4R68A

Lactate dehydrogenase in complex with inhibitor compound 31
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r68A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r68A02
1PZEA 3B1FA 2FY8A 3K96A 5A9RA 5LDHA 1DJNA 3ZWCA 3UF0A 4YRBA 2B4RO 4DC1A 1HE4A 3DAPA 4XIYA 2UUOA 4IDAA 1NBOA 1YDWA 3ZWBA 3SEFA 1RWBA 3UN1A 1DB3A 1VJTA 2DTXA 3PYMA 2BFOA 2EXXA 3RQSA 2DLDA 4E12A 4I1IA 1DHRA 4TROA 4UEKA 3WFIA 1PR3A 2J8ZA 4D44A 1MC5A 2JKVA 4BNLA 4FC7A 4CMKA 1Y6JA 1H6CA 4OIMA 3N58A 4ZHSA 1ENPA 2D1YA 3MTJA 4R1UA 4UEOA 5IDQA 5TIIA 1Y8QA 2HRBA 5KKCA 1DIRA 2ZCUA 1OOEA 3MTGA 4Q9NA 5ICMA 1WVGA 2E48A 2AEMA 1ZSYA 5H82A 3HUDA 3BHMA 3WICA 1CRWG 1SCUA 4EUHA 1C0PA 4E32A 1QG6A 1ZUD1 5B4VA 2PGDA 4FOSA 1I24A 1LQUA 4ZVVA 1CYDA 3FF4A 2FHSA 3Q11A 1XKQA 4LRSB 1F12A 2DBZA 4IJVA 4JP3A 4QUKA 3GC6A 2GN4A 3GNSA 4HBGA 3A1NA 2EGGA 5EQDA 5JCJA 4XQGA 3RSHA 1BXGB 3ANNA 4DLAA 1K6XA 3OHSX 4J9UE 5I9NA 1ISFA 4DPMA 1E77A 3QWFA 2HO5A 2VUUA 2B69A 3C1TA 4ND4A 5ES3A 3JD3A 4C4OA 5JMWA 1GUZA 1HE5A 4W6ZA 1XU9A 3ONDA 4N5MA 3BZUA 1ZMTA 3PJEA 4RF3A 1IZ0A 1T1RA 2H63A 5C7LO 2NQ8A 1MP0A 3PDUA 3F47A 5CAEA 4DUPA 4A10A 3C1AA 1YBAA 1ONPA 5HS4A 4AG3A 1PJ4A 2PV7A 2I67A 1YXMA 2DUUA 2AG8A 3LT2A 3ABIA 4IS2A 3OIGA 3GVPA 2JFHA 1VM6A 3HADA 4D45A 1OFGA 1X15A 2HCTA 2J5KA 3ANMA 3LLVA 5TT1A 4CLHA 9LDBA 3RC9A 1XYGA 3D3EA 2VQ3A 1P0CA 1IL0A 3D7LA 4GH5A 2GASA 1DIHA 3ZN2A 4Y6RA 5L4NA 4F6CA 2V6FA 4RVDA 2P68A 3FR8A 3G49A 3U0BA 2CY0A 4KUGA 3OETA 3GN2A 4WCFA 2HSDA 2FPPA 3Q3CA 4J1SA 4YDRA 1NWCA 4MKRA 4EBFA 5U9CA 1ULSA 1ULUA 2XPCA 1EQ2A 3VH1A 1QXSA 1LDEA 4K1LA 4RJTA 2P9CA 5CDUA 4CM6A 3BMOA 3AW9A 3VAZA 5B1YA 2PTGA 7ADHA 4RVFA 2JD0A 1YQGA 5DNAA 2G76A 4WECA 3TFQA 4CM8A 2CVQA 2J6IA 5KJ6A 3CZMA 3ZDFA 1Z73A 5HBRA 1HYHA 3WGOA 4HNHA 1MUUA 1I32A 1A27A 1QMGA 3OA0A 4XR9A 4YAGA 1JKFA 1PL8A 1JVBA 5KTKA 4I9UA 3UVEA 1VRWA 3FWNA 4HUJA 4DVJA 4CR8A 1QLHA 4HNGA 4P38A 3X2EA 1TB4A 1IHYA 1F06A 3V1YA 1DAPA 2DTEA 4LSWA 3VPFA 1E3IA 4NR0A 5AYVA 1U2DA 3GNQA 1QLJA 4XX0A 3WMXA 3VPSA 3INTA 4PLZA 1TI7A 4GWKA 1DLIA 3BMQA 5TX7A 3GRPA 1DJQA 4CM3A 5DBGA 4BMVA 3ZHXA 1T4BA 2POQX 2ZB8A 4J90A 4Y98A 4LVCA 1ZSVA 3WJAA 1M66A 3KUXA 5I9MA 4BGUA 3HWRA 2P91A 4MVJD 4CPDA 5JFOA 1EBUA 3ZWAA 2WD7B 4XA8A 5JO9A 4H15A 4K28A 4MJLA 2IDZA 3BHJA 1Y5MA 4IMRA 4ZQEA 3VKUA 1ZK2A 4WCDA 4CM4A 3IKTA 5DT9A 1LDGA 5H81A 2E82A 3EC7A 1SBYA 3PJDA 4S3MA 1UP4A 4IINA 4RZHA 1B3BA 4OGWA 3BIOA 4Q3DA 2DAPA 3WQRA 1RKXA 2PY6A 4U6SA 3G3EA 4O1MA 1YH3A 4WCFB 4YA6A 2ET6A 4CLXA 4AJPA 4OQZA 4B7CA 5CEFA 1I0ZA 2Q46A 4HFNA 3VDRA 4FFRA 2FOIA 4JROA 2GUGA 4UAGA 3BMOB 1B8UA 4ND2A 4K9DA 4WKGA 2PK3A 3G0OA 5T8KA 1KEVA 2YV2A 2I66A 3OEYA 3INGA 3ZHBA 4OSPA 2X9GA 4FJ0A 4WE3A 4UUOA 1DIAA 4URFA 5BNTA 2A94A 1GV0A 5LDGA 3E18A 2ZQZA 3I4FA 4R01A 5FF9A 4D3SA 4UUNA 1HF3A 3AY6A 3K30A 4E6PA 3HDYA 4AVYA 1LRLA 2VZ8A 2PH3A 3E5MA 4BV8A 2E49A 3LC2O 4HXYA 4BUCA 2ZYGA 2ZJ0A 1IPFA 2EEZA 1K3TA 3GN1A 2Q1TA 3JQFA 4WCFC 1U5CA 1YVEI 3TF5A 3PK0A 4DMMA 3RUIA 4FB5A 1BVUA 1GCOA 3BMQB 3CXRA 3GHYA 1EUZA 2Y05A 4L8VA 4ZQGA 1NR1A 5IN5A 4PG6A 4CLDA 4JJGA 1KVTA 1UH5A 4D43A 3U4IA 3GK3A 3MJCA 4KZPA 1NQAO 2CFCA 3ROKA 3ORFA 4BNJA 1OI7A 5BSFA 3WBBA 4FJ1A 4PVDA 1T25A 4FGWA 4JCOA 2VCYA 1U5AA 3VH4A 1VJ0A 3LQFA 2Y93A 1S7CA 3PWKA 4LK3A 3GF4A 1EK6A 4BNIA 1W73A 3EVNA 3GFBA 3JYOA 4WPGA 2D5CA 4Q3CA 1B8PA 1V3TA 3OM9A 3WGQA 3ZCXA 4AL4A 4N54A 4A7PA 2Y68A 2CMDA 3I6QA 4XDYA 4UUPA 4BKUA 1FDSA 1WXDA 1IPEA 4E21A 1ISGA 3QLJA 4E5MA 1ADGA 2CDAA 3ENKA 1T2AA 3I9KA 4ND1A 5DOZA 4B3JA 1SZJG 3P2OA 3E48A 2O3UA 2UV8A 3VVCA 3HG7A 2H5LA 2BGLA 1NPYA 4IDCA 3HQ4O 1N2SA 1U28A 4FR5A 1RPNA 4IDGA 4MIEA 3AOGA 3KSDO 3ONFA 1IB6A 3ZWPA 1KIFA 1ZK4A 4XDZA 1ZO8A 2Q2WA 4NNJA 5DBIA 3GT0A 3KLPX 4IBOA 3LSYA 1YDEA 1VPDA 3VDQA 5A3JA 1E5LA 1F14A 3Q9UA 3LDHA 1ENYA 4RPHA 3ZNPA 4QFCA 4ZN6A 1Y1PA 1UXIA 1XCBA 4ILKA 4IJUA 4BO3A 1YS4A 3DZBA 1KEWA 3G1TA 3E9QA 2HK7A 3DTYA 4DQXA 1GADO 3K9QO 3NTOA 5C37A 5DF1A 4Z3DA 1YBMA 1C3VA 2JL1A 2PWZA 2ZTLA 4XRRA 3IOYA 2VWQA 4CMCA 1E1NA 1N5DA 4CQLA 2BHLA 1IULA 1GFSA 4QSMA 1FDVA 1R4NA 4B79A 4OOFA 4UUMA 4FFMA 1GEEA 5T8KC 3MWEB 1LU9A 2Y1OA 1BDBA 4XQEA 2BFAA 2C5AA 1HRDA 2D8AA 1GUYA 2GYYA 3BAZA 3TOXA 1HE2A 1KY5A 4ID9A 2EWMA 4UVEA 3TL2A 4DYDA 1H9AA 1QYVA 4L73A 4A5OA 2E4AA 1C0LA 4HFMA 4JJFA 4BKRA 2O3JA 1H9BA 2UAGA 3O38A 1NFQA 3U3XA 4TMFA 1H2BA 5L9AA 3CE6A 3R1IA 2PFGA 4J9VA 2GO1A 5BR7A 3QV1A 4FQ8A 2X23A 2YYYA 5G0UA 4TZKA 1HDCA 3DZKA 4FBGA 1B26A 1R12A 3JQFC 2OHXA 4UVDA 4NFSA 3VTFA 2I6TA 3BTUA 4GMGA 4YPOA 2Q4BA 1M6HA 2OFPA 2NV6A 3DAFA 3ZWYA 2B83A 4XGKA 4AJHA 1K5HA 5JCXA 2GSDA 1C1DA 3MJSA 2ZB4A 4YJHB 2GRAA 1JU9A 5ER6A 5L4SA 3S2FA 4K26A 3QIVA 2ZYAA 1OAAA 1A9ZA 2AE2A 4BGIA 2O3TA 1H6AA 3OSUA 4JXKA 5FFFA 1D3AA 1E6UA 2EJVA 1SC6A 3ZHZA 2XOXA 3H7AA 1ISHA 3AK4A 2O50A 1Z82A 2UVDA 3ZNOA 1H6BA 3UOGA 3HHPA 3QWAA 3PHGA 1UJMA 1NVGA 3R3JA 4TWRA 3WLEA 3I1JA 2OXIA 5FYDA 4CQLB 5COAA 3QE3A 3PIDA 1YQXA 2Y0DA 2ZTUA 5IAAA 3VZPA 4BOYA 2Y99A 1JW9B 4XYEA 4WOJA 3WBFA 4XYGA 1X1EA 3CUKA 1JQBA 1BDMA 2RCYA 2YHIA 4BGEA 1KYQA 4IPTA 4XCVA 4B8ZA 1IHXA 5G0WA 3W4IA 4BNGA 4DLLA 4XEHA 1DXYA 6ADHA 4FOOA 5J23A 4R1TA 5IDWA 2IZ0A 1T2EA 2V6GA 4NMHA 2Y66A 2GF2A 3ZNNA 5I9LA 2OOSA 1HYGA 1ZK3A 3K2BA 2WTBA 3AM4A 3PHLA 5L40A 4H3VA 1P1RA 2VHVA 1I2BA 3UFXA 3I83A 3AI3A 2X6TA 2A35A 4ZU3A 1AN9A 4ALIA 5GZ1A 1I36A 3ZGYA 3DZGA 4XKJA 2IYPA 2JFGA 1QV6A 4XQ9A 4ZQBA 5DDIP 3AFNA 3JQCA 3GR6A 4BNNA 1VKNA 2EP5A 2NVUA 4C7JA 3HB5X 4TSKA 1EVIA 1C1DB 2NVWA 3JQBA 5DBFA 1D1TA 5TSDA 4WLEA 2XXJA 4BO1A 5ILGA 4HP8A 4RF2A 2O4UX 3NJ8A 3WSWA 1P3DA 1V3VA 2JCYA 2FZWA 1FDUA 1X1TA 2IEDA 4FFLA 1BXKA 4E30A 3HNPA 3QHAA 4JQCA 1XR3A 2NU8A 1WPQA 4ONEA 2NTJA 4I5EA 5A02A 4YYZA 3WGZA 1BWSA 2DC1A 2CVOA 1I3MA 2J5RA 1C1XA 5I8WA 3FNGA 4DQUA 3TDKA 1DLJA 1E1LA 4XIJA 1QKIA 3RFVA 3KO8A 3NTQA 1HT0A 5MGBA 2QHXA 2W2KA 1NQ5A 3OQ1A 3QWIA 6LDHA 4DPLA 4PG4A 2VWHA 2YV3A 1ISJA 4ALNA 4BNXA 5BNFA 2AHRA 4CUKA 4W99A 5HRUA 4FCCA 4GL4A 3DZIA 2VN8A 2BGMA 4J6FA 3JQAA 5JE8A 3DC2A 1MG5A 1ZW1A 3PGXA 3HN2A 5JAZA 1NR7A 5KJEA 4XRGA 2EW8A 2V6BA 2P2SA 2RH8A 5T67A 5G0VA 1E92A 5EL0A 2O2YA 3KXDA 3WGHA 3T4EA 2QRLA 1PIWA 4I5DA 3PLNA 2JJYA 5L53A 3P19A 3RC2A 4YQZA 3BXXA 3PHIA 1Y8RA 2HU2A 4IGFA 4CM7A 3EW7A 4FPXA 4KP7A 1KY4A 3WYCA 3ENNA 3RBXA 5JDCA 1U1IA 4IGEA 4LW8A 2WDZA 3L6EA 2HDHA 3DBVO 4LRTB 1P1KA 3TJRA 2NVUB 2NQTA 4CUZA 1EVYA 1ZK0A 4Z9FA 1BHSA 1O9BA 3WQQA 2X8LA 3ST7A 2X5OA 4NHEA 3WWZA 4WGGA 2CD9A 4YRDA 5JDIA 3Q6IA 1RM3A 1E7RA 2NTVA 3AUTA 4YQYA 3ADPA 3NDRA 5EESA 5EPOA 3PVZA 4E0BA 1V35A 1AUPA 4IDDA 3CTMA 1Q7GA 2E6UX 4E2XA 3SBOA 3KSZO 1K2WA 4DC0A 4QEDA 1MC4A 4LCEA 2WWRA 4C7KA 3KVOA 5AVOA 3QVSA 4LGVA 2BFPA 2J5QA 3IJRA 4R4JA 4CLRB 4J7CA 1PGPA 5ITWA 3EUWA 3MJTA 3HDHA 1TLTA 1PJCA 3ZH2A 5F21A 2DPHA 1DC6A 5DCUA 1GU7A 4KDFA 4DPKA 1PZHA 2WYVA 4BO6A 1KS9A 1R0LA 3QVTA 4RGBA 4XB2A 2EP7A 2PD3A 4RDHA 3TSCA 2P4QA 5TQVA 3QVXA 1FMCA 1GCUA 1WAMA 3K8ZA 1A71A 3JQBC 4R5HA 4IY1A 1V3UA 3JQAB 4DWVA 3DBHA 3F6YA 4GBJA 3MEQA 1B8VA 1Z7EA 3FNEA 1OBFO 1P33A 4W7IA 3PYXA 4MO2A 4GMFA 4M49A 1NHWA 5KIAA 4ALJA 4M86A 2IZ1A 1GPJA 1FXSA 1HTBA 1UR5A 1LDYA 1ZVMA 1Z45A 2IYOA 1WP4A 3WYEA 1ID1A 3ZU5A 5CPFA 4Q3AA 2ZATA 4PRLA 3TWOA 1WZIA 1Y8RB 2GLXA 4E5NA 3KOUA 4YWJA 4FFOA 3H5RA 5TT0A 4R5MA 2VHYA 3JQ9A 3OA2A 4TKMA 1NAHA 2C0CA 1UXGA 3IUSA 3VKVA 3DONA 5IFLA 4JJIA 1B3RA 4PRKA 1U3TA 3AU8A 3DBLA 5JAIA 2CUKA 1KERA 4TVOA 4XYMA 4NJMB 2NU9A 1LC3A 1Z74A 3WJ7A 4ND3A 3H9EO 2F1KA 3SLKA 2UUPA 5BSGA 1UZLA 4UULA 5DN9A 3TZHA 2I76A 1E1MA 4WLFA 5KVQA 3ANLA 2V6MA 1NQOA 3VVBA 2PD4A 2RBEA 2B0JA 4RPKA 4QO8A 4B8WA 4ND5A 2GZ2A 4TZTA 1D7OA 2IXAA 4TQGA 1HL3A 1XEAA 2HMUA 2VNAA 1C14A 4XGNA 1K89A 3V1UA 2NUAA 2OGUA 4N5NA 3V8BA 1LSUA 4PLFA 5A4DA 1E1KA 1NAIA 1RM4A 4WLVA 4IXTA 3FCOA 4O0LA 4R69A 1XQ6A 3ZHYA 4YT5A 3W6ZA 5JDCC 4CV2A 2BD0A 3JSAA 2OORA 3ZWXA 5KJCA 4PG7A 1LBEA 3DOOA 4I9HA 3LT0A 4NK5A 1HDYA 2AG5A 3STHA 4XQCA 1IYZA 3DBHB 1QRRA 5JAMA 3FPLA 1SOVA 3CIFA 5JDIC 2R6JA 4H7PA 3RBVA 4GX1A 1LEHA 2D59A 3DB2A 4M54A 1GV1A 3LK7A 5A04A 3QJ5A 3F5QA 1YB4A 2OBYA 2GNAA 2OL4A 4IQ8A 3GGGA 4WLUA 1A72A 4OM8A 3K92A 2OO5A 3L0DA 1LNQA 4F6LA 4YT4A 1VL8A 3W6UA 3RFXA 4BMSA 4NPCA 1NVTA 2BI8A 2WD7A 5KVSA 2GDZA 3LF2A 3ZWOA 2H9IA 3NT4A 2D4AA 3PQEA 4ZQFA 2YJZA 3JQAD 3GG2A 1CQIA 4QECA 1ENZA 4OKNA 3DBLB 5CDTA 1PZFA 4BHTA 3QY9A 4BIIA 1WWKA 2C59A 4NBWA 3NTRA 1PWXA 2OP1A 3WXBA 3DAGA 4BQPA 5B12A 5EERA 3MWDB 2G1UA 3H5AA 3QWBA 3AOEC 4PLTA 5AQ1A 4BO5A 2Y0EA 1ZEJA 3O9ZA 5IF3A 4PIVA 3BYZA 1EDZA 1LSSA 4BNVA 1XIVA 3IMFA 3PPIA 1AGNA 1EQUA 2CDCA 5G4KA 2ZJ1A 2DU8A 3IC5A 3ZU3A 4KQWA 2H6EA 5HM8A 2ZB3A 3FD8A 3WX0A 1V9LA 4MVJF 3V2GA 8ADHA 3KYCB 2GR9A 3TL3A 5JYDA 1U7TA 4MVJE 3DOJA 1LC0A 2GGSA 1SPXA 3DWFA 1M2WA 1V6AA 1YJQA 4J2OA 2HK8A 1CWUA 3JQ9C 4OO3A 5DCYA 1YJ8A 4L74A 2JD2A 3L9XA 4GLOA 4RQUA 4BQRA 4I5FA 3SLGA 4PVCA 1E3SA 5AXBA 1HDOA 3H8VA 4NZ9A 3AI1A 4U5QA 4MIOA 2OMEA 4YJFA 3FHLA 3ICCA 5I7SA 3OICA 4J7XA 4PLVA 4PLYA 3S2IA 1ZSNA 3ASVA 4P4GA 1YE3A 3H65A 4K6CA 5G0TA 3OJEA 2I99A 5EJ2A 2FR0A 2X9NA 2JFFA 1KVQA 4I8XA 2Y1DA 4XR4A 1ORRA 1P1FA 1PGQA 3DR3A 1VLLA 4NBVA 1NM5A 1PU2A 1CQJA 1YQDA 4M87A 4UVIA 2YUTA 1N8KA 4QXMA 4BO7A 3B1KA 4NFHA 1R37A 1PSDA 4R9SA 1X0VA 3BTVA 1MXFA 2EERA 1UDBA 1D8AA 3PFWO 1MGOA 2XXBA 2JD1A 1N1EA 3GDOA 1JWBB 5A3VA 2B36A 1TT7A 5AXCA 3U62A 2HLPA 3W8EA 1P1IA 4GX0A 3O03A 3GZ4A 3ITDA 1A4IA 2RAFA 4M89A 1BVRA 2Q1SA 3CINA 3GAZA 4TRRA 5G4KB 1U8FO 3HSKA 3ROQA 4B4UA 5CFZA 3WGIA 4DTIA 4IS3A 5BNIA 2EIHA 1L1FA 1IY8A 2Q50A 4XJTA 3IAHA 3OBBA 1LUAA 3I9MA 2GN8A 3GUCA 4R68A 2HQ1A 4HV4A 3PIIA 1GYQA 1LLUA 4B3IA 4EYEA 1UUFA 2VNSA 2Z1MA 1R16A 3EDMA 3ZWMA 3GVXA 4CQMA 1Y5RA 1LDMA 1GR0A 2FSVA 3EZYA 1I10A 3IS3A 3ZNQA 3P5SA 2NU7A 4DGSA 2X5JO 4E4YA 4EITA 4CJXA 1X7HA 1U3WA 5JW6A 3ZU4A 4MP6A 2Y1CA 2VHZA 4YJFB 1H94A 1SB8A 3OQ6A 5JBIA 1GZ6A 3VPXA 3AY7A 5DOVA 1QYXA 1AHIA 2CNBA 3IP3A 4YBZA 2AEFA 4CM9A 3K2EA 1LRKA 5I7VA 4GKVA 1ZJZA 3ETGA 5GMOA 2CVZA 3PZRA 1B14A 5ENDA 1J6UA 1SEPA 3ETEA 2P9GA 4TRNA 2PR2A 4DYVA 2PZMA 3G79A 4CM1A 2FWMX 3SXPA 3DFUA 3PGJA 2Q3EA 4XJSA 4OKIA 4EEXA 3EVTA 4L0QA 4AJNA 3CMMA 1R0KA 2DQ4A 1MX3A 2IODA 3KETA 1NFRA 3L77A 3TN7A 1JWAB 1Q7CA 1A7AA 4R16A 3NEPX 3E9MA 5T64A 3GLQA 1BG6A 2J3HA 4YTEA 1XELA 3EMKA 4PZEA 1I3LA 5L7WA 3JYPA 3PZBA 4YCAA 2VZ0A 5DP1A 2B5VA 2UDPA 4LISA 2PKQP 3NGLA 3D64A 3KYDA 2AW5A 5EN4A 4I5GA 1MV8A 1GEGA 4YJHA 2YFQA 3I4CA 3OECA 4GX5A 1UZNA 1KBZA 2A4KA 5JLAA 4X54A 4U8GA 2P9EA 3ZWVA 2VOJA 4CQMB 1QYWA 2YHUA 2BRUA 3I5MA 2NADA 5BQFA 1VSVA 1MFPA 3KZVA 4KUHA 1GQ2A 1N92A 5JY1A 3AI2A 2JAHA 1U3VA 5HS6A 4RF4A 4F46A 4KWHA 1Y9AA 3W1VA 2BI7A 1D4FA 3K31A 1C0IA 1UZMA 3H3JA 1VKOA 4LVUA 3U4HA 3OJFA 1U8XX 4XYLA 3KEQA 1F17A 2HJSA 4GWGA 4J49A 5AXDA 1ZIDA 2GN9A 3PWSA 4BO0A 1EE2A 2TMDA 2W90A 3WOHA 5C7OO 3GVCA 4J7UA 3UGKA 1RYEA 1VL0A 3B20A 3E9NA 1E3EA 4NBTA 2J3JA 4MVJM 3HDJA 3DHNA 4IM7A 1J49A 1YO6A 3NAQA 4NU6A 1LJ8A 1KVSA 4PG5A 3A06A 4RPLA 1I5RA 5ER9A 3UW3A 1X0XA 2DFDA 2P5YA 2BFMA 4YXFA 1GUFA 1UDCA 3JQGA 1L7DA 2XAAA 1N1GA 2X0RA 1LXCA 2X0NA 3QW2A 5CEEA 5K6AA 1HYEA 4BNHA 1EUCA 3BTOA 2AMFA 5KKAA 5KJFA 4AJ4A 5JNLA 3O26A 2V7PA 4XB1A 1V8BA 1T1SA 1EEHA 2R00A 1DRWA 1NFFA 2BELA 2X58A 3JQ8A 3K73O 2A92A 2O48X 3OJLA 8LDHA 3S55A 3FN4A 1U4OA 1YL5A 4RPJA 3TZCA 1T26A 4CV0A 1B0AA 4NU5A 5JO0A 3T7EA 2DTDA 1ZBQA 5LCXA 4HX5A 4CMGA 4D3FA 3KYDB 4ZRMA 3GMSA 4II2A 5THQA 5L7YA 2HAEA 1GAEO 4GLLA 1O6ZA 1DRUA 2FPIA 4JP2A 5CHEA 2Q1UA 2EKLA 1LA2A 4Z9YA 4DBZA 2VRCA 5BT9A 3D0OA 1ADCA 1YWGO 1HZZA 2P5UA 3ROPA 4CMJA 1XHLA 4D3DA 5CDYA 4IDEA 2GN6A 4L4XA 3F3SA 2Q99A 2I3AA 3WQSB 4YT2A 4INAA 1BSVA 3GMDA 2LDXA 3HN7A 4NFYA 1PL6A 1XU7A 3DBRB 2Y67A 5T5QA 1FK8A 5C7IO 2O3QA 5COBA 1BGVA 4XGIA 1E0DA 3IJPA 4DLBA 3W4JA 2YY7A 3OJOA 3ZZNA 4AJEA 4Z0TA 1E6WA 3WYBA 4E2YA 1L7EA 4DXHA 1YONA 1ZEMA 2I3GA 1N9GA 1ZJYA 4JBIA 2QG4A 2JCVA 3KYBA 4MOWA 4CQMD 2DT5A 1O94A 3AFMA 3E8XA 1UDAA 3E82A 1E7MA 3EGOA 4Z0HO 3WS7A 3W8DA 1NTOA 2Q2VA 1RJWA 3WWYA 3JQGB 1I30A 5THKA 2DBQA 1OC2A 1E3JA 2EGHA 3GVHA 1R15A 3H9GA 1GY8A 5K9ZA 1PQUA 1O0SA 3VH3A 3FTNA 2GD1O 5T57A 3ZWWA 1U9JA 2HKIA 2Y1FA 4WNIA 3RU7A 4IXWA 1W6UA 4R41A 4CM9D 2NTNA 5IJZA 3V2HA 3P2YA 4BGVA 5JYEA 1WZEA 3IUPA 3JQ8B 3H9UA 1PJSA 3N74A 4Z6KA 3D1LA 3H6KA 3JYNA 1YB5A 1LQTA 1P31A 2HRZA 3MOGA 3P7MA 3FPCA 2ZIZA 3AUAA 3LLSA 2VRBA 2IRWA 1QYDA 4GI2A 2QQ5A 4PG8A 1B2LA 1T2FA 4RCVA 1NPDA 3Q0EA 4CR6A 1QR6A 3WB9A 1DC5A 4L9RA 1JLLA 3RROA 2I65A 3U9LA 5GY7A 3I9JA 2Y1EA 3D3WA 4YJGA 2W2LA 5GZ3A 2PZJA 3FSRA 3NYWA 3SVTA 5F1PA 2C2XA 1F0YA 2D3TA 3RI3A 1PJ3A 5K6AC 3G17A 1U7HA 2P4HX 4MPDA 3X2FA 4DIBA 4CLRA 3I6IA 4QT0A 3IQDB 2G17A 1XA0A 1UAGA 4MVJH 1NXQA 1JAYA 2GERA 4EW6A 3LC7O 2PGLA 3DFZA 1BW9B 2R00C 1X7DA 2VUSA 1SOWA 3NX4A 3TOZA 4FFPA 4IZIA 3COSA 5CDGA 1B16A 3RIHA 4JGBA 4J43A 4J1NA 2B5WA 1U3UA 1N9GB 1ZH8A 2PKRA 5EINA 1CIVA 1ZMOA 3KHUA 4FD3A 4PLPA 3RJ5A 4EI2A 3UUWA 4OXYA 5IN4A 3WSVA 1P77A 3F9IA 1T2DA 3L4SO 4EEZA 4BNFA 4OJNA 4CMBA 2NU6A 1FF9A 1TT5A 5ITVA 2RIRA 3PQDA 3TZKA 1H93A 1KEPA 1BTOA 1R4MB 5CP8A 1T2CA 3RVDA 3FRJA 4KMSA 3F1LA 4IQGA 3VC7A 3EAGA 1DC3A 1Q7BA 1YOVA 3OEWA 4N7RA 2VWGA 4GSLA 2JHFA 4AJ1A 2EJWA 4IMPA 4YB8A 3DMYA 4CMEA 2IE0A 3AM3A 4G65A 1JN0A 2RHRA 3C7DB 2XF8A 4RPGA 4TRMA 3IIEA 2CDBA 3GZNA 4K6FA 1JKIA 2B4QA 4MVJP 1GQQA 3C3XA 4NJMA 3NV9A 1J5PA 3JCZA 2OUIA 2CF6A 3WLFA 2HMWA 3RAJA 7MDHA 1AXGA 2YV1A 3D3WB 3QA9A 4NIMA 4YJGB 2PGJA 3V2UA 5KVVA 2NSDA 1E5QA 2X0IA 3GEDA 4UEJA 3GDFA 1HXHA 2YW9A 4FJ2A 3C1OA 4O59O 1DO8A 3O4RA 2G0TA 3ON5A 3HFSA 3AY3A 1X7GA 4MP8A 1WDLA 5JMPA 1DFIA 1GQYA 1C0KA 1I3NA 3KSUA 4RORA 5JAQA 3SJUA 3VZQA 3CMCO 1ZFNA 4G5HA 1NP3A 2Y0CA 4J1QA 3RBZA 3JYLA 4ESOA 4BMNA 3PJFA 3C85A 3AUSA 5CG1A 1SAYA 4XYBA 2VRCD 3GGPA 5A5FA 1VSUA 3QRWA 4GPD1 3CPSA 5A05A 3WGGA 4MKXA 4PFJA 4PLGA 1PJBA 4E2ZA 4G81A 4MP3A 3ZV5A 4DIOA 3DEYX 3AUUA 5I7EA 1TT5B 4NJOA 4OH1A 5JC8A 1R6DA 3OP4A 3VTZA 5KVCA 1PJLA 2W98A 4OSOA 4CLOA 4R54A 5KCZA 5KJ1A 2LDBA 3NGXA 3A28A 1KVRA 4NK4A 5C3MA 1ISMA 3IP1A 3CSDA 4ZICA 4BL5A 3FI9A 2B4TO 2OP0A 3ZV3A 1EFLA 2X5KO 4Y9DA 4L4SA 3INRA 1PR9A 3DHEA 3RCBA 4BB5A 2VYNA 4BO9A 5LC1A 1YOVB 2IEBA 1DEHA 1XDWA 3V5NA 4ZD6A 5B4UA 3PRJA 1P74A 4NG5A 5JS6A 3OQBA 2AA3A 3JV7A 2Q1WA 4BNUA 3GH3A 5TRTA 1M75A 3C8MA 2GPTA 3FWZA 2O7SA 3GZNB 3PYLA 4KQXA 3WTCA 4R3NA 3I9OA 3MJVA 1DPGA 4E2WA 1I2CA 4MVJI 1E3WA 1M76A 4A26A 3PTZA 3T4XA 3A9WA 3H2ZA 2QRJA 4BNKA 2EHDA 1J0XO 1NNUA 1PL7A 3CH6A 3TPCA 3UXYA 4BS9A 1PQWA 1CDOA 1O8CA 3EYWA 1DFHA 1PEDA 4LN1A 2YQ4A 3HDQA 4RV9A 4LSMA 5CDSA 1N7HA 4FW8A 5AXAA 2QZ9A 1T24A 1TA4A 4OAQA 4D46A 1FDTA 3U5TA 1ML3A 4IDBA 3W8FA 5ADHA 4Q39A 5KNLA 3KYCA 2DBVO 4AJLA 1PTJA 1Q2XA 4GGPA 2FP4A 3QVWA 5EMHA 2V65A 3L07A 3D5QA 3TRIA 2X0JA 4EDFA 4AJOA 3H4VA 5JSFA 5HTOA 2C07A 2VZ9A 4CMEC 1I33A 2W4QA 2WE7A 4HY3A 4Q3NA 4U7WA 5IZCA 1OZAA 4JX8A 2W2LD 2WYUA 1VJ1A 3JQDA 4NQZA 1XG5A 1PS9A 1HEUA 1R66A 2BLLA 4AJIA 5FWNA 1D1SA 1NHGA 4G2NA 2SCUA 3NJ4A 4H16A 3LT1A 3NRCA 1VI2A 4LMRA 1ADFA 4R9RA 2D5AA 4CLOB 3U4DA 5U4QA 5ILOA 1ONNA 5G0SA 1GZ3A 3PLRA 1AHHA 4JLWA 4DREA 1MA0A 3Q2KA 3H3FA 1Q0QA 3WGYA 1ARZA 4FS3A 3CZRA 1QP8A 4ZGWA 5IZ4A 1PX0A 5B4TA 1UXKA 1HLDA 2VHXA 2PKQO 2O2SA 2DPGA 2YQ5A 3N7UA 3PHHA 1ISIA 2VOEA 4B4VA 3RUHA 2C7GA 2ZB7A 1Q0HA 3FNFA 3PDJA 4GKBA 3IKVA 3DDNA 1ZXBA 3PJGA 3ETDA 3OMLA 2HUNA 4BNTA 1G0NA 4EJ6A 2F00A 4B7XA 1E3WB 3KRTA 2AXQA 3R6DA 1ZK1A 3F4LA 4J4TA 4D79A 2DKNA 5A03A 3UICA 4CMAA 4DIFA 1XGKA 2PZLA 2VT3A 3L6DA 4D0SA 4MDHA 1E7SA 5A1TA 3DOCA 3SC4A 3MJEA 3KV3O 1NQTA 3R3SA 1I3KA 3BTSA 4J0EA 2QRKA 2YDXA 2NWQA 3DZHA 5TGDA 1MLDA 3T7CA 2TMGA 1DIBA 1WDMA 1Y8QB 2BMAA 2QX7A 3L6OO 3DZJA 4OL9A 1GDHA 3KB6A 1HLPA 4P8RA 3ULKA 2J3IA 4EJMA 4B7UA 4FFNA 4CV3A 1A5ZA 4P4LA 1YKFA 2Y1GA 5IXYA 4FC6A 2EF1A 2FR8A 1JAXA 4TKLA 2WJPA 1PJQA 1DSSG 2VTEA 3C7CB 1EVZA 2PH5A 2WD8A 1YBVA 1ZKMA 1GL3A 4P4NA 4Z9XA 1LI4A 5T6BA 4ALMA 4KDEA 4E5KA 2VUTA 4NBRA 4Q3BA 4RLHA 5BSEA 2C2YA 3ROMA 5L51A 1S6YA 4AJKA 1OMOA 1B15A 4IJWA 5HWSA 2DM6A 1YL6A 1HDGO 3A14A 2GCGA 4J1TA 4MIYA 1V0JA 3PI7A 4JK3A 3IL2A 4UVGA 4CR7A 2C7VA 3O8QA 2WM3A 4ZQHA 4DQVA 3RUCA 5EIOA 3U4CA 1SEVA 3ASUA 5JXWA 3GPDG 4ROSA 2OZPA 2J3KA 2PZKA 4EUFA 3F1KA 4A27A 1CETA 1E7YA 1EDOA 1ZNQO 2BGKA 3FTPA 1A7KA 4M55A 3UAGA 5KWEA 2ZQYA 1PJ2A 4A73A 2D0IA 3S1LA 4OYRA 3WR5A 4E33A 1BMDA 5C5IA 5HA5A 4IUYA 4D42A 1R0SA 4D0RA 3VPGA 5IZCC 3K5PA 1SO8A 3NDJA 3RASA 3G1UA 3ITKA 4KOAA 5B37A 4PLWA 3KEOA 4NBUA 4GQAA 4S1VA 3GGOA 2QYTA 2H1SA 3GOHA 4WEOA 3B6ZA 5I8ZA 2DVMA 3WG9A 2VYND 3RWBA 4AFNA 1NPTO 3PWZA 3RUDA 5CPBA 3DTTA 3MJ4A 4M1QA 1P45A 1RM0A 5FI5A 1I8TA 4J91A 4RDIA 3RUEA 2X86A 1VC2A 4HKTA 4FGSA 2HK9A 1NWHA 4WASA 2C82A 2HMTA 1WLYA 3D4PA 3HE3A 1IOLA 1NVMB 4NH4A 3F46A 1G0OA 3JD0A 4Y67A 1JA9A 2YZ7A 3RC1A 4Y6SA 1HDZA 4O63O 1EK5A 4YAIA 2BF7A 3D4OA 3GEMA 2W8ZA 1LX6A 2AQKA 4U6QA 3TZQA 1HZJA 3DZFA 4L75A 4P22A 4M8SA 1XWFA 1U2GA 4CM8B 1LLDA 4UVHA 4YACA 5IDYA 3MOIA 3GRKA 3IDSA 3RUAA 1EBFA 3B70A 2DBRA 2O23A 4Z0PA 3RU9A 3F4BA 1EFKA 2NM0A 4BV9A 2B35A 1QORA 2ZCVA 3O8QB 5ICSA 1ZCJA 1LLCA 3KLMX 3UHAA 1UXJA 4YAJA 3GAFA 3Q2IA 1DHTA 2UYYA 9LDTA 3UKOA 1SMKA 4HWKA 2Q45A 4MVJG 2IZZA 3PXXA 1K6JA 5H83A 3M1AA 1Z7BA 2Z1NA 3BMNA 1HDRA 1I01A 4JBGA 1AXEA 1EVJA 1QYCA 5IXSA 2CZCA 2X1HA 4HADA 3WNVA 1FDWA 5I7FA 3LF1A 1M6WA 3LT4A 3GQVA 3WTBA 3AM5A 3E03A 2D2IA 1HETA 1I2ZA 1K6IA 3BMCA 3KBOA 1WDKA 3GUYA 2PNFA 3LZ6A 1P44A 3Q1LA 1PZGA 2FRDA 2GZ3A 3E5RA 5TJ9A 3HZZA 2X22A 5JCJD 1MB4A 4ZJUA 1B7GO 4BKOA 4BKPA 1DIGA 3H5NA 4OXNA 3PQFA 4RVSA 3UCEA 2JAPA 4BO4A 3SJ7A 4E3ZA 1EMDA 1M67A 1QV7A 4KUEA 4CM4B 5IG2A 2RH4A 1VL6A 4FN4A 2CSUA 4IIVA 3JD1A 4XWYA 4A2CA 3DXFA 3WDSA 4LMPA 2A9FA 4WK6A 4PN3A 1DDOA 1CF2O 5A9SA 5G4LA 2HMSA 2WYWA 3PFFA 4NI5A 3BA1A 3H9QA 2RHCA 4R1SA 3QVOA 1HWYA 3L9WA 4IZHA 1TXGA 1XLTA 4RLSA 1KOLA 1G1AA 4QFDA 5FEUA 4YT8A 1ZZEA 1Y7TA 1PQPA 2VWPA 1O95A 5ENVA 4XZ3A 3W4KA 4PCVA 3R0IA 4J16A 4J0FA 4RVGA 3JYQA 4W4TA 4DRYA 5KOIA 5G2OA 1P0FA 3RUFA 3DBRA 3C24A 3HB4X 3QP9A 4ITUA 1H6DA 5MDHA 2ZTMA 4CL8A 1FJHA 4YRAA 5BSHA 4JIGA 4J3FA 4DMLA 2VYVA 3JQ6A 5GZ6A 3TQHA 3DMTA 5JY6A 4YVFA 3D4NA 4BNZA 5COQA 1DRVA 5L45A 3AU9A 4GAEA 2G5CA 1PJTA 3NUGA 2I5PO 3BMNB 1NYTA 4OHUA 1LDBA 4L4RA 3S8MA 4YEDA 1E3LA 3LYLA 3EHEA 3VZSA 5TF4A 2ILTA 1QSGA 3BMCB 4YJDA 4EGFA 4BO8A 2C5EA 4W9NA 3DQPA 3JQEA 3PP8A 1YL7A 1DC4A 1NX6A 3MZ0A 1GYRA 5CG2A 1IE3A 4LCJA 5AOVA 3B1JA 4E31A 1CJCA 3VPHA 3Q9NA 2WEKA 4MINA 1U4SA 4O5OA 2O7QA 4EZBA 4B4WA 3GNTA 3SC6A 3L4BA 2EV9A 4II3A 5TNXA 4BKQA 4JBHA 5A9SB 3JTMA 3WMWA 1LDNA 4BB6A 3U09A 1E6EA 4DA9A 2PD6A 2FPGA 1GD1O 4J4BA 4YAKA 3ADOA 4GVXA 3UH1A 1P1HA 2EKQA 1LSOA 2VHWA 3RD5A 3EK2A 5A9TA 3M6IA 4B4OA 4CMIA 2O4CA 3CEAA 2DUWA 2NLOA 4BO2A 1WW8A 2FSSA 1UXHA 2O3SA 1JVSA 4RO0A 1EZ4A 1SNYA 1A9YA 3FBTA 4RZIA 4OOEA 4ALLA 1BW9A 4YR9A 1O89A 1W8DA 1XQ1A 4GX2A 3DHYA 3VZRA 4IDFA 3I9LA 2ZKLA 1K0UA 5F5NA 1N7GA 1HE3A 3E1KA 3EZLA 3OIFA 4WUVA 5TS3A 5L7TA 1F8GA 3HFGA 4FIZA 2JHGA 4J2HA 2BH9A 2HJRA 4O6VA 3K6JA 1RYDA 3JD2A 5TC4A 3GEGA 4DL9A 1J4AA 1BRMA 2WE8A 3CKYA 4OMUA 4FDAA 1X13A 1P9LA 4EUEA 3FNHA 2AQHA 1IZ9A 4RF5A 1HDXA 3M1LA 3KM0A 1VE9A 1R4MA 1R4NB 1TVEA 4JNKA 3RKUA 1KC3A 1BXZA 4EJ0A 3PHJA 2WMDA 1Y81A 4RVHA 5F3RA 1GZ4A 4PZCA 1Z75A 3NDIA 4GGOA 4QTZA 3UCXA 5L4LA 1AE1A 4PGFA 1ONOA 4ALKA 4R1NA 2CF5A 3C7AA 1X14A 3WIDA 3F5SA 5A5EA 3ICPA 3SX2A 3AWDA 2JCXA 2Q49A 1MG0A 1IUKA 4CL3A 3DMTC 3JQ7A 3ZI0A 2R2GA 5FI3A 1O5IA 2PA3A 4WJZA 5DZSA 5JPIA 4A0SA 3GA0A 1PS0A 2C20A 1PGJA 5DCWA 4ZA2A 3WGTA 4OXKA 4CM5A 4PLHA 4PLCA 4CMIB 1RM5A 5F1OA 3U49A 4HFJA 4D41A 4CLEA 2HMVA 3LU1A 4J4HA 5EQFA 1KEUA 1JDJA 1ZXLA 4WEQA 4WLNA 4W9NC 4Y6PA 2I9PA 3NT2A 2X9VA 4F3YA 2VTDA 4BNMA 4W7HA 5IDXA 1PS8A 4CMHA 2AEJA 3I9NA 3RC7A 3ZW9A 1HSOA 3LC1O 1H0KA 1DFGA 1H2HA 1YRLA 3OFSA 1ADBA 2C29D 1OC4A 3TNLA 1PGOA 4TRJA 1Y9EA 1ENOA 4N5LA 3L4BC 5DULA 1CEQA 2B37A 4CUJA 2FZEA 1YB1A 3KTDA 3GHHA 4RQTA 3WIEA 4E5YA 3GDGA 2AQ8A 4PZDA 4QO7A 2ZYDA 4IQ0A 3DL2A 4CV1A 1DBVO 2X4GA 3PEFA 4D7AA 3I52A 4GSKA 3VH2A 4N18A 2QIOA 3DO5A 3OJ0A 1PGNA 4IIUA 4FSHA 1KC1A 2WSBA 2VYVD 2YFHA 2YHIB 4BVAA 4GVLA 1JTVA 3ZW8A 1LTHR 2Q2QA 2Q4EA 4IJKA 4I08A 3H2SA 3ZV6A 3VHRA 3HJAA 4R51A 4Z3KA 3JQ7B 2NACA 4QQRA 3TZ6A 5K0ZA 4UREA 3S2GA 4B3HA 1Q1NA 3QSGA 3VOSA 5A06A 2BKAA 2O3RA 1HSZA 2NVBA 4RL6A 5F5LA 1Z6ZA 3D5TA 2ZTVA 3M2PA 4R3WA 2PLAA 3RKRA 4CODB 5TLSA 1UP7A 4AJJA 2E37A 2VT2A 1UP6A 1EE9A 2IXBA 2ZK7A 1GTMA 4HFRA 2QYSA 5U1PA 3TFOA 1YGYA 4F45A 2OBNA 5F1KA 2C54A 1MXHA 4I9NA 4DBVO 5JC1A 3LVFO 1EUDA 1JKJA 4ZRNA 3AJRA 3A4VA 3GY0A 3ZV4A 1P1JA 3NKLA 3RFTA 1HKUA 1G6KA 4OQYA 3WNQA 5CEJA 2FN7A 5L95A 1E7QA 3QQPA 1SB9A 2QZZA 2EG9A 5L3ZA 3GFGA 2Z95A 3ONEA 4BNYA 2FMUA 3OH8A 4RVUA 2G82A 4U0JA 3OIDA 1WNTA 4KWIA 3FBGA 1DAOA 3JD4A 1CERA 3BHIA 4E13A 3EY4A 1H5QA 3GG9A 4YAEA 3WFJA 2YDYA 3FR7A 2NNLD 4QX6A 1PWZA 3E6AA 4AICA 2FR1A 4KTVE 2EKPA 1F8FA 3GVIA 3M2TA 1C1XB 4TVBA 1XSEA 1LSJA 4U0KA 3H9JA 1DOHA 5TJHA 1LRJA 2DFVA 3I23A 2EW2A 3RJ9A 1KVUA 1WMBA 2W2KB 1LLQA 1Q0LA 3V1TC 1GPDG 1BXGA 1TEHA 4XD2A 1MFZA 2GZ1A 4BNWA 2Z5LA 4MVJA 4A03A 1WMAA 1W0CA 3GPIA 2AQIA 2X7HA 3ZU2A 3MCVA 4MKZA 1E7WA 3S2EA 2QW8A 3I3OA 2AE1A 4Q3EA 3QWHA 3ZWNA 3AOEA 4WOKA 4JN6B 1GYPA 4WLOA 4KTTE 1T4DA 4L76A 3UCFA 3OF2A 1KETA 1UAYA 3NT5A 4NDNE 4WNCA 1NASA 4Y8VA 4W82A 4AJ2A 1A4UA 4E5PA 1W4ZA 5DP2A
chains in the Genus database with same CATH superfamily
4YRAA 3B1FA 2K7ZA 4WK2B 4G5GA 2H4XA 4UDYX 4GECA 4TTIA 5A9RA 5TARA 5LDHA 2DHCA 4XOIA 5KX5A 4V1CA 3D0QA 1MHTA 3KYJB 1PN3A 1ZHOA 1Q84A 2B4RO 1YBHA 5J4LA 2H18A 1ZX1A 3DAPA 2BCEA 4P36A 4X84A 1V2GA 2UUOA 1KDTA 1L3CA 5IC4A 1QRAA 1LBHA 4BB0A 4EKEA 1DB3A 2HMYB 4K03A 3L0PA 1RRGA 3I1IA 3HL0A 2I7TA 2BFOA 2VL7A 4MXDA 4BVBA 4E12A 3LWDA 1DHRA 4F9TA 4H6WA 4BATA 3KS9A 1MC5A 2JKVA 1JU3A 3FWHA 4FC7A 4QBFA 3Q7PA 1OIXA 1S02A 5FKJA 1DBQA 1Y6JA 3N58A 2BSQA 2YHAA 5TIIA 4W5JA 1DTWA 4ABTA 4V1CI 1N4AA 4HGQA 2ZCUA 5KC9A 1WHTB 1EWYA 3HY4A 4CRWB 1C2YA 2FW1A 1J0EA 4ZIRA 3L0SA 3L8EA 4KAFA 5BVGB 2AEMA 3U9SA 1W7AA 1NUSA 2RGNC 3FNQA 4TV9B 4UXJA 3LX6A 4U7GA 3TKAA 1XDDA 3K6SA 1DCTA 2A4MA 4FBLA 1CRWG 2RGBA 3SE7A 3D7NA 3NFRA 5ECWA 4E32A 4X92A 1QG6A 4OLFA 3FJYA 4G0NA 3H87A 4FOSA 1I24A 2CGEA 3BPSA 4MUMA 1LQUA 4MV3A 4K9RA 1W2GA 3Q11A 1XKQA 5KYXB 5DM60 3CZ5A 3STTA 1LPPA 2DBZA 2WWIA 2QN1A 5EQDA 2QR3A 3CZPA 3N2IA 2ZT8A 3RSHA 4P7BA 5DI3B 5TEVA 4EYKA 5JXJA 3FTFA 4MQEB 4L78A 5I9NA 4R7ZA 5K3BA 1TRKA 4FINA 1IN7A 1NJSA 1MQAA 4A1OA 1E77A 3QWFA 4CN9A 4TLDA 1A8PA 1E4EA 1FSGA 2B69A 4EECA 5JMWA 3K7EA 3VYSB 4AZ3B 1PRYA 1XU9A 1ETHA 2O7NA 1ZMTA 3F3YA 4I2NA 1IZ0A 5IBCA 1DXOA 2H63A 1D1PA 1JVNA 3MRVA 3NNSA 4MVXA 1A88A 3HPQA 5CK4A 1HNZB 3F47A 4ZMBA 2YXLA 1EWVA 1A95A 3GDHA 4DDHA 2G4LA 5FPHA 4D9IA 5DM70 4D81A 4V1CB 5KQPA 1YASA 3H0EA 4MWSA 4P84A 5ED0A 4LHWA 4QULA 4Y6OA 2H7YA 3MBOA 4D9CA 1LS1A 5DYNA 2YZGA 1PNOA 4IL5A 1ZL0A 3P9XA 2R79A 3DEFA 5AFSA 5SICE 2PEZA 3EZNA 4EOGA 2NZYA 2HCTA 2J5KA 3LLVA 3CLUC 4GOLD 5FWXB 2R85A 2BBOA 2Z4TA 1OAOC 3BH7A 3HNRA 9LDBA 1MT3A 2VAWA 4CVNA 3P9RA 2E85A 1JPJA 5CX1A 3DR5A 5IJ9A 3D7LA 1W5SA 3BDVA 4FNAA 1RWPA 1KORA 4L4ZA 3ZN2A 4ENSA 2AR7A 5IAJA 3K0KA 3G49A 1AT1A 3BIJA 1DTWB 1Q5PA 3GLUA 3S5JA 3OETA 1IC6A 4FDUA 5DX0A 3VOBA 3ZOZA 4ZIRB 4KWTA 4WCFA 1WEKA 1DAHA 2XVXA 2OWEA 3BB3A 3TNDA 3HXTA 3MB5A 1AQIA 4PU0A 2XPCA 3ORYA 4MZDA 2WOOA 5T4FA 1HE8B 1J9GA 2LP4Y 3AIMA 1Z6PA 2B20A 1JLRA 5KDDA 5CDUA 1PR4A 1ZPDA 3NC4A 4YP6A 1KYWA 3ETCA 3PUXA 2C98A 2GXSA 3PITA 4F84A 5EIXA 3WL3A 3KQOA 5DTEA 4BJ1A 2BTOA 4MWGA 3LC0A 1OV4A 4UMFA 2BFCB 2ANBA 5FOTA 1TVMA 1P81A 2H4WA 2WM2A 5KTRA 5EEGA 1S3GA 2J46A 4R1MA 3DMFA 3EC1A 2BZGA 3QQ5A 1MUUA 1NV8A 1KDPA 2HH9A 3BDIA 2PEYA 1NOJA 4XR9A 3IALA 5FA8A 3T5TA 3ZJ5A 3P0JA 2X77A 5EUQB 5KNCA 5AW9A 1JKFA 1JVBA 4I9UA 3R7BA 3UVEA 4DVJA 1QLHA 4HNGA 1TB4A 1IHYA 1F06A 2JJ1D 1V8FA 1CZRA 2FSFA 3M8KA 3I0MA 2DTEA 3PKIA 4LSWA 4BN5A 5EFOA 3U2QA 3TIVA 5AYVA 3OX1A 4FLEA 4NR0A 3AG5A 3FCSB 3DFFA 4MEJA 3S0JA 4QPCA 4FOTA 5JS8A 3D3JA 4D96A 3VPSA 1XDSA 4XARA 4EHDA 4CL2A 2HC9A 1KK2A 1RABA 1TI7A 2OBMA 2TECE 1S8FA 3PQ7A 2KW5A 4GWKA 4M0LA 4MW4A 2VBGA 1U3FA 5H0IA 3UAYA 3FUUA 1IM8A 1V5WA 1SU8A 3L0BA 5LP6A 3OOYA 1AZTA 5DBGA 1G63A 2E87A 2PVCA 1PJ8A 4CM3A 1T4BA 4MTCA 1BMQA 5B1IA 3L4JA 3WJAA 3FGNA 5CIQA 3KUXA 1F48A 3JX9A 1J2RA 2P91A 4CPDA 4V0NA 4DLRA 4P2GA 2WD7B 4XA8A 5JO9A 3DOUA 4H15A 3KR2A 2F4VB 4QBIA 2VDVE 1J2UA 2PX0A 1JPNA 4ZQEA 3LWZA 4DCCA 1JIKA 5CX1B 5DWQA 1V43A 4JLPA 2WU8A 5FV4A 1UZUA 5IJ9B 2XEXA 4QJ5A 5H81A 2E82A 3EC7A 1SBYA 4I1YA 4KIJA 2PKYX 2CL7X 4OY3A 4S3MA 1EX7A 2P0YA 4IINA 3DV9A 1B3BA 1Y6ZA 3IB6A 4OGWA 1E62A 3WQRA 1NVWQ 4C4RA 4C6TA 5F7XA 2XXAA 1XQWA 3AO0B 3I2FA 4O1MA 3WQHA 2RGDA 1LPAB 4WCFB 5T4HA 2ET6A 1R6XA 2J3LA 2XNJA 4UARA 5HZMA 1XN1A 2EDAA 4YFVA 4FB4A 1I0ZA 3CVJA 2HRDA 2BMFA 4LXTA 4A16A 4UFNA 3TLXA 2YWEA 2JIZD 3L4EA 3VDRA 1Y63A 4BE4A 4TYWA 2KB0A 2C0QA 4JXXA 3UYLA 3P2KA 2Y8EA 3VU1A 1W1WA 3U40A 3L1UA 2IEIA 4K9DA 1TK3A 1WZNA 2ZR0A 1KEVA 2YV2A 3GLIE 1Y8ZA 4IQFA 3TLEA 1JLKA 4V0RA 4OSPA 2H4ZA 2HGSA 1MJGM 4C0AC 3PTLA 3EPRA 1L4LA 1DIAA 1FLNA 4URFA 5BNTA 3E7PA 3GP3A 5LYJF 3P96A 3WA7A 3H7IA 4KC0A 4YDQA 3CRNA 3L46A 3LY9A 4FZVA 3C8ZA 2I4NA 1NSTA 4D3SA 4R71A 3DLBA 1X8XA 4FGJA 4YO7A 4D4LA 1WKCA 4LZPA 1LRLA 3NPMA 1T9AA 2G6BA 2B4KA 2PH3A 1XCOA 3AESA 4EWLA 5F4ZA 2O8VA 3NHLA 4DQKA 4INOA 5LA6A 3OZRA 3GIWA 3GGDA 4JLUA 4RX1A 4B5LA 4UAVA 2Q1TA 5ADVA 4WCFC 1CR6A 3ZD6A 1ADJA 2ZS9A 1U5CA 1YVEI 3SS7X 4M0CA 3OZFA 3TF5A 2O8EB 4TT3D 3NM6B 3JVIA 2PAAA 3RUIA 5A4FS 1T5IA 3GNLA 4EF6A 2F7SA 1J0CA 3CXRA 3GHYA 2H5IA 2Y05A 3C6YA 4K9OA 4L8VA 3VSAA 4DLNA 3NANA 3F5DA 4PG6A 2A0YA 2CD7A 4RQAA 1FNMA 1UH5A 4D43A 1OXUA 3GK3A 3D8RA 3FGZA 3DLHA 3ROKA 5ILQA 1AZSC 4IH9A 3D0RA 3Q2OA 2XE8A 2IUSA 3DHVA 3UAZA 3WBBA 2H52A 1T25A 4EAQA 3V1NA 3ODGA 3BFJA 3KYIB 1W4RA 2Y93A 2OCYC 2UXDB 1DJLA 1G20B 1OX4A 3NTXA 3IP9A 4WXPA 2XWBF 4YV2A 4ZJYA 3GFBA 3JYOA 4ME6A 1M1YA 5AUQA 2YFYA 4PHCA 4MSUA 4CKBA 5I01A 2K5UA 3WGQA 4AL4A 3L8YA 4N54A 4C6TB 1FNNA 3WK9A 4A7PA 1WV1A 1OFHA 2Y68A 3BEOA 1E89A 4HAXA 2H4FA 1FDSA 3O0DA 4KE9A 3GT7A 3ZVMA 4FILA 3QLJA 4NL4H 1C4XA 5JQGA 3GLKA 4DAEA 2ZSBA 4Q4JA 2IWRA 5A0TA 5A3RA 5CFMA 4UTOA 1GTRA 3EA0A 4F93B 3H9BA 5DOZA 3CVXA 1XYVA 3KZMA 1SUSA 2TYSB 3AUYA 3P2OA 1BHO1 1E69A 5L3QA 3RK4A 5AW4A 3V2IA 3NP7A 2H5LA 1ZMRA 3PL5A 1NPYA 4H6XA 5LP6C 3HQ4O 4JI7B 1N2SA 3ONVA 4TMTA 1U7ZA 1J0DA 4M2LA 4ZMSA 4WKNA 4JGIA 4ZK6A 1XROA 3KSDO 4ZT7A 5J2TF 6YASA 3B5EA 3QJYA 4X93A 1OH8A 1UC9A 2D4HA 4XDZA 5FR2A 2NO7A 4ZQIA 4NNJA 1QM5A 5DBIA 3GT0A 2GYUA 2F1RA 3GCWA 1YDEA 4Q12A 1VPDA 3QM1A 4KLNA 5LQRA 4MWBA 1JIXA 2ZJ2A 4RWZA 2XVMA 4M83A 1OWPA 2ZI6A 2NUTA 1S9HA 4RVOA 4DMGA 2HIHA 3OM8A 2R0QC 3ZNPA 2VJDA 4QFCA 2X0FA 2X1MA 3OY7A 4EPTA 4HEA1 1PT5A 1YS4A 2AEEA 2G7MC 3EVAA 4QATA 1KY3A 4MROA 4DQXA 2QU8A 4M36A 1E0SA 1QVRA 2EX1A 3AGPA 3K9QO 3NTOA 5C37A 5AVUA 2VHTA 4XRRA 1L7XA 5K0GA 2WMNB 4CMCA 4NQRA 1EHIA 4QWMA 4QSMA 3U3KA 4KPFC 1FDVA 1R4NA 3MTQA 2XHZA 1GEEA 4BBJA 1EVKA 1ULAA 1A5TA 1E64A 1BEZA 1TZCA 1BDBA 4GUAA 4F71A 4XQEA 4MMXB 4QM7A 2J07A 2IW1A 5IJ0A 2BFAA 4OQLA 5BSVA 5CT9A 4PSCA 2OCAA 3F8WA 3RPEA 2YXEA 2ERXA 1AF7A 3TGPA 1OX4B 2BC9A 4DYDA 3PUYA 1V6CA 3E58A 5FEMA 4JIMA 3WLTA 3MUOA 2E4AA 3UAWA 3O1LA 2YYSA 13PKA 1M1YB 5J40A 4HFMA 4AIRA 4BKRA 5D6OA 4DF3A 4DWJA 1H9BA 1WO8A 2UAGA 3IT1A 4FD2A 3EGEA 3ICWA 2RH5A 1ESMA 3WP0A 1O57A 3MGKA 2N0SA 3DO6A 2CLKB 2PFGA 3EDYA 3QXXA 2WHQA 4OJMX 5I47A 5IM4A 5BR7A 3QV1A 4Q15A 5JQGB 1PG5A 1N6LA 2HLHA 5EYPA 5LKRA 4LS3A 1HDCA 2FFAA 2P6UA 2BAGA 4FBGA 1B26A 2JH8A 4Q4JB 1Z56C 4TKVB 4HDOB 1XNJA 4K46A 5AI8A 1KO1A 1GPLA 1BDIA 3D4IA 1Q1BA 1J9EA 1DQRA 5L3QB 1M6HA 5IAEA 3T1OA 3HU5A 4YUZA 5KREA 1EBBA 4D74A 1EM6A 2VF2A 1JXAA 4HXGA 4MWZA 4Y2GA 1VDZA 5JCXA 3C3DA 1DINA 2ZB4A 3QY0A 1Z07A 2G06A 5ER6A 1CE8A 5A6VA 1THZA 5LQUA 1SVLA 1CUWA 2ZYAA 3BJMA 3RHSA 2RGXA 1GKUB 4LTDA 3VMMA 2OV3A 1UZAA 3GA7A 5TQ0A 2VSXA 3A6JA 5HE9A 4ANFA 1E6UA 5DIZA 3PXBA 2CE2X 1K5GA 2E5FA 1YZFA 2XOXA 3C41J 1SWVA 2NUTB 2ZYRA 1CJKC 2GLTA 1Z82A 3ABSB 5G1PA 3ZE9A 2M1XA 5AOCA 4IIBA 2KBFA 3ZHUA 1YCGA 3K9BA 4DMFA 1RJDA 3HMKA 5JBNA 3QH4A 1MAHA 2CL0X 3VSBA 4A8JA 3OCUA 3ZHQA 5JS2A 1NMYA 2ZRLA 4P35A 1TA0A 1L9KA 2W11A 3IT2A 4R2WA 3ETNA 3KUCA 3TQTA 1S4QA 2H85A 1CNMA 1REQA 2YJ3A 1SG0A 3PIDA 3Q41A 1XQVA 2IIBA 1TM5E 2CEKA 2Y0DA 1AKMA 1KK0A 5IAAA 4IYJA 5EJGA 1OLUA 1APBA 1C81A 3V4PB 3ZWDA 1VG0B 5ED4A 3HVHA 2RI6A 5E6RA 5C4IA 1RC8A 3K1TA 1BDMA 4PO9A 5IJ0B 2YHIA 4BGEA 4KXYA 3SEQA 1FTYA 2QD1A 1Y4UA 5G0WA 2BM8A 3LOUA 2FJPA 3MINA 4HNUA 2FGKA 4OMFG 4QHTA 2O5RA 1FNDA 2WB4A 3WRWA 1L4HA 3BX1A 2IZ0A 3EODA 4S1TA 3H42B 3ZJ4A 4ZC8A 1T2EA 1KEZA 3HLKA 4NMHA 3E2IA 4W5QA 3MFQA 2OOSA 1K4MA 1ODFA 3UMYA 3KU1A 2O2GA 4UPDA 1ZK3A 3K2BA 2XBLA 3AM4A 4A15A 3BUSA 5L40A 3KVYA 1P1RA 3ND5A 4J94A 3EGIA 1A9QA 1I2BA 2VHVA 4NY1A 4HRYA 2Q07A 3UFXA 2WIDA 2P4SA 2VP4A 3PCXA 5FR1A 1KEKA 1P2UA 3R3VA 2A35A 5ERXA 1O0CA 2PO7A 3BQMB 2DETA 3DZGA 3OCYA 4XKJA 4OM7A 5CD1A 1PDVA 1XA3A 5JZSA 3PUIA 5KPJA 4R2IA 1M6EX 3N2EA 1F5NA 4B3XA 1B76A 3C6KA 2EP5A 3K8YA 3LCRA 4JQYA 4C7JA 3SQXA 3HB5X 3U81A 3RRJA 1EJ2A 4JJ8A 5JZMA 1VYHA 2G8LA 1PLKA 3JQBA 5E3HA 4US2R 1D1TA 5HKBA 3EH2A 1CE8B 2DY0A 2GKGA 2XXJA 5CLLA 3RRZA 3LKVA 5LDDC 1AUOA 3CLTD 2R7NA 4HP8A 3MCZA 3NJ8A 4KN9S 3WSWA 1T1EA 5DNUA 4LXUA 2FW6A 4RD4A 5IHXA 1ZZGA 1JXOA 2QJRA 1ACLA 2WA1A 4JLOA 3A6ZA 3HLYA 4FFLA 4PICA 4QYMA 4E30A 3NEAA 2I4LA 3HNPA 1A9OA 3QHAA 1TZKA 1WPQA 2NTJA 5A02A 1JDZA 2GTHA 1V16A 3QSYA 3C6ZA 1WMDA 3KSAC 1IWPB 2OE2A 2GF0A 5EHZA 4N40A 4HK4A 1C7IA 2VUIB 2AXPA 4BBPA 5JTTA 5EJIA 4DFDA 1Z2DA 4UNNA 4DV1B 2V1UA 5I8WA 2ZE7A 4M88A 1UK9A 2HPHA 4XIJA 1E1LA 4A8JB 1DBRA 3TLAA 4HLDA 3UJHA 1SD2A 3RFVA 2ZETA 3NTQA 2BJWA 4NV3A 3E35A 1NDQA 2QHXA 2ZANA 5MGBA 1HT1E 1IQRA 2D3WA 1REQB 3Q8KA 4H0FA 4DM7A 5HRAA 1V1MA 4FK8A 1OLUB 5CTAA 1BZYA 4YR7A 2G83A 4ALNA 2XKAA 5BNFA 3C2QA 5FLEX 4KRFA 5E6RB 5BR8B 1JFSA 1RJGA 3SJZA 2FF5A 3DMGA 4FCCA 4GL4A 4QDJA 4QJIA 4F3TA 3PG5A 4EA7A 3I62A 4DDTA 3PEEA 3MINB 4JB2A 2O06A 2BR5A 4RAOA 1MG5A 3OOJA 4CN8A 1MEOA 1HX7A 4WOBA 1NF8A 1UDWA 2VG8A 5FWYB 2K6GA 3PGXA 1NR7A 2HF2A 2ZUVA 1MW9X 4XM2A 3VKHA 4M8NE 3IBSA 1OJ7A 3TBHA 5IAOA 1O87A 2RGGA 2HV9A 2O2YA 4AXBA 2HPAA 3ZVKA 1D07A 1PJAA 1Y48E 2G67A 2I8LA 2QRLA 4I5DA 2J7PA 4WZ6A 4ZARA 3UFXB 3PNMA 2XBUA 1XUOA 2ZAOA 3AEKA 3CR7A 2EGUA 3LL4A 1UKCA 4LZOA 4MYTA 2IUYA 4XB6B 4YQZA 1Y8RA 2ZJBA 2IEGA 2OCGA 5I7WA 2DFPA 4HNTA 5LMZA 3U7GA 1RAHA 4UUBA 3WYCA 3ENNA 4A8JC 2I7DA 1YS7A 4OHVA 3DWGA 4O4LA 5B3AA 4A4DA 2WDZA 1I6WA 2V6IA 5A4MS 3EWAA 4LRTB 1BFDA 3E7WA 4FIDA 5JNWA 5KHLB 4Z53A 1RQXA 3PR1A 3UQYS 2CV0A 4Z9FA 2BMVA 4YRFA 5IK2D 1RKBA 4LFAB 1AIPA 2MJLA 4NPHA 4COOA 3B1VA 1JECA 1Q22A 3CNOA 3DVQX 4YRDA 1JLLB 3WWZA 1WSAA 1RM3A 5JH7F 3AUTA 1XL0A 4BU1A 1ZVVA 4QODA 1G5IA 3HWX1 3NDRA 5AKZA 5EPOA 1I5OA 3AJEA 1QBKC 3PVZA 4E0BA 1UMBA 1KGSA 1ZMXA 3NWEA 2BJHA 1Q7GA 4IDDA 2PBRA 1NNSA 5CVVA 4AY5A 3OG9A 4CF6A 4DC0A 4O2LA 3IXLA 2WWRA 3RRFA 4OI4A 4P5DA 2JRLA 1V16B 2RHWA 2QRHA 3E4CA 2BFPA 2J5QA 3P8ZA 4X1KA 1PGPA 2V59A 1EA5A 2QTRA 3MJTA 1YKGA 1G19A 1VA4A 3ZS8A 3MW8A 3VA7A 2EIXA 2A2ZA 1Y3FE 3RYFA 5DCUA 2CJFA 1RFLA 2AZDA 3ZY6A 1GU7A 4KDFA 4MZXA 1G6Q1 2WYVA 4BO6A 1JI0A 2JCGA 3B3GA 3BGDA 4ZCSA 3SF0A 3K16A 4RGBA 1V1MB 1FFEA 3PD1A 4B6SA 4EIWA 5HR5A 2NZXA 2PD3A 1FS6A 4FWIB 4LXHA 2X13A 5M04A 2ZXUA 3LQ2A 5FUXA 1QTIA 3TSCA 5TQVA 2FE1A 1JAHA 3K8ZA 3KKPA 3N2NA 3JQBC 2BF4A 3OM0A 1V3UA 4V38A 2VIIA 1EI9A 3IYLW 4IP0A 4R6XA 2VP5A 1TEVA 2I55A 2NNWB 3I6ZA 2P4UA 1E99A 3O4VA 4WZBE 1TJ3A 3EAFA 3BKXA 1W9HA 3NDPA 1CQPA 4L15A 5IP5A 4E70A 3QKTA 1LJLA 3L79A 3EVCA 3T5BA 1NHWA 4BTEA 3KHTA 4ALJA 2X9QA 1B74A 2DPXA 3I8OA 4M86A 1GNLA 2IZ1A 2FI1A 1Z45A 2PSJA 5E6SA 2IKSA 5HZHA 2AZ4A 3WYEA 3IRVA 1ID1A 1IDOA 3WSTA 3AEKB 4LZAA 2FFJA 3HSYA 4PRLA 1I4OA 4N3GA 2GEDA 1Y8RB 4KKXB 3TWOA 4DRXA 2C1XA 3WZ2A 4E5NA 2WHXA 3CY6A 4Z4EA 5E3IA 4YWJA 4FFOA 3RRMA 2XRYA 3DCIA 3JQ9A 3L0ZA 1T5HX 4OGLA 3FCCA 1BRTA 3IUSA 3QBEA 4DR4B 1P0PA 3LG2A 2XYGA 4JJIA 1CBUA 2ON6A 3RSLA 1K97A 1N5LA 1XKTA 2V8BA 1CY6A 3AU8A 4KN5A 6GPBA 1B4DA 2W0MA 5I48A 1GFZA 4TVOA 2VPZA 1RRCA 4U9HS 1IK4A 3Q0IA 1DPFA 1Z74A 4GICA 4JL8A 1FYVA 1XJ0A 3EZFA 4LPSA 1SUIA 5EHIA 4G5OA 2P3LA 3IDFA 4QARA 2UUPA 3FJOA 3SLKA 3I05A 3IGFA 1XFDA 3W0LB 1E3QA 3TZHA 4JXZA 1YDGA 1UMBB 4XFKA 4H17A 1AK2A 5E9JA 2P9HA 2POCA 1V1RA 4A6EA 2G40A 4PFQA 2PD4A 4M60A 4RPKA 4ZCTA 2Z6QA 4BFVA 1Z15A 4B8WA 1PHPA 2XX3A 1X2BA 4ND5A 2XCSB 4X1KB 2PQ2A 4AT1A 1T0JB 1T2VA 3BXFA 1P6UA 3OT5A 2OGUA 4J29A 4J0DA 4N5NA 4U9IS 5EXSA 1D4AA 1UBLS 4RZQA 5HKLA 3V8BA 2GN0A 1IAQA 5BQPA 5A4DA 1E1KA 3T7SA 1V7CA 2YY6A 2X5NA 3GUHA 4O0LA 2R4QA 4MKIA 3W6ZA 4RTNA 1JYSA 4YCJA 1JQLB 3TX6A 1HV8A 1KNQA 4BPBA 3PFCA 5DI9A 4MJ7A 1W4CA 3QLTA 3R09A 2RARA 3ZWXA 3CVUA 4PG7A 1AQUA 3CRMA 4M22A 3RSGA 4NK5A 3QFCA 2NT4A 5K3FA 1SZPA 2E1PA 1IYZA 3NIBA 5BN4B 1SOVA 1DU4A 4R05A 2R6JA 1SD5A 2W6QA 5DK6A 3SSAA 1I1NA 1KQPA 1XP8A 3VC2A 1U0EA 4C78A 4EPRA 2D59A 2PUEA 3K72B 2WIFA 1V4NA 3NHAA 3QW4B 4Q1VA 2A57A 3ZIUA 1MT0A 2IHTA 3QJ5A 1UJ6A 3F5QA 5A04A 5E6SB 3OAAA 2GT1A 3PFGA 1XF1A 3HNOA 4IQ8A 1CPYA 2AYYA 3H9CA 3JAWA 1QHHA 1H22A 1LNQA 2HLNA 2YWHA 4JBWA 4OBEA 5TF0A 4DRXB 2E89A 4F6LA 4YT4A 1VL8A 1NU8A 4PC2A 3BFXA 5DCLA 2EBWA 3N2GA 2JAWA 4OAOA 1G5HA 4WXHA 2NW6A 3LF2A 3VI3B 3NLLA 3PDHA 3WI7A 5DO9A 1O3YA 4EY6A 2O59A 1RMQA 3MCAA 5AVQA 3JQAD 2JI4A 1E6CA 3GG2A 3R5SA 4NYJR 3QE3A 1GL6A 1ENZA 5B3JA 5CDTA 2AI1A 2CKDA 3QNMA 4RANA 5TDHA 1PZFA 3R3ZA 2HA5A 1E2PA 1WWKA 4JVSB 5D01A 5DXAA 1AHPA 1FVOA 3BIWA 3DAGA 2CBZA 4JP1A 3MWDB 3SDBA 5B12A 3AW8A 5FUWA 4KXUA 1UDXA 3OJCA 3HVIA 4A6PA 1D09A 1Q15A 3TTXA 4AI6A 4RK1A 4AKEA 2IHJA 1V1RB 1LSSA 2AL7A 5K3SA 3T15A 4BNVA 1DC7A 1AGNA 1JKMA 2YHSA 1KA9H 4B9EA 5G4KA 2BN4A 1XZJA 4QUIA 2BUBA 3LY5A 4KQWA 5HM8A 2JGRA 3FD8A 3KAQA 3KKMA 2FUNB 3BD7A 3DSRA 2QN9A 5AO9A 3RS9A 3TL3A 3RH0A 1U7TA 5DHSA 1K7XB 2GTIA 5FUVA 1OI3A 4H4EA 3AV3A 2UZ4A 1Y6GA 5TQ2B 2CV1A 3DP7A 2AFVA 1H2WA 2HLDD 2V8OA 2GGSA 4Z1MD 3BGOS 4Z7NB 5JNTA 4O2RA 3VYVA 1M2WA 4FT2A 4OSEA 2Y27A 3WWDA 4O1IA 5B6IA 2BIFA 3JQ9C 2R47A 3NHYA 3W05A 3ZIDA 5IBPA 5KQRA 1G7CA 1TW2A 1XJQA 1HQDA 2FHPA 1S2DA 4MCIA 4PGHA 2JD2A 5B1SA 3SLGA 2DEUA 3LTEA 1NBME 2WQ6A 5AXBA 2Y9PB 2C4KA 1HDOA 1P8AA 3H8VA 3LRXA 3TBKA 5CVUA 4NYMR 5LZ9A 4MIOA 2AG6A 4RBNA 4YJFA 2FWRA 2QR2A 3FHLA 5ADHA 3RS0A 3BRCA 3E23A 4XQ0A 5I7SA 4PLVA 5K4GA 2FQQA 1ZDMA 2QYOA 2I34A 2ZYVX 4EATA 1H2EA 4RHCA 2WQ7A 4B4DA 1ZC3A 1EK1A 4CIWA 1FE8A 4JWKA 3OJEA 2P35A 3D5EA 2I99A 1T9ZA 2IT1A 3B38A 4XWTA 5EHNA 4OD0A 3DXYA 1NW5A 4HS4A 1YB7A 2JFFA 3F7OA 4KODA 4I5IA 4I8XA 2VHJA 3AR9A 3K0FA 2COKA 1IMJA 3M5DA 4N3AA 2BEJA 3COVA 3N2GB 2W7TA 5BV2P 3OVMA 3T7AA 2Q28A 2PX5A 4QXMA 1ZJJA 3G9ZA 4QA9A 4Z2YA 3B85A 3TS1A 1ONSA 3FTDA 3EDQA 1R37A 5EWLB 5ALHA 2XUKA 1TJPB 4UXHA 4R9SA 3SLRA 2EERA 1UDBA 3TM4A 5AHOA 3E9ZA 4BFLA 3VNQA 2O2JA 4NONA 1UBSB 3PNBA 4Z4CA 4UPEA 1RHQA 2JD1A 3UH0A 1HH4A 1W6RA 4DSTA 5JWRA 1N1EA 1C8KA 3QHQA 3TGLA 4TMYA 2K87A 5KYKA 4ZO9A 1MVNA 5E8RA 1N2OA 5F2EA 3W8EA 4B81A 3O03A 3LLUA 2XA9A 3E2PA 4Q9AA 5HIIA 4HRXA 2RAFA 4PCUA 2HF8A 3IJEB 5G4KB 3ROQA 2ONYA 3CUYA 3HTXA 3WQBA 5AM1A 4B4UA 3WGIA 3R7SA 3IE2A 3KQQA 2ODPA 4ZU6X 3SG0A 5D3MA 4IS3A 5JI3E 3C39A 3ER8A 1L1FA 4H7IA 1IY8A 1GZDA 2Q50A 2TS1A 1GKYA 5AQEA 5CJJA 2HX1A 3NETA 5HF5A 3SSOA 4EW1A 2CLOB 3LXRA 1NDUA 3G5LA 3KUKA 1B1CA 1PDWA 4FLMA 1YRQA 5LD2B 5I8PA 1CB7A 1LLUA 1VE5A 1GJRA 5JYCA 4YAFA 1R16A 3L05A 4PZYA 3FCYA 3W2IA 4LWQA 4OU4A 5LP1A 3VNVA 3EMVA 1G291 1GR0A 3IS3A 1I10A 1QK5A 2OUKA 4E4YA 1CQXA 2IX9A 1H8ED 2X5JO 1PFQA 4PHTA 4EITA 5B3JC 1X7HA 2ZPAA 3RVKA 5K0FA 2XNCA 1N2EA 1QTNA 1QS0A 2GVZC 3PENA 4LDRA 4MP6A 1PQYA 4X90A 2VHZA 4YJFB 1UEIA 2KM1A 2OA0A 2R8OA 1AGPA 3EZ9A 4QVKA 4DMUB 4J2TA 2VKQA 3MWJA 1AHIA 1L3BA 4GPZA 3ZZ1A 3ZK7A 4YBZA 1AS2A 1XMPA 1NBHA 1DWOA 2IYSA 3ETGA 3TOSA 1IN4A 2Z2YA 5CCDA 4D6XA 4LNUA 5KSOA 3K0FB 1B14A 3BG5A 2R6GA 1FQKA 1SEPA 3PNSA 2EFHB 5DHAA 1XYYA 2FK7A 5EP2A 3CZ9A 4TRNA 4UZFA 4A8TA 3PVSA 1ZCAA 2VLBA 4CM1A 2JJMA 2ZROA 4R98A 2HU7A 3PGJA 4XJSA 2BCGY 2WVHA 1U2ZA 1AURA 3D3KA 2YIJA 3FNIA 4G2TA 1KSFX 3SR3A 4HTAA 4D9EA 5AT1A 3D31A 1XAGA 4G97A 1GDTA 4IIEA 1MAUA 1B41A 4B35A 1NFRA 1T2NA 2R7AA 5K05A 2C9DA 3D81A 1JWAB 3DT9A 1Q7CA 1Q6YA 2ZRHA 4C14A 3E0QA 2I4IA 3QVVA 1MJNA 4AX4A 5HZKA 1AJEA 2GPAA 2J5XA 1UWCA 5T64A 4CKEA 3GLQA 2AVDA 3B48A 1L5KA 3U4GA 3M81A 1U04A 1VL1A 1GNRA 4DMCA 3FIUA 1QE0A 1ZD3A 5J9FA 3TJMA 2P1ZA 4RTRA 4F6RA 1G64A 1GQSA 5D3MB 3GJ4A 2B5VA 4B3BA 2UDPA 4X3CA 3Q7RA 1E2BA 2PKQP 1XTUA 3F4KA 2V7WA 4YH1A 2WZQA 4HQNA 1IU9A 2AW5A 3TLMA 4I5GA 1MV8A 2R6ZA 5CIWA 3PC7A 2VT6A 3SSMA 2PZ8A 4I55B 4YJHA 4CIVA 3I4CA 5F33A 1J24A 4ZVTA 5CCEA 5I5EA 4ZV9A 4C6RA 4U8GA 4M9RA 2VOJA 3FH0A 3AKCA 1JU4A 3RTBA 3UJAA 2H4JA 3AHGA 3LH5A 3U7EB 4BNDA 1FW8A 2RD2A 4KUHA 4DLUA 2DH6A 4AN1A 2YMLA 3AVUA 5FLKA 2V7GA 4F46A 1Y9AA 4MRSA 3VUFA 1A2QA 1QS0B 4JBYA 2JFVA 4HWPA 1AVTA 4JLSA 1MOSA 3U3RA 1C0IA 1FJ2A 2I1QA 3MQ4A 4N5HX 1W5BA 4LVUA 1UT8A 2ZYTX 4W1PA 4BUJA 2C8KA 4F92B 1GVNB 1FRNA 2HJSA 4GWGA 5AXDA 4EI8A 1ZIDA 2GN9A 4YROA 1TRHA 3HBFA 3QENA 5JZOA 1KQ3A 2ZR8A 4BMCA 4NENA 2ZWIA 4JZYA 5C35A 3GVCA 1RWXA 4I4NA 1RYEA 2C3OA 3PX2A 3OC6A 4LNUB 3REOA 3VR5D 1RSZA 4F4FA 4UAJA 4UBNA 3K0BA 2WJWA 3B20A 1W0JD 3FPHA 3NZEA 1V7ZA 3KLOA 2LCIA 1MJHA 4HR7A 5KNBA 3PPYA 1D0VA 1J49A 1K8XB 3NAQA 4IM7A 4MUYA 1KVSA 2EATA 3A06A 4NU6A 1I5RA 2BT4A 4UBKA 1NVBA 1G3MA 3RM3A 2QW0X 3FWYA 4QDUA 3AINA 4YXFA 2BFEA 5E7JA 4AP6A 1N1GA 4KBYA 2Z56A 2X0RA 2H59A 3IQEA 3QW2A 4RA6A 3RU3A 5K6AA 4MV8A 1EUCA 1YV9A 1QOPB 3NAZA 3DA8A 2DRIA 2V58A 621PA 4LX0A 3A4IA 1XK7A 3JQPA 2A7QA 4FFVA 3A36A 2JGKA 1OD6A 4AJ4A 4QGBA 1A5SB 2C5HA 3TQFA 4BCBA 2DB3A 2IF0A 5K8VA 2OGSA 4RFLA 3UGJA 3V1KA 2V7QA 5AK3A 4CKEB 1NFFA 2XE7A 4TN5A 8LDHA 2AG0A 3BXHA 3JWGA 3GAAA 3H97A 1YL5A 4RPJA 4TKUA 3UYKA 2VNKA 4KNVA 1UL1X 3RIXA 3K0AA 3T7IA 4TWBA 3KSBC 1FY2A 1B0AA 4F6RB 2RCNA 5J3JA 3T7EA 3TE6A 5JJLA 3GH1A 2PU7A 3D6VA 1V1JA 2Z5VA 3AETA 4IIJA 1NE2A 4XWKA 1DS6A 2FEOA 4LJ7A 4QOHA 1G16A 4JOCA 1VCHA 1VRVA 5AKLA 3C4QA 2HAEA 1CY0A 1ZRMA 1DRUA 2FPIA 4BTLA 3HGTA 2VRCA 5ALGA 5BT9A 1VLZA 5C34B 3HVJA 1WTAA 4ZXFA 1ADCA 3IIMA 2QM3A 3OT1A 4B2PA 2JGNA 2CEAA 2HHAA 1YSCA 4BNDB 3JATA 4D3DA 1ZBDA 3CGGA 4FN5A 3WQSB 4WK0B 3LKBA 2GXAA 4MUKA 4RSRA 4LZLA 2C58A 2LDXA 1HEIA 2GEUA 5IC5A 4NFYA 2Q0HA 3G13A 1PL6A 5JBQA 3HK2A 1MB9A 2I4MA 4LYYA 1DNPA 1YJBA 4MAAA 1FK8A 3AVTA 4EUNA 4A6XA 3UFBA 3L6RA 3D7MA 2ES4A 4ENRA 2YL2A 5COBA 3K4HA 3HEMA 1MNAA 3TCNA 3W4JA 1WZ2A 2AI3A 2YY7A 4NENB 3V1LA 4WKBA 4TS3A 3PRHA 3ZLVA 4AJEA 1E6WA 1XTVA 2KPOA 3WYBA 3JAKA 4RY0A 3SXUA 2I3GA 1N9GA 1ZJYA 4Z2AA 3VTAA 4IOMA 1OWOA 4MOWA 4CQMD 2IEZA 2DT5A 1O94A 3I2GA 3RO7A 3WS7A 1GGKA 3E82A 3S28A 3EGOA 3KUUA 5DISB 3W04A 3W90A 1GU1A 2OHIA 1TLLA 1XXHA 1T9HA 3WWYA 5BSWA 3MMSA 1I30A 3RYCA 4BFZA 4BYGA 2EGHA 4RA6B 3AXSA 1YZYA 1EUCB 4UE6A 1ZR4A 1PQUA 1JAIA 1VMKA 1O0SA 2JZCA 3BEDA 2RK6A 1KJQA 3RLFA 2GJSA 1PFUA 3ZWWA 1N2CE 1U9JA 1TF2A 5SY6A 4WNIA 1CJTC 1RAGA 4CM9D 3NHPA 2VS1A 2IYRA 4PM4A 4YALA 3UK0A 1LKZA 1EFTA 3IUBA 4ZCQA 4L4UA 1KZ6A 4TKUB 4C4PA 4ENPA 1U63A 3K0AB 2P7IA 2RI1A 1RZUA 1XPRA 4FFBA 2HRZA 3GBSA 3QNWA 3UAOA 3P7MA 2GS9A 1YVRA 2ZSFA 1ZWLA 1T13A 2R8ZA 3DB1A 2V74B 1U0GA 3AETB 4HSEA 5HUJA 4PHFA 1EXWA 1BVYF 3JR3A 3GJXC 4CR6A 3AG6A 1NPDA 3PUKA 3NCHA 4RCVA 1QR6A 1ZMBA 4BVFA 5JYBA 5A2QA 2BYTA 1OZFA 3SS8A 2FPIB 4B3CA 4K9QA 1PYOA 1PR2A 2I65A 3U9LA 4GIBA 1KI3A 1C5KA 3T99A 4D8WA 2PZJA 3OT1B 2PX6A 3M4YA 1E96A 1XPUA 3JATB 5CVEA 5FBLB 2VF8A 3R9WA 4RNCA 3IERA 4CIBA 3G17A 5K6AC 5KOYA 3HYRA 5LQDA 1Z2NX 2IYTA 1MJGA 3EG5A 3M1YA 4QT0A 1NIJA 2G17A 2YR0A 3F6BX 1Q0PA 3D6HA 5FA6A 3QLUA 1M2OA 1JAYA 2ALJA 3LC7O 2Y6VA 4L3VA 3LQRA 1J8DA 1NMQA 2VUSA 2SHKA 3B1YA 4B6OA 2EWVA 4HXFB 3ZPXA 1NUUA 3U7RA 3RIMA 1WW3A 3COSA 3PIRA 4HQRA 4XCXA 3U3JA 4PYOA 1ISSA 4G1UC 3SXUB 4RTOA 1QGZA 3AF1A 3OFND 1N9GB 1ZH8A 1I7PA 1EFRA 1CIVA 2B2XA 3BL5A 4NNPA 4R2XA 1Q7RA 3WNZA 4EI2A 5BWMA 5IVKA 3EVEA 3C87A 3GWGA 1MQSA 1P77A 1U7OA 1T2DA 3E9YA 3WSVA 1JALA 1FTNA 3SDSA 4O2AF 1FF9A 5ITVA 5AW5A 5EMNA 2F3TA 4GO1A 1CUGA 2YJ6A 3A6PC 1KNXA 2H54A 1KEPA 1R4MB 5CBKA 2R6CA 3KU4A 5KYWA 3FRJA 1JB9A 4IH4A 4HNVA 3ZKWA 1PNVA 2NO1A 3ZUGA 1IXRC 3UAVA 3EAGA 3Q3VA 2NZJA 5HPYB 2WTMA 5BPHA 2FCAA 4ESVA 2IV2X 1K9VF 1D0SA 1YOVA 1NJGA 1WDTA 3SC3A 3IUYA 1HT3A 1ZCFA 1XHEA 1V5GA 3VR2D 2CK3D 2WWFA 4GSLA 5KTKA 5L3SA 4IMPA 3IOBA 4YB8A 1G9XA 4MI1A 2IE0A 3UBMA 4G65A 4QICA 1JN0A 4A8HA 2RHRA 4EGQA 4ZZ3A 2Q5OA 5CX4A 3IP8A 4TRMA 4YCCA 5BV0A 2CDBA 1OI2A 4FVTA 3DP9A 2Z8ZA 3PGLA 4K6FA 1D2EA 1XO1A 3BH0A 2MCFA 3UWKA 3C3XA 4NJMA 1JDNA 2R66A 2UVPB 3WIBA 1O94C 5M5BA 16PKA 1AXGA 3QA9A 3VGPA 1WA5A 4FUTA 5KSPA 3WRVA 3OWXA 1ZH0A 3IDZA 2MR6A 3GEDA 4ZU1X 4DJTA 1FVFA 4Y30A 4FJ2A 1QHXA 4PQFA 2QSUA 4I1RA 3NBQA 1FPMA