4R6JA

Crystal structure of computaional designed lucine rich repeats dlrr_h in space group p212121
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
253
Chain Sequence
TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQGVFEKLTNLTTLNLSNNQLTSLPQGVFERLASLTTLNLSNNNLANLNDKVFEGLTNLTTLNLSNNNLARLWKHANPGGPIYFLKGLTNLTTLNLSNNGFDEFPKEVFKDLTSLTTLNLSNNQLTSLPQGVFERLTNLKTLNLSNNQLQSLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lucine rich repeats DLRR_H
publication title Control of repeat-protein curvature by computational protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 77
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4r6jA00
4R6JA 2A0ZA 2V70A 2O6SA 1K5GC 3FXIA 4M7EA 4BSRA 4U08A 3OJAB 3WPEA 3W3KA 4RWTC 4AW4A 3WPIA 1G9UA 4GT6A 3DZEA 3C6PB 3E2JA 2P1QB 1D0BA 4B8CD 4V2EA 2P1NB 5IJDA 2OMUA 1IO0A 4LI2A 3CIGA 3OGMB 4HQ1A 3WPDA 4BSSA 2Z81A 3UN9A 4K17A 1OOKG 4NKGA 4R5DA 4R58A 2Y5QA 1U0ND 4G8AA 3E6JA 4FS7A 4M7EC 4CP6A 4L3FA 1SQ0B 2O6QA 3RIZA 4QXEA 4CNMA 2IFGA 1OTNA 3VQ2A 2V9TB 4WYKA 4R5CA 3WPBA 4J0MA 4I6JB 3OGKB 1ZIWA 3RFEA 4IM6A 4Z61C 1OTOA 2UZYA 4C2BB 5AWDA 2FT3A 4P8SA 1OZNA 3ULVA 3G04C 2JQDA 2Z82A 3P72A 1H6TA 4ECNA 4AY9X 1JL5A 1W8AA 4MN8B 4U06A 4Z79A 4V2DA 2OMVA 2R9UA 3W3JA 5A5CA 1OGQA 4Q62A 4EZGA 4BSUA 3E4GA 2Q4GW 3RW6A 3RJ0A 1PGVA 4Z94G 2Z7XA 4CC4A 2RR6A 5GS0A 2WQXA 3M19A 4CNCA 3RFJA 4LSCA 4OQTA 3O6NA 5GS2B 3M18A 4PQ8A 1P8VA 3RGXA 1YRGA 4R6AA 3SB4A 2Z7XB 5D3IA 1XEUA 5HZLB 3REZA 3TSRE 2P1MB 5IJBA 4XOSA 3W3LA 2Z66A 4J4LA 1QYYA 3ZYIA 3WN4A 4R08A 1A9NA 2WQWA 1FS2A 2OMZA 2ELLA 5HDHA 4CC4C 3G39A 4ARNA 2Z65A 3E3ZA 2Z64A 4WP6A 4H09A 2CA6A 4KXFB 4Q3GA 2P1PB 1OTMA 3W3NA 4U7LA 1A4YA 1H6UA 2OMXA 4R6GA 3GOZA 1M9SA 3CIYA 4P91A 1FT8A 4YEBB 1O6TA 3G3BA 4FHOA 3ULAA 1M0ZA 1GWBA 4TZHA 4PEQB 2BEXA 5GQRK 3C6OB 2BNHA 1XKUA 3JB9j 3A79B 3O53A 1LTXA 3CVRA 2OMTA 3WPFA 1XWDC 2V9SA 2JE1A 1K5DC 3RFSA 3WPHA 4ECOA 3OGLB 2O6RA 3ZYJA 2Z63A 4UFRA 3KJ4A 3G3AA 5B4PA 3ULUA 1FO1A 4Z8GA 4RCAB 5B0TA 3C6NB 3PMHG 4FDWA 1M9LA 4CILA 4ARRA 3W3MA 5AWCA 1P9AG 2WFHA 4FD0A 4LI1A 4LSAA 5LFNA 4KT1A 1P8TA 1XCDA 2OMWA 3BZ5A 3ZYOA 2RA8A 3WPGA 4FMZA 2XWTC 5AWBA 2XOTA 4GLPA 4RCWA 4QBZA 2JE0A 4V2CA 4LSXC 4NKHA 1DFJI 4XGOA 2Z62A 2UZXA 4PSJA 4QC0A 4Q3IA 4KNGA 3UL7A 1O6VA 1KOOA 2ASTB 3WPCA 5GMGA 1XECA 5B0NA 3W3GA 4PERA 5AWAA 4LXRA 5AZ5A 5GMFA 3UL9A 5CMNA 4LXSA 1FQVA 4U09A 5IJCA 1DS9A 4L3AA 2ID5A 4R09A 4R0AA 3ZYNA 5FTTB 4PKIG 4R6FA 1WWLA 5GMHA 4Y61B 4XSQA 4R07A 2ASSB 4LSXA 2WQUA 4Z64C 4FCGA 2WQVA 1O6SA 3G06A 4MQWX 5IYXC 4C2AB 1Z7XW 3RW7A 2P1OB 1M10B 4BV4R 2OMYA 1DCEA 3OJAA 3VQ1A 3RGZA 5CMPA 1KOHA 3UL8A
chains in the Genus database with same CATH superfamily
4R6JA 2A0ZA 2V70A 2O6SA 1K5GC 3FXIA 4M7EA 4BSRA 4U08A 3OJAB 3WPEA 4NZRM 3W3KA 4RWTC 4AW4A 3WPIA 1G9UA 4GT6A 3DZEA 3C6PB 3E2JA 2P1QB 1D0BA 4B8CD 4V2EA 2P1NB 5IJDA 2OMUA 1IO0A 4LI2A 3CIGA 3OGMB 4HQ1A 3WPDA 4BSSA 2Z81A 3UN9A 4K17A 1OOKG 4NKGA 4R5DA 4R58A 2Y5QA 1U0ND 4G8AA 3E6JA 4FS7A 4M7EC 4CP6A 4L3FA 1SQ0B 2O6QA 3RIZA 4QXEA 4CNMA 2IFGA 1OTNA 3VQ2A 2V9TB 4WYKA 4R5CA 3WPBA 4J0MA 4I6JB 3OGKB 1ZIWA 3RFEA 4IM6A 4Z61C 1OTOA 2UZYA 4C2BB 5AWDA 2FT3A 4P8SA 1OZNA 3ULVA 3G04C 2JQDA 2Z82A 3P72A 1H6TA 4ECNA 4AY9X 1JL5A 1W8AA 4MN8B 4U06A 4Z79A 4V2DA 2OMVA 2R9UA 3W3JA 5A5CA 1OGQA 4Q62A 4EZGA 4BSUA 3E4GA 2Q4GW 3RW6A 3RJ0A 1PGVA 4Z94G 2Z7XA 4CC4A 2RR6A 5GS0A 2WQXA 3M19A 4CNCA 3RFJA 4LSCA 4OQTA 3O6NA 5GS2B 3M18A 4PQ8A 1P8VA 3RGXA 1YRGA 4R6AA 3SB4A 2Z7XB 5D3IA 1XEUA 5HZLB 3REZA 3TSRE 2P1MB 5IJBA 4XOSA 3W3LA 2Z66A 4J4LA 1QYYA 3ZYIA 3WN4A 4R08A 1A9NA 2WQWA 1FS2A 2OMZA 2ELLA 4NZTM 5HDHA 4CC4C 3G39A 4ARNA 2Z65A 3E3ZA 2Z64A 4WP6A 4H09A 2CA6A 4KXFB 4Q3GA 2P1PB 1OTMA 3W3NA 4U7LA 1A4YA 1H6UA 2OMXA 4R6GA 3GOZA 1M9SA 3CIYA 4P91A 1FT8A 4YEBB 1O6TA 3G3BA 4FHOA 3ULAA 1M0ZA 1GWBA 4TZHA 4PEQB 2BEXA 5GQRK 3C6OB 2BNHA 1XKUA 3JB9j 3A79B 3O53A 1LTXA 3CVRA 2OMTA 3WPFA 1XWDC 2V9SA 2JE1A 1K5DC 3RFSA 3WPHA 4ECOA 3OGLB 2O6RA 3ZYJA 2Z63A 4UFRA 3KJ4A 3G3AA 5B4PA 3ULUA 1FO1A 4Z8GA 4RCAB 5B0TA 3C6NB 3PMHG 4FDWA 1M9LA 4CILA 4ARRA 3W3MA 5AWCA 1P9AG 2WFHA 4FD0A 4LI1A 4LSAA 5LFNA 4KT1A 1P8TA 1XCDA 2OMWA 3BZ5A 3ZYOA 2RA8A 3WPGA 4FMZA 2XWTC 5AWBA 2XOTA 4GLPA 4RCWA 4QBZA 2JE0A 4V2CA 4LSXC 4NKHA 1DFJI 4XGOA 2Z62A 2UZXA 4PSJA 4QC0A 4Q3IA 4KNGA 3UL7A 1O6VA 1KOOA 2ASTB 3WPCA 5GMGA 1XECA 5B0NA 3W3GA 4PERA 5AWAA 4LXRA 5AZ5A 5GMFA 3UL9A 5CMNA 4LXSA 1FQVA 4U09A 5IJCA 1DS9A 4L3AA 2ID5A 4R09A 4R0AA 3ZYNA 5FTTB 4PKIG 4R6FA 1WWLA 5GMHA 4Y61B 4XSQA 4R07A 2ASSB 4LSXA 2WQUA 4Z64C 4FCGA 2WQVA 1O6SA 3G06A 4MQWX 5IYXC 4C2AB 1Z7XW 3RW7A 2P1OB 1M10B 4BV4R 2OMYA 1DCEA 3OJAA 3VQ1A 3RGZA 5CMPA 1KOHA 3UL8A
chains in the Genus database with same CATH topology
4R6JA 2A0ZA 2V70A 2O6SA 1K5GC 3FXIA 4M7EA 4BSRA 4U08A 3OJAB 3WPEA 3W3KA 4RWTC 4AW4A 3WPIA 1G9UA 4GT6A 3DZEA 3C6PB 3E2JA 2P1QB 1D0BA 4B8CD 4V2EA 2P1NB 5IJDA 2OMUA 1IO0A 4LI2A 3CIGA 3OGMB 4HQ1A 3WPDA 4BSSA 2Z81A 3UN9A 4K17A 1OOKG 4NKGA 4R5DA 4R58A 2Y5QA 1U0ND 4G8AA 3E6JA 4FS7A 4M7EC 4CP6A 4L3FA 1SQ0B 2O6QA 3RIZA 4QXEA 4CNMA 2IFGA 1OTNA 3VQ2A 2V9TB 4WYKA 4R5CA 3WPBA 4J0MA 4I6JB 3OGKB 1ZIWA 3RFEA 4IM6A 4Z61C 1OTOA 2UZYA 4C2BB 5AWDA 2FT3A 4P8SA 1OZNA 3ULVA 3G04C 2JQDA 2Z82A 3P72A 1H6TA 4ECNA 4AY9X 1JL5A 1W8AA 4MN8B 4U06A 4Z79A 4V2DA 2OMVA 2R9UA 3W3JA 5A5CA 1OGQA 4Q62A 4EZGA 4BSUA 3E4GA 2Q4GW 3RW6A 3RJ0A 1PGVA 4Z94G 2Z7XA 4CC4A 2RR6A 5GS0A 2WQXA 3M19A 4CNCA 3RFJA 4LSCA 4OQTA 3O6NA 5GS2B 3M18A 4PQ8A 1P8VA 3RGXA 1YRGA 4R6AA 3SB4A 2Z7XB 5D3IA 1XEUA 5HZLB 3REZA 3TSRE 2P1MB 5IJBA 4XOSA 3W3LA 2Z66A 4J4LA 1QYYA 3ZYIA 3WN4A 4R08A 1A9NA 2WQWA 1FS2A 2OMZA 2ELLA 5HDHA 4CC4C 3G39A 4ARNA 2Z65A 3E3ZA 2Z64A 4WP6A 4H09A 2CA6A 4KXFB 4Q3GA 2P1PB 1OTMA 3W3NA 4U7LA 1A4YA 1H6UA 2OMXA 4R6GA 3GOZA 1M9SA 3CIYA 4P91A 1FT8A 4YEBB 1O6TA 3G3BA 4FHOA 3ULAA 1M0ZA 1GWBA 4TZHA 4PEQB 2BEXA 5GQRK 3C6OB 2BNHA 1XKUA 3JB9j 3A79B 3O53A 1LTXA 3CVRA 2OMTA 3WPFA 1XWDC 2V9SA 2JE1A 1K5DC 3RFSA 3WPHA 4ECOA 3OGLB 2O6RA 3ZYJA 2Z63A 4UFRA 3KJ4A 3G3AA 5B4PA 3ULUA 1FO1A 4Z8GA 4RCAB 5B0TA 3C6NB 3PMHG 4FDWA 1M9LA 4CILA 4ARRA 3W3MA 5AWCA 1P9AG 2WFHA 4FD0A 4LI1A 4LSAA 5LFNA 4KT1A 1P8TA 1XCDA 2OMWA 3BZ5A 3ZYOA 2RA8A 3WPGA 4FMZA 2XWTC 5AWBA 2XOTA 4GLPA 4RCWA 4QBZA 2JE0A 4V2CA 4LSXC 4NKHA 1DFJI 4XGOA 2Z62A 2UZXA 4PSJA 4QC0A 4Q3IA 4KNGA 3UL7A 1O6VA 1KOOA 2ASTB 3WPCA 5GMGA 1XECA 5B0NA 3W3GA 4PERA 5AWAA 4LXRA 5AZ5A 5GMFA 3UL9A 5CMNA 4LXSA 1FQVA 4U09A 5IJCA 1DS9A 4L3AA 2ID5A 4R09A 4R0AA 3ZYNA 5FTTB 4PKIG 4R6FA 1WWLA 5GMHA 4Y61B 4XSQA 4R07A 2ASSB 4LSXA 2WQUA 4Z64C 4FCGA 2WQVA 1O6SA 3G06A 4MQWX 5IYXC 4C2AB 1Z7XW 3RW7A 2P1OB 1M10B 4BV4R 2OMYA 1DCEA 3OJAA 3VQ1A 3RGZA 5CMPA 1KOHA 3UL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6J A;  2A0Z A;  2V70 A;  2O6S A;  1K5G C;  3FXI A;  4M7E A;  4BSR A;  4U08 A;  3OJA B;  3WPE A;  3W3K A;  4RWT C;  4AW4 A;  3WPI A;  1G9U A;  4GT6 A;  3DZE A;  3C6P B;  3E2J A;  2P1Q B;  1D0B A;  4B8C D;  4V2E A;  2P1N B;  5IJD A;  2OMU A;  1IO0 A;  4LI2 A;  3CIG A;  3OGM B;  4HQ1 A;  3WPD A;  4BSS A;  2Z81 A;  3UN9 A;  4K17 A;  1OOK G;  4NKG A;  4R5D A;  4R58 A;  2Y5Q A;  1U0N D;  4G8A A;  3E6J A;  4FS7 A;  4M7E C;  4CP6 A;  4L3F A;  1SQ0 B;  2O6Q A;  3RIZ A;  4QXE A;  4CNM A;  2IFG A;  1OTN A;  3VQ2 A;  2V9T B;  4WYK A;  4R5C A;  3WPB A;  4J0M A;  4I6J B;  3OGK B;  1ZIW A;  3RFE A;  4IM6 A;  4Z61 C;  1OTO A;  2UZY A;  4C2B B;  5AWD A;  2FT3 A;  4P8S A;  1OZN A;  3ULV A;  3G04 C;  2JQD A;  2Z82 A;  3P72 A;  1H6T A;  4ECN A;  4AY9 X;  1JL5 A;  1W8A A;  4MN8 B;  4U06 A;  4Z79 A;  4V2D A;  2OMV A;  2R9U A;  3W3J A;  5A5C A;  1OGQ A;  4Q62 A;  4EZG A;  4BSU A;  3E4G A;  2Q4G W;  3RW6 A;  3RJ0 A;  1PGV A;  4Z94 G;  2Z7X A;  4CC4 A;  2RR6 A;  5GS0 A;  2WQX A;  3M19 A;  4CNC A;  3RFJ A;  4LSC A;  4OQT A;  3O6N A;  5GS2 B;  3M18 A;  4PQ8 A;  1P8V A;  3RGX A;  1YRG A;  4R6A A;  3SB4 A;  2Z7X B;  5D3I A;  1XEU A;  5HZL B;  3REZ A;  3TSR E;  2P1M B;  5IJB A;  4XOS A;  3W3L A;  2Z66 A;  4J4L A;  1QYY A;  3ZYI A;  3WN4 A;  4R08 A;  1A9N A;  2WQW A;  1FS2 A;  2OMZ A;  2ELL A;  5HDH A;  4CC4 C;  3G39 A;  4ARN A;  2Z65 A;  3E3Z A;  2Z64 A;  4WP6 A;  4H09 A;  2CA6 A;  4KXF B;  4Q3G A;  2P1P B;  1OTM A;  3W3N A;  4U7L A;  1A4Y A;  1H6U A;  2OMX A;  4R6G A;  3GOZ A;  1M9S A;  3CIY A;  4P91 A;  1FT8 A;  4YEB B;  1O6T A;  3G3B A;  4FHO A;  3ULA A;  1M0Z A;  1GWB A;  4TZH A;  4PEQ B;  2BEX A;  5GQR K;  3C6O B;  2BNH A;  1XKU A;  3JB9 j;  3A79 B;  3O53 A;  1LTX A;  3CVR A;  2OMT A;  3WPF A;  1XWD C;  2V9S A;  2JE1 A;  1K5D C;  3RFS A;  3WPH A;  4ECO A;  3OGL B;  2O6R A;  3ZYJ A;  2Z63 A;  4UFR A;  3KJ4 A;  3G3A A;  5B4P A;  3ULU A;  1FO1 A;  4Z8G A;  4RCA B;  5B0T A;  3C6N B;  3PMH G;  4FDW A;  1M9L A;  4CIL A;  4ARR A;  3W3M A;  5AWC A;  1P9A G;  2WFH A;  4FD0 A;  4LI1 A;  4LSA A;  5LFN A;  4KT1 A;  1P8T A;  1XCD A;  2OMW A;  3BZ5 A;  3ZYO A;  2RA8 A;  3WPG A;  4FMZ A;  2XWT C;  5AWB A;  2XOT A;  4GLP A;  4RCW A;  4QBZ A;  2JE0 A;  4V2C A;  4LSX C;  4NKH A;  1DFJ I;  4XGO A;  2Z62 A;  2UZX A;  4PSJ A;  4QC0 A;  4Q3I A;  4KNG A;  3UL7 A;  1O6V A;  1KOO A;  2AST B;  3WPC A;  5GMG A;  1XEC A;  5B0N A;  3W3G A;  4PER A;  5AWA A;  4LXR A;  5AZ5 A;  5GMF A;  3UL9 A;  5CMN A;  4LXS A;  1FQV A;  4U09 A;  5IJC A;  1DS9 A;  4L3A A;  2ID5 A;  4R09 A;  4R0A A;  3ZYN A;  5FTT B;  4PKI G;  4R6F A;  1WWL A;  5GMH A;  4Y61 B;  4XSQ A;  4R07 A;  2ASS B;  4LSX A;  2WQU A;  4Z64 C;  4FCG A;  2WQV A;  1O6S A;  3G06 A;  4MQW X;  5IYX C;  4C2A B;  1Z7X W;  3RW7 A;  2P1O B;  1M10 B;  4BV4 R;  2OMY A;  1DCE A;  3OJA A;  3VQ1 A;  3RGZ A;  5CMP A;  1KOH A;  3UL8 A; 
#chains in the Genus database with same CATH topology
 4R6J A;  2A0Z A;  2V70 A;  2O6S A;  1K5G C;  3FXI A;  4M7E A;  4BSR A;  4U08 A;  3OJA B;  3WPE A;  4NZR M;  3W3K A;  4RWT C;  4AW4 A;  3WPI A;  1G9U A;  4GT6 A;  3DZE A;  3C6P B;  3E2J A;  2P1Q B;  1D0B A;  4B8C D;  4V2E A;  2P1N B;  5IJD A;  2OMU A;  1IO0 A;  4LI2 A;  3CIG A;  3OGM B;  4HQ1 A;  3WPD A;  4BSS A;  2Z81 A;  3UN9 A;  4K17 A;  1OOK G;  4NKG A;  4R5D A;  4R58 A;  2Y5Q A;  1U0N D;  4G8A A;  3E6J A;  4FS7 A;  4M7E C;  4CP6 A;  4L3F A;  1SQ0 B;  2O6Q A;  3RIZ A;  4QXE A;  4CNM A;  2IFG A;  1OTN A;  3VQ2 A;  2V9T B;  4WYK A;  4R5C A;  3WPB A;  4J0M A;  4I6J B;  3OGK B;  1ZIW A;  3RFE A;  4IM6 A;  4Z61 C;  1OTO A;  2UZY A;  4C2B B;  5AWD A;  2FT3 A;  4P8S A;  1OZN A;  3ULV A;  3G04 C;  2JQD A;  2Z82 A;  3P72 A;  1H6T A;  4ECN A;  4AY9 X;  1JL5 A;  1W8A A;  4MN8 B;  4U06 A;  4Z79 A;  4V2D A;  2OMV A;  2R9U A;  3W3J A;  5A5C A;  1OGQ A;  4Q62 A;  4EZG A;  4BSU A;  3E4G A;  2Q4G W;  3RW6 A;  3RJ0 A;  1PGV A;  4Z94 G;  2Z7X A;  4CC4 A;  2RR6 A;  5GS0 A;  2WQX A;  3M19 A;  4CNC A;  3RFJ A;  4LSC A;  4OQT A;  3O6N A;  5GS2 B;  3M18 A;  4PQ8 A;  1P8V A;  3RGX A;  1YRG A;  4R6A A;  3SB4 A;  2Z7X B;  5D3I A;  1XEU A;  5HZL B;  3REZ A;  3TSR E;  2P1M B;  5IJB A;  4XOS A;  3W3L A;  2Z66 A;  4J4L A;  1QYY A;  3ZYI A;  3WN4 A;  4R08 A;  1A9N A;  2WQW A;  1FS2 A;  2OMZ A;  2ELL A;  4NZT M;  5HDH A;  4CC4 C;  3G39 A;  4ARN A;  2Z65 A;  3E3Z A;  2Z64 A;  4WP6 A;  4H09 A;  2CA6 A;  4KXF B;  4Q3G A;  2P1P B;  1OTM A;  3W3N A;  4U7L A;  1A4Y A;  1H6U A;  2OMX A;  4R6G A;  3GOZ A;  1M9S A;  3CIY A;  4P91 A;  1FT8 A;  4YEB B;  1O6T A;  3G3B A;  4FHO A;  3ULA A;  1M0Z A;  1GWB A;  4TZH A;  4PEQ B;  2BEX A;  5GQR K;  3C6O B;  2BNH A;  1XKU A;  3JB9 j;  3A79 B;  3O53 A;  1LTX A;  3CVR A;  2OMT A;  3WPF A;  1XWD C;  2V9S A;  2JE1 A;  1K5D C;  3RFS A;  3WPH A;  4ECO A;  3OGL B;  2O6R A;  3ZYJ A;  2Z63 A;  4UFR A;  3KJ4 A;  3G3A A;  5B4P A;  3ULU A;  1FO1 A;  4Z8G A;  4RCA B;  5B0T A;  3C6N B;  3PMH G;  4FDW A;  1M9L A;  4CIL A;  4ARR A;  3W3M A;  5AWC A;  1P9A G;  2WFH A;  4FD0 A;  4LI1 A;  4LSA A;  5LFN A;  4KT1 A;  1P8T A;  1XCD A;  2OMW A;  3BZ5 A;  3ZYO A;  2RA8 A;  3WPG A;  4FMZ A;  2XWT C;  5AWB A;  2XOT A;  4GLP A;  4RCW A;  4QBZ A;  2JE0 A;  4V2C A;  4LSX C;  4NKH A;  1DFJ I;  4XGO A;  2Z62 A;  2UZX A;  4PSJ A;  4QC0 A;  4Q3I A;  4KNG A;  3UL7 A;  1O6V A;  1KOO A;  2AST B;  3WPC A;  5GMG A;  1XEC A;  5B0N A;  3W3G A;  4PER A;  5AWA A;  4LXR A;  5AZ5 A;  5GMF A;  3UL9 A;  5CMN A;  4LXS A;  1FQV A;  4U09 A;  5IJC A;  1DS9 A;  4L3A A;  2ID5 A;  4R09 A;  4R0A A;  3ZYN A;  5FTT B;  4PKI G;  4R6F A;  1WWL A;  5GMH A;  4Y61 B;  4XSQ A;  4R07 A;  2ASS B;  4LSX A;  2WQU A;  4Z64 C;  4FCG A;  2WQV A;  1O6S A;  3G06 A;  4MQW X;  5IYX C;  4C2A B;  1Z7X W;  3RW7 A;  2P1O B;  1M10 B;  4BV4 R;  2OMY A;  1DCE A;  3OJA A;  3VQ1 A;  3RGZ A;  5CMP A;  1KOH A;  3UL8 A; 
#chains in the Genus database with same CATH homology
 4R6J A;  2A0Z A;  2V70 A;  2O6S A;  1K5G C;  3FXI A;  4M7E A;  4BSR A;  4U08 A;  3OJA B;  3WPE A;  3W3K A;  4RWT C;  4AW4 A;  3WPI A;  1G9U A;  4GT6 A;  3DZE A;  3C6P B;  3E2J A;  2P1Q B;  1D0B A;  4B8C D;  4V2E A;  2P1N B;  5IJD A;  2OMU A;  1IO0 A;  4LI2 A;  3CIG A;  3OGM B;  4HQ1 A;  3WPD A;  4BSS A;  2Z81 A;  3UN9 A;  4K17 A;  1OOK G;  4NKG A;  4R5D A;  4R58 A;  2Y5Q A;  1U0N D;  4G8A A;  3E6J A;  4FS7 A;  4M7E C;  4CP6 A;  4L3F A;  1SQ0 B;  2O6Q A;  3RIZ A;  4QXE A;  4CNM A;  2IFG A;  1OTN A;  3VQ2 A;  2V9T B;  4WYK A;  4R5C A;  3WPB A;  4J0M A;  4I6J B;  3OGK B;  1ZIW A;  3RFE A;  4IM6 A;  4Z61 C;  1OTO A;  2UZY A;  4C2B B;  5AWD A;  2FT3 A;  4P8S A;  1OZN A;  3ULV A;  3G04 C;  2JQD A;  2Z82 A;  3P72 A;  1H6T A;  4ECN A;  4AY9 X;  1JL5 A;  1W8A A;  4MN8 B;  4U06 A;  4Z79 A;  4V2D A;  2OMV A;  2R9U A;  3W3J A;  5A5C A;  1OGQ A;  4Q62 A;  4EZG A;  4BSU A;  3E4G A;  2Q4G W;  3RW6 A;  3RJ0 A;  1PGV A;  4Z94 G;  2Z7X A;  4CC4 A;  2RR6 A;  5GS0 A;  2WQX A;  3M19 A;  4CNC A;  3RFJ A;  4LSC A;  4OQT A;  3O6N A;  5GS2 B;  3M18 A;  4PQ8 A;  1P8V A;  3RGX A;  1YRG A;  4R6A A;  3SB4 A;  2Z7X B;  5D3I A;  1XEU A;  5HZL B;  3REZ A;  3TSR E;  2P1M B;  5IJB A;  4XOS A;  3W3L A;  2Z66 A;  4J4L A;  1QYY A;  3ZYI A;  3WN4 A;  4R08 A;  1A9N A;  2WQW A;  1FS2 A;  2OMZ A;  2ELL A;  5HDH A;  4CC4 C;  3G39 A;  4ARN A;  2Z65 A;  3E3Z A;  2Z64 A;  4WP6 A;  4H09 A;  2CA6 A;  4KXF B;  4Q3G A;  2P1P B;  1OTM A;  3W3N A;  4U7L A;  1A4Y A;  1H6U A;  2OMX A;  4R6G A;  3GOZ A;  1M9S A;  3CIY A;  4P91 A;  1FT8 A;  4YEB B;  1O6T A;  3G3B A;  4FHO A;  3ULA A;  1M0Z A;  1GWB A;  4TZH A;  4PEQ B;  2BEX A;  5GQR K;  3C6O B;  2BNH A;  1XKU A;  3JB9 j;  3A79 B;  3O53 A;  1LTX A;  3CVR A;  2OMT A;  3WPF A;  1XWD C;  2V9S A;  2JE1 A;  1K5D C;  3RFS A;  3WPH A;  4ECO A;  3OGL B;  2O6R A;  3ZYJ A;  2Z63 A;  4UFR A;  3KJ4 A;  3G3A A;  5B4P A;  3ULU A;  1FO1 A;  4Z8G A;  4RCA B;  5B0T A;  3C6N B;  3PMH G;  4FDW A;  1M9L A;  4CIL A;  4ARR A;  3W3M A;  5AWC A;  1P9A G;  2WFH A;  4FD0 A;  4LI1 A;  4LSA A;  5LFN A;  4KT1 A;  1P8T A;  1XCD A;  2OMW A;  3BZ5 A;  3ZYO A;  2RA8 A;  3WPG A;  4FMZ A;  2XWT C;  5AWB A;  2XOT A;  4GLP A;  4RCW A;  4QBZ A;  2JE0 A;  4V2C A;  4LSX C;  4NKH A;  1DFJ I;  4XGO A;  2Z62 A;  2UZX A;  4PSJ A;  4QC0 A;  4Q3I A;  4KNG A;  3UL7 A;  1O6V A;  1KOO A;  2AST B;  3WPC A;  5GMG A;  1XEC A;  5B0N A;  3W3G A;  4PER A;  5AWA A;  4LXR A;  5AZ5 A;  5GMF A;  3UL9 A;  5CMN A;  4LXS A;  1FQV A;  4U09 A;  5IJC A;  1DS9 A;  4L3A A;  2ID5 A;  4R09 A;  4R0A A;  3ZYN A;  5FTT B;  4PKI G;  4R6F A;  1WWL A;  5GMH A;  4Y61 B;  4XSQ A;  4R07 A;  2ASS B;  4LSX A;  2WQU A;  4Z64 C;  4FCG A;  2WQV A;  1O6S A;  3G06 A;  4MQW X;  5IYX C;  4C2A B;  1Z7X W;  3RW7 A;  2P1O B;  1M10 B;  4BV4 R;  2OMY A;  1DCE A;  3OJA A;  3VQ1 A;  3RGZ A;  5CMP A;  1KOH A;  3UL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...