4R6KA

Crystal structure of abc transporter substrate-binding protein yeso from bacillus subtilis, target efi-510761, an open conformation
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
396
structure length
396
Chain Sequence
EDVTLRIAWWGGQPRHDYTTKVIELYEKKNPHVHIEAEFANWDDYWKKLAPMSAAGQLPDVIQMDTAYLAQYGKKNQLEDLTPYTKDGTIDVSSIDENMLSGGKIDNKLYGFTLGVNVLSVIANEDLLKKAGVSINQENWTWEDYEKLAYDLQEKAGVYGSNGMHPPDIFFPYYLRTKGERFYKEDGTGLAYQDDQLFVDYFERQLRLVKAKTSPTPDESAQIKGMEDDFIVKGKSAITWNYSNQYLGFARLTDSPLSLYLPPEQMQEKALTLKPSMLFSIPKSSEHKKEAAKFINFFVNNEEANQLIKGERGVPVSDKVADAIKPKLNEEETNIVEYVETASKNISKADPPEPVGSAEVIKLLKDTSDQILYQKVSPEKAAKTFRKKANEILERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transporter Yeso from Bacillus subtilis, Target Efi-510761
rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords SOLUTE-BINDING PROTEIN
total genus 147
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6kA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6kA02
3PUWE 2PBWA 3O6GA 4QFNA 1M5EA 1AL3A 1Q1KA 4GXAA 2GRVA 4YU0A 3S9LC 3C35A 2QPQA 4MLVA 4QSDA 4R2FA 4C1TA 2D5WA 3K6UA 4H5GA 2F7CA 1ZMGA 3MWBA 3OSRA 4POWA 1B46A 1S50A 3IOUA 3MZBA 1B7ZA 1JETA 4LVQA 1SW5A 4DCYA 2V93A 2H99A 5CMMA 3RUMA 4EQ9A 1OLAA 4Q5TA 3P7IA 4O3AA 1I6AA 2DSFA 4DCXA 3E4RA 3KG2A 1VR5A 3Q29A 4QSCA 4R73A 4I62A 4OZ9A 2V3TA 2IEEA 2F97A 3E3KA 4JDFA 4NF8A 3RTFB 4EDPA 2OZZA 1VE4A 1QJMA 4ZECA 1FTMA 3IR1A 2UVIA 3G3IA 5L9OA 4EQBA 3H6VA 1AIVA 1LB9A 5FHOA 3LSXA 3VLUA 1MXXA 1JEUA 1DPEA 3E13X 4GL8A 4M1VA 4M4GA 3K2DA 3HO7A 1LLSA 2I49A 3IB1A 5DT6A 5FHNA 4ZEDA 2VP1A 5KCJB 3T9HB 3QSLA 1LFIA 4GIZA 4HCWA 2PT1A 1A40A 3EN3A 3H4ZA 3KZGA 2WKYA 2Q88A 3BFTA 3IB2A 3S4UA 5ICQA 3U94A 2F6GA 1PB8A 2XXXA 4IO4A 3FJMA 1B58A 5L9MA 5HM4B 3ONMA 2PVUA 4IY5A 5H8NB 4IO7A 1URSA 4JWXA 2DP8A 3V5AA 1OQHA 2B3FA 4NWCA 5I58A 1NNFA 3OENA 4IGRA 1T0KA 3U8QA 1B05A 3M3KA 3MW0A 3PU5A 3MZ1A 3SEVA 1QULA 4JWOA 3U92A 1HSEA 1LCFA 2DVCA 3EQ1A 3S2VA 4XKQA 1P1QA 5TPAA 4I8CA 2P2AA 1MRPA 1SDXA 4LZ8A 1SBPA 4QFKA 4U2RA 1UTBA 3LC8A 5EHSA 4F19A 3QXMA 1JVXA 1LFGA 1B0HA 1XT8A 2RINA 4H0WA 3FVOA 1N76A 3MUQA 2NUVA 3G3JA 4K3FA 2ZYKA 5CMBA 4YKIA 2D21A 4QFOA 2RCAA 3S9NC 1MXZA 3VDFA 1Y4TA 4BDNA 4OENA 1ANFA 2G93A 4WXJA 1MXVA 4R9GA 5FTHA 1ATGA 2F7BA 3T9XB 4F31B 1IXGA 1IEJA 2PMSA 3C31A 2REJA 3B6TA 3CSGA 1A8FA 3FGSA 3N94A 4R72A 1IQ7A 1A99A 3R26A 4NF5A 3TTMA 3PV0E 4IO3A 2O51A 4MFIA 4U22A 3EF7A 4DLDA 3S9EA 2XX9A 1JW4A 2Q2AA 4R9FA 2OWSA 3H03A 5EYFA 2XX7A 4DZ1A 4G68B 4R6YA 1XVYA 1P1NA 2UXAA 5TU0A 2VD3A 2PT2A 2I48A 5I2NB 3IO6A 3LBSA 3TYHA 3GZGA 3PPOA 2DWJA 2I4CA 3C33A 1B7UA 4N07A 5M2VA 1BKAA 1B9JA 1GR2A 2QJEA 3GBBA 4MBPA 5DVJA 3SEWA 2Y84A 1UIUA 3H06B 3MAMA 4LUBA 1FW0A 2QMWA 1USYH 1GV8A 2V84A 3K02A 1AOVA 2HEUA 4EXKA 2DVZA 4FJPA 1SI1A 3IO4A 2QS4A 2A5SA 1EU8A 2RKMA 2A5TA 2QS3A 4G8MA 1QVSA 1XVXA 3KN3A 1QUJA 4ZDMA 5JTYA 2Q8JA 3PD8A 5AA2A 2HZKA 1MY4A 1EZ9A 3RTWB 1MXWA 2I0CA 5I2NA 3T22A 1B5IA 3FZVA 2VHAA 4NF8B 3TMGA 1B32A 2Q89A 3V89B 4O3BA 4U4XA 2UVJA 2XXRA 1JVYA 3DP8A 3DM0A 3M3LA 2CZLA 3SERA 2B3BA 3KFMA 3MC2A 3R7XA 5IKBA 4G68C 1XS5A 1Z7ME 4BDQA 1Y3NA 1A8EA 1OIBA 1RYOA 2UYFA 4FIMA 4E0XA 2V25A 4ISUA 2HCAA 3EHUA 3W9WA 3ODBA 4WEPA 1RKMA 2ZYOA 2X7PA 3IJOB 3TODA 3UP9A 2H25A 2X7QA 3H6UA 1MY3A 2PYYA 3KBRA 3MBPA 3LR1A 3S9MC 3MJNA 3KSXA 5ITOA 3RN8A 3RT6B 1ZKBA 1MG1A 2YPNA 2QMXA 2F5XA 2XXUA 3C9HA 3CSBA 1DPPA 1N7XA 4MH5A 1J1NA 4FAJA 1B40A 5H8QB 3PUYE 4LZ7A 4GWOA 4YICA 3RGYA 4NF5B 4F3GA 1GVCA 2ANJA 1SD3A 3LSLA 4IGTA 4LZ5A 1PEBA 3L6HA 4RA1A 2GFEA 1MPCA 4RNSA 1LAHE 1N7WA 3TZAA 3VXBA 1LFHA 1POY1 1ZBMA 4G8NA 1ZIUA 2R71A 1NFTA 4X48A 3O6HA 5TP9B 1LB8A 3I5OA 4KQPA 1SYHA 3A09A 3IOVA 1B3EA 4OTEA 3OO6A 4X1BA 1II5A 1FQAA 1MPBA 3DLNA 1UTHA 3IJXB 4LQ2A 3OELA 3O6IA 3PPRA 3QAXA 1PBQA 1MQJA 1YTVA 1MPDA 1Y1ZA 5DTBA 3U1OA 4F1UA 3UN6A 5H8FB 3KN8A 5HBCA 2ESNA 2VD2A 3CG1A 3JYRA 3PMWA 4QRZA 4ZEKA 2HQ0A 3CFXA 3IX1A 3K6WA 3MZ9A 4H8JA 4QFPA 1I6QA 4RYAA 1USYE 2XXVA 1H43A 3FXRA 1FTLA 3OD7A 3O29A 1M5BA 2Z8EA 3FIRA 4YKKA 3D4CA 2HXWA 2Q2CA 3K1NA 3O9PA 3SESA 3TDJA 2V3QA 5H8NA 2YJPA 2OWTA 1EZPA 3A3CA 4ZZAA 3QUJA 4OFLA 5BWJA 5H8FA 2ZMBA 2O7UA 1D9VA 4POXA 5I59A 2F34A 4NF4B 1H76A 4GD5A 1VSOA 2OK2A 2H98A 3CVGA 2I0BA 4MLQA 3UGWA 1Y9UA 3VE1B 4PE5B 3Q27A 4EF1A 5CM6A 3HPIA 4KYSA 1DTZA 2I3VA 1NNKA 1DOTA 2E1SA 2O84X 4HTGA 2OJTA 3T9VA 1B5JA 3MVXA 3TTKA 4RPNA 1B3FA 1MY1A 3KOTA 5AA1A 2QL3A 4H8IA 1MQGA 4F1YA 1IITA 1SYIA 3QK6A 3TELA 3KN7A 4DXUA 1EH3A 2Z8FA 3QUFA 4YB6A 4NF4A 1A7LA 5H8SA 2O1LA 4IB2A 4KYEA 3MVZA 1O64A 3PPQA 4GRKA 3K6XA 4U1OA 4FATA 2XD2A 1MQIA 2QS2A 5I2KB 3PPPA 3CG3A 4OVJA 1VFEA 2XXQA 4JB7A 4H1XA 2GHAA 2ZNSA 1VFDA 5CRYA 5LOMA 3WAEA 4FORA 1URGA 4R2BA 1MM6A 1R9QA 1UTBB 3DP6A 3LSFB 4C1UA 4EF2A 5KDTB 4P0IA 3V8XB 3AXFA 5BUUA 1US5A 2P1SA 3B7DA 1H45A 1MDQA 5DVIA 4AQ4A 2B65A 1PB7A 2F8DA 2ALUA 3IK6B 1R9LA 4OFJA 4PQJA 1D4NA 2NOOA 4QHQA 3TCGA 2Z23A 3O2AA 1MY2A 4JBZA 4XIGQ 3TKDA 4GFRA 1BP5A 4F18A 1B2HA 4R6KA 4OETA 4F3SA 4IO2A 3PMVA 4OYVA 5ELVA 1US4A 4LP2B 3FVKA 5FHMA 5I84A 3DELB 1D3KA 5CC2A 2R9JA 3K1MA 3RLFE 3CRBA 4ELQA 3G7WA 2YLNA 3KGCA 3KSJA 5ITPA 1JEVA 1QUKA 2UYEA 1TFAA 3FVGA 3USDA 2DWAA 3K1PA 3IOTA 1FQBA 2BJJX 3RQTA 3UA8A 4UA8A 2DOJA 3U93A 4AB6A 1S9TA 2VGQA 1CB6A 1P99A 3PGFA 4IY6A 4PFUA 3SKPA 2VOZA 4KHZE 4LONB 4ECFA 1LGBC 3CI8A 3PD9A 1ZTYA 3FUZA 5F7VA 5H8HB 4EQ7A 3W15C 1OQGA 3LUYA 4G4PA 4RJZA 4DE8A 2DWHA 4ZE8A 5JK4A 3UORA 1P1UA 3OMBA 4TQUQ 3I6VA 2F35A 3K0VA 1JW5A 1MM7A 3PUVE 5TPAB 4ZEBA 5L9SA 3C34A 1NKXA 1OVBA 1UTHB 2F7AA 4DDDA 5KZTA 3ZKLA 1N04A 1JW1A 4OFOA 5H8QA 1QUIA 1YAEA 4ELPA 3UIFA 1B3GA 1ZJLA 3MVYA 2AIXA 4GF8A 4GQOA 4HCYA 1SQYA 4ZE9A 4FECA 2KLFA 4JSOA 4ONYA 4HW8A 3GBAA 2I58A 1SW1A 2Y7PA 4G77A 4YMAA 3VVFA 1IXIA 3MPLA 3EHTA 5I56A 4KPTA 2W7YA 1M5CA 4JXIA 3THIA 2ABHA 3RNNA 3BKIB 4GL0A 4YB7A 4GVOA 1LSTA 1MXUA 4YKJA 5B7DA 4H5FA 1MH4A 3W9VA 4LQ5A 3EHSA 4QF9A 2DQVA 2XXYA 1I69A 5ICTA 3PMXA 1MQHA 1WVJA 3FV1A 3FXUA 2FYIA 3I3VA 5FTIA 3U72A 1FQCA 4F2OA 4Z7EA 5I2KA 3JZJA 3A3UA 2XHDA 3G3KA 4RK9A 4ELOA 2O7IA 1B0LA 1PBPA 5DEXB 4JSDA 1AMFA 4NF6B 4NTLA 3RT8A 5CBRA 5KDTA 3CIJA 1XOCA 2REGA 3TCFA 4I9DA 4EXLA 2GH9A 3N5LA 4RPOA 3QIMA 1SI0A 1RYXA 3FV2A 4Q8RA 1SW4A 4YB5A 4R74A 2XXTA 4YMBA 3M3FA 4ND9A 4KFQA 1GTKA 4DIGA 1Y3PA 3L6GA 1TFDA 1B51A 1URDA 2F6PA 4YZZA 2RC9A 3DP4A 3HV1A 4OHNA 3TEPA 2O1MA 2ZYNA 4TOZA 1LCTA 4PETA 4KCDA 2CMOA 4P0GA 2HZLA 2I4BA 3KJTA 4H65A 1B6HA 1JQFA 2F36A 1BIYA 1POTA 3FVNA 1QW0A 3MP1A 1WDNA 3IB0A 3H3GA 3N6TA 1AH5A 3SEXA 3OEKA 2ONRA 4E0WA 1B7HA 2M8CA 1Y3QA 3OO9A 4OEUA 1SVXB 5I57A 2F78A 4F22A 2OBGA 3IOWA 4WEDA 1IXHA 3TTLA 2HFBA 4U4SA 4U1ZA 3FJGA 1DSNA 3ZKKA 5A5XA 4Q30B 4R75A 3SEYA 1ZU0A 5ISUA 4OEVA 4PFYA 4R6HA 1MDP1 1XHYA 5AE4A 3K4UA 4MF3A 3ILUB 2ZNUA 1NNPA 2UVGA 2RC8A 1FQFA 1L5TA 3ZS6A 1TWYA 4KCCA 4U23A 1CE2A 2ZNTA 3LSWA 4F1VA 3IORA 3EPEA 3Q25A 1B4ZA 3MPKA 1NNTA 1YCJA 3H6TA 3SDFA 3PPNA 3TPAA 3HHGA 1OVTA 3C36A 2AL5A 1Y4CA 4F29A 2XXPA 1LAGE 4FEBA 4QSEA 1M5FA 1IXCA 5JTYB 3VV5A 2H5YA 1Y20A 2DXRA 2Y7KA 3N6UA 4OMBA 4BLAA 4TLMB 4G2ZA 4ELRA 5HPQA 5I57B 4P11A 4NE4A 3K01A 4F3BA 4FEDA 2Y7WA 1R6ZA 4I1DA 3KJ7A 3SEUA 1B1HA 5TP9A 2OLBA 3ILTB 4LA9A 4XTCQ 4OQOA 5DYHA 1P1OA 3HHFA 4OXVA 2NVUB 4Q0CA 3H7MA 1ELJA 5L8DA 5A5XB 1MXYA 2PX1A 4HS7A 4O3CA 3VVDA 3T96B 3VFJA 3OSQA 4OESA 1B1XA 1O63A 3TAJA 1FTOA 5K2XA 5CMKA 1M5DA 5I56B 1IZ1A 4XKRA 1XC1A 2QSXA 5JEIA 2THIA 4XKPA 2NWJA 1I6BA 3C4MA 2FNCA 1Q35A 2H9BA 1HSLA 2XXIA 2Z8DA 4NMYA 2DE4A 1FQEA 5KCJA 2UVHA 2ZYMA 2DXYA 2HAVA 1FTKA 3FD3A 4KD5A 2XD3A 3MQ9A 3FASA 1SW2A 3O28A 4ESWA 4F2QA 3D4GA 2O6AA 5AA4A 3B6QA 5AA3A 4KR5A 3TCHA 3TTNA 5DEXA 2OCUA 2Y7IA 1B3HA 4U21A 1GGGA 4OERA 3RPWA 1FCKA 3MVWA 5H8HA 1B4HA 3OOAA 1WODA 4FE8A 1LBBA 4F39A 3TTRA 3K00A 1NMUA 4X1DA 2ZXTA 5CI5A 5AA2D 5CBSA 4F3PA 3O66A 4RK2A 2RC7A 3OEMA 4Z0IA 1R1NA 2DYXA 1HSJA 4PFWA 2D3IA 3VVEA 4ZS9A 4N13A 3BBRA 1MQDA 1QKBA 1QKAA 3H6WA 5J1DA 3RY3A 3TUSA 2ONSA 2XXWA 2XX8A 4TLLB 3N26A 1DTGA 1OMPA 4ZEIA 1EZOA 2G29A 4EUOA 3MP8A 1NL5A 4C0RA 4N6PA 2Y7RA 2HAUA 4G68A 4H6DA 3IL1B 3JV9A 4UACA 1B5HA 4BDOA 3GLBA 1IUDA 4BDLA 3CFZA 4IO5A 4IO6A 4ZEFA 3C32A 2FA7A 3Q28A 2QS1A 3KOSA 4YAHX 3VXCA 5I59B 2GHBA 1MY0A 3KEIA 3M8UA 4LATA 3T93B 3PUZE 4DXCA 2DWIA 2IA4A 2O69A 1FQDA 3B6WA 4XKNA 4YKPA 3TQLA 1LAXA 1NH7A 3SETA 4OWDA 3FATA 3HN0A 3K6VA 4H67A 1OLCA 2Q9TA 3IAZA 1PB9A 2H4IA 1LAFE 3QYTA 3MP6A 5EHMA 3VLVA 2AL4A 3CFLA 4RXLA 4DXBA 1N0TA 3TQWA 2NXOA 4NWDA 3OO8A 5DVFA 1TT1A 3ZSFA 1D9YA 3FXQA 5IAIA 1H3DA 2X26A 3HCQA 5F1QA 5B70A 2DS9A 2AYSA 1N3XA 1A55A 1N3WA 3PUXE 2I3WA 4L17A 3FJ7A 4AB5A 1YPNA 3Q26A 2DE2A 2XXHA 2LAOA 3O97A 4XXUA 3UK4A 1DMBA 5K2YA 3OO7A 2I6EA 2DE3A 1FTJA 4JWYA 4THIA 1UQWA 4WKMA 3WAFA 4BDRA 1PDAA 1PC3A 2A5TB 3G3HA 4NEDA 1B52A 3VLWA 4RY1A 2R6GE 4GXSB 4X9TA 1B3LA 3HSTA 1BLFA 3BFUA 3OXNA 1TXFA 1KWHA 1ZLQA 3CR9A 3G3FA 3E9XA 4KI0E 1S7YA 1LBCA 2P0SA 3T66A 4NF6A 4PP0A 1JNFA 1A54A 2Z22A 2O68A 3ECRA 4G8HA 5I58B 3V83A 5AA2B 1P1WA 3GXAA 1MS7A 1O7TA 1Y1MA 5CMCA 5AA4B 1MH3A 2V3UA 4ZZEA 1NH8A 1H44A 3TFLA 2E0SA 4GOTA 3G3GA 4ESXA 1IIWA 2RF1A 4BDMA 4QFLA 1UIVA 3R6UA 1Z7NE 4GLIA 3T9UA 1BTJA 1N84A 2QRYA 2ONKE 4PFTA 1F9BA 3F11A 2RCBA 4KYDA
chains in the Genus database with same CATH superfamily
1RDZA 1AL3A 1Q1KA 2OX3A 4R2FA 3K6UA 4H5GA 2F7CA 1S50A 3IOUA 1JETA 1SW5A 2V93A 4EQ9A 4Q5TA 3P7IA 2DSFA 4DCXA 3E4RA 1DBZA 1VR5A 2WYPA 4NF8A 5IZ1A 3IR1A 2UVIA 5L9OA 5FHOA 1MXXA 4HE0A 1IMAA 1FRPA 4ZEDA 4PF6A 2PT1A 3KZGA 2WKYA 3S4UA 2F6GA 4IO4A 1FJ9A 4OVTA 5H8NB 1URSA 2DP8A 5I58A 4IGRA 3U92A 3MZ1A 1QULA 4JWOA 5ET8A 1LCFA 2DVCA 1P1QA 5TPAA 1SDXA 5EHSA 3QXMA 1JVXA 1LFGA 4NGUA 2D21A 1MXZA 4OENA 4WXJA 1NV1A 1IEJA 4QXDA 4NF5A 2O51A 3EF7A 2XX9A 2OWSA 2JJKA 4DZ1A 4R6YA 1P1NA 3TYHA 3GZGA 3C33A 1B7UA 4MBPA 5DVJA 4JVCA 1UIUA 3H06B 3MAMA 4LUBA 1GV8A 2DVZA 3IO4A 4NF4B 5LDZA 1XVXA 4ZDMA 3PD8A 2HZKA 1MY4A 3RTWB 2Q74A 2VHAA 4PF8A 3V89B 2UVJA 2XXRA 3DM0A 3M3LA 2B3BA 3R7XA 4G68C 1Y3NA 1A8EA 4FIMA 4ISUA 2HCAA 1FBDA 2ZYOA 2PCRA 4PDHA 3KBRA 3MBPA 3KSXA 3C9HA 2XXUA 3SZPA 4LZ7A 4LZ5A 1PEBA 3MYUA 1MPCA 4NX1A 1ZBMA 2R71A 1NFTA 4NAPA 1SYHA 1II5A 3DLNA 5DTBA 1FTAA 3KN8A 2ESNA 5EYGA 2FHYA 3MZ9A 4RYAA 2QVRA 2Z8EA 3SESA 2V3QA 2OWTA 3EKIA 3A3CA 1D9VA 2F34A 1JP4A 4GD5A 2OK2A 2H98A 3UGWA 3HPIA 1DTZA 2O84X 4HTGA 4RPNA 2QL3A 1IITA 1EH3A 2O1LA 4FATA 2XD2A 5I2KB 2ZZVA 1VFEA 2XXQA 4JB7A 1VFDA 2PFYA 5KDTB 1MM6A 1R9QA 3LSFB 3A29A 3V8XB 1US5A 2P1SA 4PCDA 1MDQA 2B65A 1LBWA 1PB7A 2OWZA 2P3NA 2NOOA 4I3EA 2Z23A 4JBZA 4GFRA 1B2HA 4OYVA 3PMVA 3FVKA 5ET7A 2R9JA 3RLFE 3CRBA 3KGCA 5ITPA 1FQBA 2DOJA 3U93A 1P99A 4PFUA 4KHZE 4GBWA 3CI8A 3PD9A 5F7VA 5JK4A 4G4PA 4DE8A 3I6VA 3K0VA 1JW5A 5L9SA 5KZTA 1JW1A 4OFOA 1B3GA 3MVYA 2AIXA 4HCYA 4FECA 4ONYA 1SW1A 1IXIA 3MPLA 3FBPA 4KPTA 4JXIA 2ABHA 4YB7A 4GVOA 1MXUA 4H5FA 4QF9A 1I69A 3PMXA 1WVJA 3I3VA 3MSTA 2XHDA 4ELOA 4JSDA 1AMFA 4RPOA 3N5LA 4Q8RA 1RYXA 4I3YA 3QMFA 1FPFA 4P8BA 1B51A 4YZZA 3T1BA 2RC9A 2ZYNA 4TOZA 4PETA 2CMOA 1BIYA 1POTA 1WDNA 3IB0A 4JVDA 3OO9A 5I57A 2F78A 3IOWA 1QGXA 5I7IA 3FXBA 1DSNA 3ZKKA 5A5XA 4FBPA 4I40A 4OEVA 4PFYA 1L5TA 1FQFA 1TWYA 4U23A 4F1VA 3IORA 5DW8A 1NNTA 1YCJA 4OA4A 4PAKA 1OVTA 2XXPA 4QSEA 1M5FA 5JTYB 3VV5A 3N6UA 4BLAA 4TLMB 4G2ZA 5HPQA 5EYHA 4FEDA 3KJ7A 4OVSA 1B1HA 5TP9A 2NVUB 3HHFA 4OXVA 5ET6A 4Q0CA 3H7MA 1ELJA 4HS7A 4O3CA 3TAJA 2THIA 4XKPA 4GX6A 3C4MA 2FNCA 1Q35A 2F3BA 5KCJA 1FQEA 2UVHA 2ZYMA 3S9EA 4ESWA 2O6AA 4KR5A 5DEXA 4OERA 1FCKA 3OOAA 4FE8A 2HHMA 5AA2D 4F3PA 2RC7A 1HSJA 1XI6A 3VVEA 4ZS9A 3KBZA 5J1DA 1OMPA 4ZEIA 3RPLA 2Y7RA 1B5HA 1IUDA 4XF5A 3CFZA 1MY0A 3KEIA 3M8UA 4LATA 3T93B 3PUZE 4DXCA 3SETA 4XFEA 3FATA 4GBVA 1PB9A 1LAFE 3MP6A 4RXLA 3OO8A 5IAIA 3FJ7A 4AB5A 1YPNA 1NV3A 3OO7A 1PDAA 1PC3A 3VLWA 2R6GE 1NV4A 1BLFA 3OXNA 2R8TA 5CMCA 1FSAA 1H44A 3TFLA 4GOTA 1IIWA 4MNIA 2RF1A 2WEFA 1UIVA 2QRYA 2ONKE 4PFTA 3O6GA 4GXAA 2D5WA 4POWA 5ET5A 3MZBA 1B7ZA 3RUMA 1OLAA 2FBPA 4O3AA 2WBDA 3D1RA 4R73A 4I62A 4JDFA 1VE4A 1FTMA 3G3IA 3LSXA 1JEUA 1DPEA 4GL8A 3K2DA 3HO7A 2I49A 5DT6A 3GYYA 4GIZA 3H4ZA 3IB2A 2Q88A 1CNQA 5ICQA 1YXIA 3FJMA 1B58A 3ONMA 2PVUA 4G61A 3V5AA 1OQHA 4NWCA 2Y5KA 3MW0A 3SEVA 5I3SA 4QFKA 4LZ8A 1SBPA 1UTBA 1B0HA 1XT8A 4H0WA 3FVOA 2NUVA 4K3FA 4QFOA 3VDFA 4BDNA 1ANFA 2G93A 2FIXA 5FTHA 3C31A 3N94A 3TTMA 3R26A 3PV0E 4IO3A 4R9FA 3H03A 5EYFA 2XX7A 1INPA 4G68B 2VD3A 2I48A 1FBPA 5I2NB 3LBSA 3PPOA 1D9QA 3K02A 4NQ8A 3HFUA 2A5SA 1EU8A 2Q8JA 1EZ9A 1FBCA 2I0CA 1B5IA 4O3BA 2B4LA 4O8MA 3DP8A 1JVYA 4N6DA 4E0XA 4PBHA 2V25A 4PE3A 4WEPA 2PYYA 2CEYA 3MJNA 3RT6B 1ZKBA 4AS4A 1DPPA 1B40A 3PUYE 4YICA 1NUZA 4MMPA 4RNSA 1LAHE 1N7WA 3VXBA 1ZIUA 3O6HA 3NOHA 3I5OA 4KQPA 3IOVA 4OTEA 5EQ9A 4LQ2A 1UTHA 3QAXA 1YTVA 1MPDA 1Y1ZA 5H8FB 3PMWA 4QRZA 2HQ0A 3IX1A 3K6WA 4QFPA 1USYE 4H46A 3FXRA 1H43A 1M5BA 3FIRA 3D4CA 3TDJA 1EZPA 1NV6A 4ZZAA 5BWJA 5H8FA 4MLQA 2I0BA 1Y9UA 4PE5B 3Q27A 5CM6A 1FJ6A 1DOTA 1B5JA 4H8IA 1MQGA 4AS5A 3TELA 3KN7A 4DXUA 4NF4A 1A7LA 4U1OA 4OVJA 2GHAA 3WAEA 1URGA 3DP6A 4EF2A 4N6KA 4QBAA 5BUUA 1H45A 4LN5A 4AQ4A 2ALUA 3IK6B 1R9LA 4OFJA 3O2AA 3TKDA 1EYJA 4F18A 4OETA 1US4A 4LP2B 5I84A 3K1MA 3KSJA 1JEVA 1QUKA 2UYEA 1TFAA 3FVGA 2VGQA 4F1YA 3SKPA 1AIVA 4IY6A 1FPDA 4F1UA 1OQGA 4TQUQ 3PUVE 5TPAB 2F7AA 4GWWA 1BK4A 4ZE9A 1SQYA 3VVFA 2QVUA 2XXYA 3U72A 3G3KA 1B0LA 1PBPA 4NF6B 3RT8A 3CIJA 4EXLA 1G0IA 2GH9A 3QIMA 1SI0A 3FV2A 1SW4A 4YB5A 4P1EA 4KFQA 1GTKA 3L6GA 3HV1A 2O1MA 1NUWA 4P0GA 2HZLA 2XWKA 3KJTA 5ESYA 1B6HA 3CHGA 3FVNA 1QW0A 3H3GA 3N6TA 1AH5A 4MJOA 2CEXA 2F3DA 3OEKA 5IGAA 4F22A 4GWZA 4U4SA 3FJGA 1XHYA 5AE4A 2ZNUA 1NNPA 2RC8A 2ZNTA 3RPLB 3Q25A 2Q8MA 2AL5A 1Y4CA 1LAGE 2VT5A 2H5YA 1Y20A 2DXRA 4I1DA 5A5LA 4NN3A 3BIGA 2XWOA 5K2XA 1IMDA 5I56B 4XKRA 5JEIA 2H9BA 2XXIA 2DE4A 4MEVA 3MQ9A 3O28A 1SW2A 4NG7A 3D4GA 1DK4A 3TTNA 2Y7IA 2WYKA 1GGGA 1WODA 3TTRA 3K00A 2ZXTA 4MNCA 1FBHA 1R1NA 2DYXA 4MAGA 2ONSA 2G29A 2HAUA 4G68A 4PGPA 3GLBA 3C32A 3Q28A 3KOSA 4YAHX 2GHBA 2DWIA 3TQLA 4XKNA 1LAXA 3K6VA 3IAZA 4GWYA 1LEVA 3TQWA 5DVFA 1D9YA 2X26A 5B70A 1IMFA 2AYSA 2CZKA 3PUXE 2I3WA 4L17A 2ZZXA 4XXUA 2DE2A 2XXHA 1DMBA 1EYIA 2DE3A 1FTJA 4THIA 4BDRA 1UQWA 3G3HA 4RY1A 4GXSB 4X9TA 3HSTA 4GWXA 1S7YA 1LBCA 4PP0A 2Z22A 2O68A 3V83A 4JVIA 5AA2B 1IMBA 2L5VA 3GXAA 1MS7A 1Y1MA 2V3UA 2E0SA 3G3GA 4ESXA 3T9UA 1Z7NE 4GLIA 1F9BA 4PC9A 5J16A 1M5EA 4YU0A 4QSDA 4C1TA 1ZMGA 1SPIA 5CMMA 2H99A 1I6AA 4QSCA 1LBZA 2V3TA 2IEEA 2F97A 3E3KA 2OZZA 1QJMA 4EQBA 3VLUA 3E13X 4O94A 4MCOA 3IB1A 5KCJB 2VP1A 3T9HB 3QSLA 3BFTA 5HM4B 2XXXA 4N91A 1T0KA 2B3FA 4P3LA 1NNFA 3PTYA 1KA1A 1B05A 3PU5A 4I8CA 2P2AA 1MRPA 2Y5LA 1K9ZA 1Q9DA 2RINA 1N76A 5EQ8A 3MUQA 3G3JA 2ZYKA 4YKIA 2RCAA 1Y4TA 3T9XB 2F7BA 1IXGA 2PMSA 1IQ7A 1A99A 1JW4A 2Q2AA 4N81A 4GWUA 1XVYA 2UXAA 5TU0A 3LUZA 3IO6A 4GX3A 2I4CA 1BKAA 1B9JA 1GR2A 2QJEA 3GBBA 2V84A 4FJPA 1SI1A 2QS4A 1FPJA 2A5TA 1QVSA 3KN3A 3T22A 4NF8B 4N4UA 3TMGA 2Q89A 4U4XA 1FPBA 2CZLA 3MC2A 1XS5A 1Z7ME 4BDQA 4NF0A 3EHUA 3UP9A 3TODA 2H25A 3H6UA 3RN8A 5ITOA 5EQ7A 5EHMA 1MG1A 2QMXA 2F5XA 3CSBA 4FAJA 1N7XA 1J1NA 4F3GA 4NF5B 1SD3A 3LSLA 4IGTA 3L6HA 4RA1A 3TZAA 1LFHA 1POY1 5I5PA 4X48A 5TP9B 5F24A 3OO6A 1FQAA 5IZ3A 3IJXB 1MQJA 4P9KA 3UN6A 5HBCA 3JYRA 5T3JA 4H8JA 3E79A 3O29A 4YKKA 2Q2CA 3O9PA 5H8NA 2YJPA 3QUJA 2O7UA 4POXA 4EF1A 4KYSA 3T9VA 3TTKA 3KOTA 5AA1A 2CZHA 2Z8FA 3QUFA 5H8SA 4KYEA 1O64A 2FIEA 3K6XA 2QS2A 3PPPA 3CG3A 5LOMA 4C1UA 1NI9A 2F8DA 4PQJA 3TCGA 4QHQA 1MY2A 4F3SA 5ELVA 5FHMA 3DELB 1D3KA 4N15A 2FVZA 4P47A 2YLNA 3USDA 2DWAA 3U65A 3RQTA 2BJJX 3UA8A 4UA8A 1S9TA 3PGFA 1CB6A 4KXPA 1LGBC 1ZTYA 3FUZA 3LUYA 4RJZA 4ZE8A 3OMBA 4ZEBA 1NKXA 1OVBA 4DDDA 5H8QA 1YAEA 3T0JA 4JSOA 2Y7PA 4YMAA 4G77A 2W7YA 1LBVA 1M5CA 3THIA 3RNNA 3BKIB 4GL0A 1LSTA 1MH4A 3W9VA 3FV1A 2FYIA 1FQCA 4F2OA 5I2KA 3JZJA 1YZ0A 5CBRA 5KDTA 2REGA 4I9DA 4ND9A 4PFBA 1Y3PA 1DCUA 4MIJA 4OHNA 4KCDA 1LBXA 3ISPA 1JQFA 2F36A 2XWIA 1Y3QA 1SVXB 2QFLA 1IXHA 3BIHA 4HE1A 3TTLA 4Q30B 4R75A 3SEYA 4R6HA 4MF3A 2UVGA 1CE2A 3EPEA 1B4ZA 3MPKA 3SDFA 3H6TA 3TPAA 4F29A 1IXCA 4OMBA 4P11A 4NE4A 3K01A 4F3BA 4LA9A 3ILTB 4P56A 5A5XB 1MXYA 2PX1A 3T96B 3OSQA 4OESA 1O63A 1FTOA 1G0HA 1K9YA 5CMKA 1IZ1A 2QSXA 2NWJA 1HSLA 2Z8DA 1FTKA 4KD5A 4F2QA 2XD3A 5CC2A 3FASA 5AA4A 3TCHA 1B3HA 3MVWA 5CI5A 4IR8A 5CBSA 4RK2A 1FPEA 2D3IA 4N13A 3BBRA 1MQDA 1QKBA 1QKAA 3RY3A 4GWSA 2XX8A 4TLLB 3N26A 5IM2A 4N6PA 4H6DA 3IL1B 4BDOA 4BDLA 4IO6A 2FA7A 2QS1A 5I59B 2O69A 4YKPA 4OWDA 3VLVA 3CFLA 2NXOA 4NWDA 3E78A 1TT1A 3FXQA 5F1QA 2DS9A 1N3XA 1N3WA 5AA2A 3Q26A 4PTKA 3UK4A 1YYZA 5K2YA 2I6EA 4JWYA 2A5TB 1B52A 1B3LA 3LV0A 3BFUA 1KWHA 2VPOA 1ZLQA 3G3FA 3E9XA 4KI0E 2MKZA 3T66A 4NF6A 5I58B 1JNFA 4G8HA 2QVVA 1RDXA 1O7TA 5AA4B 1NH8A 4OANA 4QFLA 4BDMA 1BTJA 1N84A 2ZNSA 4X1BA 2XWVA 3PUWE 2PBWA 3OEMA 2RCBA 4QFNA 2GRVA 3S9LC 3C35A 2QPQA 4MLVA 3MWBA 3OSRA 1B46A 4LVQA 4DCYA 5ISUA 3KG2A 3Q29A 4OZ9A 3RTFB 4EDPA 4ZECA 3H6VA 1LB9A 4M1VA 4DI4B 1FBFA 4M4GA 1LLSA 5FHNA 1NV2A 1LFIA 4HCWA 2KR0A 1A40A 3EN3A 5EQAA 3B8BA 3U94A 1PB8A 5L9MA 4IY5A 4IO7A 4JWXA 3OENA 4OVPA 3U8QA 3M3KA 4MX6A 2CZIA 1HSEA 3S2VA 3EQ1A 4XKQA 4U2RA 3LC8A 4MNPA 4F19A 5CMBA 3S9NC 2PFZA 1MXVA 4R9GA 1ATGA 4F31B 2REJA 3B6TA 3CSGA 1A8FA 3FGSA 4H45A 4R72A 4MFIA 4U22A 4DLDA 1FPKA 1LBYA 2PT2A 2DWJA 5M2VA 4N07A 3SEWA 2Y84A 1FW0A 2QMWA 1USYH 4NHBA 2HEUA 1AOVA 2VPNA 2RKMA 2QS3A 4G8MA 5JTYA 1QUJA 1MXWA 5I2NA 3FZVA 4O7IA 1B32A 3SERA 3KFMA 5IKBA 2UYFA 1OIBA 1RYOA 3W9WA 3ODBA 1RKMA 2X7PA 3IJOB 2X7QA 3KC0A 1MY3A 4UABA 3LR1A 3S9MC 3UIFA 2YPNA 4MH5A 5H8QB 3RGYA 4GWOA 1GVCA 2ANJA 2GFEA 4G8NA 1FBGA 1LB8A 1FPGA 2HXRA 3A09A 1B3EA 1MPBA 3OELA 3O6IA 3PPRA 1PBQA 4EXKA 3U1OA 2VD2A 3CG1A 4ZEKA 3CFXA 1I6QA 2XXVA 1FTLA 3OD7A 2HXWA 3K1NA 4O7MA 4HE2A 4OFLA 2ZMBA 5I59A 1H76A 1VSOA 3CVGA 3VE1B 4PFRA 2HPGA 2I3VA 1NNKA 2E1SA 3ROJA 2OJTA 3MVXA 1B3FA 1MY1A 1SYIA 3QK6A 4YB6A 4IB2A 3MVZA 4GRKA 3PPQA 1MQIA 1NV5A 5CRYA 4H1XA 4PAIA 4FORA 4R2BA 1UTBB 4OVQA 4P0IA 3AXFA 3B7DA 5DVIA 1D4NA 4XIGQ 1BP5A 4R6KA 4IO2A 1NV0A 1FPIA 4ELQA 3G7WA 4GX4A 3K1PA 3IOTA 4AB6A 4ECFA 2VOZA 4LONB 2BJIA 5H8HB 4EQ7A 4MHFA 3W15C 5LTCA 2DWHA 3UORA 1P1UA 2F35A 1MM7A 4XEQA 1RDYA 3C34A 3IFAA 1UTHB 3ZKLA 1N04A 1QUIA 4ELPA 4P1LA 1ZJLA 4GF8A 4GQOA 2KLFA 4HW8A 3GBAA 2I58A 3EHTA 5I56A 1KZ8A 4PFIA 5B7DA 4YKJA 4LQ5A 3EHSA 2DQVA 5ICTA 1MQHA 1FPLA 3FXUA 5FTIA 4Z7EA 3A3UA 4RK9A 2O7IA 5DEXB 4NTLA 1XOCA 3TCFA 2DDKA 3IFCA 4R74A 2XXTA 4YMBA 3M3FA 4DIGA 2KQZA 1TFDA 2F6PA 1URDA 3DP4A 3TEPA 3RYDA 4PDDA 1LCTA 2P3VA 2I4BA 4H65A 3MP1A 3SEXA 2WBBA 2ONRA 4E0WA 1B7HA 1IMCA 2M8CA 4OEUA 2OBGA 4WEDA 1AWBA 2HFBA 4U1ZA 1ZU0A 1MDP1 3K4UA 3ILUB 3ZS6A 4KCCA 5IZZA 2WX9A 3LSWA 3PPNA 3HHGA 3C36A 4FEBA 1NUYA 2Y7KA 4ELRA 5I57B 1NV7A 1NUXA 2Y7WA 1R6ZA 3SEUA 2OLBA 1FBEA 4XTCQ 1IMEA 4OQOA 5DYHA 1P1OA 5L8DA 3VVDA 3VFJA 1KA0A 1B1XA 2XA5A 1M5DA 4HXVA 1XC1A 1I6BA 4NMYA 2GQ1A 4PGNA 4X8RA 2DXYA 2HAVA 3FD3A 4N17A 3B6QA 4N8GA 5AA3A 2OCUA 4U21A 3RPWA 4PBQA 5H8HA 1B4HA 4F39A 1LBBA 1NMUA 4X1DA 1VDWA 3O66A 4Z0IA 4PFWA 3B50A 3H6WA 3TUSA 2XXWA 2B4MA 2V4CA 4N8YA 1DTGA 1EZOA 4EUOA 4DI3D 3MP8A 1NL5A 4C0RA 4UACA 3JV9A 4IO5A 4ZEFA 3VXCA 5FBPA 2IA4A 3B6WA 1FQDA 1NH7A 3HN0A 4H67A 1OLCA 2Q9TA 2H4IA 3QYTA 5IZ3B 2ZZWA 2AL4A 4DXBA 1N0TA 3ZSFA 2XXKA 1H3DA 3HCQA 1A55A 4OVRA 3O97A 2LAOA 3WAFA 4WKMA 4NEDA 4X04A 1TXFA 3CR9A 2P0SA 1A54A 3ECRA 3KC1A 1P1WA 1MH3A 4ZZEA 4PAFA 1EYKA 3R6UA 3F11A 4KYDA
chains in the Genus database with same CATH topology
3PUWE 2PBWA 3O6GA 4QFNA 1M5EA 1AL3A 1Q1KA 4GXAA 2GRVA 4YU0A 3S9LC 3C35A 2QPQA 4MLVA 4QSDA 4R2FA 4C1TA 2D5WA 3K6UA 4H5GA 2F7CA 1ZMGA 3MWBA 3OSRA 4POWA 1B46A 1S50A 3IOUA 3MZBA 1B7ZA 1JETA 4LVQA 1SW5A 4DCYA 2V93A 2H99A 5CMMA 3RUMA 4EQ9A 1OLAA 4Q5TA 3P7IA 4O3AA 1I6AA 2DSFA 4DCXA 3E4RA 3KG2A 1VR5A 3Q29A 4QSCA 4R73A 4I62A 4OZ9A 2V3TA 2IEEA 2F97A 3E3KA 4JDFA 4NF8A 3RTFB 4EDPA 2OZZA 1VE4A 1QJMA 4ZECA 1FTMA 3IR1A 2UVIA 3G3IA 5L9OA 4EQBA 3H6VA 1AIVA 1LB9A 5FHOA 3LSXA 3VLUA 1MXXA 1JEUA 1DPEA 3E13X 4GL8A 4M1VA 4M4GA 3K2DA 3HO7A 1LLSA 2I49A 3IB1A 5DT6A 5FHNA 4ZEDA 2VP1A 5KCJB 3T9HB 3QSLA 1LFIA 4GIZA 4HCWA 2PT1A 1A40A 3EN3A 3H4ZA 3KZGA 2WKYA 2Q88A 3BFTA 3IB2A 3S4UA 5ICQA 3U94A 2F6GA 1PB8A 2XXXA 4IO4A 3FJMA 1B58A 5L9MA 5HM4B 3ONMA 2PVUA 4IY5A 5H8NB 4IO7A 1URSA 4JWXA 2DP8A 3V5AA 1OQHA 2B3FA 4NWCA 5I58A 1NNFA 3OENA 4IGRA 1T0KA 3U8QA 1B05A 3M3KA 3MW0A 3PU5A 3MZ1A 3SEVA 1QULA 4JWOA 3U92A 1HSEA 1LCFA 2DVCA 3EQ1A 3S2VA 4XKQA 1P1QA 5TPAA 4I8CA 2P2AA 1MRPA 1SDXA 4LZ8A 1SBPA 4QFKA 4U2RA 1UTBA 3LC8A 5EHSA 4F19A 3QXMA 1JVXA 1LFGA 1B0HA 1XT8A 2RINA 4H0WA 3FVOA 1N76A 3MUQA 2NUVA 3G3JA 4K3FA 2ZYKA 5CMBA 4YKIA 2D21A 4QFOA 2RCAA 3S9NC 1MXZA 3VDFA 1Y4TA 4BDNA 4OENA 1ANFA 2G93A 4WXJA 1MXVA 4R9GA 5FTHA 1ATGA 2F7BA 3T9XB 4F31B 1IXGA 1IEJA 2PMSA 3C31A 2REJA 3B6TA 3CSGA 1A8FA 3FGSA 3N94A 4R72A 1IQ7A 1A99A 3R26A 4NF5A 3TTMA 3PV0E 4IO3A 2O51A 4MFIA 4U22A 3EF7A 4DLDA 3S9EA 2XX9A 1JW4A 2Q2AA 4R9FA 2OWSA 3H03A 5EYFA 2XX7A 4DZ1A 4G68B 4R6YA 1XVYA 1P1NA 2UXAA 5TU0A 2VD3A 2PT2A 2I48A 5I2NB 3IO6A 3LBSA 3TYHA 3GZGA 3PPOA 2DWJA 2I4CA 3C33A 1B7UA 4N07A 5M2VA 1BKAA 1B9JA 1GR2A 2QJEA 3GBBA 4MBPA 5DVJA 3SEWA 2Y84A 1UIUA 3H06B 3MAMA 4LUBA 1FW0A 2QMWA 1USYH 1GV8A 2V84A 3K02A 1AOVA 2HEUA 4EXKA 2DVZA 4FJPA 1SI1A 3IO4A 2QS4A 2A5SA 1EU8A 2RKMA 2A5TA 2QS3A 4G8MA 1QVSA 1XVXA 3KN3A 1QUJA 4ZDMA 5JTYA 2Q8JA 3PD8A 5AA2A 2HZKA 1MY4A 1EZ9A 3RTWB 1MXWA 2I0CA 5I2NA 3T22A 1B5IA 3FZVA 2VHAA 4NF8B 3TMGA 1B32A 2Q89A 3V89B 4O3BA 4U4XA 2UVJA 2XXRA 1JVYA 3DP8A 3DM0A 3M3LA 2CZLA 3SERA 2B3BA 3KFMA 3MC2A 3R7XA 5IKBA 4G68C 1XS5A 1Z7ME 4BDQA 1Y3NA 1A8EA 1OIBA 1RYOA 2UYFA 4FIMA 4E0XA 2V25A 4ISUA 2HCAA 3EHUA 3W9WA 3ODBA 4WEPA 1RKMA 2ZYOA 2X7PA 3IJOB 3TODA 3UP9A 2H25A 2X7QA 3H6UA 1MY3A 2PYYA 3KBRA 3MBPA 3LR1A 3S9MC 3MJNA 3KSXA 5ITOA 3RN8A 3RT6B 1ZKBA 1MG1A 2YPNA 2QMXA 2F5XA 2XXUA 3C9HA 3CSBA 1DPPA 1N7XA 4MH5A 1J1NA 4FAJA 1B40A 5H8QB 3PUYE 4LZ7A 4GWOA 4YICA 3RGYA 4NF5B 4F3GA 1GVCA 2ANJA 1SD3A 3LSLA 4IGTA 4LZ5A 1PEBA 3L6HA 4RA1A 2GFEA 1MPCA 4RNSA 1LAHE 1N7WA 3TZAA 3VXBA 1LFHA 1POY1 1ZBMA 4G8NA 1ZIUA 2R71A 1NFTA 4X48A 3O6HA 5TP9B 1LB8A 3I5OA 4KQPA 1SYHA 3A09A 3IOVA 1B3EA 4OTEA 3OO6A 4X1BA 1II5A 1FQAA 1MPBA 3DLNA 1UTHA 3IJXB 4LQ2A 3OELA 3O6IA 3PPRA 3QAXA 1PBQA 1MQJA 1YTVA 1MPDA 1Y1ZA 5DTBA 3U1OA 4F1UA 3UN6A 5H8FB 3KN8A 5HBCA 2ESNA 2VD2A 3CG1A 3JYRA 3PMWA 4QRZA 4ZEKA 2HQ0A 3CFXA 3IX1A 3K6WA 3MZ9A 4H8JA 4QFPA 1I6QA 4RYAA 1USYE 2XXVA 1H43A 3FXRA 1FTLA 3OD7A 3O29A 1M5BA 2Z8EA 3FIRA 4YKKA 3D4CA 2HXWA 2Q2CA 3K1NA 3O9PA 3SESA 3TDJA 2V3QA 5H8NA 2YJPA 2OWTA 1EZPA 3A3CA 4ZZAA 3QUJA 4OFLA 5BWJA 5H8FA 2ZMBA 2O7UA 1D9VA 4POXA 5I59A 2F34A 4NF4B 1H76A 4GD5A 1VSOA 2OK2A 2H98A 3CVGA 2I0BA 4MLQA 3UGWA 1Y9UA 3VE1B 4PE5B 3Q27A 4EF1A 5CM6A 3HPIA 4KYSA 1DTZA 2I3VA 1NNKA 1DOTA 2E1SA 2O84X 4HTGA 2OJTA 3T9VA 1B5JA 3MVXA 3TTKA 4RPNA 1B3FA 1MY1A 3KOTA 5AA1A 2QL3A 4H8IA 1MQGA 4F1YA 1IITA 1SYIA 3QK6A 3TELA 3KN7A 4DXUA 1EH3A 2Z8FA 3QUFA 4YB6A 4NF4A 1A7LA 5H8SA 2O1LA 4IB2A 4KYEA 3MVZA 1O64A 3PPQA 4GRKA 3K6XA 4U1OA 4FATA 2XD2A 1MQIA 2QS2A 5I2KB 3PPPA 3CG3A 4OVJA 1VFEA 2XXQA 4JB7A 4H1XA 2GHAA 2ZNSA 1VFDA 5CRYA 5LOMA 3WAEA 4FORA 1URGA 4R2BA 1MM6A 1R9QA 1UTBB 3DP6A 3LSFB 4C1UA 4EF2A 5KDTB 4P0IA 3V8XB 3AXFA 5BUUA 1US5A 2P1SA 3B7DA 1H45A 1MDQA 5DVIA 4AQ4A 2B65A 1PB7A 2F8DA 2ALUA 3IK6B 1R9LA 4OFJA 4PQJA 1D4NA 2NOOA 4QHQA 3TCGA 2Z23A 3O2AA 1MY2A 4JBZA 4XIGQ 3TKDA 4GFRA 1BP5A 4F18A 1B2HA 4R6KA 4OETA 4F3SA 4IO2A 3PMVA 4OYVA 5ELVA 1US4A 4LP2B 3FVKA 5FHMA 5I84A 3DELB 1D3KA 5CC2A 2R9JA 3K1MA 3RLFE 3CRBA 4ELQA 3G7WA 2YLNA 3KGCA 3KSJA 5ITPA 1JEVA 1QUKA 2UYEA 1TFAA 3FVGA 3USDA 2DWAA 3K1PA 3IOTA 1FQBA 2BJJX 3RQTA 3UA8A 4UA8A 2DOJA 3U93A 4AB6A 1S9TA 2VGQA 1CB6A 1P99A 3PGFA 4IY6A 4PFUA 3SKPA 2VOZA 4KHZE 4LONB 4ECFA 1LGBC 3CI8A 3PD9A 1ZTYA 3FUZA 5F7VA 5H8HB 4EQ7A 3W15C 1OQGA 3LUYA 4G4PA 4RJZA 4DE8A 2DWHA 4ZE8A 5JK4A 3UORA 1P1UA 3OMBA 4TQUQ 3I6VA 2F35A 3K0VA 1JW5A 1MM7A 3PUVE 5TPAB 4ZEBA 5L9SA 3C34A 1NKXA 1OVBA 1UTHB 2F7AA 4DDDA 5KZTA 3ZKLA 1N04A 1JW1A 4OFOA 5H8QA 1QUIA 1YAEA 4ELPA 3UIFA 1B3GA 1ZJLA 3MVYA 2AIXA 4GF8A 4GQOA 4HCYA 1SQYA 4ZE9A 4FECA 2KLFA 4JSOA 4ONYA 4HW8A 3GBAA 2I58A 1SW1A 2Y7PA 4G77A 4YMAA 3VVFA 1IXIA 3MPLA 3EHTA 5I56A 4KPTA 2W7YA 1M5CA 4JXIA 3THIA 2ABHA 3RNNA 3BKIB 4GL0A 4YB7A 4GVOA 1LSTA 1MXUA 4YKJA 5B7DA 4H5FA 1MH4A 3W9VA 4LQ5A 3EHSA 4QF9A 2DQVA 2XXYA 1I69A 5ICTA 3PMXA 1MQHA 1WVJA 3FV1A 3FXUA 2FYIA 3I3VA 5FTIA 3U72A 1FQCA 4F2OA 4Z7EA 5I2KA 3JZJA 3A3UA 2XHDA 3G3KA 4RK9A 4ELOA 2O7IA 1B0LA 1PBPA 5DEXB 4JSDA 1AMFA 4NF6B 4NTLA 3RT8A 5CBRA 5KDTA 3CIJA 1XOCA 2REGA 3TCFA 4I9DA 4EXLA 2GH9A 3N5LA 4RPOA 3QIMA 1SI0A 1RYXA 3FV2A 4Q8RA 1SW4A 4YB5A 4R74A 2XXTA 4YMBA 3M3FA 4ND9A 4KFQA 1GTKA 4DIGA 1Y3PA 3L6GA 1TFDA 1B51A 1URDA 2F6PA 4YZZA 2RC9A 3DP4A 3HV1A 4OHNA 3TEPA 2O1MA 2ZYNA 4TOZA 1LCTA 4PETA 4KCDA 2CMOA 4P0GA 2HZLA 2I4BA 3KJTA 4H65A 1B6HA 1JQFA 2F36A 1BIYA 1POTA 3FVNA 1QW0A 3MP1A 1WDNA 3IB0A 3H3GA 3N6TA 1AH5A 3SEXA 3OEKA 2ONRA 4E0WA 1B7HA 2M8CA 1Y3QA 3OO9A 4OEUA 1SVXB 5I57A 2F78A 4F22A 2OBGA 3IOWA 4WEDA 1IXHA 3TTLA 2HFBA 4U4SA 4U1ZA 3FJGA 1DSNA 3ZKKA 5A5XA 4Q30B 4R75A 3SEYA 1ZU0A 5ISUA 4OEVA 4PFYA 4R6HA 1MDP1 1XHYA 5AE4A 3K4UA 4MF3A 3ILUB 2ZNUA 1NNPA 2UVGA 2RC8A 1FQFA 1L5TA 3ZS6A 1TWYA 4KCCA 4U23A 1CE2A 2ZNTA 3LSWA 4F1VA 3IORA 3EPEA 3Q25A 1B4ZA 3MPKA 1NNTA 1YCJA 3H6TA 3SDFA 3PPNA 3TPAA 3HHGA 1OVTA 3C36A 2AL5A 1Y4CA 4F29A 2XXPA 1LAGE 4FEBA 4QSEA 1M5FA 1IXCA 5JTYB 3VV5A 2H5YA 1Y20A 2DXRA 2Y7KA 3N6UA 4OMBA 4BLAA 4TLMB 4G2ZA 4ELRA 5HPQA 5I57B 4P11A 4NE4A 3K01A 4F3BA 4FEDA 2Y7WA 1R6ZA 4I1DA 3KJ7A 3SEUA 1B1HA 5TP9A 2OLBA 3ILTB 4LA9A 4XTCQ 4OQOA 5DYHA 1P1OA 3HHFA 4OXVA 2NVUB 4Q0CA 3H7MA 1ELJA 5L8DA 5A5XB 1MXYA 2PX1A 4HS7A 4O3CA 3VVDA 3T96B 3VFJA 3OSQA 4OESA 1B1XA 1O63A 3TAJA 1FTOA 5K2XA 5CMKA 1M5DA 5I56B 1IZ1A 4XKRA 1XC1A 2QSXA 5JEIA 2THIA 4XKPA 2NWJA 1I6BA 3C4MA 2FNCA 1Q35A 2H9BA 1HSLA 2XXIA 2Z8DA 4NMYA 2DE4A 1FQEA 5KCJA 2UVHA 2ZYMA 2DXYA 2HAVA 1FTKA 3FD3A 4KD5A 2XD3A 3MQ9A 3FASA 1SW2A 3O28A 4ESWA 4F2QA 3D4GA 2O6AA 5AA4A 3B6QA 5AA3A 4KR5A 3TCHA 3TTNA 5DEXA 2OCUA 2Y7IA 1B3HA 4U21A 1GGGA 4OERA 3RPWA 1FCKA 3MVWA 5H8HA 1B4HA 3OOAA 1WODA 4FE8A 1LBBA 4F39A 3TTRA 3K00A 1NMUA 4X1DA 2ZXTA 5CI5A 5AA2D 5CBSA 4F3PA 3O66A 4RK2A 2RC7A 3OEMA 4Z0IA 1R1NA 2DYXA 1HSJA 4PFWA 2D3IA 3VVEA 4ZS9A 4N13A 3BBRA 1MQDA 1QKBA 1QKAA 3H6WA 5J1DA 3RY3A 3TUSA 2ONSA 2XXWA 2XX8A 4TLLB 3N26A 1DTGA 1OMPA 4ZEIA 1EZOA 2G29A 4EUOA 3MP8A 1NL5A 4C0RA 4N6PA 2Y7RA 2HAUA 4G68A 4H6DA 3IL1B 3JV9A 4UACA 1B5HA 4BDOA 3GLBA 1IUDA 4BDLA 3CFZA 4IO5A 4IO6A 4ZEFA 3C32A 2FA7A 3Q28A 2QS1A 3KOSA 4YAHX 3VXCA 5I59B 2GHBA 1MY0A 3KEIA 3M8UA 4LATA 3T93B 3PUZE 4DXCA 2DWIA 2IA4A 2O69A 1FQDA 3B6WA 4XKNA 4YKPA 3TQLA 1LAXA 1NH7A 3SETA 4OWDA 3FATA 3HN0A 3K6VA 4H67A 1OLCA 2Q9TA 3IAZA 1PB9A 2H4IA 1LAFE 3QYTA 3MP6A 5EHMA 3VLVA 2AL4A 3CFLA 4RXLA 4DXBA 1N0TA 3TQWA 2NXOA 4NWDA 3OO8A 5DVFA 1TT1A 3ZSFA 1D9YA 3FXQA 5IAIA 1H3DA 2X26A 3HCQA 5F1QA 5B70A 2DS9A 2AYSA 1N3XA 1A55A 1N3WA 3PUXE 2I3WA 4L17A 3FJ7A 4AB5A 1YPNA 3Q26A 2DE2A 2XXHA 2LAOA 3O97A 4XXUA 3UK4A 1DMBA 5K2YA 3OO7A 2I6EA 2DE3A 1FTJA 4JWYA 4THIA 1UQWA 4WKMA 3WAFA 4BDRA 1PDAA 1PC3A 2A5TB 3G3HA 4NEDA 1B52A 3VLWA 4RY1A 2R6GE 4GXSB 4X9TA 1B3LA 3HSTA 1BLFA 3BFUA 3OXNA 1TXFA 1KWHA 1ZLQA 3CR9A 3G3FA 3E9XA 4KI0E 1S7YA 1LBCA 2P0SA 3T66A 4NF6A 4PP0A 1JNFA 1A54A 2Z22A 2O68A 3ECRA 4G8HA 5I58B 3V83A 5AA2B 1P1WA 3GXAA 1MS7A 1O7TA 1Y1MA 5CMCA 5AA4B 1MH3A 2V3UA 4ZZEA 1NH8A 1H44A 3TFLA 2E0SA 4GOTA 3G3GA 4ESXA 1IIWA 2RF1A 4BDMA 4QFLA 1UIVA 3R6UA 1Z7NE 4GLIA 3T9UA 1BTJA 1N84A 2QRYA 2ONKE 4PFTA 1F9BA 3F11A 2RCBA 4KYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUW E;  2PBW A;  3O6G A;  4QFN A;  1M5E A;  1AL3 A;  1Q1K A;  4GXA A;  2GRV A;  4YU0 A;  3S9L C;  3C35 A;  2QPQ A;  4MLV A;  4QSD A;  4R2F A;  4C1T A;  2D5W A;  3K6U A;  4H5G A;  2F7C A;  1ZMG A;  3MWB A;  3OSR A;  4POW A;  1B46 A;  1S50 A;  3IOU A;  3MZB A;  1B7Z A;  1JET A;  4LVQ A;  1SW5 A;  4DCY A;  2V93 A;  2H99 A;  5CMM A;  3RUM A;  4EQ9 A;  1OLA A;  4Q5T A;  3P7I A;  4O3A A;  1I6A A;  2DSF A;  4DCX A;  3E4R A;  3KG2 A;  1VR5 A;  3Q29 A;  4QSC A;  4R73 A;  4I62 A;  4OZ9 A;  2V3T A;  2IEE A;  2F97 A;  3E3K A;  4JDF A;  4NF8 A;  3RTF B;  4EDP A;  2OZZ A;  1VE4 A;  1QJM A;  4ZEC A;  1FTM A;  3IR1 A;  2UVI A;  3G3I A;  5L9O A;  4EQB A;  3H6V A;  1AIV A;  1LB9 A;  5FHO A;  3LSX A;  3VLU A;  1MXX A;  1JEU A;  1DPE A;  3E13 X;  4GL8 A;  4M1V A;  4M4G A;  3K2D A;  3HO7 A;  1LLS A;  2I49 A;  3IB1 A;  5DT6 A;  5FHN A;  4ZED A;  2VP1 A;  5KCJ B;  3T9H B;  3QSL A;  1LFI A;  4GIZ A;  4HCW A;  2PT1 A;  1A40 A;  3EN3 A;  3H4Z A;  3KZG A;  2WKY A;  2Q88 A;  3BFT A;  3IB2 A;  3S4U A;  5ICQ A;  3U94 A;  2F6G A;  1PB8 A;  2XXX A;  4IO4 A;  3FJM A;  1B58 A;  5L9M A;  5HM4 B;  3ONM A;  2PVU A;  4IY5 A;  5H8N B;  4IO7 A;  1URS A;  4JWX A;  2DP8 A;  3V5A A;  1OQH A;  2B3F A;  4NWC A;  5I58 A;  1NNF A;  3OEN A;  4IGR A;  1T0K A;  3U8Q A;  1B05 A;  3M3K A;  3MW0 A;  3PU5 A;  3MZ1 A;  3SEV A;  1QUL A;  4JWO A;  3U92 A;  1HSE A;  1LCF A;  2DVC A;  3EQ1 A;  3S2V A;  4XKQ A;  1P1Q A;  5TPA A;  4I8C A;  2P2A A;  1MRP A;  1SDX A;  4LZ8 A;  1SBP A;  4QFK A;  4U2R A;  1UTB A;  3LC8 A;  5EHS A;  4F19 A;  3QXM A;  1JVX A;  1LFG A;  1B0H A;  1XT8 A;  2RIN A;  4H0W A;  3FVO A;  1N76 A;  3MUQ A;  2NUV A;  3G3J A;  4K3F A;  2ZYK A;  5CMB A;  4YKI A;  2D21 A;  4QFO A;  2RCA A;  3S9N C;  1MXZ A;  3VDF A;  1Y4T A;  4BDN A;  4OEN A;  1ANF A;  2G93 A;  4WXJ A;  1MXV A;  4R9G A;  5FTH A;  1ATG A;  2F7B A;  3T9X B;  4F31 B;  1IXG A;  1IEJ A;  2PMS A;  3C31 A;  2REJ A;  3B6T A;  3CSG A;  1A8F A;  3FGS A;  3N94 A;  4R72 A;  1IQ7 A;  1A99 A;  3R26 A;  4NF5 A;  3TTM A;  3PV0 E;  4IO3 A;  2O51 A;  4MFI A;  4U22 A;  3EF7 A;  4DLD A;  3S9E A;  2XX9 A;  1JW4 A;  2Q2A A;  4R9F A;  2OWS A;  3H03 A;  5EYF A;  2XX7 A;  4DZ1 A;  4G68 B;  4R6Y A;  1XVY A;  1P1N A;  2UXA A;  5TU0 A;  2VD3 A;  2PT2 A;  2I48 A;  5I2N B;  3IO6 A;  3LBS A;  3TYH A;  3GZG A;  3PPO A;  2DWJ A;  2I4C A;  3C33 A;  1B7U A;  4N07 A;  5M2V A;  1BKA A;  1B9J A;  1GR2 A;  2QJE A;  3GBB A;  4MBP A;  5DVJ A;  3SEW A;  2Y84 A;  1UIU A;  3H06 B;  3MAM A;  4LUB A;  1FW0 A;  2QMW A;  1USY H;  1GV8 A;  2V84 A;  3K02 A;  1AOV A;  2HEU A;  4EXK A;  2DVZ A;  4FJP A;  1SI1 A;  3IO4 A;  2QS4 A;  2A5S A;  1EU8 A;  2RKM A;  2A5T A;  2QS3 A;  4G8M A;  1QVS A;  1XVX A;  3KN3 A;  1QUJ A;  4ZDM A;  5JTY A;  2Q8J A;  3PD8 A;  5AA2 A;  2HZK A;  1MY4 A;  1EZ9 A;  3RTW B;  1MXW A;  2I0C A;  5I2N A;  3T22 A;  1B5I A;  3FZV A;  2VHA A;  4NF8 B;  3TMG A;  1B32 A;  2Q89 A;  3V89 B;  4O3B A;  4U4X A;  2UVJ A;  2XXR A;  1JVY A;  3DP8 A;  3DM0 A;  3M3L A;  2CZL A;  3SER A;  2B3B A;  3KFM A;  3MC2 A;  3R7X A;  5IKB A;  4G68 C;  1XS5 A;  1Z7M E;  4BDQ A;  1Y3N A;  1A8E A;  1OIB A;  1RYO A;  2UYF A;  4FIM A;  4E0X A;  2V25 A;  4ISU A;  2HCA A;  3EHU A;  3W9W A;  3ODB A;  4WEP A;  1RKM A;  2ZYO A;  2X7P A;  3IJO B;  3TOD A;  3UP9 A;  2H25 A;  2X7Q A;  3H6U A;  1MY3 A;  2PYY A;  3KBR A;  3MBP A;  3LR1 A;  3S9M C;  3MJN A;  3KSX A;  5ITO A;  3RN8 A;  3RT6 B;  1ZKB A;  1MG1 A;  2YPN A;  2QMX A;  2F5X A;  2XXU A;  3C9H A;  3CSB A;  1DPP A;  1N7X A;  4MH5 A;  1J1N A;  4FAJ A;  1B40 A;  5H8Q B;  3PUY E;  4LZ7 A;  4GWO A;  4YIC A;  3RGY A;  4NF5 B;  4F3G A;  1GVC A;  2ANJ A;  1SD3 A;  3LSL A;  4IGT A;  4LZ5 A;  1PEB A;  3L6H A;  4RA1 A;  2GFE A;  1MPC A;  4RNS A;  1LAH E;  1N7W A;  3TZA A;  3VXB A;  1LFH A;  1POY 1;  1ZBM A;  4G8N A;  1ZIU A;  2R71 A;  1NFT A;  4X48 A;  3O6H A;  5TP9 B;  1LB8 A;  3I5O A;  4KQP A;  1SYH A;  3A09 A;  3IOV A;  1B3E A;  4OTE A;  3OO6 A;  4X1B A;  1II5 A;  1FQA A;  1MPB A;  3DLN A;  1UTH A;  3IJX B;  4LQ2 A;  3OEL A;  3O6I A;  3PPR A;  3QAX A;  1PBQ A;  1MQJ A;  1YTV A;  1MPD A;  1Y1Z A;  5DTB A;  3U1O A;  4F1U A;  3UN6 A;  5H8F B;  3KN8 A;  5HBC A;  2ESN A;  2VD2 A;  3CG1 A;  3JYR A;  3PMW A;  4QRZ A;  4ZEK A;  2HQ0 A;  3CFX A;  3IX1 A;  3K6W A;  3MZ9 A;  4H8J A;  4QFP A;  1I6Q A;  4RYA A;  1USY E;  2XXV A;  1H43 A;  3FXR A;  1FTL A;  3OD7 A;  3O29 A;  1M5B A;  2Z8E A;  3FIR A;  4YKK A;  3D4C A;  2HXW A;  2Q2C A;  3K1N A;  3O9P A;  3SES A;  3TDJ A;  2V3Q A;  5H8N A;  2YJP A;  2OWT A;  1EZP A;  3A3C A;  4ZZA A;  3QUJ A;  4OFL A;  5BWJ A;  5H8F A;  2ZMB A;  2O7U A;  1D9V A;  4POX A;  5I59 A;  2F34 A;  4NF4 B;  1H76 A;  4GD5 A;  1VSO A;  2OK2 A;  2H98 A;  3CVG A;  2I0B A;  4MLQ A;  3UGW A;  1Y9U A;  3VE1 B;  4PE5 B;  3Q27 A;  4EF1 A;  5CM6 A;  3HPI A;  4KYS A;  1DTZ A;  2I3V A;  1NNK A;  1DOT A;  2E1S A;  2O84 X;  4HTG A;  2OJT A;  3T9V A;  1B5J A;  3MVX A;  3TTK A;  4RPN A;  1B3F A;  1MY1 A;  3KOT A;  5AA1 A;  2QL3 A;  4H8I A;  1MQG A;  4F1Y A;  1IIT A;  1SYI A;  3QK6 A;  3TEL A;  3KN7 A;  4DXU A;  1EH3 A;  2Z8F A;  3QUF A;  4YB6 A;  4NF4 A;  1A7L A;  5H8S A;  2O1L A;  4IB2 A;  4KYE A;  3MVZ A;  1O64 A;  3PPQ A;  4GRK A;  3K6X A;  4U1O A;  4FAT A;  2XD2 A;  1MQI A;  2QS2 A;  5I2K B;  3PPP A;  3CG3 A;  4OVJ A;  1VFE A;  2XXQ A;  4JB7 A;  4H1X A;  2GHA A;  2ZNS A;  1VFD A;  5CRY A;  5LOM A;  3WAE A;  4FOR A;  1URG A;  4R2B A;  1MM6 A;  1R9Q A;  1UTB B;  3DP6 A;  3LSF B;  4C1U A;  4EF2 A;  5KDT B;  4P0I A;  3V8X B;  3AXF A;  5BUU A;  1US5 A;  2P1S A;  3B7D A;  1H45 A;  1MDQ A;  5DVI A;  4AQ4 A;  2B65 A;  1PB7 A;  2F8D A;  2ALU A;  3IK6 B;  1R9L A;  4OFJ A;  4PQJ A;  1D4N A;  2NOO A;  4QHQ A;  3TCG A;  2Z23 A;  3O2A A;  1MY2 A;  4JBZ A;  4XIG Q;  3TKD A;  4GFR A;  1BP5 A;  4F18 A;  1B2H A;  4R6K A;  4OET A;  4F3S A;  4IO2 A;  3PMV A;  4OYV A;  5ELV A;  1US4 A;  4LP2 B;  3FVK A;  5FHM A;  5I84 A;  3DEL B;  1D3K A;  5CC2 A;  2R9J A;  3K1M A;  3RLF E;  3CRB A;  4ELQ A;  3G7W A;  2YLN A;  3KGC A;  3KSJ A;  5ITP A;  1JEV A;  1QUK A;  2UYE A;  1TFA A;  3FVG A;  3USD A;  2DWA A;  3K1P A;  3IOT A;  1FQB A;  2BJJ X;  3RQT A;  3UA8 A;  4UA8 A;  2DOJ A;  3U93 A;  4AB6 A;  1S9T A;  2VGQ A;  1CB6 A;  1P99 A;  3PGF A;  4IY6 A;  4PFU A;  3SKP A;  2VOZ A;  4KHZ E;  4LON B;  4ECF A;  1LGB C;  3CI8 A;  3PD9 A;  1ZTY A;  3FUZ A;  5F7V A;  5H8H B;  4EQ7 A;  3W15 C;  1OQG A;  3LUY A;  4G4P A;  4RJZ A;  4DE8 A;  2DWH A;  4ZE8 A;  5JK4 A;  3UOR A;  1P1U A;  3OMB A;  4TQU Q;  3I6V A;  2F35 A;  3K0V A;  1JW5 A;  1MM7 A;  3PUV E;  5TPA B;  4ZEB A;  5L9S A;  3C34 A;  1NKX A;  1OVB A;  1UTH B;  2F7A A;  4DDD A;  5KZT A;  3ZKL A;  1N04 A;  1JW1 A;  4OFO A;  5H8Q A;  1QUI A;  1YAE A;  4ELP A;  3UIF A;  1B3G A;  1ZJL A;  3MVY A;  2AIX A;  4GF8 A;  4GQO A;  4HCY A;  1SQY A;  4ZE9 A;  4FEC A;  2KLF A;  4JSO A;  4ONY A;  4HW8 A;  3GBA A;  2I58 A;  1SW1 A;  2Y7P A;  4G77 A;  4YMA A;  3VVF A;  1IXI A;  3MPL A;  3EHT A;  5I56 A;  4KPT A;  2W7Y A;  1M5C A;  4JXI A;  3THI A;  2ABH A;  3RNN A;  3BKI B;  4GL0 A;  4YB7 A;  4GVO A;  1LST A;  1MXU A;  4YKJ A;  5B7D A;  4H5F A;  1MH4 A;  3W9V A;  4LQ5 A;  3EHS A;  4QF9 A;  2DQV A;  2XXY A;  1I69 A;  5ICT A;  3PMX A;  1MQH A;  1WVJ A;  3FV1 A;  3FXU A;  2FYI A;  3I3V A;  5FTI A;  3U72 A;  1FQC A;  4F2O A;  4Z7E A;  5I2K A;  3JZJ A;  3A3U A;  2XHD A;  3G3K A;  4RK9 A;  4ELO A;  2O7I A;  1B0L A;  1PBP A;  5DEX B;  4JSD A;  1AMF A;  4NF6 B;  4NTL A;  3RT8 A;  5CBR A;  5KDT A;  3CIJ A;  1XOC A;  2REG A;  3TCF A;  4I9D A;  4EXL A;  2GH9 A;  3N5L A;  4RPO A;  3QIM A;  1SI0 A;  1RYX A;  3FV2 A;  4Q8R A;  1SW4 A;  4YB5 A;  4R74 A;  2XXT A;  4YMB A;  3M3F A;  4ND9 A;  4KFQ A;  1GTK A;  4DIG A;  1Y3P A;  3L6G A;  1TFD A;  1B51 A;  1URD A;  2F6P A;  4YZZ A;  2RC9 A;  3DP4 A;  3HV1 A;  4OHN A;  3TEP A;  2O1M A;  2ZYN A;  4TOZ A;  1LCT A;  4PET A;  4KCD A;  2CMO A;  4P0G A;  2HZL A;  2I4B A;  3KJT A;  4H65 A;  1B6H A;  1JQF A;  2F36 A;  1BIY A;  1POT A;  3FVN A;  1QW0 A;  3MP1 A;  1WDN A;  3IB0 A;  3H3G A;  3N6T A;  1AH5 A;  3SEX A;  3OEK A;  2ONR A;  4E0W A;  1B7H A;  2M8C A;  1Y3Q A;  3OO9 A;  4OEU A;  1SVX B;  5I57 A;  2F78 A;  4F22 A;  2OBG A;  3IOW A;  4WED A;  1IXH A;  3TTL A;  2HFB A;  4U4S A;  4U1Z A;  3FJG A;  1DSN A;  3ZKK A;  5A5X A;  4Q30 B;  4R75 A;  3SEY A;  1ZU0 A;  5ISU A;  4OEV A;  4PFY A;  4R6H A;  1MDP 1;  1XHY A;  5AE4 A;  3K4U A;  4MF3 A;  3ILU B;  2ZNU A;  1NNP A;  2UVG A;  2RC8 A;  1FQF A;  1L5T A;  3ZS6 A;  1TWY A;  4KCC A;  4U23 A;  1CE2 A;  2ZNT A;  3LSW A;  4F1V A;  3IOR A;  3EPE A;  3Q25 A;  1B4Z A;  3MPK A;  1NNT A;  1YCJ A;  3H6T A;  3SDF A;  3PPN A;  3TPA A;  3HHG A;  1OVT A;  3C36 A;  2AL5 A;  1Y4C A;  4F29 A;  2XXP A;  1LAG E;  4FEB A;  4QSE A;  1M5F A;  1IXC A;  5JTY B;  3VV5 A;  2H5Y A;  1Y20 A;  2DXR A;  2Y7K A;  3N6U A;  4OMB A;  4BLA A;  4TLM B;  4G2Z A;  4ELR A;  5HPQ A;  5I57 B;  4P11 A;  4NE4 A;  3K01 A;  4F3B A;  4FED A;  2Y7W A;  1R6Z A;  4I1D A;  3KJ7 A;  3SEU A;  1B1H A;  5TP9 A;  2OLB A;  3ILT B;  4LA9 A;  4XTC Q;  4OQO A;  5DYH A;  1P1O A;  3HHF A;  4OXV A;  2NVU B;  4Q0C A;  3H7M A;  1ELJ A;  5L8D A;  5A5X B;  1MXY A;  2PX1 A;  4HS7 A;  4O3C A;  3VVD A;  3T96 B;  3VFJ A;  3OSQ A;  4OES A;  1B1X A;  1O63 A;  3TAJ A;  1FTO A;  5K2X A;  5CMK A;  1M5D A;  5I56 B;  1IZ1 A;  4XKR A;  1XC1 A;  2QSX A;  5JEI A;  2THI A;  4XKP A;  2NWJ A;  1I6B A;  3C4M A;  2FNC A;  1Q35 A;  2H9B A;  1HSL A;  2XXI A;  2Z8D A;  4NMY A;  2DE4 A;  1FQE A;  5KCJ A;  2UVH A;  2ZYM A;  2DXY A;  2HAV A;  1FTK A;  3FD3 A;  4KD5 A;  2XD3 A;  3MQ9 A;  3FAS A;  1SW2 A;  3O28 A;  4ESW A;  4F2Q A;  3D4G A;  2O6A A;  5AA4 A;  3B6Q A;  5AA3 A;  4KR5 A;  3TCH A;  3TTN A;  5DEX A;  2OCU A;  2Y7I A;  1B3H A;  4U21 A;  1GGG A;  4OER A;  3RPW A;  1FCK A;  3MVW A;  5H8H A;  1B4H A;  3OOA A;  1WOD A;  4FE8 A;  1LBB A;  4F39 A;  3TTR A;  3K00 A;  1NMU A;  4X1D A;  2ZXT A;  5CI5 A;  5AA2 D;  5CBS A;  4F3P A;  3O66 A;  4RK2 A;  2RC7 A;  3OEM A;  4Z0I A;  1R1N A;  2DYX A;  1HSJ A;  4PFW A;  2D3I A;  3VVE A;  4ZS9 A;  4N13 A;  3BBR A;  1MQD A;  1QKB A;  1QKA A;  3H6W A;  5J1D A;  3RY3 A;  3TUS A;  2ONS A;  2XXW A;  2XX8 A;  4TLL B;  3N26 A;  1DTG A;  1OMP A;  4ZEI A;  1EZO A;  2G29 A;  4EUO A;  3MP8 A;  1NL5 A;  4C0R A;  4N6P A;  2Y7R A;  2HAU A;  4G68 A;  4H6D A;  3IL1 B;  3JV9 A;  4UAC A;  1B5H A;  4BDO A;  3GLB A;  1IUD A;  4BDL A;  3CFZ A;  4IO5 A;  4IO6 A;  4ZEF A;  3C32 A;  2FA7 A;  3Q28 A;  2QS1 A;  3KOS A;  4YAH X;  3VXC A;  5I59 B;  2GHB A;  1MY0 A;  3KEI A;  3M8U A;  4LAT A;  3T93 B;  3PUZ E;  4DXC A;  2DWI A;  2IA4 A;  2O69 A;  1FQD A;  3B6W A;  4XKN A;  4YKP A;  3TQL A;  1LAX A;  1NH7 A;  3SET A;  4OWD A;  3FAT A;  3HN0 A;  3K6V A;  4H67 A;  1OLC A;  2Q9T A;  3IAZ A;  1PB9 A;  2H4I A;  1LAF E;  3QYT A;  3MP6 A;  5EHM A;  3VLV A;  2AL4 A;  3CFL A;  4RXL A;  4DXB A;  1N0T A;  3TQW A;  2NXO A;  4NWD A;  3OO8 A;  5DVF A;  1TT1 A;  3ZSF A;  1D9Y A;  3FXQ A;  5IAI A;  1H3D A;  2X26 A;  3HCQ A;  5F1Q A;  5B70 A;  2DS9 A;  2AYS A;  1N3X A;  1A55 A;  1N3W A;  3PUX E;  2I3W A;  4L17 A;  3FJ7 A;  4AB5 A;  1YPN A;  3Q26 A;  2DE2 A;  2XXH A;  2LAO A;  3O97 A;  4XXU A;  3UK4 A;  1DMB A;  5K2Y A;  3OO7 A;  2I6E A;  2DE3 A;  1FTJ A;  4JWY A;  4THI A;  1UQW A;  4WKM A;  3WAF A;  4BDR A;  1PDA A;  1PC3 A;  2A5T B;  3G3H A;  4NED A;  1B52 A;  3VLW A;  4RY1 A;  2R6G E;  4GXS B;  4X9T A;  1B3L A;  3HST A;  1BLF A;  3BFU A;  3OXN A;  1TXF A;  1KWH A;  1ZLQ A;  3CR9 A;  3G3F A;  3E9X A;  4KI0 E;  1S7Y A;  1LBC A;  2P0S A;  3T66 A;  4NF6 A;  4PP0 A;  1JNF A;  1A54 A;  2Z22 A;  2O68 A;  3ECR A;  4G8H A;  5I58 B;  3V83 A;  5AA2 B;  1P1W A;  3GXA A;  1MS7 A;  1O7T A;  1Y1M A;  5CMC A;  5AA4 B;  1MH3 A;  2V3U A;  4ZZE A;  1NH8 A;  1H44 A;  3TFL A;  2E0S A;  4GOT A;  3G3G A;  4ESX A;  1IIW A;  2RF1 A;  4BDM A;  4QFL A;  1UIV A;  3R6U A;  1Z7N E;  4GLI A;  3T9U A;  1BTJ A;  1N84 A;  2QRY A;  2ONK E;  4PFT A;  1F9B A;  3F11 A;  2RCB A;  4KYD A; 
#chains in the Genus database with same CATH topology
 1RDZ A;  1AL3 A;  1Q1K A;  2OX3 A;  4R2F A;  3K6U A;  4H5G A;  2F7C A;  1S50 A;  3IOU A;  1JET A;  1SW5 A;  2V93 A;  4EQ9 A;  4Q5T A;  3P7I A;  2DSF A;  4DCX A;  3E4R A;  1DBZ A;  1VR5 A;  2WYP A;  4NF8 A;  5IZ1 A;  3IR1 A;  2UVI A;  5L9O A;  5FHO A;  1MXX A;  4HE0 A;  1IMA A;  1FRP A;  4ZED A;  4PF6 A;  2PT1 A;  3KZG A;  2WKY A;  3S4U A;  2F6G A;  4IO4 A;  1FJ9 A;  4OVT A;  5H8N B;  1URS A;  2DP8 A;  5I58 A;  4IGR A;  3U92 A;  3MZ1 A;  1QUL A;  4JWO A;  5ET8 A;  1LCF A;  2DVC A;  1P1Q A;  5TPA A;  1SDX A;  5EHS A;  3QXM A;  1JVX A;  1LFG A;  4NGU A;  2D21 A;  1MXZ A;  4OEN A;  4WXJ A;  1NV1 A;  1IEJ A;  4QXD A;  4NF5 A;  2O51 A;  3EF7 A;  2XX9 A;  2OWS A;  2JJK A;  4DZ1 A;  4R6Y A;  1P1N A;  3TYH A;  3GZG A;  3C33 A;  1B7U A;  4MBP A;  5DVJ A;  4JVC A;  1UIU A;  3H06 B;  3MAM A;  4LUB A;  1GV8 A;  2DVZ A;  3IO4 A;  4NF4 B;  5LDZ A;  1XVX A;  4ZDM A;  3PD8 A;  2HZK A;  1MY4 A;  3RTW B;  2Q74 A;  2VHA A;  4PF8 A;  3V89 B;  2UVJ A;  2XXR A;  3DM0 A;  3M3L A;  2B3B A;  3R7X A;  4G68 C;  1Y3N A;  1A8E A;  4FIM A;  4ISU A;  2HCA A;  1FBD A;  2ZYO A;  2PCR A;  4PDH A;  3KBR A;  3MBP A;  3KSX A;  3C9H A;  2XXU A;  3SZP A;  4LZ7 A;  4LZ5 A;  1PEB A;  3MYU A;  1MPC A;  4NX1 A;  1ZBM A;  2R71 A;  1NFT A;  4NAP A;  1SYH A;  1II5 A;  3DLN A;  5DTB A;  1FTA A;  3KN8 A;  2ESN A;  5EYG A;  2FHY A;  3MZ9 A;  4RYA A;  2QVR A;  2Z8E A;  3SES A;  2V3Q A;  2OWT A;  3EKI A;  3A3C A;  1D9V A;  2F34 A;  1JP4 A;  4GD5 A;  2OK2 A;  2H98 A;  3UGW A;  3HPI A;  1DTZ A;  2O84 X;  4HTG A;  4RPN A;  2QL3 A;  1IIT A;  1EH3 A;  2O1L A;  4FAT A;  2XD2 A;  5I2K B;  2ZZV A;  1VFE A;  2XXQ A;  4JB7 A;  1VFD A;  2PFY A;  5KDT B;  1MM6 A;  1R9Q A;  3LSF B;  3A29 A;  3V8X B;  1US5 A;  2P1S A;  4PCD A;  1MDQ A;  2B65 A;  1LBW A;  1PB7 A;  2OWZ A;  2P3N A;  2NOO A;  4I3E A;  2Z23 A;  4JBZ A;  4GFR A;  1B2H A;  4OYV A;  3PMV A;  3FVK A;  5ET7 A;  2R9J A;  3RLF E;  3CRB A;  3KGC A;  5ITP A;  1FQB A;  2DOJ A;  3U93 A;  1P99 A;  4PFU A;  4KHZ E;  4GBW A;  3CI8 A;  3PD9 A;  5F7V A;  5JK4 A;  4G4P A;  4DE8 A;  3I6V A;  3K0V A;  1JW5 A;  5L9S A;  5KZT A;  1JW1 A;  4OFO A;  1B3G A;  3MVY A;  2AIX A;  4HCY A;  4FEC A;  4ONY A;  1SW1 A;  1IXI A;  3MPL A;  3FBP A;  4KPT A;  4JXI A;  2ABH A;  4YB7 A;  4GVO A;  1MXU A;  4H5F A;  4QF9 A;  1I69 A;  3PMX A;  1WVJ A;  3I3V A;  3MST A;  2XHD A;  4ELO A;  4JSD A;  1AMF A;  4RPO A;  3N5L A;  4Q8R A;  1RYX A;  4I3Y A;  3QMF A;  1FPF A;  4P8B A;  1B51 A;  4YZZ A;  3T1B A;  2RC9 A;  2ZYN A;  4TOZ A;  4PET A;  2CMO A;  1BIY A;  1POT A;  1WDN A;  3IB0 A;  4JVD A;  3OO9 A;  5I57 A;  2F78 A;  3IOW A;  1QGX A;  5I7I A;  3FXB A;  1DSN A;  3ZKK A;  5A5X A;  4FBP A;  4I40 A;  4OEV A;  4PFY A;  1L5T A;  1FQF A;  1TWY A;  4U23 A;  4F1V A;  3IOR A;  5DW8 A;  1NNT A;  1YCJ A;  4OA4 A;  4PAK A;  1OVT A;  2XXP A;  4QSE A;  1M5F A;  5JTY B;  3VV5 A;  3N6U A;  4BLA A;  4TLM B;  4G2Z A;  5HPQ A;  5EYH A;  4FED A;  3KJ7 A;  4OVS A;  1B1H A;  5TP9 A;  2NVU B;  3HHF A;  4OXV A;  5ET6 A;  4Q0C A;  3H7M A;  1ELJ A;  4HS7 A;  4O3C A;  3TAJ A;  2THI A;  4XKP A;  4GX6 A;  3C4M A;  2FNC A;  1Q35 A;  2F3B A;  5KCJ A;  1FQE A;  2UVH A;  2ZYM A;  3S9E A;  4ESW A;  2O6A A;  4KR5 A;  5DEX A;  4OER A;  1FCK A;  3OOA A;  4FE8 A;  2HHM A;  5AA2 D;  4F3P A;  2RC7 A;  1HSJ A;  1XI6 A;  3VVE A;  4ZS9 A;  3KBZ A;  5J1D A;  1OMP A;  4ZEI A;  3RPL A;  2Y7R A;  1B5H A;  1IUD A;  4XF5 A;  3CFZ A;  1MY0 A;  3KEI A;  3M8U A;  4LAT A;  3T93 B;  3PUZ E;  4DXC A;  3SET A;  4XFE A;  3FAT A;  4GBV A;  1PB9 A;  1LAF E;  3MP6 A;  4RXL A;  3OO8 A;  5IAI A;  3FJ7 A;  4AB5 A;  1YPN A;  1NV3 A;  3OO7 A;  1PDA A;  1PC3 A;  3VLW A;  2R6G E;  1NV4 A;  1BLF A;  3OXN A;  2R8T A;  5CMC A;  1FSA A;  1H44 A;  3TFL A;  4GOT A;  1IIW A;  4MNI A;  2RF1 A;  2WEF A;  1UIV A;  2QRY A;  2ONK E;  4PFT A;  3O6G A;  4GXA A;  2D5W A;  4POW A;  5ET5 A;  3MZB A;  1B7Z A;  3RUM A;  1OLA A;  2FBP A;  4O3A A;  2WBD A;  3D1R A;  4R73 A;  4I62 A;  4JDF A;  1VE4 A;  1FTM A;  3G3I A;  3LSX A;  1JEU A;  1DPE A;  4GL8 A;  3K2D A;  3HO7 A;  2I49 A;  5DT6 A;  3GYY A;  4GIZ A;  3H4Z A;  3IB2 A;  2Q88 A;  1CNQ A;  5ICQ A;  1YXI A;  3FJM A;  1B58 A;  3ONM A;  2PVU A;  4G61 A;  3V5A A;  1OQH A;  4NWC A;  2Y5K A;  3MW0 A;  3SEV A;  5I3S A;  4QFK A;  4LZ8 A;  1SBP A;  1UTB A;  1B0H A;  1XT8 A;  4H0W A;  3FVO A;  2NUV A;  4K3F A;  4QFO A;  3VDF A;  4BDN A;  1ANF A;  2G93 A;  2FIX A;  5FTH A;  3C31 A;  3N94 A;  3TTM A;  3R26 A;  3PV0 E;  4IO3 A;  4R9F A;  3H03 A;  5EYF A;  2XX7 A;  1INP A;  4G68 B;  2VD3 A;  2I48 A;  1FBP A;  5I2N B;  3LBS A;  3PPO A;  1D9Q A;  3K02 A;  4NQ8 A;  3HFU A;  2A5S A;  1EU8 A;  2Q8J A;  1EZ9 A;  1FBC A;  2I0C A;  1B5I A;  4O3B A;  2B4L A;  4O8M A;  3DP8 A;  1JVY A;  4N6D A;  4E0X A;  4PBH A;  2V25 A;  4PE3 A;  4WEP A;  2PYY A;  2CEY A;  3MJN A;  3RT6 B;  1ZKB A;  4AS4 A;  1DPP A;  1B40 A;  3PUY E;  4YIC A;  1NUZ A;  4MMP A;  4RNS A;  1LAH E;  1N7W A;  3VXB A;  1ZIU A;  3O6H A;  3NOH A;  3I5O A;  4KQP A;  3IOV A;  4OTE A;  5EQ9 A;  4LQ2 A;  1UTH A;  3QAX A;  1YTV A;  1MPD A;  1Y1Z A;  5H8F B;  3PMW A;  4QRZ A;  2HQ0 A;  3IX1 A;  3K6W A;  4QFP A;  1USY E;  4H46 A;  3FXR A;  1H43 A;  1M5B A;  3FIR A;  3D4C A;  3TDJ A;  1EZP A;  1NV6 A;  4ZZA A;  5BWJ A;  5H8F A;  4MLQ A;  2I0B A;  1Y9U A;  4PE5 B;  3Q27 A;  5CM6 A;  1FJ6 A;  1DOT A;  1B5J A;  4H8I A;  1MQG A;  4AS5 A;  3TEL A;  3KN7 A;  4DXU A;  4NF4 A;  1A7L A;  4U1O A;  4OVJ A;  2GHA A;  3WAE A;  1URG A;  3DP6 A;  4EF2 A;  4N6K A;  4QBA A;  5BUU A;  1H45 A;  4LN5 A;  4AQ4 A;  2ALU A;  3IK6 B;  1R9L A;  4OFJ A;  3O2A A;  3TKD A;  1EYJ A;  4F18 A;  4OET A;  1US4 A;  4LP2 B;  5I84 A;  3K1M A;  3KSJ A;  1JEV A;  1QUK A;  2UYE A;  1TFA A;  3FVG A;  2VGQ A;  4F1Y A;  3SKP A;  1AIV A;  4IY6 A;  1FPD A;  4F1U A;  1OQG A;  4TQU Q;  3PUV E;  5TPA B;  2F7A A;  4GWW A;  1BK4 A;  4ZE9 A;  1SQY A;  3VVF A;  2QVU A;  2XXY A;  3U72 A;  3G3K A;  1B0L A;  1PBP A;  4NF6 B;  3RT8 A;  3CIJ A;  4EXL A;  1G0I A;  2GH9 A;  3QIM A;  1SI0 A;  3FV2 A;  1SW4 A;  4YB5 A;  4P1E A;  4KFQ A;  1GTK A;  3L6G A;  3HV1 A;  2O1M A;  1NUW A;  4P0G A;  2HZL A;  2XWK A;  3KJT A;  5ESY A;  1B6H A;  3CHG A;  3FVN A;  1QW0 A;  3H3G A;  3N6T A;  1AH5 A;  4MJO A;  2CEX A;  2F3D A;  3OEK A;  5IGA A;  4F22 A;  4GWZ A;  4U4S A;  3FJG A;  1XHY A;  5AE4 A;  2ZNU A;  1NNP A;  2RC8 A;  2ZNT A;  3RPL B;  3Q25 A;  2Q8M A;  2AL5 A;  1Y4C A;  1LAG E;  2VT5 A;  2H5Y A;  1Y20 A;  2DXR A;  4I1D A;  5A5L A;  4NN3 A;  3BIG A;  2XWO A;  5K2X A;  1IMD A;  5I56 B;  4XKR A;  5JEI A;  2H9B A;  2XXI A;  2DE4 A;  4MEV A;  3MQ9 A;  3O28 A;  1SW2 A;  4NG7 A;  3D4G A;  1DK4 A;  3TTN A;  2Y7I A;  2WYK A;  1GGG A;  1WOD A;  3TTR A;  3K00 A;  2ZXT A;  4MNC A;  1FBH A;  1R1N A;  2DYX A;  4MAG A;  2ONS A;  2G29 A;  2HAU A;  4G68 A;  4PGP A;  3GLB A;  3C32 A;  3Q28 A;  3KOS A;  4YAH X;  2GHB A;  2DWI A;  3TQL A;  4XKN A;  1LAX A;  3K6V A;  3IAZ A;  4GWY A;  1LEV A;  3TQW A;  5DVF A;  1D9Y A;  2X26 A;  5B70 A;  1IMF A;  2AYS A;  2CZK A;  3PUX E;  2I3W A;  4L17 A;  2ZZX A;  4XXU A;  2DE2 A;  2XXH A;  1DMB A;  1EYI A;  2DE3 A;  1FTJ A;  4THI A;  4BDR A;  1UQW A;  3G3H A;  4RY1 A;  4GXS B;  4X9T A;  3HST A;  4GWX A;  1S7Y A;  1LBC A;  4PP0 A;  2Z22 A;  2O68 A;  3V83 A;  4JVI A;  5AA2 B;  1IMB A;  2L5V A;  3GXA A;  1MS7 A;  1Y1M A;  2V3U A;  2E0S A;  3G3G A;  4ESX A;  3T9U A;  1Z7N E;  4GLI A;  1F9B A;  4PC9 A;  5J16 A;  1M5E A;  4YU0 A;  4QSD A;  4C1T A;  1ZMG A;  1SPI A;  5CMM A;  2H99 A;  1I6A A;  4QSC A;  1LBZ A;  2V3T A;  2IEE A;  2F97 A;  3E3K A;  2OZZ A;  1QJM A;  4EQB A;  3VLU A;  3E13 X;  4O94 A;  4MCO A;  3IB1 A;  5KCJ B;  2VP1 A;  3T9H B;  3QSL A;  3BFT A;  5HM4 B;  2XXX A;  4N91 A;  1T0K A;  2B3F A;  4P3L A;  1NNF A;  3PTY A;  1KA1 A;  1B05 A;  3PU5 A;  4I8C A;  2P2A A;  1MRP A;  2Y5L A;  1K9Z A;  1Q9D A;  2RIN A;  1N76 A;  5EQ8 A;  3MUQ A;  3G3J A;  2ZYK A;  4YKI A;  2RCA A;  1Y4T A;  3T9X B;  2F7B A;  1IXG A;  2PMS A;  1IQ7 A;  1A99 A;  1JW4 A;  2Q2A A;  4N81 A;  4GWU A;  1XVY A;  2UXA A;  5TU0 A;  3LUZ A;  3IO6 A;  4GX3 A;  2I4C A;  1BKA A;  1B9J A;  1GR2 A;  2QJE A;  3GBB A;  2V84 A;  4FJP A;  1SI1 A;  2QS4 A;  1FPJ A;  2A5T A;  1QVS A;  3KN3 A;  3T22 A;  4NF8 B;  4N4U A;  3TMG A;  2Q89 A;  4U4X A;  1FPB A;  2CZL A;  3MC2 A;  1XS5 A;  1Z7M E;  4BDQ A;  4NF0 A;  3EHU A;  3UP9 A;  3TOD A;  2H25 A;  3H6U A;  3RN8 A;  5ITO A;  5EQ7 A;  5EHM A;  1MG1 A;  2QMX A;  2F5X A;  3CSB A;  4FAJ A;  1N7X A;  1J1N A;  4F3G A;  4NF5 B;  1SD3 A;  3LSL A;  4IGT A;  3L6H A;  4RA1 A;  3TZA A;  1LFH A;  1POY 1;  5I5P A;  4X48 A;  5TP9 B;  5F24 A;  3OO6 A;  1FQA A;  5IZ3 A;  3IJX B;  1MQJ A;  4P9K A;  3UN6 A;  5HBC A;  3JYR A;  5T3J A;  4H8J A;  3E79 A;  3O29 A;  4YKK A;  2Q2C A;  3O9P A;  5H8N A;  2YJP A;  3QUJ A;  2O7U A;  4POX A;  4EF1 A;  4KYS A;  3T9V A;  3TTK A;  3KOT A;  5AA1 A;  2CZH A;  2Z8F A;  3QUF A;  5H8S A;  4KYE A;  1O64 A;  2FIE A;  3K6X A;  2QS2 A;  3PPP A;  3CG3 A;  5LOM A;  4C1U A;  1NI9 A;  2F8D A;  4PQJ A;  3TCG A;  4QHQ A;  1MY2 A;  4F3S A;  5ELV A;  5FHM A;  3DEL B;  1D3K A;  4N15 A;  2FVZ A;  4P47 A;  2YLN A;  3USD A;  2DWA A;  3U65 A;  3RQT A;  2BJJ X;  3UA8 A;  4UA8 A;  1S9T A;  3PGF A;  1CB6 A;  4KXP A;  1LGB C;  1ZTY A;  3FUZ A;  3LUY A;  4RJZ A;  4ZE8 A;  3OMB A;  4ZEB A;  1NKX A;  1OVB A;  4DDD A;  5H8Q A;  1YAE A;  3T0J A;  4JSO A;  2Y7P A;  4YMA A;  4G77 A;  2W7Y A;  1LBV A;  1M5C A;  3THI A;  3RNN A;  3BKI B;  4GL0 A;  1LST A;  1MH4 A;  3W9V A;  3FV1 A;  2FYI A;  1FQC A;  4F2O A;  5I2K A;  3JZJ A;  1YZ0 A;  5CBR A;  5KDT A;  2REG A;  4I9D A;  4ND9 A;  4PFB A;  1Y3P A;  1DCU A;  4MIJ A;  4OHN A;  4KCD A;  1LBX A;  3ISP A;  1JQF A;  2F36 A;  2XWI A;  1Y3Q A;  1SVX B;  2QFL A;  1IXH A;  3BIH A;  4HE1 A;  3TTL A;  4Q30 B;  4R75 A;  3SEY A;  4R6H A;  4MF3 A;  2UVG A;  1CE2 A;  3EPE A;  1B4Z A;  3MPK A;  3SDF A;  3H6T A;  3TPA A;  4F29 A;  1IXC A;  4OMB A;  4P11 A;  4NE4 A;  3K01 A;  4F3B A;  4LA9 A;  3ILT B;  4P56 A;  5A5X B;  1MXY A;  2PX1 A;  3T96 B;  3OSQ A;  4OES A;  1O63 A;  1FTO A;  1G0H A;  1K9Y A;  5CMK A;  1IZ1 A;  2QSX A;  2NWJ A;  1HSL A;  2Z8D A;  1FTK A;  4KD5 A;  4F2Q A;  2XD3 A;  5CC2 A;  3FAS A;  5AA4 A;  3TCH A;  1B3H A;  3MVW A;  5CI5 A;  4IR8 A;  5CBS A;  4RK2 A;  1FPE A;  2D3I A;  4N13 A;  3BBR A;  1MQD A;  1QKB A;  1QKA A;  3RY3 A;  4GWS A;  2XX8 A;  4TLL B;  3N26 A;  5IM2 A;  4N6P A;  4H6D A;  3IL1 B;  4BDO A;  4BDL A;  4IO6 A;  2FA7 A;  2QS1 A;  5I59 B;  2O69 A;  4YKP A;  4OWD A;  3VLV A;  3CFL A;  2NXO A;  4NWD A;  3E78 A;  1TT1 A;  3FXQ A;  5F1Q A;  2DS9 A;  1N3X A;  1N3W A;  5AA2 A;  3Q26 A;  4PTK A;  3UK4 A;  1YYZ A;  5K2Y A;  2I6E A;  4JWY A;  2A5T B;  1B52 A;  1B3L A;  3LV0 A;  3BFU A;  1KWH A;  2VPO A;  1ZLQ A;  3G3F A;  3E9X A;  4KI0 E;  2MKZ A;  3T66 A;  4NF6 A;  5I58 B;  1JNF A;  4G8H A;  2QVV A;  1RDX A;  1O7T A;  5AA4 B;  1NH8 A;  4OAN A;  4QFL A;  4BDM A;  1BTJ A;  1N84 A;  2ZNS A;  4X1B A;  2XWV A;  3PUW E;  2PBW A;  3OEM A;  2RCB A;  4QFN A;  2GRV A;  3S9L C;  3C35 A;  2QPQ A;  4MLV A;  3MWB A;  3OSR A;  1B46 A;  4LVQ A;  4DCY A;  5ISU A;  3KG2 A;  3Q29 A;  4OZ9 A;  3RTF B;  4EDP A;  4ZEC A;  3H6V A;  1LB9 A;  4M1V A;  4DI4 B;  1FBF A;  4M4G A;  1LLS A;  5FHN A;  1NV2 A;  1LFI A;  4HCW A;  2KR0 A;  1A40 A;  3EN3 A;  5EQA A;  3B8B A;  3U94 A;  1PB8 A;  5L9M A;  4IY5 A;  4IO7 A;  4JWX A;  3OEN A;  4OVP A;  3U8Q A;  3M3K A;  4MX6 A;  2CZI A;  1HSE A;  3S2V A;  3EQ1 A;  4XKQ A;  4U2R A;  3LC8 A;  4MNP A;  4F19 A;  5CMB A;  3S9N C;  2PFZ A;  1MXV A;  4R9G A;  1ATG A;  4F31 B;  2REJ A;  3B6T A;  3CSG A;  1A8F A;  3FGS A;  4H45 A;  4R72 A;  4MFI A;  4U22 A;  4DLD A;  1FPK A;  1LBY A;  2PT2 A;  2DWJ A;  5M2V A;  4N07 A;  3SEW A;  2Y84 A;  1FW0 A;  2QMW A;  1USY H;  4NHB A;  2HEU A;  1AOV A;  2VPN A;  2RKM A;  2QS3 A;  4G8M A;  5JTY A;  1QUJ A;  1MXW A;  5I2N A;  3FZV A;  4O7I A;  1B32 A;  3SER A;  3KFM A;  5IKB A;  2UYF A;  1OIB A;  1RYO A;  3W9W A;  3ODB A;  1RKM A;  2X7P A;  3IJO B;  2X7Q A;  3KC0 A;  1MY3 A;  4UAB A;  3LR1 A;  3S9M C;  3UIF A;  2YPN A;  4MH5 A;  5H8Q B;  3RGY A;  4GWO A;  1GVC A;  2ANJ A;  2GFE A;  4G8N A;  1FBG A;  1LB8 A;  1FPG A;  2HXR A;  3A09 A;  1B3E A;  1MPB A;  3OEL A;  3O6I A;  3PPR A;  1PBQ A;  4EXK A;  3U1O A;  2VD2 A;  3CG1 A;  4ZEK A;  3CFX A;  1I6Q A;  2XXV A;  1FTL A;  3OD7 A;  2HXW A;  3K1N A;  4O7M A;  4HE2 A;  4OFL A;  2ZMB A;  5I59 A;  1H76 A;  1VSO A;  3CVG A;  3VE1 B;  4PFR A;  2HPG A;  2I3V A;  1NNK A;  2E1S A;  3ROJ A;  2OJT A;  3MVX A;  1B3F A;  1MY1 A;  1SYI A;  3QK6 A;  4YB6 A;  4IB2 A;  3MVZ A;  4GRK A;  3PPQ A;  1MQI A;  1NV5 A;  5CRY A;  4H1X A;  4PAI A;  4FOR A;  4R2B A;  1UTB B;  4OVQ A;  4P0I A;  3AXF A;  3B7D A;  5DVI A;  1D4N A;  4XIG Q;  1BP5 A;  4R6K A;  4IO2 A;  1NV0 A;  1FPI A;  4ELQ A;  3G7W A;  4GX4 A;  3K1P A;  3IOT A;  4AB6 A;  4ECF A;  2VOZ A;  4LON B;  2BJI A;  5H8H B;  4EQ7 A;  4MHF A;  3W15 C;  5LTC A;  2DWH A;  3UOR A;  1P1U A;  2F35 A;  1MM7 A;  4XEQ A;  1RDY A;  3C34 A;  3IFA A;  1UTH B;  3ZKL A;  1N04 A;  1QUI A;  4ELP A;  4P1L A;  1ZJL A;  4GF8 A;  4GQO A;  2KLF A;  4HW8 A;  3GBA A;  2I58 A;  3EHT A;  5I56 A;  1KZ8 A;  4PFI A;  5B7D A;  4YKJ A;  4LQ5 A;  3EHS A;  2DQV A;  5ICT A;  1MQH A;  1FPL A;  3FXU A;  5FTI A;  4Z7E A;  3A3U A;  4RK9 A;  2O7I A;  5DEX B;  4NTL A;  1XOC A;  3TCF A;  2DDK A;  3IFC A;  4R74 A;  2XXT A;  4YMB A;  3M3F A;  4DIG A;  2KQZ A;  1TFD A;  2F6P A;  1URD A;  3DP4 A;  3TEP A;  3RYD A;  4PDD A;  1LCT A;  2P3V A;  2I4B A;  4H65 A;  3MP1 A;  3SEX A;  2WBB A;  2ONR A;  4E0W A;  1B7H A;  1IMC A;  2M8C A;  4OEU A;  2OBG A;  4WED A;  1AWB A;  2HFB A;  4U1Z A;  1ZU0 A;  1MDP 1;  3K4U A;  3ILU B;  3ZS6 A;  4KCC A;  5IZZ A;  2WX9 A;  3LSW A;  3PPN A;  3HHG A;  3C36 A;  4FEB A;  1NUY A;  2Y7K A;  4ELR A;  5I57 B;  1NV7 A;  1NUX A;  2Y7W A;  1R6Z A;  3SEU A;  2OLB A;  1FBE A;  4XTC Q;  1IME A;  4OQO A;  5DYH A;  1P1O A;  5L8D A;  3VVD A;  3VFJ A;  1KA0 A;  1B1X A;  2XA5 A;  1M5D A;  4HXV A;  1XC1 A;  1I6B A;  4NMY A;  2GQ1 A;  4PGN A;  4X8R A;  2DXY A;  2HAV A;  3FD3 A;  4N17 A;  3B6Q A;  4N8G A;  5AA3 A;  2OCU A;  4U21 A;  3RPW A;  4PBQ A;  5H8H A;  1B4H A;  4F39 A;  1LBB A;  1NMU A;  4X1D A;  1VDW A;  3O66 A;  4Z0I A;  4PFW A;  3B50 A;  3H6W A;  3TUS A;  2XXW A;  2B4M A;  2V4C A;  4N8Y A;  1DTG A;  1EZO A;  4EUO A;  4DI3 D;  3MP8 A;  1NL5 A;  4C0R A;  4UAC A;  3JV9 A;  4IO5 A;  4ZEF A;  3VXC A;  5FBP A;  2IA4 A;  3B6W A;  1FQD A;  1NH7 A;  3HN0 A;  4H67 A;  1OLC A;  2Q9T A;  2H4I A;  3QYT A;  5IZ3 B;  2ZZW A;  2AL4 A;  4DXB A;  1N0T A;  3ZSF A;  2XXK A;  1H3D A;  3HCQ A;  1A55 A;  4OVR A;  3O97 A;  2LAO A;  3WAF A;  4WKM A;  4NED A;  4X04 A;  1TXF A;  3CR9 A;  2P0S A;  1A54 A;  3ECR A;  3KC1 A;  1P1W A;  1MH3 A;  4ZZE A;  4PAF A;  1EYK A;  3R6U A;  3F11 A;  4KYD A; 
#chains in the Genus database with same CATH homology
 3PUW E;  2PBW A;  3O6G A;  4QFN A;  1M5E A;  1AL3 A;  1Q1K A;  4GXA A;  2GRV A;  4YU0 A;  3S9L C;  3C35 A;  2QPQ A;  4MLV A;  4QSD A;  4R2F A;  4C1T A;  2D5W A;  3K6U A;  4H5G A;  2F7C A;  1ZMG A;  3MWB A;  3OSR A;  4POW A;  1B46 A;  1S50 A;  3IOU A;  3MZB A;  1B7Z A;  1JET A;  4LVQ A;  1SW5 A;  4DCY A;  2V93 A;  2H99 A;  5CMM A;  3RUM A;  4EQ9 A;  1OLA A;  4Q5T A;  3P7I A;  4O3A A;  1I6A A;  2DSF A;  4DCX A;  3E4R A;  3KG2 A;  1VR5 A;  3Q29 A;  4QSC A;  4R73 A;  4I62 A;  4OZ9 A;  2V3T A;  2IEE A;  2F97 A;  3E3K A;  4JDF A;  4NF8 A;  3RTF B;  4EDP A;  2OZZ A;  1VE4 A;  1QJM A;  4ZEC A;  1FTM A;  3IR1 A;  2UVI A;  3G3I A;  5L9O A;  4EQB A;  3H6V A;  1AIV A;  1LB9 A;  5FHO A;  3LSX A;  3VLU A;  1MXX A;  1JEU A;  1DPE A;  3E13 X;  4GL8 A;  4M1V A;  4M4G A;  3K2D A;  3HO7 A;  1LLS A;  2I49 A;  3IB1 A;  5DT6 A;  5FHN A;  4ZED A;  2VP1 A;  5KCJ B;  3T9H B;  3QSL A;  1LFI A;  4GIZ A;  4HCW A;  2PT1 A;  1A40 A;  3EN3 A;  3H4Z A;  3KZG A;  2WKY A;  2Q88 A;  3BFT A;  3IB2 A;  3S4U A;  5ICQ A;  3U94 A;  2F6G A;  1PB8 A;  2XXX A;  4IO4 A;  3FJM A;  1B58 A;  5L9M A;  5HM4 B;  3ONM A;  2PVU A;  4IY5 A;  5H8N B;  4IO7 A;  1URS A;  4JWX A;  2DP8 A;  3V5A A;  1OQH A;  2B3F A;  4NWC A;  5I58 A;  1NNF A;  3OEN A;  4IGR A;  1T0K A;  3U8Q A;  1B05 A;  3M3K A;  3MW0 A;  3PU5 A;  3MZ1 A;  3SEV A;  1QUL A;  4JWO A;  3U92 A;  1HSE A;  1LCF A;  2DVC A;  3EQ1 A;  3S2V A;  4XKQ A;  1P1Q A;  5TPA A;  4I8C A;  2P2A A;  1MRP A;  1SDX A;  4LZ8 A;  1SBP A;  4QFK A;  4U2R A;  1UTB A;  3LC8 A;  5EHS A;  4F19 A;  3QXM A;  1JVX A;  1LFG A;  1B0H A;  1XT8 A;  2RIN A;  4H0W A;  3FVO A;  1N76 A;  3MUQ A;  2NUV A;  3G3J A;  4K3F A;  2ZYK A;  5CMB A;  4YKI A;  2D21 A;  4QFO A;  2RCA A;  3S9N C;  1MXZ A;  3VDF A;  1Y4T A;  4BDN A;  4OEN A;  1ANF A;  2G93 A;  4WXJ A;  1MXV A;  4R9G A;  5FTH A;  1ATG A;  2F7B A;  3T9X B;  4F31 B;  1IXG A;  1IEJ A;  2PMS A;  3C31 A;  2REJ A;  3B6T A;  3CSG A;  1A8F A;  3FGS A;  3N94 A;  4R72 A;  1IQ7 A;  1A99 A;  3R26 A;  4NF5 A;  3TTM A;  3PV0 E;  4IO3 A;  2O51 A;  4MFI A;  4U22 A;  3EF7 A;  4DLD A;  3S9E A;  2XX9 A;  1JW4 A;  2Q2A A;  4R9F A;  2OWS A;  3H03 A;  5EYF A;  2XX7 A;  4DZ1 A;  4G68 B;  4R6Y A;  1XVY A;  1P1N A;  2UXA A;  5TU0 A;  2VD3 A;  2PT2 A;  2I48 A;  5I2N B;  3IO6 A;  3LBS A;  3TYH A;  3GZG A;  3PPO A;  2DWJ A;  2I4C A;  3C33 A;  1B7U A;  4N07 A;  5M2V A;  1BKA A;  1B9J A;  1GR2 A;  2QJE A;  3GBB A;  4MBP A;  5DVJ A;  3SEW A;  2Y84 A;  1UIU A;  3H06 B;  3MAM A;  4LUB A;  1FW0 A;  2QMW A;  1USY H;  1GV8 A;  2V84 A;  3K02 A;  1AOV A;  2HEU A;  4EXK A;  2DVZ A;  4FJP A;  1SI1 A;  3IO4 A;  2QS4 A;  2A5S A;  1EU8 A;  2RKM A;  2A5T A;  2QS3 A;  4G8M A;  1QVS A;  1XVX A;  3KN3 A;  1QUJ A;  4ZDM A;  5JTY A;  2Q8J A;  3PD8 A;  5AA2 A;  2HZK A;  1MY4 A;  1EZ9 A;  3RTW B;  1MXW A;  2I0C A;  5I2N A;  3T22 A;  1B5I A;  3FZV A;  2VHA A;  4NF8 B;  3TMG A;  1B32 A;  2Q89 A;  3V89 B;  4O3B A;  4U4X A;  2UVJ A;  2XXR A;  1JVY A;  3DP8 A;  3DM0 A;  3M3L A;  2CZL A;  3SER A;  2B3B A;  3KFM A;  3MC2 A;  3R7X A;  5IKB A;  4G68 C;  1XS5 A;  1Z7M E;  4BDQ A;  1Y3N A;  1A8E A;  1OIB A;  1RYO A;  2UYF A;  4FIM A;  4E0X A;  2V25 A;  4ISU A;  2HCA A;  3EHU A;  3W9W A;  3ODB A;  4WEP A;  1RKM A;  2ZYO A;  2X7P A;  3IJO B;  3TOD A;  3UP9 A;  2H25 A;  2X7Q A;  3H6U A;  1MY3 A;  2PYY A;  3KBR A;  3MBP A;  3LR1 A;  3S9M C;  3MJN A;  3KSX A;  5ITO A;  3RN8 A;  3RT6 B;  1ZKB A;  1MG1 A;  2YPN A;  2QMX A;  2F5X A;  2XXU A;  3C9H A;  3CSB A;  1DPP A;  1N7X A;  4MH5 A;  1J1N A;  4FAJ A;  1B40 A;  5H8Q B;  3PUY E;  4LZ7 A;  4GWO A;  4YIC A;  3RGY A;  4NF5 B;  4F3G A;  1GVC A;  2ANJ A;  1SD3 A;  3LSL A;  4IGT A;  4LZ5 A;  1PEB A;  3L6H A;  4RA1 A;  2GFE A;  1MPC A;  4RNS A;  1LAH E;  1N7W A;  3TZA A;  3VXB A;  1LFH A;  1POY 1;  1ZBM A;  4G8N A;  1ZIU A;  2R71 A;  1NFT A;  4X48 A;  3O6H A;  5TP9 B;  1LB8 A;  3I5O A;  4KQP A;  1SYH A;  3A09 A;  3IOV A;  1B3E A;  4OTE A;  3OO6 A;  4X1B A;  1II5 A;  1FQA A;  1MPB A;  3DLN A;  1UTH A;  3IJX B;  4LQ2 A;  3OEL A;  3O6I A;  3PPR A;  3QAX A;  1PBQ A;  1MQJ A;  1YTV A;  1MPD A;  1Y1Z A;  5DTB A;  3U1O A;  4F1U A;  3UN6 A;  5H8F B;  3KN8 A;  5HBC A;  2ESN A;  2VD2 A;  3CG1 A;  3JYR A;  3PMW A;  4QRZ A;  4ZEK A;  2HQ0 A;  3CFX A;  3IX1 A;  3K6W A;  3MZ9 A;  4H8J A;  4QFP A;  1I6Q A;  4RYA A;  1USY E;  2XXV A;  1H43 A;  3FXR A;  1FTL A;  3OD7 A;  3O29 A;  1M5B A;  2Z8E A;  3FIR A;  4YKK A;  3D4C A;  2HXW A;  2Q2C A;  3K1N A;  3O9P A;  3SES A;  3TDJ A;  2V3Q A;  5H8N A;  2YJP A;  2OWT A;  1EZP A;  3A3C A;  4ZZA A;  3QUJ A;  4OFL A;  5BWJ A;  5H8F A;  2ZMB A;  2O7U A;  1D9V A;  4POX A;  5I59 A;  2F34 A;  4NF4 B;  1H76 A;  4GD5 A;  1VSO A;  2OK2 A;  2H98 A;  3CVG A;  2I0B A;  4MLQ A;  3UGW A;  1Y9U A;  3VE1 B;  4PE5 B;  3Q27 A;  4EF1 A;  5CM6 A;  3HPI A;  4KYS A;  1DTZ A;  2I3V A;  1NNK A;  1DOT A;  2E1S A;  2O84 X;  4HTG A;  2OJT A;  3T9V A;  1B5J A;  3MVX A;  3TTK A;  4RPN A;  1B3F A;  1MY1 A;  3KOT A;  5AA1 A;  2QL3 A;  4H8I A;  1MQG A;  4F1Y A;  1IIT A;  1SYI A;  3QK6 A;  3TEL A;  3KN7 A;  4DXU A;  1EH3 A;  2Z8F A;  3QUF A;  4YB6 A;  4NF4 A;  1A7L A;  5H8S A;  2O1L A;  4IB2 A;  4KYE A;  3MVZ A;  1O64 A;  3PPQ A;  4GRK A;  3K6X A;  4U1O A;  4FAT A;  2XD2 A;  1MQI A;  2QS2 A;  5I2K B;  3PPP A;  3CG3 A;  4OVJ A;  1VFE A;  2XXQ A;  4JB7 A;  4H1X A;  2GHA A;  2ZNS A;  1VFD A;  5CRY A;  5LOM A;  3WAE A;  4FOR A;  1URG A;  4R2B A;  1MM6 A;  1R9Q A;  1UTB B;  3DP6 A;  3LSF B;  4C1U A;  4EF2 A;  5KDT B;  4P0I A;  3V8X B;  3AXF A;  5BUU A;  1US5 A;  2P1S A;  3B7D A;  1H45 A;  1MDQ A;  5DVI A;  4AQ4 A;  2B65 A;  1PB7 A;  2F8D A;  2ALU A;  3IK6 B;  1R9L A;  4OFJ A;  4PQJ A;  1D4N A;  2NOO A;  4QHQ A;  3TCG A;  2Z23 A;  3O2A A;  1MY2 A;  4JBZ A;  4XIG Q;  3TKD A;  4GFR A;  1BP5 A;  4F18 A;  1B2H A;  4R6K A;  4OET A;  4F3S A;  4IO2 A;  3PMV A;  4OYV A;  5ELV A;  1US4 A;  4LP2 B;  3FVK A;  5FHM A;  5I84 A;  3DEL B;  1D3K A;  5CC2 A;  2R9J A;  3K1M A;  3RLF E;  3CRB A;  4ELQ A;  3G7W A;  2YLN A;  3KGC A;  3KSJ A;  5ITP A;  1JEV A;  1QUK A;  2UYE A;  1TFA A;  3FVG A;  3USD A;  2DWA A;  3K1P A;  3IOT A;  1FQB A;  2BJJ X;  3RQT A;  3UA8 A;  4UA8 A;  2DOJ A;  3U93 A;  4AB6 A;  1S9T A;  2VGQ A;  1CB6 A;  1P99 A;  3PGF A;  4IY6 A;  4PFU A;  3SKP A;  2VOZ A;  4KHZ E;  4LON B;  4ECF A;  1LGB C;  3CI8 A;  3PD9 A;  1ZTY A;  3FUZ A;  5F7V A;  5H8H B;  4EQ7 A;  3W15 C;  1OQG A;  3LUY A;  4G4P A;  4RJZ A;  4DE8 A;  2DWH A;  4ZE8 A;  5JK4 A;  3UOR A;  1P1U A;  3OMB A;  4TQU Q;  3I6V A;  2F35 A;  3K0V A;  1JW5 A;  1MM7 A;  3PUV E;  5TPA B;  4ZEB A;  5L9S A;  3C34 A;  1NKX A;  1OVB A;  1UTH B;  2F7A A;  4DDD A;  5KZT A;  3ZKL A;  1N04 A;  1JW1 A;  4OFO A;  5H8Q A;  1QUI A;  1YAE A;  4ELP A;  3UIF A;  1B3G A;  1ZJL A;  3MVY A;  2AIX A;  4GF8 A;  4GQO A;  4HCY A;  1SQY A;  4ZE9 A;  4FEC A;  2KLF A;  4JSO A;  4ONY A;  4HW8 A;  3GBA A;  2I58 A;  1SW1 A;  2Y7P A;  4G77 A;  4YMA A;  3VVF A;  1IXI A;  3MPL A;  3EHT A;  5I56 A;  4KPT A;  2W7Y A;  1M5C A;  4JXI A;  3THI A;  2ABH A;  3RNN A;  3BKI B;  4GL0 A;  4YB7 A;  4GVO A;  1LST A;  1MXU A;  4YKJ A;  5B7D A;  4H5F A;  1MH4 A;  3W9V A;  4LQ5 A;  3EHS A;  4QF9 A;  2DQV A;  2XXY A;  1I69 A;  5ICT A;  3PMX A;  1MQH A;  1WVJ A;  3FV1 A;  3FXU A;  2FYI A;  3I3V A;  5FTI A;  3U72 A;  1FQC A;  4F2O A;  4Z7E A;  5I2K A;  3JZJ A;  3A3U A;  2XHD A;  3G3K A;  4RK9 A;  4ELO A;  2O7I A;  1B0L A;  1PBP A;  5DEX B;  4JSD A;  1AMF A;  4NF6 B;  4NTL A;  3RT8 A;  5CBR A;  5KDT A;  3CIJ A;  1XOC A;  2REG A;  3TCF A;  4I9D A;  4EXL A;  2GH9 A;  3N5L A;  4RPO A;  3QIM A;  1SI0 A;  1RYX A;  3FV2 A;  4Q8R A;  1SW4 A;  4YB5 A;  4R74 A;  2XXT A;  4YMB A;  3M3F A;  4ND9 A;  4KFQ A;  1GTK A;  4DIG A;  1Y3P A;  3L6G A;  1TFD A;  1B51 A;  1URD A;  2F6P A;  4YZZ A;  2RC9 A;  3DP4 A;  3HV1 A;  4OHN A;  3TEP A;  2O1M A;  2ZYN A;  4TOZ A;  1LCT A;  4PET A;  4KCD A;  2CMO A;  4P0G A;  2HZL A;  2I4B A;  3KJT A;  4H65 A;  1B6H A;  1JQF A;  2F36 A;  1BIY A;  1POT A;  3FVN A;  1QW0 A;  3MP1 A;  1WDN A;  3IB0 A;  3H3G A;  3N6T A;  1AH5 A;  3SEX A;  3OEK A;  2ONR A;  4E0W A;  1B7H A;  2M8C A;  1Y3Q A;  3OO9 A;  4OEU A;  1SVX B;  5I57 A;  2F78 A;  4F22 A;  2OBG A;  3IOW A;  4WED A;  1IXH A;  3TTL A;  2HFB A;  4U4S A;  4U1Z A;  3FJG A;  1DSN A;  3ZKK A;  5A5X A;  4Q30 B;  4R75 A;  3SEY A;  1ZU0 A;  5ISU A;  4OEV A;  4PFY A;  4R6H A;  1MDP 1;  1XHY A;  5AE4 A;  3K4U A;  4MF3 A;  3ILU B;  2ZNU A;  1NNP A;  2UVG A;  2RC8 A;  1FQF A;  1L5T A;  3ZS6 A;  1TWY A;  4KCC A;  4U23 A;  1CE2 A;  2ZNT A;  3LSW A;  4F1V A;  3IOR A;  3EPE A;  3Q25 A;  1B4Z A;  3MPK A;  1NNT A;  1YCJ A;  3H6T A;  3SDF A;  3PPN A;  3TPA A;  3HHG A;  1OVT A;  3C36 A;  2AL5 A;  1Y4C A;  4F29 A;  2XXP A;  1LAG E;  4FEB A;  4QSE A;  1M5F A;  1IXC A;  5JTY B;  3VV5 A;  2H5Y A;  1Y20 A;  2DXR A;  2Y7K A;  3N6U A;  4OMB A;  4BLA A;  4TLM B;  4G2Z A;  4ELR A;  5HPQ A;  5I57 B;  4P11 A;  4NE4 A;  3K01 A;  4F3B A;  4FED A;  2Y7W A;  1R6Z A;  4I1D A;  3KJ7 A;  3SEU A;  1B1H A;  5TP9 A;  2OLB A;  3ILT B;  4LA9 A;  4XTC Q;  4OQO A;  5DYH A;  1P1O A;  3HHF A;  4OXV A;  2NVU B;  4Q0C A;  3H7M A;  1ELJ A;  5L8D A;  5A5X B;  1MXY A;  2PX1 A;  4HS7 A;  4O3C A;  3VVD A;  3T96 B;  3VFJ A;  3OSQ A;  4OES A;  1B1X A;  1O63 A;  3TAJ A;  1FTO A;  5K2X A;  5CMK A;  1M5D A;  5I56 B;  1IZ1 A;  4XKR A;  1XC1 A;  2QSX A;  5JEI A;  2THI A;  4XKP A;  2NWJ A;  1I6B A;  3C4M A;  2FNC A;  1Q35 A;  2H9B A;  1HSL A;  2XXI A;  2Z8D A;  4NMY A;  2DE4 A;  1FQE A;  5KCJ A;  2UVH A;  2ZYM A;  2DXY A;  2HAV A;  1FTK A;  3FD3 A;  4KD5 A;  2XD3 A;  3MQ9 A;  3FAS A;  1SW2 A;  3O28 A;  4ESW A;  4F2Q A;  3D4G A;  2O6A A;  5AA4 A;  3B6Q A;  5AA3 A;  4KR5 A;  3TCH A;  3TTN A;  5DEX A;  2OCU A;  2Y7I A;  1B3H A;  4U21 A;  1GGG A;  4OER A;  3RPW A;  1FCK A;  3MVW A;  5H8H A;  1B4H A;  3OOA A;  1WOD A;  4FE8 A;  1LBB A;  4F39 A;  3TTR A;  3K00 A;  1NMU A;  4X1D A;  2ZXT A;  5CI5 A;  5AA2 D;  5CBS A;  4F3P A;  3O66 A;  4RK2 A;  2RC7 A;  3OEM A;  4Z0I A;  1R1N A;  2DYX A;  1HSJ A;  4PFW A;  2D3I A;  3VVE A;  4ZS9 A;  4N13 A;  3BBR A;  1MQD A;  1QKB A;  1QKA A;  3H6W A;  5J1D A;  3RY3 A;  3TUS A;  2ONS A;  2XXW A;  2XX8 A;  4TLL B;  3N26 A;  1DTG A;  1OMP A;  4ZEI A;  1EZO A;  2G29 A;  4EUO A;  3MP8 A;  1NL5 A;  4C0R A;  4N6P A;  2Y7R A;  2HAU A;  4G68 A;  4H6D A;  3IL1 B;  3JV9 A;  4UAC A;  1B5H A;  4BDO A;  3GLB A;  1IUD A;  4BDL A;  3CFZ A;  4IO5 A;  4IO6 A;  4ZEF A;  3C32 A;  2FA7 A;  3Q28 A;  2QS1 A;  3KOS A;  4YAH X;  3VXC A;  5I59 B;  2GHB A;  1MY0 A;  3KEI A;  3M8U A;  4LAT A;  3T93 B;  3PUZ E;  4DXC A;  2DWI A;  2IA4 A;  2O69 A;  1FQD A;  3B6W A;  4XKN A;  4YKP A;  3TQL A;  1LAX A;  1NH7 A;  3SET A;  4OWD A;  3FAT A;  3HN0 A;  3K6V A;  4H67 A;  1OLC A;  2Q9T A;  3IAZ A;  1PB9 A;  2H4I A;  1LAF E;  3QYT A;  3MP6 A;  5EHM A;  3VLV A;  2AL4 A;  3CFL A;  4RXL A;  4DXB A;  1N0T A;  3TQW A;  2NXO A;  4NWD A;  3OO8 A;  5DVF A;  1TT1 A;  3ZSF A;  1D9Y A;  3FXQ A;  5IAI A;  1H3D A;  2X26 A;  3HCQ A;  5F1Q A;  5B70 A;  2DS9 A;  2AYS A;  1N3X A;  1A55 A;  1N3W A;  3PUX E;  2I3W A;  4L17 A;  3FJ7 A;  4AB5 A;  1YPN A;  3Q26 A;  2DE2 A;  2XXH A;  2LAO A;  3O97 A;  4XXU A;  3UK4 A;  1DMB A;  5K2Y A;  3OO7 A;  2I6E A;  2DE3 A;  1FTJ A;  4JWY A;  4THI A;  1UQW A;  4WKM A;  3WAF A;  4BDR A;  1PDA A;  1PC3 A;  2A5T B;  3G3H A;  4NED A;  1B52 A;  3VLW A;  4RY1 A;  2R6G E;  4GXS B;  4X9T A;  1B3L A;  3HST A;  1BLF A;  3BFU A;  3OXN A;  1TXF A;  1KWH A;  1ZLQ A;  3CR9 A;  3G3F A;  3E9X A;  4KI0 E;  1S7Y A;  1LBC A;  2P0S A;  3T66 A;  4NF6 A;  4PP0 A;  1JNF A;  1A54 A;  2Z22 A;  2O68 A;  3ECR A;  4G8H A;  5I58 B;  3V83 A;  5AA2 B;  1P1W A;  3GXA A;  1MS7 A;  1O7T A;  1Y1M A;  5CMC A;  5AA4 B;  1MH3 A;  2V3U A;  4ZZE A;  1NH8 A;  1H44 A;  3TFL A;  2E0S A;  4GOT A;  3G3G A;  4ESX A;  1IIW A;  2RF1 A;  4BDM A;  4QFL A;  1UIV A;  3R6U A;  1Z7N E;  4GLI A;  3T9U A;  1BTJ A;  1N84 A;  2QRY A;  2ONK E;  4PFT A;  1F9B A;  3F11 A;  2RCB A;  4KYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...