z0TA 3ICPA 3AUTA 2AA3A 2Q3EA 2JKVA 1U8FO 4UVDA 1EDZA 1JKJA 1K5HA 1F12A 1WDKA 2AQ8A 3A28A 3JD3A 4FSHA 3H6KA 4JK3A 5T8KC 1TXGA 3WGIA 1NAIA 1EUCA 4IDAA 4CR8A 4F6LA 2ZTLA 3LT1A 1KEUA 4IIVA 4HKTA 4WNCA 4R1TA 5KOIA 4ALLA 2CFCA 3D3EA 3C1TA 1PJ2A 2PGJA 4D79A 1KY4A 1A5ZA 1ZEJA 2YJZA 3AM3A 3DOOA 3L77A 3GDOA 3HB4X 3GFBA 4WNIA 2QZZA 2GZ1A 4WJZA 4YAIA 5TF4A 5KTKA 3WQQA 1M6HA 2CNBA 3LU1A 4BNXA 4EJMA 2Q2VA 1DJNA 2O3SA 3Q2IA 3NRCA 5T64A 2H6EA 2FHSA 2VOEA 1Y8RB 3AY7A 4IQ0A 4AJNA 1KOLA 5T5QA 2DBVO 4BB6A 1TLTA 3DBRA 3LLSA 3H2ZA 3Q9NA 3FCOA 5L7TA 4IXWA 3MEQA 5KIAA 4AJLA 3DDNA 3HDHA 4KQXA 1XIVA 1OC2A 2NU8A 4HXYA 3AI3A 2P4QA 3OQ1A 2PZMA 5EL0A 1HE4A 1MXHA 2OXIA 1H2BA 4MJLA 1NASA 1JLLA 5B4UA 1RJWA 1ADCA 2CVOA 2WMDA 4JNKA 2O50A 2X0RA 3LC2O 3ZU2A 3JQFC 3QVXA 4BOYA 3KYBA 1DFIA 4XZ3A 4J6FA 4KDEA 5ES3A 1RYEA 2HK9A 3WMXA 1P1KA 2JCXA 1PQPA 3M2TA 4ALNA 2WDZA 4J91A 5BNFA 1KBZA 3ABIA 2JL1A 1IB6A 2C82A 4RVDA 3B6ZA 4OXKA 2WD7A 5G2OA 2JAPA 3VOSA 4RLHA 3DHYA 3LYLA 3L07A 4BGVA 3L9XA 5A1TA 5KVSA 4DLBA 4E21A 5ICSA 4CV3A 5KWEA 3PJDA 1PWZA 2NVUA 1J0XO 2VT3A 4TRMA 3F5QA 3WYBA 2B5VA 4GVXA 1VSUA 3GMSA 4W6ZA 3AU8A 4FFOA 2EERA 1E1LA 4Q3NA 3OQ6A 3ZHXA 1OMOA 3C3XA 4R9RA 1R37A 2W90A 2C5EA 2W2LA 5IDYA 1SNYA 1UXIA 5CDYA 2ZTVA 2GN4A 1MUUA 1ZFNA 3QVTA 4LCJA 1XGKA 3O03A 2JFHA 4JJIA 2VRCA 4QTZA 1SEPA 4YEDA 2Q4BA 3LDHA 1LX6A 1P9LA 1YBVA 4NU6A 1E7YA 3ZWPA 1G6KA 3RU9A 1NPYA 4TRNA 1LDNA 3G0OA 3E8XA 5F1KA 3O8QA 4NBWA 4D43A 4ZHSA 4NR0A 3QLJA 2ZJ0A 3OETA 2I6TA 3K73O 3WDSA 1JWBB 3PFFA 4ALIA 1IHXA 3RC2A 3ITDA 3K8ZA 4KWIA 3VVCA 1NQOA 5KJ6A 3GZNA 4O1MA 3OJ0A 1W73A 3HFGA 1SMKA 2CMDA 3I9LA 1NQ5A 5T57A 4BMVA 2XF8A 4ZRMA 1AXGA 2VYNA 1PS0A 2YHUA 4OAQA 3BTOA 4INAA 1X15A 1MXFA 4BNLA 4IGFA 1BVUA 1JWAB 1ZSVA 3T4XA 4B7CA 3TL2A 1ISFA 4OGWA 1CERA 4CM9A 1H6CA 5ENVA 2WTBA 4BQRA 1KS9A 4YAJA 4R5MA 4FIZA 5CG2A 4I1IA 3VHRA 3HJAA 2B69A 2I99A 3DBLB 1WW8A 4L4RA 1A4UA 1VLLA 3G1UA 1LXCA 1K6IA 3SBOA 1BMDA 1B26A 1K6JA 1NHGA 2Y1FA 4CM4A 4Y9DA 3R1IA 1HKUA 1ZK1A 4DPKA 3TN7A 3I5MA 1U4SA 1JTVA 1Y7TA 1YRLA 1ID1A 3C85A 2O3RA 3WFJA 4K9DA 3PQDA 3C24A 4KP7A 2DUUA 3WGQA 1J5PA 1OZAA 3CEAA 3W8DA 2UDPA 1S7CA 3E6AA 4GX5A 4HX5A 1WZEA 3PGJA 4IBOA 4RPHA 2B37A 4JJFA 4NU5A 4GBJA 1N9GA 1XEAA 3HNPA 3RUCA 4BUCA 4XR4A 3QWFA 1LRKA 4N54A 1P1JA 4EI2A 1EUDA 5EJ2A 4BGEA 4Z9YA 1GUYA 3UFXA 5JAZA 3U09A 1SCUA 3DFZA 2C59A 3ZHYA 1EE9A 2D3TA 1DBVO 2QQ5A 4J7CA 4CM3A 3V2GA 1P77A 4N5LA 4OXNA 1AHIA 3ETDA 1YB5A 4XR9A 2HKIA 1E7RA 2ZTUA 4DQVA 3O4RA 3OJLA 1EVJA 1XDWA 1C0KA 4J2OA 2JD1A 5JYDA 1X7DA 3JYPA 4YJGB 1MB4A 1Q7GA 1I01A 4YT8A 5ITWA 2DC1A 2GYYA 3I9KA 5GZ3A 4OQZA 3MJSA 4CQMB 1BSVA 1O0SA 4BKPA 4DYVA 2Q99A 1YGYA 1N2SA 5A04A 3LT2A 4Q39A 2NWQA 1I36A 1DC5A 4PIVA 3UH1A 3EZYA 4E5PA 5I7VA 5L3ZA 4YRBA 1NP3A 5COBA 3DZBA 1QSGA 2EGHA 4RQTA 3ETGA 3UKOA 1UZLA 3VKUA 4CPDA 1XWFA 3KV3O 2VHXA 5FWNA 3HN7A 3MOIA 4ALJA 5L4SA 1U9JA 4JP2A 1NQTA 3U49A 4Z6KA 1LUAA 3KOUA 1QKIA 2Y0CA 4EJ0A 2Y05A 2X9VA 4HNGA 4WE3A 4MKXA 4FQ8A 2BGKA 1IPFA 2ZATA 4P4GA 5DBIA 3FR7A 2VWPA 4FPXA 3W4JA 5KKCA 2QZ9A 4NI5A 3F47A 3BIOA 3JQ7A 3HN2A 4PRLA 3RUAA 3QWIA 3T7EA 3DB2A 4GAEA 1PZEA 3FRJA 3ROPA 1FDVA 5B1YA 3EY4A 1YS4A 1ZO8A 4CM1A 1DFHA 3RQSA 4E2YA 4CMIB 4Y6RA 4WKGA 5F5NA 2P5YA 2OL4A 3GRPA 5JE8A 2Q49A 1NWCA 3FWNA 1VM6A 1E3IA 4CR6A 4Q3DA 4II3A 1SAYA 4CLRB 3UCEA 4F45A 3RU7A 2CDAA 4ILKA 3HADA 1QRRA 1XA0A 1M76A 2P91A 3D3WB 3CKYA 4L74A 2FZWA 4TMFA 3E9MA 2ILTA 3FR8A 3L4BA 1LEHA 1U2DA 2WE8A 5DCWA 1BDBA 1QYWA 2NU6A 1Q7CA 1R0KA 1Y5MA 3GNTA 4D7AA 1E92A 1R4NB 5B4VA 2EEZA 3RBZA 3U4HA 3VH2A 4M49A 1SO8A 2R00A 5JYEA 1WNTA 4IQGA 1G0NA 4E5NA 4OH1A 4FJ1A 2DBZA 1DC4A 3GQVA 2PA3A 1ZK2A 4IMRA 4MINA 5A5EA 4FD3A 2E6UX 1YB1A 2W98A 4MDHA 1I0ZA 2GNAA 4TWRA 2NQ8A 4DIOA 3MJ4A 3INRA 1VPDA 1XQ1A 5G4KB 3AM4A 3JQ9A 2IYOA 5B4TA 4I5GA 3BYZA 4GX1A 3H9QA 3BHMA 1T25A 4EBFA 4KMSA 3EDMA 3JYOA 2YDYA 4Z0PA 1RM5A 5AXAA 5MDHA 3DAPA 4BV8A 4BMNA 4J4BA 1U28A 3WQRA 4LVCA 2P9GA 1D7OA 2I76A 3PZRA 3LT4A 4TROA 1Y8RA 3U62A 1ULUA 1ZK4A 1HRDA 4UULA 3RSHA 2J3HA 3G3EA 3G49A 3GFGA 5EQFA 3U9LA 4YR9A 3BTUA 2B4RO 2DT5A 3W8FA 4PLWA 1C14A 4A2CA 4MVJF 4NBVA 3ZV4A 3JQ6A 5I7SA 4CM5A 5TJHA 1H93A 2OO5A 2QRKA 3DXFA 1ENOA 4QT0A 4XIYA 1UZMA 1WLYA 3H9EO 4LN1A 4U6QA 4YT5A 4R51A 1GD1O 2FMUA 3DZKA 4EYEA 4CQMD 4HUJA 4HFNA 5TSDA 3T4EA 2BFOA 4AJJA 5TGDA 3DHEA 4FR5A 1PSDA 1UDAA 3VPGA 3X2FA 1I2BA 4C4OA 3DZGA 2J8ZA 4ZVVA 3ADOA 4IDFA 4ZJUA 4LMPA 3EK2A 3GN2A 3AFNA 1KETA 2FZEA 2FPPA 1OOEA 2D5CA 1D4FA 4BNNA 1TEHA 3WIEA 1RM4A 2UVDA
chains in the Genus database with same CATH superfamily
3EGXA 5EYPA 2JGMA 2IZ1A 5FV7A 4DC0A 5IVDA 1EHIA 3AHIA 4Z4FA 2IIBA 4DLRA 5BOSB 1DGQA 4ZPJA 3FSEA 4A2QA 3Q3VA 1KIFA 1A97A 1OR8A 1EX6A 5JAQA 2OVFA 5CVJA 4C78A 4D25A 1OXBB 4R6XA 4YROA 5CIWA 4EPXA 1MFZA 1PT6A 4IIYA 3I2JA 1JECA 2V7UA 4Z99A 2ZSFA 3BZBA 4JJAA 3R7WB 3AEYA 4C07A 3UY4A 5FPSA 1EAMA 1W30A 3MJVA 3U0BA 2W6ZA 4ER7A 3PJRA 2MYNA 1E1DA 1XKLA 3MTDA 2RHRA 4NZZA 5E38A 1YHZA 2ODTX 2VOJA 2FMFA 5BN5B 5CX1A 1H1LA 3C3EA 3WGGA 5ARDA 4DDMA 1G64A 4QAQA 3RC9A 3V4VB 1Q74A 4ZQHA 1YR7A 4EKYA 2HSEA 4I55A 2BI7A 2CJYA 5E1DA 3FFBA 1M6VB 5ESRA 2H5EA 3HJBA 1KNXA 1T0IA 3N59A 2CMGA 5IULC 4GEGA 3STHA 1W88A 3KOMA 2O0KA 5ICFA 4J1NA 2QSYA 5FBZA 4M88A 3O1JC 5DZSA 4NOJA 5HF9A 5HMLA 4BP1A 4HGZA 1TF2A 1J9EA 1VA4A 3WQBA 5A4KA 2F1IA 4N40A 1PS9A 4RTQA 2RGUA 2WJAA 3F8WA 3R09A 5AVYA 1BVYF 2SKCA 4J4HA 5J23A 2QAGC 5FP0A 1XMIA 3BICA 1HO3A 2LCIA 3WGHA 4ARUA 2UU9B 1ADYA 2QR2A 2VXCA 2O8NA 1SUFA 3KB1A 4R9SA 5ALSA 3W9UA 2PX0A 4AIRA 4ZYUA 3OZTA 4I2NA 2JGFA 3ANSA 2NUAB 5IC6A 3A2NA 1L9XA 4DF3A 5HA5A 2X14A 4MYTA 3W6OA 3HCEA 5EKSA 4WBXC 1Y9ZA 1XLTC 4CT5A 2QVXX 3SBXA 4RMGA 5BVHB 5GGXA 1UFKA 3OE5A 2X5XA 4FZJA 4XJVA 5ALPA 2F1HA 1IB0A 1YI0A 3QX8A 3MRTA 4HGRA 5LYYA 2JHGA 4RHEA 2XQJA 4P34A 1OZHA 3AGQA 4WPGA 3HB5X 5JO0A 3JALA 1JWLA 4Y9RA 5DN9A 4BIIA 4ZVTA 4ZT3A 1ODFA 3A8TA 3FYCA 2A0WA 3ECCA 3I58A 1E1RD 4QO8A 4D92A 3RS4A 4OGLA 3LHKA 1LC3A 1BKYA 1P2FA 1Q0UA 1QV9A 1W5FA 2FPWA 2JIBA 3AV0B 4NG5A 2X42A 4NCHA 4O25A 4OA8A 1OT5A 4X7RA 2WY2D 3RHTA 1D2CA 1VIYA 3HDYA 1E2UA 3ABOB 3UMCA 3GC6A 3I01A 4QKQA 1J23A 5GMOA 1EWKA 3BXPA 3I28A 1SHUX 4JJ7A 4JJ8A 1S3SA 2Y1GA 1N8KA 1PZHA 1RABA 1TKBA 2JGIA 2ZEJA 4V3BA 5IEBA 3UQYS 1RZRD 1RKUA 4MRVA 4R7TA 3G17A 3PT9A 3MGBA 4QHSA 3DE7X 4D6YA 2X86A 3GJZA 2BBWA 4MVJH 1I4TD 4YV1A 1COZA 1Z22A 2YWBA 3R5TA 3KJIA 4QAJA 5LL6P 3PGKA 1NX6A 3C43A 4GBMA 4PPYA 5AM1A 7AT1A 4G81A 4RM2A 2PUVA 1RC0A 3JVIA 2H1RA 3C41J 3LOQA 4MQ4A 3GDHA 3M7IA 2VBIA 4I50B 4WLNA 4KFTA 4E0BA 4PGMA 4FGLA 4RTPA 3ILYA 1LNZA 2WEKA 3QGMA 2CHVA 4MLPA 2BFDB 2B4TO 2GD2A 4RDIA 3VTFA 2EAUA 2X58A 2UV8A 4HK4A 2FEWB 2AR9A 5LB4A 3BF8A 2WRZA 2X4IA 3SYRA 3LIPA 3NFRA 3ORSA 5IXJA 1WXHA 1D2NA 3S28A 4B7ZA 1RBMA 3F6CA 4I5FA 4IDDA 1ZAYA 1Z0FA 2GH1A 4E5MA 1P6UA 1SKYB 4D8UA 1ES9A 2F43B 4YRZA 2Z3WA 4GMFA 5JSKA 2X9QA 3LXXA 4EHDA 3A4VA 3NBXX 5AHRA 3LWZA 5HHTA 1BE0A 1W75A 2VNJA 3DE1X 3MTJA 2Q3BA 1TJ5A 1MTZA 1AE1A 4JI2B 3VSBA 3I53A 3WRXC 4FXOA 4GVPA 4RVFA 4P82A 1XP8A 2G4LA 1ACJA 4HXEB 4YP0A 2GEBA 4BIMA 1C30B 3MA0A 4HO1X 3ER6A 3ML1A 4V02A 3EIUA 1XX6A 5JSZB 1QLHA 1JAHA 3EISA 3PLRA 1E3JA 3HGQA 4BGDA 4KVAA 1G7RA 4ARBA 1II0A 4IIXA 4C2BA 3JVDA 3QU7A 2W5UA 2WSMA 2J9ZB 3WGUA 3DLPX 3HB7A 1Y81A 2ZJ4A 3PC8A 2FEKA 1GTL1 4KDFA 4MR7A 5CB0A 1AV7A 3RWOA 4LJSA 1UBHS 1V37A 1F0KA 4MR9A 4L4UA 3CB2A 4ZAXA 5CBPA 2F90A 1NIJA 1P4GA 1NR1A 3KZNA 1G20A 4L9AA 621PA 4W7HA 3P26A 2GLXA 4CLHA 2H4WA 4KU4A 5KAMA 2GETA 1O94C 1QIKA 3ZQUA 2O8EB 2J85A 3L9WA 3OZDA 3AIOA 4BX0A 1JLSA 2NO9A 1O03A 1P1FA 1U2DC 3PS9A 5ILOA 3T54A 3UATA 1NBOA 1WB5A 2WJJA 4CXMA 5CT8A 2I29A 2NTJA 3LUBA 2ZDQA 2FFBA 3OO1A 2PWPA 5U1PA 3P0EA 1ZN7A 2JKYA 1GU1A 1P9NA 1PV2A 3CLTD 3LD9A 5EOVA 3RLFA 3RJMA 5JCOC 4R3NA 3K1YA 5BV8A 2IYEA 1Y3FE 4J9UE 3SD7A 2P11A 4OOFA 2P68A 3JQ9C 3L0YA 3I9NA 1IEQA 2F00A 1FP4B 5EZ5A 1I13A 3OECA 4LXUA 1E2DA 4YYZA 3ES9A 3G13A 2Y1DA 4TN1A 2V59A 2I6GA 4ZAWA 2C2GA 3H5TA 3KT3A 1WDWB 2BEVB 3CF4G 3ET5A 3R6LA 2AEFA 3DA8A 3NEJA 5AW6A 2INGX 4KIJA 5I01A 2A5YB 4GXNA 2NNWB 4IJ6A 5JRDS 5KJ1A 4R8VA 4H6VA 1YQQA 2W70A 1G7TA 2WP8J 5LMCA 5HRUA 1QIFA 1HYQA 3RARA 2YS6A 3L1HA 2H16A 4G23A 1UANA 3PR2B 3EGVA 4LZZA 3C8MA 5F1OA 5KC9A 1P5JA 1ZJJA 3SZOA 2HA3A 3WFIA 5I5EA 1N6NA 4HDAA 2DHEA 5FORA 4DILA 4RD6A 1VFNA 1XVUA 3SK0A 1CF2O 2BFMA 1TYBE 1ZK3A 2G4VA 4K81B 2Q5QA 3ZWKA 3AR6A 1HFWA 2M6RA 1GRNA 2NYRA 5K51A 1ZICA 3VPFA 1PJAA 3DZDA 1UC8A 4NULA 4B9AA 4J49A 2PD3A 1ISJA 3OG9A 3EF3A 3NT5A 2VSXA 1D0VA 2FCAA 3KP1A 1HTTA 2CEKA 4YRQA 4DIDA 4S24A 3WV4A 2G1UA 4A9AA 4FMDF 4AX4A 5A5FA 1BXKA 3ESQA 2C3YA 1R0XA 2J5QA 1ZW6A 2XYHA 3JYLA 2VPQA 2XUFA 1YJ5A 1AY0A 1S4MA 3D6AA 5KMGA 8LDHA 2ZRBA 3CQ9A 4S0ZA 5EIXA 3AF0A 1IZYA 4CEHA 3DLCA 3H1EA 1CFZA 4WEOA 4ZVSA 3WLQA 4JLNA 3CVOA 1NLFA 4TLLB 1Q92A 3KUDA 4I8IA 1W93A 1JDBB 2CXUA 1VPWA 4NDAA 4II2A 3N05A 4IYJA 2I5PO 4LYEA 1BEEA 4F6RA 1FSZA 1D3AA 2BGTA 2O2CA 4QOGA 1F2VA 5E2AA 1NBME 2I62A 3SEQA 3LVFO 2HCTA 3EPJA 1G291 5IJ0B 5DHFA 1PSWA 2HPAA 4HQFA 2GDJA 2XWPA 2YBDA 4RH1A 2Z83A 2CHFA 1PF7E 3KPUA 1ZR2A 3D2LA 1A7JA 1S01A 3ABQB 1A1SA 4DCNA 2XMSA 1WP9A 1T8TA 3NNNA 4MVXA 4WN9A 5TT0A 3HXMA 2PUCA 1RPNA 1TKAA 2QOEA 3KAJA 4KNWA 3ZXSA 1UEJA 4F9FA 4YC7A 1QC5B 2OSVA 1CUJA 4PXYA 2FQWA 1BS2A 1DIRA 2FR1A 2QN7A 3ESXA 4Y2YA 5AR1A 3NHLA 3TSCA 1TUGA 3JQ8B 3DVAA 4MI1A 3ZWMA 3K32A 4EUSA 1CDZA 3CVYA 3PB3A 3HCFA 5HDQA 5J4YA 1EEHA 5A62A 3ICVA 1CU1A 4NVRA 4TX1A 3T5CA 4JC4A 1ZH2A 3QEMA 2BH9A 2WA1A 3EOAI 5CH5A 3W1EA 2ZRMA 5KUTA 4LZAA 1YS6A 2RKOA 1GG8A 1XRRA 4HTFA 3WGZA 4AMGA 4EFLA 2IFTA 3ANYB 4ENTA 4YQEA 2Q6VA 1LQTA 2VP4A 5E1OA 1R1DA 1HFJA 1N7IA 5DYIA 3EYWA 4NG4A 5FTWA 4MCJA 4DAOA 2PTHA 4V0NA 2YV2A 4C30A 1FRVA 2WOOA 5TLSA 5DNEA 3PQ4A 1UK8A 1XJQA 2B1IA 5DBGA 4EKGA 1XD9A 1Y8QA 2A0KA 2WUDA 3SG0A 1TKCA 2NXCA 2GWRA 4G0WA 2H2AA 2PZEA 4H1VA 4OU5A 1WVMA 1I4WA 1WZNA 2YN2A 1C9EA 3EXHB 3QFTA 2O2JA 2JIRA 3IR6A 2X6RA 1LKZA 5D3MA 2H4FA 4DC1A 3AR8A 4P83A 3ZW9A 2O8BA 2EGUA 2J9FA 2X3FA 2R2GA 1NFFA 2DCUA 4UM9B 3GEBA 2VJBA 3OTIA 3QU9A 4N3NA 3HFRA 2DHQA 4OJKA 1LDGA 3G02A 4JLVA 3T1VA 5LQJA 4DV7B 1X13A 2WU3A 5CPBA 1Q2UA 2Y0EA 4NBLA 3P9SA 1E3SA 5B1DA 4RF3A 1TTHA 1L4YA 1T3TA 3K2IA 4HRVA 2RCYA 4I99A 3U7RA 3C16C 2PGDA 4JBHA 3M0EA 1CJMA 3QW2A 3ZDFA 1DEXA 2DFTA 1LBSA 2MSDB 3AI2A 3ZU3A 3CVWA 4ZCSA 1V7QA 1D9XA 1E66A 3CLVA 3BSWA 1O9GA 4JGGA 5EUMA 5JNWA 9LDTA 3B6KA 4FOPA 4MV7A 2VQ3A 1NF8A 4AG3A 3F73A 1E3EA 3HL0A 3CO5A 4AM8A 4F4DA 3WNVA 2DRIA 3ETJA 1ML4A 1ULTA 3HMQA 3QKSB 4QD3A 3IBGA 2O0LA 2AG8A 1KO8A 2V6FA 2FPSA 3P4XA 3WWEA 1MRZA 2AD1A 3EHEA 1F60A 3TJRA 1EKXA 4DC9A 4DCTA 2WJ4A 2RHLA 3V2IA 1V7PC 2LPMA 2IPAB 5HRCA 5JSFA 2QTMA 3JTMA 4RULA 2JBAA 3EPHA 4R1OA 2W83A 1OWOA 2XNDA 1JDSA 3B1XA 2D1SA 3WK4A 4M9CA 1QZTA 4A4DA 4YUYA 2V7TA 3ADKA 3OX3A 3RODA 2XAAA 4IWNA 3MW8A 4RE6A 1MZPA 1E2BA 1R5OA 4C7KA 2IITA 5IZCA 4MIOA 1LRLA 3P94A 2W8BB 1M1YB 3OY7A 2WM2A 3OIUA 1IMJA 4LI0A 4AT1A 5JDIA 1C0LA 1NM5A 5MGBA 1U0BB 4QFMA 2BI4A 2IUUA 4LJRA 4UW9A 3HJNA 3FLMA 1CUHA 2HB6A 1XDSA 3FBTA 3LKBA 4FZ5A 2X1MA 4G85A 1FDIA 1YKFA 4ZTZB 2JFGA 2NO6A 3BHJA 3D8UA 3EUAA 1J5EB 4PZLA 2OK7A 1K89A 3D7NA 3HBLA 4PG7A 1C41A 1FTGA 1S3GA 5HQTA 1AKUA 2JCVA 3Q6MA 1G8YA 4X92A 4HOYA 2ZM6B 4L75A 3M3PA 2OAGA 2GN0A 2NXNA 1ZQ1A 3FY4A 3GLVA 4G2NA 4XYBA 5E95A 2I33A 1VCMA 3KU4A 5AIAA 3MGAA 3T4UA 1AU9A 2L19A 3NTXA 4Q16A 4KODA 2XUHA 3M6LA 1EP2B 5LBUA 2VP5A 4NDNE 2BZGA 5FL3A 4BYGA 2V4MA 3HKDA 4GR4A 4LXGA 5CVTA 3PV0A 3ZD9A 1GITA 1ZJ4A 5H3HA 4FYVA 3B6IA 3F3SA 3NNSA 1OBOA 2HFKA 1HG0A 3F4BA 1LNSA 1JMKC 1U1EA 1UZUA 2PZFA 3GRFA 3QX7A 5SZIA 4I8XA 3NORA 1WS6A 3WB1A 5IN5A 4BEWA 2Q3JA 3Q98A 5K3DA 4CGYA 4YRDA 4FHDA 2FG5A 2UYQA 4MWTA 1JR3A 4LF6B 1E6EA 1HLFA 4EPRA 5C18A 4BYMA 1X1DA 4MA4A 2GHTA 5CHEA 3RSOA 3R9XB 1HSOA 3SP1A 3W34A 1GTMA 4PEVA 5GOZA 1N2XA 5K0NA 2ZR8A 4PG5A 4S1VA 4HH0A 1U1IA 3G1WA 2WLTA 2WSLA 3BWDD 3NIGB 4YUAA 4QQRA 5CD9A 3N0VA 1ULZA 2WHPB 2C4HA 1DAFA 4M0DA 4EGAA 4M0KA 4RYDA 4KFUA 4NU0A 2DAPA 4BJ6A 4YT2A 5CIYA 3TINA 5DYTA 3U1BA 1KJWA 4HWRA 4CUJA 2NYAA 3FMOB 1NWHA 2JC3A 1O87A 3I83A 3JAKA 2G6TA 3HACA 4NIMA 5CTJA 3H0CA 5K8IA 5EN4A 1Z7YA 3AF5A 3N8IA 1K88A 1YVDA 2EKPA 1ZU5A 2I2XB 2XUPA 5HKLA 3QQ5A 2Q7DA 2Q5JA 1T4GA 1RZVA 4RE5A 2WD8A 2CLFB 5BQPA 4AZ0B 2GPTA 4URZR 2QY6A 5BYBA 5LC1A 1FU8A 1U9YA 2XJ4A 4ESVA 2C2XA 3OVMA 1N33B 2LIPA 2XYPA 2FWPA 4MRRA 2ANCA 3G85A 4OQ4A 1UFRA 3Q12A 4EEKA 4UQLA 3AVVA 5K6TA 5CCEA 2WF8A 1F06A 3H86A 3NHBA 5C46F 5IUNC 4G1EB 4RPKA 3NANA 5BMVF 5CP8A 3CRVA 4XSGA 3LBFA 3AJAA 5G0UA 2AOUB 4INJA 1FK8A 1VZ2A 3DMHA 2YWJA 1H3EA 1KGSA 3LO8A 3ZQ4A 1SBNE 4BNKA 1EVLA 3QUCA 2OB2A 1OGJA 1K8RA 1L5NA 4I4TB 3F90A 5ALGA 3WQHA 4BBJA 1JSCA 1ZKMA 2EDAA 1H8EA 2WFAA 4DREA 1U2TA 1BCSB 1E9FA 1UBTS 2YOHA 1SXPA 3QBEA 3QSGA 5B30A 2D1YA 2VZEA 4U2KA 5LXTF 2OA0A 2NQ2C 2RHBA 3KXPA 1T6BY 1ZOSA 3TRHA 3VC3A 3LFHA 1YA4A 3AKCA 1E6CA 5L6LB 3LLVA 2NSLA 1Q22A 1UUFA 1DC3A 1FFHA 1V16A 5B1IA 3JWHA 4BZPA 4QXMA 4DCMA 1FFWA 4TTQA 3WDKA 4KJXA 2ETXA 1DAMA 4L8WB 4Y9TA 4B3RB 3KQVA 5CX4A 2O7QA 1EFPA 3WBFA 4GZLA 4E4YA 1P19A 1WRBA 2YQ5A 3QEJA 1BRTA 1RPAA 1AF7A 2N46A 4GEKA 4Q5IA 3FTDA 4RJIA 4YPFA 3H3JA 1G2QA 1ADGA 2VG8A 4GMXA 4PNPA 2PWYA 2D5AA 2UUOA 4RS3A 1EVQA 1FEZA 4U8GA 3EEBA 5DK6A 3RVDA 1NVWQ 1N1EA 4EYSA 2CHQA 3BMXA 4P86A 2JFFA 1AKNA 5JAHA 1A27A 3HWRA 1VHWA 2MYUA 1XMQB 2X9GA 3O74A 3UHAA 4MRAA 4PRYA 1V1JA 3VYSB 4CJXA 3ZC3A 3INTA 1YD7A 3PDIB 4H16A 4XXHA 3N5KA 4Q34A 4KREA 1YQDA 3FETA 3NV9A 3F9CA 3ZWWA 3EC7A 4B74A 4A8TA 1KYWA 4YWJA 1OFTA 2H1VA 3G5MA 3RREA 3TL6A 4DUGD 3WRVA 2QIOA 1E4EB 1WE2A 2PT7A 2BHSA 2JLXA 1ZM7A 2R97A 4M7WA 4RHCA 2ZSJA 4PM4A 5B64A 4DG8A 1KAMA 1VBNA 2B92A 3HJTA 1DKUA 2QRUA 3JASB 5DHQA 3V4PB 1J2TA 2LCQA 3V46A 4D97A 2CHGA 2H8KA 1L7AA 1Y5IA 4MHTA 1G8GA 4RZ2A 1ZCBA 2NG1A 1X74A 4ZDIA 1SB8A 2F1RA 2ZRFA 3CSDA 5F3DA 3PNVA 4RNCA 1ZIOA 2R7NA 4EGFA 1Z36A 3ILSA 2GGSA 3KXDA 4E88A 2WABA 5IMBA 4LSMA 1NXTA 3DF7A 1XWIA 4XQ0A 4NHEA 5E7JA 3S4YA 1ZR4A 4JOQA 5CDTA 4DY4A 4YDRA 1YQWA 3FSJX 3IVGA 3T12A 2LTAA 1UIMA 2ZWIA 3I8SA 1OI7A 1E6WA 4YB8A 3VX3A 3DL2A 3EPRA 3I4CA 5FNZA 1J20A 3PFNA 2FW8A 1TVCA 1JSXA 2EZ4A 2VDRB 3GL9A 1L5LA 3W7BA 2MT9A 2VDQB 3PX2A 3QE3A 2Q2NA 4LK3A 5KS2A 1S9HA 3PQCA 3KAKA 1UT6A 2NO0A 2BKEA 4ZHQA 2FUCA 3HDGA 1XPJA 4EUEA 4TQGA 2GNPA 3GGPA 4DM7A 3B6JA 2Z5GA 4GRDA 1EXDA 3O2JA 3DVLA 4Y1EA 1M6NA 3MK31 3UV3A 4EA7A 1FXSA 4PFKA 1W2GA 1PLLA 1VMDA 2QV0A 1WLSA 3T35A 1KMMA 2CW5A 3DEZA 3OD1A 4UOQA 5I9TA 1AQLA 4A0QA 5JJKA 3DJFA 3PXDA 4J43A 4X1IA 3R0QA 3MCAA 4C7XA 2OWEA 2AF4C 1GRCA 1YJCA 4A0SA 3TXXA 1R9MA 1MNQA 2ZOSA 3K6SB 3LVQE 5E3JA 4NBNA 2BWJA 3C15C 5JH7A 3F6SA 4IF6A 1XTZA 2V7QA 2PGNA 1W1WA 5BSVA 1GXSB 2QVGA 2XE6A 1CW2B 1G20E 2FK7A 4WXHA 4RXUA 2WAYA 3TFOA 4H6PA 2NTNA 5K2OA 3O8DA 1JAXA 5U4XA 2H7VA 1XP5A 3KLNA 5I47A 2XNKA 1K4MA 3E22B 4FNGA 4QDXA 3N39C 3T1QA 4Y6SA 1VG0B 1GFSA 3TLJA 1B8VA 4U2DA 4TQ9A 5DSTA 1XN1A 3H5NA 2QMYA 2X22A 3TMYA 1T2CA 2I2AA 3GJ4A 2QVYX 2NUTB 1J5XA 2W2NA 3S2ZA 4ZC8A 2J6HA 4O2RA 4CQLB 4EG5A 1Q7TA 4CKWA 2VPPA 5JWHA 2VNKA 3ESCA 3RUPA 2O7VA 3C8ZA 2FG6C 4HQ6A 1ZD2P 4UVIA 2GLUA 2ZYAA 4A23A 3W90A 3VR6D 5EJGA 2EQBA 5CDUA 2UAGA 2VAWA 4Z9AA 3U80A 4JXXA 4WZBB 3CLRD 2XXAB 4K9OA 3PRKE 1N6PA 3NWPA 1CS0A 2PRSA 4Q3AA 1MF7A 4GXQA 1Z74A 2WYIA 3BBLA 2BMJA 3COVA 3GZNB 2NZXA 3N8HA 3CLTC 1X9GA 3LQYA 5AM4A 4B32A 2EHJA 3JQGB 4JENA 2F9MA 4DJTA 5A3JA 4DR1B 1SXHA 4QA9A 4C87A 4F8EA 4BWYA 1TIBA 2D5BA 4RLSA 1IG3A 1NUHA 2GBLC 3DBHA 4YCJA 5DNDA 5DGCA 1R2QA 2VHCA 3P19A 4PNZA 1THTA 4C6TA 4LF8B 4PZUA 2PZGA 4DQKA 4FIDA 2JFPA 5EHGA 2UZIR 2XQKA 4GI5A 2DPLA 3L05A 2IW3A 4MKRA 4F86A 1CFJA 3KBBA 3ZVLA 4HQNA 1SHKA 2EFYA 3H16A 1OLSA 4OU4A 3VVBA 4E5UA 1I7SB 1OPXA 2VP3A 4XSHA 1G9TA 2HYDA 3KR2A 4AJPA 1G8HA 3CUSA 4ISBA 2R9VA 4PAMA 1WM1A 2XR1A 4YAWA 1K7FB 1VLHA 2GN1A 1E2FA 3T0IA 3MAJA 1HE5A 2Y66A 4IWXA 4MVJE 5LLSA 5CB6A 4MULA 3NALA 5BR8B 1QWOA 1P4SA 3FCCA 3R0JA 2IQIA 2BFAA 2OHVA 5ALXA 2FWAA 1W35A 1WUKS 4MMXB 1NBWB 4O2BF 4QGFA 1DOHA 1OH5A 2I34A 2ZJZA 2QXYA 3GVIA 4C0WA 2FGJA 3CNOA 4Q3EA 4NCAA 5GQSA 1WHSA 3VPHA 3G2MA 1Y9JA 3NATA 2OV3A 5BV0A 3ENKA 4XDYA 3TW6A 2ZBVA 1FFXA 4XW2A 4F3RA 3QVWA 2CHEA 4GKBA 2BFWA 3DBIA 3KBOA 5FEUA 3NCTA 2CLEB 2RH8A 1FMTA 4HNTA 1QIHA 8ABPA 5AOBA 1MW8X 2WPDA 5EQTA 1KZ6A 4NMMA 5B12A 4EHJA 2HDWA 3SZMA 1YR8A 1NYTA 2QUIA 4FWBA 2X76A 2VPXA 1EGAA 4TL9A 1V6AA 2XODA 1MZVA 3UFXB 5LQDA 4LF9B 2IX9A 3M9LA 2KI5A 4BFXA 4DHWA 4Q03A 3BSFA 5AVOA 3V2UA 1RXCA 4IIDA 1XNRB 4H7FA 2ZJ8A 3AV3A 2I6QA 1GPJA 3UPDA 1BDIA 1AURA 5FTMA 1M8KA 3ZI7A 2VJMB 2H65A 1IBCA 1OLOA 3GK3A 4J2TA 4M1KA 1L8OA 3OEHD 4JLDA 1KQOA 2H07A 2C98A 2YNMC 3RRBA 1JT9A 3ISTA 3JQDA 5EFOA 1KI4A 5F3RA 1UBRS 4TVSA 3G89A 1L7OA 2KQUA 2YW2A 1QZUA 1KJ8A 1RYFA 4FYHA 4HAWA 3E8SA 4Y9SA 4NJOA 2WZCA 4YLGA 3HXTA 4B7XA 1PT9A 5DYGA 4FSDA 2ZBQA 3ENZA 1C2YA 4LW8A 4OQPA 3USZA 1VHDA 3AF4A 3CWQA 3V80A 3SQWA 2NZYA 3LV8A 2YBEA 4HRYA 5AKLA 4M9SA 3EIXA 4GPEA 3SZ3A 2YFYA 4H2DA 5AVXA 2EU8A 4NZOA 1DAKA 1U7OA 5A6SB 4MMYB 4CTNA 3ROKA 5BT8A 1DRWA 2C5HA 5BRAA 1Z25A 5J2UF 3EFBA 2FSSA 3HV0A 3M6UA 3OM1A 3D9QX 1TCCA 2VHJA 3QYFA 4IVNA 3KXKA 2EQAA 1NURA 4P92A 3S2IA 5JNSA 3V9PA 1ZEMA 3G2PA 3FYTA 5EUQB 5D6OA 2FRVA 13PKA 1TZMA 1D1TA 2V8BA 2ZB8A 3H5OA 3HZZA 3IBFA 2GHIA 3QM1A 1HDCA 4ZJZA 4YMWA 4ZOQI 3PNKA 3G9ZA 4GOKA 3KELA 4QUIA 2I3BA 1MVLA 2PD4A 2AMFA 2QYSA 1FP1D 3GPDG 2H06A 1Q7BA 2G09A 3L7MA 221PA 2B61A 1SCDA 4H31A 2NSJA 4M1WA 5TPZD 5HX7A 4I5IA 2ZSEA 2WAMA 2RGNA 3COWA 3KB8A 4BASA 2EWWA 3F2VA 4CM6A 2GJSA 3EEQA 2P30A 3OCWA 4PGFA 4TLBA 1FNSA 4KRGA 4K26A 2PWAA 4QODA 3PL5A 1Y3BE 1J2RA 5ER6A 1X7ZB 2AEMA 2WUWE 2WWGA 1KVTA 3F67A 1NI3A 1ZL2A 1JDJA 5LPNA 4OKNA 2BEWA 2UYYA 5J43A 2WJ6A 2RG7A 3A1FA 4L2IB 5D01A 4BHTA 2VYND 1SCIA 3A1NA 3HWX1 3IELA 1ZMXA 1LZLA 2QPTA 4JQYA 2O07A 4KUEA 4R2JA 1LGYA 1XF1A 4OUKX 4RF4A 2YVQA 4WXEA 3N8KA 2ZQZA 1UF9A 4PZ9A 2JD0A 4WDQA 4PTYA 3E7DA 1JHYA 2JCYA 2Z2XA 4XD7D 1BOFA 1X1QA 2FEOA 3DB1A 3IOMA 4Q00A 3A05A 4PYKA 4CM9D 1D2GA 2CVHA 2HBRA 4H35A 5C8YA 2P3OA 3FN4A 5DHTA 4LGVA 1RWVA 2R84A 3BXGA 1D1PA 1DDOA 5DGTA 4BNYA 2JI8A 3IMFA 1K5PA 2I1VB 4JMLA 4URXR 1DTSA 2RC6A 5F9HA 4YIKA 5IN4A 1MPXA 4I3FA 4ZOLB 2HBZA 3AOEC 3HCBA 4NEHB 2FPGA 1HDRA 1NW8A 3GWGA 2O2IA 3JQBC 3OLQA 4FDTA 4WAUA 2J48A 1WMAA 3O8BA 2X7HA 4FDUA 3DO5A 3QVLA 5EPEA 6GPBA 1JFRA 1QVVA 5KJFA 1A8QA 4KSCA 1CY6A 1HGXA 2ZS8A 2X0NA 2G8LA 1SC6A 2XMPA 1DT3A 3JQEA 3ZV3A 3ZX4A 5JCZA 2UYHA 3KZMA 5AK5A 2AF3C 1W4AA 2OC9A 2BFPA 2BGLA 4QQKA 4QYSA 5DCYA 1JV2B 2O2EA 4E7OA 1UXOA 3KO8A 4XYMA 1OJLA 2PZAA 3AR7A 1FQOA 4CODB 1VDZA 4JOSA 3HGTA 3BDVA 5FA6A 3H04A 3L1JA 3HLYA 4A5OA 1QMGA 3FBGA 4BE9A 4B7UA 1EWQA 1CWUA 1SG9A 2OFOA 4LC1A 4YRNA 2X2OA 5E7IA 2YV1A 4RVHA 1OAKA 1CY4A 2XMGA 2KX7A 4GLBA 5KTSA 4DCPA 4MRNA 4YMSA 5HGXA 4DIMA 4D26A 2P9BA 2ES4A 4QFBA 3AT1A 3L3BA 4RHTA 3PTLA 3WYAA 4G89A 2ECQA 3KXIA 1KR2A 4WEQA 1WJGA 2FMXA 2IYWA 4OXXA 3Q7IA 3MCTA 5F76A 1QFYA 2H1IA 2H1HA 3BB3A 1J56A 1DMRA 1WUJS 3B6MA 1C3JA 2EP7A 2RAFA 1DTEA 5HKAA 5LKRA 1UJNA 2ZWOA 1X42A 4C3ZA 5BMOA 1YS7A 4O3FA 1JR3E 4ZI7B 5I4BA 4QOJA 3ABSB 3K9LA 2WKSA 3ND9A 1IWPB 3IPXA 3W5DA 2CGEA 5FCDA 3PNBA 4IMJB 1VKNA 1Q21A 3LL4A 1UJ6A 3PGVA 5FBHA 2VSNA 3K5WA 4LDQA 3MT0A 3RCBA 1IQ0A 3MB5A 4OHCA 3KPWA 5J2TB 4P4NA 1M34B 3BRCA 4V0SA 2GNOA 1IDN1 3O3NB 3P7MA 4AG6A 1H2AS 3R8FA 4LY6A 1VXOA 2CVPA 3L06A 1WB4A 1ZH8A 3GAAA 5EGNA 4ZAVA 3RHSA 3N3AC 4BNZA 4WBNA 1T2NA 1U3TA 4KSBA 3QG1A 5JD6A 3KVYA 3OIYA 3CEJA 2UUPA 1AA9A 1M5UA 1W96A 4KXFB 3WNDA 4F72A 4E6EA 5HVNA 2ATIA 2P2CA 3MXTA 1ELOA 1KR5A 4HDCA 1TX4B 4BO1A 1IUPA 1UJCA 4LV5B 5L40A 3FOCA 3PWKA 4XWOA 1IIRA 1DXQA 4WOBA 5JLJA 3QOXA 4IKOA 4R4JA 1KORA 1PUJA 1ID8A 4XJXA 4O4IF 5EWLB 1SBYA 4KH1A 1IYZA 1AK9A 3UA3A 3ZGVA 4YNBA 4O4HB 1AUXA 3WGJA 3V7YA 1XCBA 4BZXA 4D9CA 4RFLA 4XVCA 4DSNA 5C80A 5JISA 3OJEA 4QDOA 3A9SA 1Z4QA 1Z6AA 4I1YA 4IOLA 1I5OA 1M1ZA 1Z75A 5HZHA 4MW2A 3IEVA 5FL7D 3KDAA 2Q41A 1UAAA 1RBYA 1XTRA 3E9EA 5F2NA 2GK3A 5LYJA 1AGRA 3ZDAA 1RZUA 2BGRA 1C1XB 3TD9A 3BXXA 2VUTA 4B6EA 4CF6A 4F3KA 1KOFA 1PZXA 2IXFA 1MOPA 1O08A 2JAOA 3M1YA 1QDEA 2ZIVB 3ZLVA 1TA9A 2RHWA 2X5OA 4WCVA 3E7XA 2JANA 2WWTA 2Z4SA 4RY2A 1Y4SA 2P9JA 4HNHA 2DJ5A 4M87A 1GEEA 1TZBA 2OXCA 1QO7A 4OG2A 1MO2A 1Y7IA 2DOKA 2Y1EA 2VUSA 5FR1A 5CFPA 1Q15A 3COJA 2QJOA 4HMQA 1B8UA 2EJVA 3CLUD 1DKNA 3SHVA 1W34A 3ESYA 3IP8A 2HREA 2HWWA 3RSQA 4CG2A 1R88A 5CFMA 1IVSA 1WZIA 2Z9BA 1ZN9A 3RD5A 3LVRE 4C04A 2ZUTA 3NVMB 2RMKA 5DM1A 3FDZA 3FVRA 4KR6A 2Y2VA 2QL5A 2YV5A 2Z04A 4M1SA 4JKYA 4YP6A 3TRFA 1WKVA 3JZAA 1X19A 1ISPA 5CLLA 3DZHA 1W36D 4FZVA 3N07A 4G5GA 4F96A 2A9RA 4DDWA 3ZJVA 2J3EA 1U8UA 1GL6A 1T4BA 4OOEA 4WCFC 5DEIA 2XCOA 1DAGA 2AL7A 1XAGA 1IXRC 4DZTA 2DM6A 4M0LA 4DNOA 1GT6A 1A8SA 1UFQA 3C6ZA 3BD9A 3KYCA 5CNKA 2GZRA 1U7TA 4BRSA 4EIWA 2BLNA 4TXJA 4BO7A 2I4RA 2YWCA 4BLOA 4HYEA 4FFMA 2MSEB 3ZZUA 2EZ8A 4RK1A 2YZKA 2B7CA 5A3VA 3ZWNA 2A78A 3FRHA 3GU3A 4G1BA 4XIJA 5TXGA 3UOWA 2AK3A 1QHFA 1GZ4A 2HIHA 2O48X 3I09A 2MSLA 3L49A 4MRPA 1ZVMA 4FFRA 3W77A 4ZYYA 3TAUA 3CF4A 1ZI9A 3GOHA 1V9CA 2E4VA 3QVMA 5EQJB 3SYNA 1WEHA 4A36A 3DOIA 5FPPA 3H7IA 4HWOA 2C58A 1JTEA 4O63O 1K3FA 1NZDA 1XQXA 1T2VA 1KY3A 1CS4C 1JR6A 1T2FA 2P9FA 3ETHA 3UJ8A 3OTQA 4TMVA 4XIIA 2VNIA 4FX5A 3U7QA 3VC7A 2AKEA 2W2MA 3U37A 1HG1A 3REQA 3PUKA 1NMXA 1FFSA 1LRJA 3PKZA 4FW9A 4JH0A 1P2DA 4LFCB 1NKSA 4AY4A 4K87A 1E96A 1F38A 5EMNA 1APBA 5J47A 3E1GA 1VIDA 4L9WA 2AN9A 1RJDA 2F2TA 2QPAA 2QZSA 1BG6A 3OQVA 2F4NA 3LQKA 1YBHA 3E9NA 1TZJA 1KOGA 1Z07A 3AYZB 4U7FA 1N92A 1S8OA 2FA9A 2W6CX 3BD6A 1QRAA 2FPXA 4YJ3B 4ZZ1A 3BG5A 4QNRA 2ASEA 4AXBA 1QVAA 2IZZA 1PT8A 3HDTA 4QFCA 3ZE2B 3TZKA 3ZLUA 5LWQA 4MP8A 1RIIA 1ZM2A 2UYCA 1VJTA 2RGCA 1RD4A 1EFRA 2BFDA 3ONWA 4RLQA 1PG0A 1HEIA 2HMVA 4LPKA 2RBEA 1QQTA 3O7MA 1W9HA 1VJ5A 1MD9A 3L0DA 3FF1A 2JASA 1N0IA 4KZPA 1T5SA 2C0PA 2GX6A 3EC1A 4MV1A 4D4IA 1WCV1 1T36B 1XTPA 2PLWA 4HB4A 4OXYA 5CYFA 4XOUA 4BFWA 3BRWD 2NT3A 3OIWA 4M36A 1E5DA 4OBEA 2F43A 4N39A 1VHTA 3A58B 1GKYA 2PKQP 4YAGA 2IEGA 3SZUA 4JBLA 1A96A 2F8MA 4EEZA 4MPJA 1WV1A 5A7GA 3KTOA 1O6BA 1L7DA 2CCJA 4ZANA 3RRNA 1YZFA 1J2UA 1NBEA 4JHLA 5I48A 3NH6A 3H83A 1QG6A 1YCHA 1C30A 2HF9A 1PQ4A 3TW0A 1FFAA 1K8XB 1M5RA 3ANTA 1SVOA 1I32A 2FZ5A 3IMGA 4KPUB 4QJ4A 4D9IA 4DWWA 1GTG1 5EXSA 1P6XA 2PWZA 2GN9A 2P41A 5GADl 5LWHA 4AROA 1S1CA 5FOWA 2C5FA 4L5JA 3H8VA 5JDCA 2CSUA 5C5IA 2NPIA 1WW2A 1BJRE 3IOBA 3IQZA 1RPZA 2JFBA 4HLUA 2DKOA 4ZMSA 3W5HA 1JNYA 4JWKA 1A9TA 1ZP6A 2P5UA 4WNYA 3A4IA 3L4SO 4O5OA 1T6YA 3TIFA 4XLLA 1NYRA 1XHLA 1COWD 2HM7A 2PMBA 2ZIXA 1GDHA 1NPTO 1F48A 2C2MA 2VDKB 3JXEA 3MCWA 4MWGA 4X45A 5LBIA 1CY7A 3IO3A 2W4QA 4PSAA 3LZ6A 5IYZB 2AVNA 3I6BA 4ZQIA 4WZAB 1UC9A 3PRHA 1KFCB 4A10A 3O2SB 1FNDA 4M2LA 1EZ4A 1X7XB 4GXRA 4Z5XA 4G0QA 4EW2A 1TM3E 1ZRNA 2OV8A 3MWYW 1TI7A 421PA 3CLRC 4F5YA 4M37A 1FTYA 1ZHHA 2MSNA 3KEOA 5DP1A 2LGJA 4BECA 1HMPA 1VIMA 3AI7A 3GCZA 4B87A 1LI7A 2ZT6A 3SF8B 1YC2A 3MJDA 4R2MA 5D00A 5EVCA 5ICCA 5KSOA 4ND8A 4L5IA 3V1NA 5AICA 3ST7A 1KTVA 3U3JA 4KXWA 2PKQO 1JXMA 4QO7A 3V32A 2G17A 2QX6A 3NTVA 2IYAA 2WJYA 4UNPA 4D46A 6AT1A 5HRAA 1MGOA 1GL9B 1AGNA 1SOVA 3H8WA 5TC4A 2ZS7A 3UHJA 4WESB 2PK3A 1BXGB 2FPUA 2OHOA 2AEEA 1A72A 3CLHA 4CMKA 1KJ9A 1WQ1R 3I2FA 2YJNA 1JKJB 3RJTA 3Q6NA 2QBYB 2B8JA 2ID8A 4LJYA 3TVTA 4UATA 1UBEA 5E3IA 4V1CI 4RKFA 1XAIA 4AF7A 2OORA 3DNPA 1M3SA 5JEDA 1AMOA 1KAHA 2FZ4A 4Z7NB 3KJGA 4B3JA 4F9GA 2QMUA 4OLHA 3ADPA 1V2HE 1L7EA 3WKDA 3UJ7A 1GZSA 1N1DA 2R8YA 1WU8A 2O3JA 2YV4A 1RYHA 2NLOA 3FIUA 4KC0A 1A9XB 2XA9A 2DKNA 4ND2A 3W5CA 3REOA 3V1TC 2GAOA 5EIBD 4US2R 4LSGA 4HXFB 2C7RA 2H59A 4F2GA 4C6HA 3BERA 2RAPA 3VC2A 1E79A 4Y6LA 2CNDA 1OV4A 5GJVC 4R2IA 1SCBA 3HA5A 1KJNA 1KIMA 2JLUA 1PDOA 4EFKA 1ZXBA 3VYVA 4E1BA 3F4LA 2J87A 5KOJB 3JWGA 1VSBA 4IHJB 5T8KA 1OPRA 4UOEA 4M86A 2EJWA 3P2KA 1LJ8A 1QVZA 5EXXA 1W4BA 3BGSA 3HVRA 2WTXA 4JQCA 4QNMA 3KOWA 1D09A 1QHHB 4D98A 1BFKA 3R0IA 1T8PA 1I3MA 1DWPA 5AM0A 3LOUA 3SC6A 5LBTA 1RWOA 1GJRA 1P0MA 3A4LA 3TLZA 3AESB 1PWYE 5CT9A 3CLKA 4BFV<