4R68A

Lactate dehydrogenase in complex with inhibitor compound 31
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of 5-(2,6-dichlorophenyl)-3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
total genus 115
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r68A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4r68A02
3UXYA 3P7MA 5EERA 3ZV4A 1WDKA 1P33A 4DIFA 3V8BA 3DO5A 2DPHA 4EZBA 3IP1A 1T4DA 4BNYA 2V6FA 2X86A 1UP7A 2OO5A 1YS4A 2VUTA 3IAHA 4RDIA 5T8KA 3LC1O 1R4MA 1SOWA 1UXKA 4RJTA 1M2WA 3WFJA 3PGJA 1R16A 4EUFA 1Y81A 4IDCA 3WNQA 1R37A 1QYCA 4J4BA 3VKVA 1E3LA 3W8EA 1R0LA 3PP8A 3C7AA 3CMMA 3W4JA 1EDZA 2B37A 4XR4A 4E31A 4FR5A 1QKIA 4UVGA 2FZEA 3QLJA 4O1MA 3ZGYA 2DTXA 2OMEA 2ZTMA 4RF4A 4OO3A 2B35A 3BHJA 4NMHA 4YVFA 5KVVA 3VTFA 5ITVA 1ISHA 3CZRA 1KIFA 2OORA 3GUCA 4Z9XA 2QRJA 3F3SA 3SC6A 2GCGA 1PS9A 4A0SA 2HRBA 2DLDA 3KZVA 1X13A 1ZCJA 1X0VA 4YT5A 1UJMA 1Q7GA 3HSKA 5CDUA 4MVJM 1MC4A 2J3HA 3DR3A 4GBJA 4M87A 2WD7B 3FI9A 3FPCA 1ADGA 2GDZA 1MB4A 4QQRA 2D4AA 4G2NA 3WTBA 3PHLA 4BO0A 3DOJA 2HMUA 2B36A 2VHXA 3AY3A 4NBTA 3MTGA 1AXGA 4GSKA 4U6QA 3GEMA 2VZ0A 1E7SA 5C3MA 1UUFA 3QV1A 4DMLA 4CR7A 3VVBA 1YKFA 4DPMA 4J91A 2FWMX 4OXNA 4W9NA 1U8FO 2GZ1A 2Y1EA 1C0KA 2LDBA 3I9NA 4ZU3A 3OJLA 3I4FA 1F06A 4RLSA 4K6CA 3PK0A 3RU7A 3IC5A 4OYRA 3S2IA 4XWYA 4A7PA 1LJ8A 5T6BA 1NR7A 1VJ0A 1MLDA 4NFSA 1DIGA 4PLYA 3QVSA 1WAMA 2VWPA 3GGGA 3TL3A 1ISJA 3DWFA 5GY7A 2J5QA 4XDYA 5HS6A 3O26A 3PQDA 4YT2A 4E3ZA 3PWKA 1QYVA 3HQ4O 1OC4A 4NI5A 1LLCA 1P31A 2CUKA 2B4RO 1H2HA 1HLDA 1EVIA 2NVWA 2O7SA 1DLJA 3MJEA 3GFGA 4O59O 2VRBA 3H3JA 4B8WA 1S6YA 5JBIA 3FNEA 2YV1A 2FMUA 3HADA 2W2KB 3KO8A 3QIVA 4J4TA 1BXGB 4WCFA 4Y98A 1IPFA 3JTMA 2HK7A 2YHIA 4NPCA 4ZN6A 5JXWA 1GPJA 3D1LA 3GNSA 1JTVA 4MVJD 4NR0A 3VPHA 1XQ6A 3R3JA 4CR6A 2X1HA 4YR9A 3ANMA 4IDFA 4YAGA 1JN0A 1GQ2A 4D0RA 1E3WA 1E5QA 4WKGA 1HDXA 2IXAA 4ALKA 3VKUA 1ULSA 4UREA 4X54A 3TPCA 1O89A 3PJFA 1EQ2A 4A27A 3WQQA 1VJTA 4U7WA 2BI7A 1EE2A 4HKTA 1GUFA 3SXPA 3PEFA 4CV0A 3PQFA 4ZD6A 1DC3A 4WPGA 3WGOA 3O38A 4PVDA 3DBRB 2ZYDA 1A7KA 1I8TA 4M8SA 1GV0A 1XYGA 3E5MA 1ISGA 2POQX 4H3VA 4RPGA 5THKA 2C29D 1IPEA 4DQXA 2PWZA 5JNLA 1PSDA 5G0SA 3CPSA 2JCYA 4WCDA 5THQA 4YJFB 3RUAA 3U62A 1B0AA 2Q2WA 3TZ6A 2EKQA 4NU6A 2EGGA 1PQWA 4BQRA 2GERA 4DC0A 4HUJA 1KY5A 3KYDB 2QW8A 2HK8A 3GAZA 4KDFA 2DKNA 5T64A 1ZSNA 1PGOA 4FFNA 1Q0LA 1QRRA 4OKIA 4ZA2A 1DRVA 1RM5A 3OQBA 4IGEA 8LDHA 3H2ZA 1FDSA 3L4BA 4AJ4A 1EFLA 1B8PA 2OOSA 4GLOA 2VRCD 1XQ1A 2P9CA 4RVHA 4E2XA 1WLYA 2I99A 1V3VA 1RPNA 3VZQA 4NDNE 1MGOA 3PGXA 4PZEA 2GO1A 3S1LA 1IULA 3OIDA 1DOHA 3WXBA 1BW9A 2C20A 2OZPA 4M54A 3GMSA 1XA0A 3NYWA 3TZQA 4CLOA 1XSEA 2Z1MA 1SAYA 4Q3AA 3MJCA 3RVDA 4FD3A 4J2HA 4PG4A 5TJHA 1U4OA 1RM0A 3OJEA 1C1XB 3L6EA 1O8CA 1IB6A 2BHLA 1QSGA 1TI7A 3IJRA 1VL0A 4P4LA 5ER9A 3T4EA 1NYTA 3WJAA 1Y8QB 2GN9A 1W4ZA 1YB4A 2Y99A 1VC2A 3QWBA 4B3HA 9LDBA 3RJ9A 5K9ZA 1Y9AA 4DPKA 4FJ2A 1P1JA 1LDMA 4Y6RA 1BW9B 3ZNPA 4KUHA 1ZXBA 1UXJA 1PIWA 2OHXA 5IDWA 3DOCA 3Q2IA 4CQMA 5AOVA 3L6OO 1AXEA 2P2SA 3MZ0A 2B83A 3AFMA 2AMFA 4JROA 4E4YA 1LU9A 4ZQHA 2FN7A 5T57A 4UEJA 1F8FA 3JYPA 1PJSA 1ZK2A 3UICA 4O63O 3A14A 4IXWA 3QVXA 3QQPA 1NQAO 4E5KA 1X14A 1TVEA 2UV8A 2NADA 2DAPA 5C37A 4J16A 4IJUA 3BMOA 4GMGA 4BV9A 1GUYA 3JQCA 1T1SA 5JW6A 1ZVMA 1PR9A 1I10A 4GH5A 5BSHA 2IZ1A 1R12A 2VT3A 3DZHA 5JMPA 3N74A 5A9RA 5BR7A 4YJGA 2VNAA 4BHTA 1BXGA 3COSA 3FPLA 2IRWA 1Q7CA 1HLPA 2NV6A 3JQGA 2VZ8A 1Q1NA 2I66A 1DIAA 1V8BA 2Y1OA 2X58A 4AJPA 3ZNQA 3O8QA 3QWAA 3QVOA 4OIMA 4R3NA 1NFQA 1EUCA 5CFZA 5C5IA 2GUGA 2X5KO 5A9TA 1LRLA 3H4VA 3ENKA 3TZKA 3C1TA 4BB5A 3ST7A 4PCVA 4BO3A 1DIHA 2RHRA 3JCZA 4FN4A 5AXCA 4PFJA 2ZJ1A 4JCOA 3TRIA 3I9KA 4YJGB 4ZQFA 3S55A 3ZWNA 3LZ6A 3PI7A 3ETDA 1R6DA 2Q49A 4R5HA 4EJ0A 2ZCUA 3ZWYA 3JD4A 4R41A 4Y6SA 3JYLA 5CDTA 1YWGO 4PG8A 3JQAD 4FFOA 5BQFA 4FB5A 4XYEA 1GYPA 5KNLA 3I9LA 1IZ9A 2Y0EA 1MG5A 4UVEA 2ZYAA 4WOKA 4OMUA 3ZU3A 1PJ3A 2EIHA 1DFGA 1T2CA 1NR1A 3I4CA 1ZXLA 3ON5A 4N5LA 1LDEA 1W8DA 1EZ4A 1YOVA 2VRCA 4AJEA 4UVDA 4DQVA 1Z75A 2P4QA 1T26A 4Q3DA 2A35A 4Z0PA 2EF1A 1V0JA 1Y1PA 1DJQA 2V6BA 4I8XA 5BSFA 3PDJA 2EWMA 4JBIA 3ADPA 5DZSA 4CLRB 3ABIA 4TVOA 1C14A 3GNQA 4XRRA 3W1VA 2JFFA 4W82A 3OMLA 5JCXA 4ZVVA 4BKOA 3S8MA 3ZV6A 5KCZA 2ZB7A 1JAYA 4RO0A 4E2YA 4JX8A 2FPPA 3F4BA 2X22A 3E1KA 4E2WA 4GX1A 4S1VA 1KOLA 3LSYA 4J7CA 5IN4A 3HJAA 4CL3A 1PR3A 4CPDA 4PLZA 1T25A 4CM7A 3LT4A 1GDHA 3KEQA 4PIVA 1K3TA 2BFPA 4BL5A 2IDZA 1CQIA 1XELA 3GZNB 1PGJA 1NAIA 4CUZA 3BMNA 4PLCA 3G49A 2VZ9A 4WLOA 5C7LO 4KZPA 4YT8A 2J3KA 3GK3A 1ML3A 3F1LA 2GN8A 5TF4A 3FSRA 2B4QA 3ICCA 3PZRA 1UXIA 3BHMA 4R9RA 2Y1CA 9LDTA 4XYLA 2NM0A 2G5CA 3S2EA 3OETA 1K0UA 3NT5A 4CQLA 1Y5RA 3UF0A 2GASA 4HNHA 3HZZA 5DBIA 1CRWG 4FJ0A 2IODA 1CIVA 1I36A 4BNUA 3HFGA 3GGOA 4U8GA 2BFMA 3RI3A 2C07A 3BMOB 1GFSA 2C0CA 3DTYA 2EW2A 3TL2A 1VL6A 3UW3A 4L4RA 3LK7A 3K8ZA 1DHRA 1OI7A 3PJEA 2DT5A 4Q3NA 4TQGA 1UXGA 4DIBA 2IXBA 3AW9A 5DULA 3ZU2A 2BF7A 3L07A 4LGVA 1HYEA 3CKYA 2E37A 1OZAA 5JAIA 2G82A 1IE3A 2ZATA 1LX6A 1AHHA 3CMCO 3LDHA 4OQYA 2Q99A 3B6ZA 4ND5A 2WYVA 2DU8A 4E30A 4MP3A 3WNVA 1C3VA 2QZ9A 4QO8A 2VHYA 1KEPA 3EYWA 3VPFA 2QG4A 3K96A 1WMBA 2CY0A 1E7RA 1ENZA 3OH8A 2CVOA 2XOXA 3GH3A 5IXYA 4N5MA 4QFDA 3TSCA 3GVPA 3JQ9C 5J23A 2BGMA 2XAAA 3Q9NA 4UUMA 5AXDA 5BNIA 1E6WA 4JIGA 5L7WA 1ORRA 4JLWA 3ANLA 4JBGA 1YQXA 2EW8A 2HAEA 3JD3A 1BMDA 2ZK7A 5JC1A 6LDHA 1NHWA 3LT0A 4RZHA 4P4GA 1R0SA 3IUSA 3EAGA 5A3JA 4KUEA 1LBEA 2C59A 1PTJA 1CDOA 1HYGA 4LRSB 4QTZA 3DBRA 1LDNA 5L7YA 3K5PA 3BYZA 3GFBA 3VPSA 3JQGB 1P9LA 4JP3A 1C1DB 4CQMD 4W6ZA 3U4IA 3UOGA 3RUIA 1WZIA 2CD9A 5IJZA 4AG3A 1HXHA 5B4UA 2PKRA 3OIFA 3T7CA 3H7AA 4YACA 2HMVA 1JQBA 1N8KA 3S2GA 4M86A 2GGSA 5EJ2A 4YPOA 4CV1A 1XDWA 5TQVA 3EZYA 1UDBA 2I5PO 3F1KA 4GSLA 2D0IA 5JS6A 4Z9YA 1GUZA 1PZFA 2FR1A 1AUPA 5BT9A 4D3SA 1FF9A 4EEXA 4ND3A 4CLEA 2C2YA 4E21A 4B7UA 2DUWA 2CVZA 3HNPA 2CMDA 3FN4A 3ZWAA 4BKPA 5TIIA 2AQ8A 3BMQA 1FDVA 2YV2A 2Y0DA 1KEWA 4YQZA 3PIIA 3DEYX 3ITKA 4LSMA 3EUWA 1X7GA 2CDAA 1NQ5A 4MIOA 4XEHA 3UCFA 1WNTA 4YB8A 5CDYA 4W7IA 4DLLA 4ND2A 3UHAA 1RYEA 3FR8A 3GHYA 4IQGA 1PL6A 3CH6A 4WLEA 4MVJP 3NV9A 4UVIA 1L1FA 4BVAA 1Z73A 4CLOB 1E1NA 2BGKA 4DC1A 2DBZA 2RAFA 4Q3EA 3BMCB 4RVFA 4Y67A 5JCJD 1UH5A 1E7WA 4L74A 1GR0A 4NK4A 1QP8A 2X5OA 1NPYA 4MPDA 2I6TA 1SO8A 3KSUA 3NT4A 4OSPA 4YJDA 2BFOA 5HTOA 4LRTB 1H6AA 3S2FA 3ZWBA 1WW8A 1KS9A 4N5NA 4XGKA 1M6HA 2UUPA 5G4KA 4JJFA 5LDGA 3ZWOA 1EBFA 4DMMA 2UDPA 2WWRA 2RH4A 4AFNA 5ADHA 4DRYA 1N5DA 2Q45A 5CPBA 1YJ8A 4J1NA 4JJIA 4R1UA 4MVJI 1ZKMA 2GLXA 3D5QA 4BO2A 1JDJA 5KOIA 3R0IA 3D3EA 3FNHA 4W9NC 2NU9A 3FBGA 1B7GO 1E7YA 1SBYA 1YO6A 2AXQA 4Z3KA 3TF5A 4E5PA 3FR7A 4BNXA 3DHEA 3G79A 4LCJA 4YDRA 4BNWA 4BKRA 3MOGA 3DMYA 1QORA 3D0OA 5A04A 3MJTA 5HRUA 4YA6A 1XIVA 2ZB8A 3RJ5A 4MVJA 2X0IA 2D5AA 4J9VA 2IE0A 1A9ZA 5KJ6A 1HE3A 2ZKLA 3SJ7A 4OOEA 1LDBA 1J49A 1NWHA 4JBHA 3RC7A 2D5CA 2DQ4A 4XQEA 2DBRA 3U49A 4CM5A 4R1SA 2CF6A 1XR3A 2H1SA 1C0LA 3L9WA 1XU7A 1LLDA 4S3MA 3AOEA 3GN2A 4NK5A 1JLLA 1LQTA 3WSWA 1HWYA 3BMCA 4CQMB 1R15A 2W2KA 5A9SA 2Y1DA 4D46A 3MEQA 1NFRA 1MP0A 4TMFA 1HDOA 1TB4A 3GEGA 1PJCA 3EDMA 2H63A 5HBRA 4FBGA 4XGIA 2WD7A 4OAQA 3RUEA 2AEFA 2NACA 2ZB4A 2WE8A 2RIRA 4J7UA 4L73A 3WYEA 2VNSA 4CM9A 1X1TA 2CFCA 3AM4A 4AVYA 1KC1A 5ES3A 1LSOA 1ZO8A 3DXFA 4GAEA 3ROQA 1EVZA 4IS2A 3RUFA 4BGUA 2PH5A 4IGFA 1H5QA 5BSEA 5JY1A 3IL2A 3AU9A 1PS0A 3JQBC 3LLSA 3E82A 4MJLA 1I3KA 1YOVB 4IDEA 1PEDA 5DOVA 3OBBA 3KHUA 3L4BC 2UAGA 1TXGA 2BD0A 4J6FA 4XYMA 3SX2A 3KV3O 4N18A 5GZ3A 4RCVA 2JAHA 3PYLA 1E77A 3M1AA 2B5WA 4W99A 4CMIB 2ZQYA 2PKQP 1HDCA 2AQKA 2C5AA 1HSZA 1JA9A 4QT0A 1KY4A 3A9WA 4JXKA 5EMHA 5FYDA 5CDSA 6ADHA 3U09A 3O9ZA 3ZCXA 3JQFC 1QLHA 3RU9A 4K26A 2WYUA 5G0VA 3DZFA 4CUJA 4FDAA 5CDGA 3NDIA 1I3LA 3SC4A 4AJLA 4EYEA 1YQGA 1MV8A 3SLKA 2JJYA 1A4UA 5EL0A 1LTHR 2AE2A 3MJVA 3ONEA 4PLFA 3HUDA 4H7PA 5DBFA 3L6DA 4IIVA 1HE4A 2PZLA 4NZ9A 3OHSX 4I08A 2X9NA 2YQ4A 1T1RA 1BVUA 3T7EA 1ZFNA 4PLGA 3ANNA 3W8FA 2VYNA 2HRZA 2HKIA 1GCOA 2W2LD 3IP3A 3BHIA 1U3VA 1I2CA 4OXYA 4BGIA 4E32A 4HFNA 2NU7A 3UCEA 1ZEJA 2AEJA 4A73A 2O3UA 3GN1A 4BKUA 1FJHA 1PU2A 3NDRA 4OOFA 3VVCA 2NTNA 3F4LA 3KLPX 4R16A 2EXXA 3RWBA 2J5KA 5TSDA 4G5HA 1UDAA 2J5RA 4MIYA 2HK9A 1F12A 2PR2A 1E1KA 3IOYA 5C7OO 2X7HA 4UULA 4TRRA 3NRCA 4TRJA 3KOUA 4AJJA 2Q46A 2PLAA 3DAFA 2AG8A 2ZJ0A 2RH8A 3OIGA 5KWEA 3N7UA 2AA3A 1ZMTA 3C1OA 3ZNOA 2Y1GA 3AUAA 1SB9A 3M2PA 3Q11A 5DDIP 3GDGA 4ZQBA 2FSSA 3W6UA 1ZMOA 4GGOA 4KTVE 2B5VA 2Q1TA 2PD3A 3C7CB 2IYPA 4EDFA 3U3XA 4E0BA 2YDXA 1LXCA 3JSAA 1PJQA 3ZHBA 1P44A 4GI2A 2O3RA 3CSDA 1BG6A 1KVTA 4NFHA 4XB1A 1B3RA 1VKNA 3I1JA 5JDIA 2OFPA 3H2SA 4MINA 3M1LA 1P0CA 4CM1A 5DCUA 5A5EA 5TS3A 3ASVA 3BTUA 4M89A 4CR8A 5JDCA 3FHLA 4O0LA 1OMOA 3O03A 1V35A 4IZHA 4YEDA 1GPDG 2X9VA 3OECA 1L7EA 1H6BA 1XKQA 2VHVA 4GMFA 3RBZA 1BVRA 4PLVA 1UDCA 5AQ1A 1V3UA 4DBVO 4YRAA 2NSDA 3DBVO 3PYXA 5AVOA 1EVJA 2WD8A 3CXRA 1AE1A 4BIIA 3ZWWA 2ZTUA 4R4JA 5F3RA 4TRMA 4EITA 3N58A 5JMWA 5KJCA 4I1IA 1LA2A 4DQUA 1B26A 1HL3A 1PJLA 4D43A 3PPIA 4TZKA 4ALLA 2I65A 4RVDA 4PG5A 4C7KA 1A5ZA 3EMKA 4FFRA 1ONOA 3Q2KA 4PG7A 4GWGA 5I7VA 5L7TA 1ADCA 1T2EA 3RD5A 2YHIB 4RF5A 3DDNA 2WEKA 4GX2A 4Y8VA 1PJ4A 1PQPA 5HWSA 3PWZA 4G65A 1Z6ZA 3CTMA 1O95A 1VI2A 1E7QA 4KMSA 4D7AA 3ROPA 4D3DA 2Z5LA 5BSGA 3WGGA 1HF3A 3UVEA 3WB9A 2UYYA 1PGNA 1U5AA 4L0QA 3D4PA 1NHGA 4WUVA 5CEFA 1SCUA 2VWGA 1YL7A 1YBMA 4MKZA 5H82A 2OBYA 4H16A 1WXDA 3PIDA 4MVJF 1GYRA 3PHJA 1PZEA 1X7DA 2RBEA 3BMNB 3GA0A 4YRDA 3U0BA 3C3XA 1GADO 2NVBA 1BHSA 3VPGA 4RGBA 3WDSA 2JAPA 1BDBA 2DBQA 1JAXA 1I2ZA 5T8KC 1H93A 3ZWXA 4YYZA 2PFGA 4R9SA 1F17A 5I8WA 2D1YA 4YBZA 3FWNA 4N54A 1UXHA 1YXMA 3I23A 4D79A 1DRWA 2FOIA 3IDSA 4MP8A 2DTDA 3OA0A 2J8ZA 2AQIA 3H8VA 4IDDA 5DN9A 4TKMA 1M75A 3H9QA 1ENYA 4FC7A 3KYDA 5EQFA 3VH3A 2VYND 2JHGA 3DZIA 3FTPA 1E5LA 1VL8A 3UCXA 3W8DA 4L4XA 4WCFB 2NU6A 4O5OA 4XB2A 3GT0A 3A1NA 3ZNNA 4C7JA 1PWZA 3A28A 3TZCA 2NNLD 1Y8RB 2I76A 1SEVA 4OXKA 4ID9A 4XD2A 3RASA 4BNVA 4UEKA 3BIOA 4CM8B 3PJDA 3DZKA 5KVSA 1H2BA 2Y67A 2E49A 1Z7EA 4DBZA 4F45A 4LMRA 1C0PA 2G0TA 4ALNA 3CEAA 4BGEA 2HCTA 2JKVA 1XEAA 1U7HA 5DBGA 1ZJZA 5F1OA 1TA4A 1YVEI 2GN4A 4ALMA 1I5RA 3A06A 5G4KB 2FY8A 3QW2A 4DTIA 2W8ZA 2I3GA 2PY6A 2AE1A 3FCOA 3IUPA 4Z3DA 2WTBA 3QWHA 1P77A 3RFTA 4ZQEA 3WTCA 4WEQA 4DLAA 2D2IA 4QFCA 4KWIA 5L51A 3KBOA 2OP0A 3WLEA 1CYDA 1XU9A 2JD2A 3ONDA 5IFLA 3ZHZA 4RV9A 4WASA 5I9NA 3NEPX 3KEOA 4WE3A 4B4UA 1TLTA 4BMNA 3QA9A 4QXMA 4YAKA 2ZTVA 3FNGA 2Z95A 2O7QA 3ZDFA 4E6PA 3ICPA 3NDJA 4BB6A 2ZTLA 3DFUA 4YT4A 3DAGA 4BOYA 1HZJA 2YW9A 3T4XA 1P0FA 2FPIA 1YJQA 1SZJG 1XCBA 1IYZA 2C5EA 2CZCA 3IQDB 3RBVA 2O48X 5HM8A 4BNZA 3GEDA 1CWUA 5KKCA 3RBXA 2DVMA 1Y9EA 4MIEA 3GLQA 3GAFA 3HN7A 4L75A 2H5LA 1A9YA 5U4QA 4GVLA 2QZZA 3VTZA 4CMHA 2B0JA 1DSSG 4PRLA 3JQEA 5IN5A 3ZHYA 4FCCA 3E5RA 4CV2A 1U3TA 4BNGA 4ZRNA 1WPQA 1LC0A 5ILOA 4OHUA 4IJVA 4K1LA 4CLXA 3WR5A 2X0JA 4CJXA 1K6XA 2OBNA 1KYQA 1R0KA 5IF3A 1LRJA 2AG5A 1E7MA 5JO9A 3C85A 4IXTA 2O3TA 1IOLA 2AEMA 4I9UA 5K6AA 4NH4A 2PD4A 3UAGA 3UKOA 1VE9A 1I30A 4YAEA 1NQTA 2HJSA 3MCVA 1ID1A 4UAGA 4Z6KA 4L8VA 1EDOA 3GY0A 1EQUA 5L3ZA 1E3JA 4FFPA 3SBOA 1M6WA 4OKNA 1NFFA 1EFKA 3IIEA 2P5UA 4CM4B 1N1EA 4IDGA 3KXDA 3UGKA 4BV8A 4RQUA 5TJ9A 3RIHA 1OC2A 1E3WB 3H9JA 1LNQA 3AUSA 5G4LA 2SCUA 4KTTE 3HHPA 2G1UA 5A4DA 1NVTA 2PNFA 1UR5A 1SC6A 4TRNA 4AJKA 4CMEC 1RJWA 5JFOA 1L7DA 5AXAA 4LISA 2BKAA 5FEUA 2O2YA 3QWIA 1ZH8A 2VOEA 3OEWA 3V2GA 5TT0A 4I5DA 1MFZA 1XLTA 1ISFA 2FP4A 4FFLA 2H6EA 1UAGA 2HUNA 3K9QO 4NBVA 4UUPA 5JAMA 1U3WA 4WLVA 1KEVA 4BO5A 1F0YA 2BH9A 3LLVA 4WNCA 1IL0A 4WJZA 5FWNA 3AK4A 3RSHA 4OSOA 4HP8A 3RFXA 3C8MA 4CMGA 5U9CA 4O6VA 4NQZA 4R1TA 1VLLA 2HMTA 3MTJA 5F5LA 4DUPA 1U8XX 4EBFA 3ENNA 4FGWA 4NJMA 4AJNA 2W90A 1NAHA 4IM7A 4CMBA 3VC7A 1A4IA 5L9AA 4E5YA 1ENPA 3RAJA 3KLMX 3EZLA 3KETA 2V6MA 3HFSA 1QR6A 1ZSYA 4TROA 1YDEA 1ZBQA 3U4DA 3VZPA 1GAEO 1PJTA 3HWRA 1T24A 1NBOA 2P68A 2QX7A 3DZJA 4D44A 2Q4EA 1A27A 2EEZA 3R3SA 1NVGA 3NGXA 4J1SA 1ENOA 4PLWA 4MVJH 5CHEA 2R00A 4B4OA 4MP6A 3PHIA 2EV9A 1YGYA 3GZNA 2WM3A 3I83A 3AOEC 4CMJA 4GQAA 4KWHA 4XYGA 3WGYA 1JKIA 4IDBA 1PGPA 1U4SA 4WK6A 5IDXA 2GF2A 1DC6A 1MA0A 2VTEA 1Q2XA 5T5QA 3FRJA 3I9OA 2P4HX 2EKPA 3KB6A 4MKXA 1TT5B 4XGNA 4DYDA 3BTSA 3R6DA 1E6UA 1SB8A 2NVUB 4LSWA 1Y8QA 3QE3A 1EE9A 4ZJUA 1MUUA 3P5SA 3VZRA 2EERA 3NTQA 3WGHA 4FW8A 2JD1A 4PGFA 4BGVA 4BO6A 2AHRA 1O94A 1QV7A 4RVSA 1ONPA 1Z82A 2X8LA 1VRWA 2YY7A 3P2OA 4B3IA 3W6ZA 1I3NA 2VWQA 4LK3A 4P4NA 4DIOA 4LMPA 4E12A 4J90A 3JQ7A 4RZIA 2XF8A 1TT5A 5KJFA 4BNLA 3PLRA 4KP7A 4UEOA 2JFHA 3CE6A 3C1AA 4Y9DA 3JYOA 1HYHA 5A05A 3DBHA 2DUUA 5IDYA 4BNNA 2F00A 5COAA 3IS3A 1F14A 4E33A 2BLLA 2ZYGA 4UVHA 4UUNA 4XJTA 3RKUA 3JD0A 4OQZA 1K5HA 5JPIA 5CG1A 3WGZA 3E03A 1P1KA 3DMTA 1HTBA 3TFQA 2FPGA 4J1QA 4GX0A 4EJ6A 1BRMA 1O0SA 1NPTO 3FWZA 3JQ7B 3E9NA 4ND4A 1OBFO 3FD8A 1S7CA 5U1PA 1Z7BA 2JFGA 1ZK0A 3DQPA 5F21A 3TJRA 1OOEA 2JL1A 3HG7A 4PLHA 3TZHA 4CV3A 1U2DA 2X9GA 1HETA 2CVQA 1PS8A 3DOOA 4XIYA 1UP4A 1K2WA 2HO5A 4GPD1 1VM6A 1N7GA 1WDLA 1QXSA 3TWOA 3W4KA 4E5MA 2PV7A 3ZWCA 5IZCA 2A92A 2FZWA 3DMTC 4C4OA 5JO0A 1HKUA 1CETA 1WZEA 3VDRA 3ULKA 2P9EA 2VCYA 3JD1A 1VJ1A 3TFOA 3OFSA 4XQ9A 3WQSB 2WJPA 4FJ1A 1LQUA 2YDYA 2VUSA 1R4NA 3DZGA 1GQYA 2P9GA 4DLBA 1HEUA 1LUAA 1LDGA 3WICA 3GG9A 2QIOA 3E6AA 3EK2A 2H9IA 3ASUA 3ONFA 3M2TA 4J1TA 4U0JA 1BGVA 3RUHA 4XJSA 4DVJA 4EGFA 4ZHSA 4D0SA 5JSFA 4OM8A 1PWXA 4FIZA 3ETEA 4D41A 4PRKA 2FHSA 3LT2A 1V3TA 3JYQA 2JCXA 3DAPA 3MWDB 1NVMB 3PFFA 4XRGA 3I9MA 3NAQA 1LLQA 3VH2A 2O3JA 3IKTA 3JQ6A 3WMWA 3RC9A 3ZI0A 2PA3A 3CZMA 5BNFA 3G3EA 4WECA 1J0XO 2PKQO 3INRA 3BTOA 3TQHA 4HFJA 1RM4A 1EK5A 4CMCA 4K9DA 4XKJA 3F47A 4YRBA 5DOZA 4YWJA 1GD1O 3PQEA 4JNKA 3GDFA 1YBAA 3ZW9A 1X15A 1AHIA 3EY4A 4J43A 5LDHA 1DC4A 1M76A 4F3YA 5K0ZA 4IY1A 5JAZA 2Y93A 2HLPA 1I0ZA 1IHXA 4MDHA 2EJWA 4LW8A 3BAZA 5A5FA 3OSUA 5F1PA 1GTMA 3HDHA 3NT2A 2UUOA 4A10A 3Q6IA 1DHTA 2W98A 1YB1A 3RROA 3WGTA 4ZGWA 3GPIA 3B70A 3KTDA 3JQDA 3OJ0A 3LC7O 5COQA 3GDOA 3GUYA 4I5GA 5IG2A 4CUKA 2EG9A 3DBLA 4PZDA 4P38A 3E9QA 4NG5A 5B4TA 1SEPA 1KEUA 1CERA 4BNTA 1GCUA 1DAPA 2X0NA 3X2EA 4XDZA 1LLUA 4A03A 2QYTA 3OJOA 4OGWA 2B4TO 3GZ4A 1RWBA 2VN8A 1GZ4A 4XX0A 2DM6A 1UZMA 4IQ8A 4WNIA 4XYBA 4N7RA 3UUWA 4H15A 5TLSA 2QRLA 3DBHB 1ADBA 5H81A 3M6IA 3PZBA 4A2CA 1HE2A 1P1IA 1HDGO 3QVWA 3WLFA 1JU9A 2NU8A 3QJ5A 3U4HA 4BKQA 5DP1A 5JE8A 1SOVA 5TGDA 4CQLB 3NTOA 4WLFA 1QLJA 4J49A 1HE5A 1YRLA 4XIJA 3PDUA 4WGGA 1N7HA 3ZW8A 2E4AA 4W4TA 4AJ2A 1F8GA 4BQPA 1QG6A 4XA8A 2UVDA 4XCVA 2PGJA 1H9BA 4TSKA 5BNTA 2O3QA 3AFNA 1YB5A 3AM3A 5KVCA 3FTNA 4HADA 3IMFA 1DDOA 2OP1A 1ZK1A 3AI1A 3PJGA 4D3FA 3KVOA 4YAIA 2NVUA 5KKAA 4IDAA 5L95A 3AUUA 4Y6PA 1C1DA 3ZH2A 3TDKA 1RYDA 2PD6A 3L4SO 1Z45A 3GG2A 4CL8A 4ONEA 3PWSA 4G81A 2GD1O 2X4GA 1WVGA 2I9PA 3RUDA 3WYBA 5AYVA 1CQJA 4L4SA 1P3DA 1XG5A 1R66A 5I9MA 2X0RA 4FGSA 4IPTA 3WX0A 2ZCVA 1N9GA 1GL3A 3WG9A 5A06A 1DXYA 3KSDO 3WWYA 3ZN2A 4KQXA 4J0FA 4ITUA 4B7XA 2FR8A 5FI3A 2GN6A 5G0TA 4E2ZA 5DCWA 2VYVD 2C54A 1Y7TA 3E9MA 1JW9B 3JQ8A 4NBRA 5LC1A 4NBWA 4BO8A 2AQHA 1ISMA 1ADFA 1WDMA 2J3IA 1SPXA 4ZRMA 4PLTA 5IZ4A 3INTA 5FF9A 4A26A 3OQ1A 2Q2QA 4R69A 1NQOA 2Q2VA 3GVHA 4I5FA 5I9LA 4IUYA 3H9EO 3DTTA 4CODB 3I3OA 3NUGA 4HY3A 5JY6A 4NJOA 1FK8A 5TRTA 3JQFA 1OFGA 1CEQA 1XWFA 5TX7A 2YYYA 2ZB3A 7MDHA 3VHRA 4LCEA 1QV6A 3OEYA 4R3WA 2FRDA 2HU2A 1U28A 2OL4A 3GRKA 2CNBA 4OL9A 4QECA 1DFHA 5CEJA 1D8AA 1Y5MA 3AOGA 4TKLA 1P1RA 1D4FA 1DIBA 1KVQA 3RUCA 3WJ7A 5KJEA 3K2BA 4R1NA 3LVFO 4Q3CA 5IDQA 3WYCA 5AXBA 3WGQA 3LQFA 4YJHA 1O5IA 1G0OA 2YFHA 2V7PA 3HB4X 1R4MB 3GVIA 2CDBA 1Y8RA 2WYWA 2PGDA 2B69A 4FQ8A 4GWKA 3AI2A 4BNIA 1HSOA 4HFMA 3ZU5A 4XZ3A 1U5CA 5G0WA 1V9LA 4YTEA 4GX5A 1JVBA 4DYVA 3I5MA 1DC5A 2O2SA 3IJPA 3EVNA 4I9HA 4U0KA 4B3JA 1B8VA 2E6UX 4J9UE 4FPXA 1DB3A 2BELA 5CEEA 1J6UA 4GKVA 3D4OA 1VSUA 2QRKA 4URFA 5ICMA 2EP7A 1MG0A 5HA5A 1N2SA 2HQ1A 3AUTA 4JQCA 3HDJA 1B15A 5L4LA 1E6EA 3NJ8A 2VUUA 2BFAA 1LEHA 2I3AA 2XPCA 4RQTA 1E3EA 5F5NA 3RKRA 3L0DA 5CAEA 1YBVA 1FDWA 1GV1A 1EVYA 2Y68A 4HX5A 3WOHA 1VKOA 2D8AA 1LSUA 4NIMA 5B12A 3V1TC 1PL7A 1NWCA 3KYBA 1U9JA 4IBOA 3DZBA 4ROSA 1A71A 1DRUA 2JCVA 3V2HA 3OQ6A 5I8ZA 2G76A 4FC6A 5DF1A 2XXJA 3VPXA 4Q9NA 1Z74A 3MWEB 3QWFA 1O9BA 4D42A 1HRDA 1PQUA 4GLLA 2EGHA 1YL5A 2NQ8A 3NKLA 5DNAA 3RCBA 4RLHA 2R2GA 4I9NA 3SJUA 2VHWA 4OJNA 4CM6A 3Q0EA 3QRWA 1JWAB 1LRKA 2YJZA 4JJGA 4QSMA 3NJ4A 4DWVA 5MGBA 1D1SA 4FFMA 3GVCA 3WQRA 4BMSA 1FDUA 2Q1WA 5B37A 2Q4BA 3BXXA 3TN7A 3GHHA 4F6LA 5EQDA 3GC6A 3H5NA 4EJMA 1LC3A 3DHYA 3GVXA 3I52A 1VSVA 2HMSA 4HFRA 1FDTA 2X23A 3HB5X 4RPJA 1B14A 3HN2A 1Q0HA 1N92A 1HZZA 4RORA 1NNUA 1BTOA 1EUZA 4IJWA 4U6SA 5IXSA 4XQGA 5GZ1A 3PFWO 4Q3BA 3WFIA 3KYCB 4RF3A 2PK3A 4WOJA 1JWBB 2Y05A 3DONA 1VPDA 3B1FA 3CINA 2C7GA 4F46A 4NHEA 2TMDA 3RQSA 2EJVA 1D1TA 2R6JA 5H83A 1EEHA 4RVGA 2D59A 5JC8A 2CSUA 1H6DA 2VHZA 3DL2A 3GGPA 1Y6JA 4DL9A 4AICA 1HDYA 3WSVA 1P1HA 4HWKA 4Z9FA 4F6CA 3R1IA 4D45A 2JD0A 4L76A 3F46A 3UFXA 1I32A 2E82A 5JYEA 5A3VA 2AW5A 3EC7A 5DCYA 4B79A 2QHXA 1UP6A 1SNYA 1PZGA 2QQ5A 4J3FA 1J5PA 1ZSVA 4QO7A 4AJIA 1K89A 3BTVA 4MVJE 4E13A 3DFZA 4HV4A 4LN1A 3VDQA 4M55A 5ENVA 3B20A 4DXHA 2FSVA 5L4SA 3BZUA 3NX4A 2BMAA 3H6KA 2VYVA 1PL8A 2VQ3A 1KERA 1U1IA 1G0NA 3VH4A 1AGNA 2J6IA 2O3SA 3D3WB 3OM9A 1NM5A 1J4AA 2JHFA 2P5YA 5FFFA 2TMGA 1A72A 4U5QA 1MFPA 1PX0A 2YUTA 3VZSA 5JDIC 4BNFA 2HDHA 3H5AA 4NNJA 4B7CA 4YJHB 4P8RA 2Y0CA 3K73O 2HJRA 4Q39A 2PZKA 4GVXA 3JQ8B 5CP8A 3VOSA 3D7LA 3LF1A 3P19A 2GR9A 3AY7A 1D3AA 1P45A 4RF2A 4Z0HO 2A94A 3AU8A 2EP5A 4CMKA 4BMVA 2YQ5A 1HT0A 1XGKA 1I2BA 1T2AA 4IS3A 4KOAA 2X6TA 5GMOA 3DHNA 4YCAA 1KVUA 3L9XA 3W4IA 4R54A 1Q0QA 1SMKA 5IZCC 1NXQA 3ADOA 1NTOA 3AI3A 4AJHA 1MC5A 1DIRA 3UN1A 5G2OA 3JD2A 3VAZA 4CM8A 2ET6A 4B4WA 3PLNA 5EN4A 3CUKA 4EW6A 2Q1UA 2YHUA 5TC4A 3OJFA 3JQ9A 4NBUA 3WS7A 1KVSA 3G1UA 4YJFA 5DT9A 1MXFA 3Q9UA 5L45A 4CMEA 5A03A 3IKVA 3V1UA 2IEBA 4CLDA 5A9SB 1ISIA 4BNHA 4EUEA 2GRAA 2OUIA 2IYOA 5EESA 4CLRA 4GGPA 1H6CA 1C1XA 1WWKA 3HDYA 1G6KA 3U4CA 1JVSA 1C0IA 2DC1A 1E3IA 1CF2O 3INGA 1PJ2A 2Q1SA 1W6UA 1GEGA 2Z1NA 2DFVA 2CF5A 2DBVO 5ENDA 1ZIDA 4ND1A 2P91A 4CMIA 2VTDA 1K6IA 1BXZA 4KQWA 3WGIA 1N1GA 2EKLA 1WP4A 4PG6A 1NX6A 3KSZO 4CM3A 4JK3A 4J4HA 1YDWA 4IJKA 2DPGA 2WMDA 3X2FA 4M49A 4BNMA 1MX3A 1T2FA 2GNAA 1ZW1A 1IZ0A 4R5MA 5CPFA 3VH1A 3RFVA 1I24A 2I67A 5JDCC 5A02A 3ZV3A 7ADHA 1BSVA 4YQYA 4Z0TA 3JQBA 2NTVA 3LF2A 3AWDA 5F1KA 1PGQA 2GSDA 3ZV5A 1JKJA 3KRTA 3G1TA 1NP3A 1GU7A 4PZCA 1R4NB 3ZWVA 1UZNA 4KDEA 5ICSA 2GPTA 1DO8A 2X5JO 3FBTA 1M66A 1DLIA 1EMDA 3PYMA 4BS9A 3O8QB 1DPGA 1DAOA 4UUOA 5TT1A 4A5OA 1N9GB 3TNLA 3WWZA 3NTRA 3GF4A 2BGLA 2DTEA 4HXYA 1GEEA 2DFDA 4BO4A 4L9RA 4ILKA 4GL4A 4EEZA 3EGOA 1E1MA 3QY9A 2PZJA 1ONNA 2OGUA 3MOIA 1YL6A 4AJOA 1LSJA 5I7FA 1QYWA 1KVRA 3ZHXA 3UH1A 1HDZA 3MJSA 2NUAA 3P2YA 1X1EA 5KJ1A 2O4CA 5A1TA 3A4VA 2O50A 2RHCA 5LCXA 3PXXA 4II3A 2WE7A 1GYQA 2IEDA 2YZ7A 3LYLA 1KC3A 4QUKA 1DBVO 4DGSA 2GZ2A 1I33A 2PTGA 3SEFA 1OAAA 1X7HA 3K31A 4BUCA 4DPLA 1IY8A 1W73A 2OXIA 2W2LA 3H3FA 4HBGA 1T2DA 3FF4A 4I5EA 4IMPA 5I7SA 1YQDA 4WEOA 2PZMA 1M67A 4QEDA 2IZ0A 5DP2A 3E18A 3F5SA 5KVQA 4IMRA 3QVTA 1GQQA 1ZUD1 4CM4A 3H9UA 1W0CA 4NJMB 1LI4A 1RM3A 3OA2A 3G17A 4RPKA 3DC2A 5ER6A 1UAYA 2LDXA 1H94A 2A9FA 1ZJYA 2GYYA 1H0KA 4FS3A 3O4RA 3JQAB 1KETA 4HNGA 5EIOA 3D4NA 1TEHA 3F6YA 4PVCA 3K6JA 5T67A 1U7TA 4J0EA 1I01A 3ROKA 3WBFA 1I3MA 3JYNA 3H65A 3V5NA 4BO7A 3B1JA 5ITWA 1RKXA 1DFIA 2NLOA 5TNXA 3ROMA 3D5TA 4AJ1A 3GQVA 5HS4A 1B8UA 4NU5A 2Q50A 3K30A 3I6QA 2A4KA 3ZU4A 1YH3A 4II2A 3GRPA 4DA9A 3LU1A 4RDHA 4DREA 1FMCA 3EVTA 3PVZA 3JQAA 1ULUA 3QSGA 5L40A 1QYDA 1PJBA 1U3UA 3RC2A 4E5NA 2WSBA 2RCYA 3F5QA 3WIDA 1EBUA 3TOXA 2V6GA 3EW7A 4R01A 3FNFA 5IAAA 5KTKA 1H9AA 1NPDA 1D7OA 3NGLA 1GY8A 1X0XA 2ZIZA 4IIUA 2R00C 2V65A 3AM5A 3ZWMA 1IHYA 1ZZEA 3C7DB 3DB2A 4IZIA 4J2OA 4FOSA 4XQCA 1KBZA 3BMQB 4CM9D 4YAJA 4NFYA 4W7HA 2WDZA 3CIFA 1BDMA 2YFQA 3B1KA 4LVCA 5COBA 1DJNA 1U2GA 3PHHA 4CLHA 4EI2A 2CDCA 2YV3A 3DBLB 3H5RA 3AJRA 2VOJA 1A7AA 3Q3CA 2ILTA 3L77A 8ADHA 4ESOA 2QYSA 4ALJA 3K2EA 2D3TA 3E8XA 3U9LA 1WMAA 4BO9A 3WBBA 4TVBA 5KIAA 4JGBA 4QX6A 4RVUA 3E48A 3RC1A 3OF2A 1QMGA 3HE3A 3PHGA 4FSHA 1EK6A 3ZZNA 4YXFA 3EHEA 3SVTA 1ZEMA 4FOOA 5G0UA 4OH1A 3SLGA 4JN6B 1E1LA 4K28A 4TZTA 3GR6A 1ZK3A 3U5TA 2BI8A 4K6FA 2EHDA 1V6AA 2PGLA 4MKRA 4AL4A 3ORFA 4ALIA 3JV7A 2J3JA 3Q1LA 2PH3A 4INAA 3V1YA 1CJCA 3ZWPA 1YE3A 5ILGA 5MDHA 4JP2A 1GZ6A 2W4QA 4P22A 3C24A 3LT1A 1E3SA 5B1YA 1ZK4A 3QP9A 3KYCA 3OP4A 4GKBA 3K92A 5K6AC 2F1KA 1QYXA 3KM0A 4WCFC 4BNJA 1Q7BA 1DEHA 3HDQA 2VT2A 2C7VA 1EUDA 3ETGA 1HDRA 1E92A 1LSSA 5B4VA 4B8ZA 3WIEA 3MJ4A 1BXKA 2ZQZA 4RL6A 4IQ0A 3PTZA 4R51A 5JCJA 4WLUA 4CMAA 1XHLA 2Y66A 5I7EA 2C82A 1LDYA 5FI5A 1AN9A 2FR0A 4J7XA 5EPOA 5L4NA 4PLPA 4KUGA 4RPHA 3AY6A 3I9JA 4RPLA 2C2XA 3GOHA 3KUXA 4EUHA 4ZICA 1B3BA 5JAQA 2BRUA 2NTJA 2IZZA 3V2UA 4R68A 4BNKA 1PZHA 4ZQGA 2O4UX 2Y1FA 5GZ6A 3BA1A 1FXSA 2O23A 4BO1A 5CG2A 4XR9A 5JYDA 1K6JA 2Q3EA 3GNTA 2XXBA 2NWQA 2HMWA 3ITDA 3D3WA 3PRJA 4M1QA 4MVJG 2VWHA 3G0OA 2GZ3A 3D64A 4B4VA 1B16A 5L53A 4MO2A 3TOZA 1B2LA 3H9GA 1ZNQO 1O6ZA 1T4BA 1GZ3A 2E48A 3I6IA 3WMXA 1E0DA 3OICA 1MXHA 4MOWA 1ARZA 1UZLA 3LC2O 3QHAA 4WLNA 4TWRA 1P1FA 2NQTA 1YONA 1IUKA 3GPDG 1TT7A 2G17A 1G1AA 3F9IA 3GMDA 2HSDA 1BWSA 1JKFA 4LVUA 1P74A 4PN3A 4IINA 3STHA 5C7IO 5JLAA 1NASA 5EINA
chains in the Genus database with same CATH superfamily
5EERA 3A4YA 2QAIA 4DLNA 1WDKA 1ZN7A 3LPLA 4MWEA 1HFWA 3V8BA 4DR5B 3S0JA 1AU9A 2WI8A 4DMCA 2XD9A 2IQ5A 3DOUA 3TZEA 3UG7A 1ECJA 1UP7A 2HRCA 2OK7A 3S29A 2Z4SA 3HEBA 4B4DA 4GYWA 3LC1O 4C05A 4YUVA 4EHKA 1UXKA 2EBFX 3OFNA 3PX2A 4FMBB 4OQQA 1T15A 1M2WA 4D92A 4YO8A 1ISRA 1HORA 4F9TA 4MDYA 2CSXA 3HA7A 2BFDA 1CNMA 1OX4B 2FYTA 4K8OA 1Y81A 2Q6VA 1MV5A 4IDCA 1R64A 4EGJA 3ICWA 1QYCA 4FFVA 1PR6A 4JOSA 2F3TA 3PD7A 3C7AA 1IWPB 3WL4A 3EXHB 4GKAA 4J7AA 2Q0SA 3S5JA 3GFQA 3RTCA 4UVGA 2FZEA 4MS1A 2ZU6A 3ZGYA 5KCMA 4ZZ3A 3NTVA 1B00A 3W9YA 5JZVA 5DTMA 2CBZA 2QZ4A 5ITVA 1ISHA 3A1EA 3CZRA 4G5GA 1KIFA 3ADKA 4KX3A 3P9YA 4NE7A 1XLWA 1QJCA 1UMDA 2QPOA 1RQ7A 2SKCA 2X0KA 1B93A 3DFMA 4NE9A 5GONF 1C1HA 3AHJA 4XPIB 4EY3A 1LX7A 3USES 4MAMA 1GDDA 4ZAWA 2J7PD 3B2QA 3P0RA 4MVJM 4UW9A 4DABA 4DNQA 4M87A 2WD7B 2IVFA 4E5SA 4V0OA 2WPDA 1JEDA 4LX0A 5FTMA 3PHLA 1CEYA 1VZ2A 2FZKA 1PK9A 4Q37A 1M1ZA 1ZVKA 2IEIA 1I6WA 2OKCA 3DOJA 3FCSB 1ZM3A 4N8EA 4DCGA 1WQ1R 4C0LA 1T9HA 3SYTA 2ENUA 4BAZA 2NZWA 3Q8WA 4W8GA 1UUFA 1ZLXA 1VLHA 4CR7A 4EZIA 4DPMA 4J91A 5IAOA 2M32A 3Q8XB 3U4AA 1U0NA 2Q3JA 1U8FO 3NQ41 3VKWA 4AUMA 2Y1EA 2LDBA 4I46A 4G97A 4OH7A 2ZWOA 2H65A 2WFLA 4RLSA 2ZJ5A 1ZONA 4BTEA 4QYIA 2M6SA 4OYRA 3S2IA 2XGSA 4KV7A 3SE0A 4O0MA 2V4MA 2OTCA 3E7PA 3T06B 5AKXA 4MRMB 5CT4A 5G40A 1LJ8A 1BCRB 1S9DA 1QUEA 3V7NA 5JT1A 4JLKA 3IKLA 3DVSX 3MHPA 2FHPA 1DIGA 5JADA 4KR3A 1WDWB 3WHLA 5EHNA 4ARCA 2BYTA 2ZJBA 1ISJA 3CEMA 4XTCS 2Q0QA 3DWFA 1IQ0A 4XDYA 1RYZA 4RABA 4DCSA 3ABRB 1QHXA 2FU5C 2J7PA 2NV0A 1V6SA 3ENWA 4YT2A 3HQ4O 1Q0TA 1OC4A 2O19A 1R8QA 4A92A 1AD2A 1NC3A 2HBYA 3K2QA 3JVDA 1FUKA 4KFUA 3CW8X 3M4ZA 4TWBA 4UAUA 3U0VA 1XP5A 1H2HA 3EB9A 3R5XA 4TVKA 1EVIA 1NZDA 2NVWA 1WEKA 4H1TA 1XHFA 4X66B 1DLJA 3IMEA 3K3PA 4O59O 4GFDA 4B8WA 2V0GA 1D0VA 3HADA 2FMUA 3TMAA 4HPJB 3D6VA 3QOWA 3THXB 2XJ9A 4X84A 3JTMA 4HDAA 2HK7A 3W04A 4HWPA 1LZKA 2FPLA 3AZQA 3QE0A 3OZGA 1ICEA 2B3DA 3GNSA 1JTVA 3W5HA 1KI2A 4FGJA 2PSFA 4A91A 3KZOA 3IT1A 3LP6A 4FR0A 1E5TA 3R3JA 4X6UA 3E8MA 2TS1A 3F3MA 4WIAA 5FPSA 4MB2A 1E1DA 4IDFA 4Q66C 1JN0A 4I1PA 2FPGB 1E3WA 2QRHA 3L05A 3OF5A 1PHPA 4X3OA 2WHEA 2R8OA 3WK8A 1YIDA 3I2YX 2GKSA 1EQ2A 2AC7A 1QHHA 3LQ4A 2E9SA 2WJAA 4FI3F 5DM60 4F7WA 1OH5A 1GUFA 3RS0A 4CV0A 5JJBA 2QD2A 3WZ2A 4WPGA 3WGOA 3FB1A 2FN8A 1C9EA 2G8NA 4U7TB 1G21B 2XQGA 5SYAA 2R8ZA 4K1XA 1DJLA 2BJHA 3VNRA 5AKJA 1XYGA 4P3NA 2POQX 1E2LA 1M1XB 4O4IF 4I8DA 1E0KA 1PBTA 1SU8A 2C29D 3FTFA 2O1EA 2OXEA 4RTLA 2RIPA 3ORYA 4O25A 3WNZA 3CPSA 4WXYB 1G2QA 5JCZA 3GA7A 4WCDA 1UQTA 1NLMA 2ZI3A 3HKBB 3QYFA 3ZDQA 3KFXA 2GCPA 4OX9Y 4XIGS 4AURA 4C1NA 4BQRA 5IARA 4HUJA 3KYDB 1V95A 2IWHA 1EPUA 4TYWA 1K8ZB 2HJWA 2DECA 1A8HA 3OD1A 3GAZA 1WXWA 4MHSA 4KDFA 1Q0ZA 2FZVA 2P3SA 1KAEA 1JHXA 2DKNA 2RHHA 2EC5A 3N70A 4KBGA 3VVLA 1PT6A 4CQJA 2B1IA 2ZIVB 3AHFA 3N8KA 3UJCA 2OFOA 1Q0LA 2ZI9A 5BV0A 1FRZA 3WIOA 1XZQA 3AR2A 2HQRA 3CE9A 3EIUA 4LNUA 3SZRA 1JJFA 1EFLA 3DT9A 1C9NA 4L7VA 1HQKA 2P7IA 5I9SA 5LU9A 1BEUB 2VRCD 4XB6B 4E2XA 1BS9A 2ZLBA 3I01M 3P9ZA 4FZJA 5BW8A 1IEXA 1P6QA 3ZH9B 1MGOA 2RD2A 3PGXA 4KH0A 2ZYVX 5CGQB 2AOUA 3BORA 1R6TA 3C43A 5JTUA 4LOAA 3BQNB 5D3MB 1U99A 3A26A 2OZPA 3RRBA 3WXBA 3W2GA 1CUBA 2F90A 2FG7C 4N48A 3RHZA 4YCBA 2Z1MA 3PVCA 3MJCA 5EGNA 1O54A 4WMLA 2CJWB 2PWPA 2YXBA 3CR8A 4FD3A 4OEHA 4B6JA 1EG2A 1RM0A 3KQOA 1MABA 3O91A 3OJEA 3F9RA 3L6EA 2ZXUA 4PGHA 4HS9A 1AV7A 4J2TA 4PSAA 3T4EA 4F9GA 5BN3A 3BFVA 1Q6YA 1AQNA 3WJAA 2HCFA 1V1RA 1QK4A 2E0IA 2MYNA 2OLJA 3O2QB 2XUOA 2Y99A 4GYKA 4N47A 2Q9AA 4NCJA 5K9ZA 9LDBA 3RJ9A 2Q8NA 4IKOA 1Q57A 1UJ4A 2I4LA 4QPZA 3V33A 4PEVA 2JGNA 1Y33E 1LDMA 2VATA 3QQ5A 2V7VA 2ERYA 2HIAA 4U6NA 1YSCA 3E2PA 1ZR2A 3OLVA 1TADA 2JFXA 2B6NA 4MQBA 4QXRA 5IDWA 2PQ0A 3C3PA 1HOTA 5BORA 4QJ3A 3PUVA 1ISSA 2W2TA 2P2SA 4AS2A 2G72A 4BBAA 2O2HA 4JROA 1VHTA 2AI2A 1LF5A 3LKZA 1LU9A 4XM1A 3UJ8A 5T57A 2FN7A 2YRFA 3BWXA 3DAHA 1VYVA 4IICA 4QOGA 3TW6A 1F8FA 4V2UA 5FBVB 4O63O 7REQA 4G1UC 3A14A 3RO7A 1PQYA 2ATXA 2GXQA 3LECA 5HZKA 1UBHS 2UV8A 3O2SB 1G5IA 4EIWA 1ONSA 4J16A 2HD4A 2YHBA 5K8UA 3IQHX 2X77A 1SUSA 1HPLA 3BMOA 3LUGA 4KNWA 2C95A 5K4GA 3C7TA 4Y18A 1MJHA 3G5MA 4MWSA 1L9KA 5B58T 4O29A 4N3GA 5CT8A 3W9UA 3GW8A 2J1LA 2QN7A 4X60A 1WQ4A 5JSKA 3TRHA 1Q92A 2FDCA 1QU2A 5FA8A 1GR1A 3VX3A 5BR4A 2EARA 1SY7A 2JFWA 2VNAA 2XMPA 1BXGA 5EZYF 2HBRA 4BHTA 5C8ZA 2IRWA 5FBWB 5FWXA 3GJ4A 3PXCX 5K01A 2NZVG 2WJHA 1VQ1A 2AZ4A 1U0GA 3TMYA 5E7MA 1Y98A 1XMPA 3F6SA 3LQ1A 4NONA 2PBRA 3UAOA 1YASA 3WL7A 2P1ZA 2CLMB 1TTQB 3ZNQA 2BW0A 4OIMA 3ZD9A 3QJGA 5FL7D 4KO4S 3SR4A 1FX0B 4KPUA 3RGWS 4Y2PA 1P3Y1 3QU7A 3M33A 1V96A 1SWVA 2F8LA 2MSCB 2PZEA 3D8BA 3G5UA 3REOA 3WK5A 3I73A 5KOJB 2NIPA 3ENKA 3I39X 1II0A 5DIZA 3TZKA 4DWOA 2OQRA 3D31A 2HZBA 3ST7A 3X44A 3ZD8A 2RHRA 3JCZA 4FINA 4FN4A 4B9EA 1Y3AA 5AXCA 1XEXA 4GZMA 4JCOA 1MQ9A 3I9KA 3GXBA 3LX8A 1VRCA 3JRXA 3NPAA 2I33A 3DOHA 1EFVA 2V8BA 3SZUA 5DX0A 1EFRA 1QJ4A 2JJ1D 1G2PA 3JYLA 1RFGE 4WGFA 2ERCA 1YWGO 2FUG1 1MX1A 1UJBA 1X7WA 4PG8A 3TXYA 5ITSA 4TLEA 4LXQA 2PRYA 4O08A 1IZ9A 1DEOA 3FSGA 4UVEA 2WTEA 1YHNA 3VVMA 1FY2A 4WOKA 1P39A 3C5CA 1G5HA 4OMUA 2ICAA 3E3NA 4U39A 2BHSA 2HHAA 2EIHA 3H84A 1T2CA 3O75A 2PS1A 4LRYA 1XTSA 1ZXLA 2BHTA 3CLTC 3LUDA 4N5LA 5FOVA 1P7VA 4AKSA 3U44B 1PFUA 1ZITA 4GOLD 3A1WA 3EQ8A 3TCKA 3VKHA 1FDIA 3AEQB 1JG6A 3AUXA 3UPDA 1PEYA 1CZOA 4HDQB 2OSBA 4X7MA 3OQNA 1VMAA 1SVWA 1GKUB 2P4QA 4Q3DA 4BFZA 2N1MA 1JMKC 1Y4AE 5CVUA 4PPNA 1VIYA 5HIJA 4YJ3B 1RC8A 4YGXB 2EF1A 1V0JA 2O0HA 2A7QA 2YWCA 2V6BA 1W88B 221PA 2OWDA 1NJGA 4I8XA 5CURA 1SG6A 4HNVA 4ES6A 5B3JA 3KR0A 4E6EA 2JIOA 2GA8A 5T4BA 1BMTA 2ZJ6A 4NPHA 3BXGA 3CRW1 4Y7DA 2NUBA 5FOSA 1P73A 4KN6A 4TVOA 3DVLA 4QTYA 2JFFA 1BE1A 2HHCA 4FKZA 4W82A 3ND6A 5TMDA 2JZNA 4EA9A 2I4TA 2XCSB 5KDOA 4ZGGA 4LAFA 1VSBA 2A0UA 1ZL0A 1ZJ4A 3B1XA 1XK6A 1KR2A 3UB2A 2B0CA 3OC6A 4DNFA 5IF9A 4EFKA 2ZB7A 1CUZA 1Q95A 3LI2A 3QTTA 4RO0A 4JX8A 1Y3HA 2FPPA 1JI0A 3GEBA 3GJZA 2Y77A 4RKFA 4S1VA 3LSYA 2JFBA 1USKA 4J7CA 2YWJA 4F3KA 1QIEA 1P29A 4GPAA 1I0IA 5AJZA 4BASA 4C4TA 1RKQA 1T25A 3OAAD 4H7KA 5EJFA 1ES9A 3NOXA 5IVHA 1AZTA 1QIJA 1IZYA 3N6XA 4HGOA 2MTBA 4PIVA 2IXDA 2PSHA 3QKUA 1CQIA 2PZGA 4CKWA 1XELA 3EA4A 1Z34A 1EFPA 1YDHA 2W6CX 1PGJA 2FW1A 2FN3A 1SXJC 1KZ4A 5DK4A 4CUZA 3OZTA 4L57A 4UEWA 3ZE0B 3G49A 2VZ9A 1P0IA 3MLAA 2CXTA 2PL9A 2AIRA 3NG1A 2VDJA 3FLEA 3BVPA 1R5BA 1O6BA 2XMSA 3RU2A 1ML3A 3F1LA 3HB9A 2GN8A 2WAOA 3ICCA 1GZVA 3I28A 3EIQA 3S2EA 1MH9A 3BREA 4CQLA 5H3HA 5EQTA 2GASA 3FF1A 4YQEA 3K4HA 3HCOA 2C83A 3WY9A 5JQGF 2DR2A 5LP6B 1CIVA 4MRRA 5FWAA 4M1EA 3EOAI 2QTZA 3GGOA 1E3TA 1RAIA 4WDRA 4I4IA 5JAPA 5CR9A 1YGPA 3IP9A 1VECA 1GFSA 2GKGA 4HZGA 2GOYA 2Z8YM 1DP4A 3NWEA 1P60A 1KI1A 1CRLA 5T3UA 3KD2A 2DOKA 4BJHB 3OMXA 2YL2A 4GRDA 1C9MA 4TQGA 5I47A 2C03A 3KX2A 1U2DC 1UXGA 3MERA 4ZV7A 2BPOA 2D6FA 4KIJA 3F5MA 1ZYUA 1P62B 3T5MA 3SOZA 1HYEA 2VJNA 1S2MA 1DUVG 5FYQA 5IM4F 2IH5A 3FNIA 1ZGHA 1PLJA 5DGDA 3CMCO 2HO4A 4P81A 3MSCA 1E9AA 3BCHA 2A30A 2DU8A 4JL8A 3A27A 1KXJA 2XUAA 8OHMA 1DMRA 1PSZA 3VKGA 3GQBB 2VHYA 1KEPA 2HPVA 1Y3BE 1W8IA 2A5JA 2I8AA 4H77A 1ENZA 1FB5A 3IBFA 2ID4A 2YBEA 3M6XA 3HLYA 4JBYA 1ZPDA 3TZLA 1E6MA 3ZE6A 1IHDA 5BR1A 3ZHTA 5IBCA 4UBOA 1Q0SA 2ZVDA 2XITA 4N5MA 3PCTA 3TSCA 2ZJZA 1JG3A 1OIVA 2E2WA 2WJYA 3A6GA 4FX5A 4GW3A 1NGSA 4UFNA 2QY9A 2XAAA 3BK1A 3CLUC 2AMLA 2G9RA 3E84A 4JIGA 5AXDA 3WO0A 4AD8A 5E6SB 4LFAB 4MX8A 4DR3B 2V96A 5K8IA 1C8KA 1E9SA 4NV3A 3I45A 1L1RA 1Q14A 4EKNB 3L6CA 1D2MA 4OV6B 1YQXA 4D1YA 2VJOA 5JC1A 4AY6A 1NHWA 3LT0A 2XECA 3EAGA 3DPUA 4GG1A 5AI9A 5LQCA 3N3AC 2J48A 1U9ZA 2V7BA 2ZSJA 2C59A 2VAMA 1J0EA 4DIDA 3NHPA 3P0IA 1VMEA 1CDOA 1PT5A 4KVGA 3ZK7A 3DH0A 3EBPA 3K5PA 3DEJA 4JCCA 1AQIA 2CLLB 2Q07A 2FF5A 4XCXA 3SN6A 5IEBA 2YJ4A 4CQMD 5LMCA 4EKIA 1B74A 4XWGA 3T3DA 4TS9A 3U4IA 4ZT3A 2E4VA 2H00A 3AGPA 3TE7A 4OI0A 3JVUA 4RAQA 5IVIA 1J22A 1T0JB 1TEXA 1MHTA 5D86A 2NMVA 1AS0A 3H7AA 2HMVA 4ENPA 3S2GA 1E4EB 4JGIA 2IV7A 1BC5A 4YPOA 3G2QA 4RUKA 1XDGA 4ZT7A 2IL1A 1SK9A 4I6JA 2XUGA 3EZYA 3IVMA 2I5PO 4V38A 5C5CA 2A5FA 4MIKA 1X1QA 1PZFA 4PC6A 5BT9A 2QL6A 3NORA 1WMSA 3B9BA 2GJKA 3OQIB 2YMPA 4FYWA 4E21A 2MSDB 4B7UA 2DUWA 2CVZA 3HNPA 2CMDA 3ZWAA 3O21A 3PLAE 4D8TA 1GDTA 1JPUA 2YV2A 3VU8A 5E6RA 3R40A 2BJWA 2HU7A 2CDAA 3BB4A 3PXGA 4YV7A 4R8RA 4L4UA 1NQ5A 2B3TA 3LE8A 4FZ5A 5BR8B 3UCFA 1G3RA 2XR1A 3UUFA 5FHQA 4DOMA 4G4SO 1SUWA 4OL0A 2QXUA 3Q0IA 3A6LA 1RYEA 3FR8A 3ILSA 4BYGA 3CH6A 2M6KA 1NVEA 4O2AF 4MPTA 1LBHA 1GHTA 2CLDX 1Z33A 4MVJP 4UDOA 1X77A 2VCEA 3NJRA 4BV2A 3NV9A 3KIPA 3ESRA 4XDHA 4BVAA 5LQSA 3ZJ4A 4ZANA 4N01A 4OF4A 4LJKA 4D9KA 3H42B 1FFXB 3Q7EA 1USUA 2DBZA 5KHLB 3FNRA 1XZFA 4GOMD 4LSGA 3S2SA 4US0R 5B2EA 3USZA 4DAEA 1WF6A 1RYNA 1T0UA 4WHMA 2QD5A 3EXEA 1PJRA 3WYAA 1RZ3A 1THZA 1ZVQA 3AR4A 4Y1EA 2FG5A 1XROA 1DQZA 2J67A 1H6AA 4MGHA 3MTAA 1JEOA 1TTTA 3P4YA 3U56A 4JHXA 3A31A 2AT1A 2PR7A 1EBFA 3GFPA 3ZK9A 3GLGB 1G6HA 2GLUA 2RH4A 2WSMA 5AHXA 4YH1A 4B74A 4MPRA 4IHQA 5IJ9B 1YJ8A 2AHOA 4R1UA 4QUIA 4DT1B 3D5QA 1G8GA 4BO2A 3T61A 4ASUD 5KOIA 4WWHA 3THWA 4FEEA 4O2RA 3QFCA 5EIBC 2WKPA 1PDVA 3C3YA 3PL1A 2QLBA 3ROEA 5G53C 1WUTA 2AXQA 4Z3KA 4ZT4A 1KBOA 2QYHA 4BNXA 2HPAA 2RHTA 4LDZA 2I2BA 3RVKA 4LCJA 3LM8A 4BNWA 5KSYA 1A9QA 1RRFA 3E9YA 1C3EA 2HNKA 1SN7A 4EFLA 3GLFB 1RKVA 2VNKA 5HRUA 3L8GA 4EK9A 1RXVA 4LG1A 1FJ2A 1E9DA 2HMYB 2QJFA 2LIVA 4NBSA 3KJEA 3ZXIA 4UMVA 1R18A 2IE0A 4I81A 1A9ZA 1PKXA 5JJ5A 5JMTA 3MHTA 1NLZA 4FDTA 1R4AA 2DX7A 3R74A 2Z83A 2XGJA 4I1VA 5AJHA 2I7XA 1WHTB 1JIJA 4H7IA 3QOYA 1XALA 2QAGC 1Y1SA 2QT9A 4JBHA 3SX4A 3U49A 4ED9A 3LYUA 5KDLA 4CM5A 4R1SA 2P3QA 3A4MA 3HJNA 5LB2A 3GJRA 3IEUA 1EXMA 3KEMA 4TTVA 3D3NA 1H8EA 2PGNA 3TLAA 1LV8A 4OQFA 1Q1ZA 4ZDIA 5HZGA 3OIYA 4MCAA 4RMIA 5EIEA 3HBFA 4KRXA 1W49A 1VIAA 1UMCB 4NK5A 1XNQB 1AY0A 2Q8QA 3WSWA 1HWYA 3HLTA 4JT4A 5A5GA 1ETHA 2GPJA 1F2TB 2QTMA 3FCAA 5J2TF 3B9QA 1J97A 4KWEA 3P71T 4D5GA 4PHHA 4B73A 2AVDA 1NFRA 2G4VA 2P75A 2CLOB 3R4VA 1ICIA 5BW6B 5C1PA 1BDHA 3WGLA 3LAWA 5HBRA 2VIIA 2OORC 4K0KB 3DG9A 1ZH2A 4XGIA 5T4FA 1Z2CA 4B8YA 4E1BA 4QUHA 2XA1A 1W25A 2W93A 4K9LA 3C3WA 2ZB4A 2O8CA 3TLMA 4NYJQ 4ACAA 1REQA 1IXSB 3WYEA 4COKA 5HFJA 3PEUA 1CHNA 1NVVQ 5LFAA 4KR2A 4NCHA 1Y9JA 2CFCA 3K6RA 4DLYA 4M4SA 4AVYA 2QU7A 3RTGA 4B44A 2AFVA 5K4AA 3KQLA 1W4RA 2HJGA 2PRSA 3VR5A 1VXRA 4YXWA 4GAEA 3DXFA 1B41A 4B3BA 3U44A 3BJEA 3H7IA 3ROQA 2IP4A 1CUYA 4W1SA 4IS2A 3REQB 4BGUA 1UJNA 2AFHB 2I6QA 1RMYA 2H18A 2XDQA 1GCGA 1CZNA 1I3KA 2XEDA 1TMYA 3QEMB 4NH0A 3O8OA 5DOVA 1JPJA 1EESA 3L4BC 3AEZA 2UAGA 1NVBA 1DX9A 1TM4E 1QOQB 3KV3O 1GRCA 2EYQA 1P5HA 2LIPA 2ZRDA 3CNEA 5IKEA 4KVAA 1Z6XA 4G84A 1ZJJA 3RV3A 3PYLA 1E77A 3M1AA 2B5WA 4P4UA 3FFBA 5C18A 5DWDA 2DXIA 1HDCA 1RCTE 2C5AA 1FS4A 2AOTB 1KY4A 3A9WA 3JPYA 2O9JA 4JXKA 4K88A 3G23A 4RY9A 6ADHA 2I2AA 5H3LA 2FSHA 3ZCXA 4CEHA 4EG5A 5ALHA 1O87A 4YONB 1N2JA 4HAZA 2WYUA 3MRSA 4K26A 5CB0A 1OE0A 3IDFA 3Q41A 4JI7B 1F0PA 3NHSA 5J5CA 1N0VC 3NDIA 3RTBA 5FB3A 1UIMA 3UJ3X 4ZI7A 2FMXA 4ZYYA 1MV8A 4CEJB 3QXXA 5HQTA 2J41A 1OZHA 3AESA 2AX3A 3ICVA 3O93A 5FO1A 5FP0A 5KREA 1A4UA 3HUDA 2FEXA 2V7UA 3H2IA 4IW3B 3RFFA 1B1CA 1HE4A 2BTQB 4NZ9A 3QEAZ 3ZLVA 1OJ7A 3LOQA 4I08A 3U19A 2Q9CA 2X9NA 3VSDA 5FUXA 4TLDA 2QL9A 4KQFA 4TSFA 1RWXA 2R25B 1ZFNA 4G89A 4PHGA 3T7EA 4N5IX 3ANNA 1AKEA 1MAAA 4NYIR 3U3ZA 5DM70 1FFYA 3C6MA 5B7NA 3I1FA 3RV4A 1FQKA 2YWEA 3IP3A 1QDLB 2IXTA 3T1VA 2VDPB 2CK3A 4BGIA 1I7QB 5EG5A 3GBVA 4QNMA 3UIEA 3IP8A 1JSLA 3JAKA 2DHCA 1DQYA 1E0JA 1FJHA 1PU2A 1G66A 2BGJA 2CJXA 3DWGA 3F8TA 3HJUA 3HU3A 3LVRE 3NC0C 4NY1A 4OOFA 5T6MA 4FYHA 3EIOA 2OVBA 2JIQA 1MQSA 3RWBA 4A9AA 3URKA 1XZKA 4NXNB 1Z2NX 2J5RA 4YP0A 3V00A 2A1TR 2V5UA 3UMFA 5IPFA 2HSEA 1QFSA 1M8JA 5TVGA 4DSAA 4RJKA 2QIPA 5YASA 4AY5A 3IE1A 3AVVA 3IRUA 1Y8CA 4WZBE 4YDHB 1S4QA 2EHJA 3AP1A 3KOUA 2W70A 1APBA 2D62A 4RK1A 3BGOS 4K6HA 4QTXA 4C14A 2QX4A 4RK4A 4I9FA 3I9V6 2RH8A 2W8BB 4RK5A 1ZCBA 5A71A 5INTA 3INYA 2N46A 1H23A 2XD4A 2XAUA 1N6NA 2UYOA 4Z2YA 4AX8A 3E7WA 3ZNOA 2XT6A 4DCNA 1KZ9A 1IBMB 4NYJR 4PE5B 3S27A 1XA3A 2ATEA 1QQ7A 1S2OA 2JLUA 3FZEA 1YDGA 3GDGA 1KDPA 3Q7TA 4OQ4A 1BCSB 2FSSA 3H11B 3WV5A 5BOSA 3W6UA 1T5LA 4YJ3F 2NUTA 2WF9A 1JILA 1DZIA 2HIMA 3LPDA 2WTNA 4LDQA 4DNOA 5BN5A 5JIBA 3F96A 2HA3A 1JIUA 3CVXA 3GGJA 3JSAA 4OQLA 4OQNA 3TBKA 2WUVA 3EVAA 1G8FA 1M1YA 1ZVJA 1KMHB 1XAIA 1O96A 2O07A 2YXLA 3K5IA 4FMCF 2BKUA 3CSDA 1L7OA 5K8VA 2EDAA 1E99A 3TTXA 4NFHA 4JQYA 5HDQA 1B3RA 1VKNA 2BV3A 3HI4A 2R7NA 2HHJA 3VZCA 3ZKAA 4EQZA 3S5UA 2ZRNA 1YCHA 2Q62A 2NO1A 3T52A 2SKEA 4EYGA 1L3CA 2CD7A 4CM1A 2K2QB 4DA7A 1PT7A 2RHDA 4P7FA 4XSVA 5TS3A 5TS2A 1KU6A 3I64A 4EL0A 3C4QA 4M89A 4BP3A 3ZG6A 5CBKA 3B3GA 2OOKA 3FHLA 1OFVA 3QENA 4JP1A 5BUQA 4TUYF 5B30A 3EPLA 4RPIA 2XWQA 2IP1A 2FSGA 5HE9A 1N2BA 1L7EA 4BFTA 1BQ4A 2ZANA 1H6BA 3T7DA 3WC4A 5IULC 3ONVA 3GLGE 1IJBA 3AG5A 4YRAA 2W6IA 4BKMA 5FI1B 3GJ5A 2NSDA 3PYXA 3MGCA 4MB6A 5AVOA 3MB8A 1PFYA 1A77A 1L5RA 1OXTA 4NG4A 5IDVA 3ZWWA 3F6BX 2XLBA 3G1WA 1KH3A 2CV0A 4A23A 2G88A 4OIFA 4I1IA 1LA2A 4DQUA 1B26A 4UUAA 5EUBA 1QGUA 4D43A 4C7KA 3C3AA 2Z2ZA 5C0OE 3HKEA 3V4ZA 2PXAA 3TB6A 3Q2KA 4DILA 1ESEA 4IX9A 3ZHSA 3RD5A 2TMKA 2F3UA 3GEHA 5KNDA 4RF5A 4LJ8A 3TNJA 2O2IA 1H42A 5D5QA 4JGGA 4I4LA 2ZRMA 1MAVA 3KPVA 1Z6ZA 3CTMA 4IVNA 3OZBA 5JI3E 2IUYA 4AWAA 4D3DA 3T7AA 1C7FA 1E60A 4HSGA 1ZQ9A 4O02B 2UYYA 4GECA 3GLRA 4YO7A 2W6JD 4D4MA 3JZMA 1CBUA 5CEFA 1Z4NA 1QKKA 1FLNA 2XT0A 1WXDA 3DM9B 2ODAA 1WB6A 1AKNA 1PZEA 3FY4A 3LXMA 3BMNB 1QH1A 2XZTA 1QHHB 3FXAA 3QUQA 3QZUA 3TEJA 5CCEA 1BHSA 1EZ1A 1BCRA 3IXMA 2JEYA 3U80A 3EWNA 2DBQA 1TO1E 1I2ZA 4O2BA 3A1VA 4UHDA 3BD7A 5ADVA 4V2IA 4L28A 5F76A 4DG8A 2JRCA 3R3UA 4BC0A 3LY9A 3NU1A 4PZ0A 4Y6GB 2OLKA 4NJEA 3P9RA 1KDYA 1NU6A 4MW7A 2QMYA 2ZWPA 4MWGA 2ETVA 1UANA 2NYAA 2DTDA 4AP6A 2JIPA 4MI3A 3SP1A 4IDDA 3SLRA 5JSYA 1M75A 4W5WA 3H9QA 1FVHA 2REXB 5TE9A 1VGVA 1QO7A 2AN3A 1NJSA 2JHGA 4JS0A 5DE3A 3FTPA 2JLYA 2GBLA 4US2R 1RSZA 3W8DA 3VU9A 1Z62A 3GT0A 2GM4A 2ZIWB 4C7JA 2B92A 2FW9A 2PG3A 3TZCA 1Y8RB 4PTYA 1CR0A 2OHOA 4IQ4A 4Y7CA 4EVSA 2E49A 1DL5A 3I34X 5TXGA 521PA 3ACBA 1RYHA 1EGHA 2N3ZA 3DTNA 3HEMA 2QZJA 3QX8A 1P2VA 2KI5A 2O1WA 4N0EA 1M5UA 1NBIA 2R7AA 1A5BB 3CB4A 5KNCA 2CNWD 4ALNA 3CEAA 2VYFA 5DX8A 2BCEA 2JKVA 3GX1A 3NFYA 3H19A 3L7JA 4LQ4A 4Y9TA 2C0QA 3DKIA 1G5TA 1G21A 1WE2A 1D4ZA 2FXIA 3MINB 4FNAA 3MWGA 4KMOA 4OJQA 3QW2A 4YBZA 3T9DA 4EG8A 1R5NA 2CV1A 3L8FA 3ES9A 3QWHA 3RFTA 1I6KA 2NW6A 3A04A 4C0AC 3FPSA 4PIMA 3L92A 3QHQA 2FSPA 1OGIA 5BSRA 2ANBA 1HMPA 2ZREA 3GFOA 2P2GA 5BSMA 4TOIA 3KBOA 5AK0A 2YIVX 3UK6A 3DL0A 4F85A 5GTDA 1OXSC 3IIJA 3OWOA 4UTOA 2R1ZA 3I05A 3WLEA 5CB4F 1CYDA 1XU9A 1Z0IA 5T7BA 1SCIA 1ANKA 3C8UA 5I9NA 4CEIB 3V3TA 3HXPA 2IYTA 2XOKD 1G21E 4M0PA 4N3AA 4O2AB 1D4OA 2ZIGA 1BOOA 1XJ5A 4BMNA 1JBKA 3ZY4A 1QDEA 5AO9A 2OQVA 3UK1A 5LQUA 2W2NA 2C31A 1KAMA 3SNKA 4Q05A 4KSYA 3TBHA 1S3IA 2Z95A 2RMKA 4E6PA 3ECSA 1SCJA 4J1TC 4AY2A 2JVIA 1HK7A 4BB6A 2GSWA 1EFUA 2C2ZA 4YT4A 4UTRA 2CNWA 3DAYA 1HZJA 5TQ0B 2YW9A 4BOYA 3T4XA 1P0FA 1YJQA 1SZJG 2HJHA 2PKEA 3B7PA 2CZCA 4DKXA 3C6ZA 3RBVA 5HM8A 2CT8A 4BNZA 1HYBA 1VPTA 2HX1A 3GEDA 3NNSA 4RELA 2VK1A 3RAGA 6NULA 2DVMA 3ZVLA 3RNLA 4AZWA 1Z25A 1OTYA 4DCCA 2NTEA 3HCCA 2GEUA 1SFRA 3GAFA 3HN7A 1GU0A 4KQ2A 5B57C 4KQHA 4FB4A 5U4QA 3HM9A 2B0JA 1DSSG 4CN8A 4JDUA 3HI6A 4BEVA 4FCCA 4YP5A 1YJXA 4ZRNA 3QVVA 3HYSA 1JR3A 2WFLB 4RHCA 3T3HA 2P0AA 2R6HA 4AN0A 4IJVA 5A62A 1T35A 2IYRA 3GRVA 5L3SA 1PBNA 2PJUA 1USGA 3S8EA 4KSBA 4TQUS 2Q5JA 4P98A 1KYQA 1OY1A 1R0KA 3HR4A 4ND8A 3C85A 2G6BA 3ASZA 3IAFA 4RH0A 3WRXA 4MRPA 2AEMA 3GCWA 4I9UA 5K6AA 3SYNA 3SWWA 1V3QE 4NH4A 1RAFA 1U9YA 2E7ZA 2PD4A 4BX3A 3A05A 1VIVA 1VE9A 3RYHB 1T5OA 3UKOA 4EB6A 2XA2A 1JQJC 4QGHA 4YAEA 2HJSA 2JCSA 3BSSA 3EVEA 1ZIPA 3F4KA 3LQYA 3MCVA 1A7JA 1SBTA 4PO8A 4UAGA 1UMDB 4L8VA 2NGRA 1Z6TA 4YK7A 4H4CA 3EG9B 4JBLA 4RXTA 2UUAB 2IC5A 2X76A 3PHBE 3QPAA 4RZ3A 3ZJYA 1MRSA 1ORTA 5KPJA 3AP2A 1UBFA 3GGDA 4J8PA 1DOZA 5IT0A 2W6JA 5KC9A 2H4WA 1NFFA 1Z18A 2WF8A 2B21A 1YZLA 3EXAA 1KSGA 1A97A 2RK4A 1T1JA 4IDGA 4IRXA 2C78A 4BLTA 3KXDA 1OYWA 1KIAA 4BQNA 3NHFA 1L4EA 4A0FA 4UHHA 3UAXA 4ERNA 3G5AA 4BEJA 1U80A 2BR5A 1EQAA 3MRXA 3H9JA 2E5WA 1PV2A 1LNQA 4L78A 3SZOA 1NVUQ 3AKZA 2F1RA 1H1TA 3JY6A 4JQOA 1F6DA 3PV0A 4JHLA 3PEYA 4FHZA 1SQ0A 2WPDD 5TEWA 5BQOA 4AJKA 1KYVA 1IMOA 1ZRHA 2XB4A 4ACBA 2C77A 2AWOA 2FTKE 5JFOA 4Z53A 1JB1A 5EXPA 3FUTA 4WQMA 4AW9A 1P0QA 3OEWA 1CY8A 4OHCA 4PRZA 2OCKA 5LP6C 1YD7A 2FEMA 5BXYA 3I5XA 4MKFA 3A9CA 5JAMA 4F56A 1U3WA 3LC0A 1JEYA 3V1MA 1KEVA 2CFOA 4HHEA 4JLDA 2J0UA 5AESA 2BFCB 1GGKA 2NO4A 4H08A 4WNCA 4HRYA 4JY7A 1IL0A 4TLCA 4TMVA 3RT7A 3WKAA 1WW2A 5EE3A 1XLVA 3R44A 1ZBDA 2ZUBA 3JARB 5CT6A 1ZN2A 3RFXA 1X1AA 1K08A 3AHGA 3C8MA 3FVWA 3KJFA 4JBNA 2NP7A 4HDSA 4O6VA 4R1TA 4RKQA 3ZZTA 2C5FA 2QVBA 4EBFA 3DYIA 4AJNA 3R6WA 4ENSA 3G7UA 4CI9A 5CH5A 3D4IA 3STYA 5L9AA 5E1DA 5J5AA 3QYAA 1ZICA 4XVRA 4FFDA 2V6MA 1QR6A 3RM3A 1H65A 3RHFA 3U4DA 1RHRA 3VZPA 5I7AA 2GILA 2D1SA 2NYVA 1LPNA 3HWRA 2A0KA 1A2BA 1VHWA 1INLA 1GGFA 3DZJA 3H1GA 4IZ6A 1A27A 2EEZA 4OUDA 4HDOB 4RTOA 1KIMA 4P80A 1ENOA 4UASA 2G36A 3LLCA 4IRUB 4MVJH 1XVVA 2D06A 1F3OA 2IHNA 3DDHA 3PHIA 2OV1A 1QRUA 4IJ6A 1YGYA 4TT3A 2BKEA 4ZCQA 4KWHA 2FKNA 3HCBA 4ZREA 2GXAA 1JKIA 1PGPA 1U4SA 4N7JA 3N2EA 1VG9B 2RGDA 3PFCA 2GF2A 1U2GC 3NP7A 1DC6A 1JIIA 2F1IA 3K9WA 4S1PA 4X8OA 4E11A 1NIJA 1U0EA 2GZHA 2BRUC 2P4HX 2EKPA 3KB6A 1FYDA 4XUDA 4ZAVA 1Z5OA 4KQJA 4IX1A 3SHWA 3DMGA 5KSWB 1KYIA 2O6HA 1YI0A 4BQIA 4RK6A 3QE3A 1NUUA 3RLIA 4EY6A 3UPUA 1JF8A 3AR6A 2EERA 3B9RA 1A82A 2JD1A 2WOJA 4S1OA 3S44A 2CK3D 2DWQA 2D13A 2AHRA 1IQUA 4B3IA 1ONPA 3KYJB 4B3CA 5BSGA 3P2OA 5JS8A 3KE9A 3W6ZA 3VSCA 3RABA 4G0XA 2P6RA 2VWQA 1GZHB 4P4NA 5TPWB 2AKYA 3ANYB 3TVDA 4RZIA 4OGKA 1TT5A 1M9NA 3AXTA 1N6HA 3DUFA 4ENWA 1CJMA 3EDRA 1R0CA 2V3WA 3C1AA 2WDPA 2EBHX 4G9BA 4AUEA 1HYHA 3ENVA 2BSXA 2ZM6B 2PKYX 4TQAA 4EMTA 1D09A 3F5FA 4WI1A 4YJ3A 7REQB 2G1KA 4JZYA 2OZVA 2VNIA 5IDYA 2F00A 1CD5A 2INGX 1GPLA 4CKWB 2BLLA 1KPHA 1YJ5A 2DKFA 2VLBA 4RK0A 5AUNB 2BGGA 2IYVA 4UVHA 1ZGAA 3C3EA 1N2EA 1J9ZA 3DP7A 4OQZA 4WXHA 1GG2A 4IIDA 4RQBA 1D2GA 1KA9H 1M2OA 3E03A 3H1AA 3PNQA 3SGLA 1WPXA 1HTBA 1QO9A 3CLTD 2FDXA 5CLJA 2COEA 3GJ3A 3CBQA 4Q1VA 4GX0A 5DN6D 4W8HA 2G4CA 4GQBA 5AW1A 1BRMA 2FZ4A 3L79A 2OY0A 5K3FA 1YHYA 2GEFA 3W5DA 3FD8A 1S7CA 5ICGA 2ZBQA 1MX9A 4JT8A 2WRZA 2YYZA 1LJUA 2XV1A 3DQPA 1RRPA 2JL1A 3HG7A 3LH5A 3QH4A 4PLHA 2CWWA 5GOTA 3TZHA 5BWNA 1YS2X 4K46A 1F4VA 4LDRA 3E1GA 1PX2A 1J42A 5IM5A 2IYYA 1UP4A 1NUAA 1J2EA 1CW2B 1IY2A 1WDLA 2IFTA 4HDKA 3TWOA 1JL3A 2ODNA 3ZDRA 2W42A 1IG0A 4Z8XA 1XZDA 3LA6A 4JXZA 5IYZF 1SBHA 4S1WA 1U94A 3DD1A 1EWKA 4C4OA 1E1QA 2HWYA 5C5DA 1BKDR 1RQGA 3OAAA 3JD1A 3SVLA 5TGTA 1WM1A 3FWYA 1Z2OX 3AZPA 4CMEC 3WQSB 5JD5A 4FJ1A 1YE8A 2BEJA 4LOIA 4GBMA 2VUSA 4C2AA 4YPFA 4L8LA 2AUNA 5KNBA 3TQIA 4O3MA 5LQMA 1GQYA 1KO7A 2AEEA 2JFPA 2P9GA 2Z2XA 2IHYA 3SM3A 1HEUA 5LQDA 2ZAGA 1LDGA 3PUJA 2NG1A 4ZVSA 3UHPA 1VPWA 3GG9A 4D3XA 4ITVA 4ZPJA 2F7SA 2X3UA 3EK2A 4P3PA 2H9IA 1E2BA 3WRYA 1PEKE 3ONFA 1SZDA 5L6LB 4GU5A 2PUVA 4J1TA 4TVSA 2AUMA 1E4YA 3E35A 3NRJA 4ECEA 4ZHSA 4QNRA 1PW5A 4OM8A 4PRKA 2NUAB 4IILA 4O5AA 1UBCA 3T9BA 1H2YA 2I80A 2DR0A 3KKOA 1IN8A 1V3TA 4LY9A 5DNEA 4A8HA 3MWDB 1HURA 3PFFA 3NC1C 2RI6A 1OAKA 3P0JA 4P08A 3W3AH 3NAQA 1PLLA 2I4IA 4L15A 1ZOLA 4HATA 2HV9A 3VYWA 6ABPA 3DUWA 1WXQA 3JWIA 3IA2A 4EUKA 4KAFA 2BGWA