4R6KA

Crystal structure of abc transporter substrate-binding protein yeso from bacillus subtilis, target efi-510761, an open conformation
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
396
structure length
396
Chain Sequence
EDVTLRIAWWGGQPRHDYTTKVIELYEKKNPHVHIEAEFANWDDYWKKLAPMSAAGQLPDVIQMDTAYLAQYGKKNQLEDLTPYTKDGTIDVSSIDENMLSGGKIDNKLYGFTLGVNVLSVIANEDLLKKAGVSINQENWTWEDYEKLAYDLQEKAGVYGSNGMHPPDIFFPYYLRTKGERFYKEDGTGLAYQDDQLFVDYFERQLRLVKAKTSPTPDESAQIKGMEDDFIVKGKSAITWNYSNQYLGFARLTDSPLSLYLPPEQMQEKALTLKPSMLFSIPKSSEHKKEAAKFINFFVNNEEANQLIKGERGVPVSDKVADAIKPKLNEEETNIVEYVETASKNISKADPPEPVGSAEVIKLLKDTSDQILYQKVSPEKAAKTFRKKANEILERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transporter Yeso from Bacillus subtilis, Target Efi-510761
rcsb
molecule keywords SOLUTE-BINDING PROTEIN
molecule tags Transport protein
source organism Bacillus subtilis
total genus 147
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6kA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6kA02
2XXRA 4F29A 4AB5A 2V25A 5AA1A 4R2FA 3LSFB 2OBGA 4Z7EA 1LB9A 5ISUA 2DXRA 1P1WA 1I6BA 3KFMA 3OEKA 4QFOA 1LFHA 1RYXA 1R9LA 4MLVA 4M4GA 2O51A 1P1OA 5JK4A 3TKDA 2ALUA 4JWOA 3W15C 3C35A 4OXVA 4KR5A 4QFLA 3WAEA 3L6HA 3QAXA 2ZYOA 2UVHA 1BLFA 2ZYKA 1I6AA 3Q27A 3U94A 2GHAA 5I2NA 4U21A 4FEBA 3ECRA 3KGCA 1IIWA 2R9JA 4IO7A 1N76A 3QYTA 4F1UA 3TTKA 5AE4A 3EHSA 3TYHA 2GHBA 4F3GA 5ICTA 4PQJA 2NUVA 2F97A 3E4RA 1JEVA 4OVJA 5DVJA 4H0WA 4G68B 4EQ7A 1B3HA 5CRYA 3G3IA 2HFBA 2I58A 3SEVA 1M5CA 3K01A 4EXKA 1M5BA 2XXQA 5AA2D 3MQ9A 1B05A 5I59B 3TQWA 1UTHA 3ILTB 4C0RA 5KCJA 1OIBA 1VFEA 1IEJA 4RY1A 2X7PA 3H7MA 2F6GA 1XC1A 1HSJA 3KJTA 2F5XA 3T22A 1TT1A 2NOOA 4UA8A 3MW0A 4DCYA 1MXXA 4HCYA 4GXAA 4KI0E 5TP9B 4DXCA 5CMCA 2O68A 4U2RA 1AIVA 3FVGA 3RT8A 3PV0E 4XXUA 1QUKA 4O3BA 3K1PA 4ZEDA 2OZZA 1NL5A 1J1NA 4U1OA 2NXOA 4G68A 3OO9A 3U92A 2FYIA 3IX1A 3HPIA 2QS4A 2XX7A 1QVSA 2ABHA 3QUJA 1JW1A 4F31B 4H67A 2O6AA 4EDPA 4QFNA 4X48A 4JDFA 4YB6A 3HSTA 2M8CA 3ILUB 5TPAA 1MH4A 1JW5A 2ANJA 2F6PA 5J1DA 3TZAA 1B58A 2DP8A 3MPKA 3KJ7A 5K2XA 3EN3A 4JWYA 4H5GA 1Q1KA 2XXYA 4KPTA 4POWA 4QHQA 3H6UA 3MVXA 2W7YA 1ATGA 5TP9A 3N6UA 4NWCA 1YCJA 5I2KB 3K00A 1MXVA 4AQ4A 1SI0A 4I8CA 3O2AA 3FASA 3H6VA 1OQGA 1HSLA 3ODBA 3ZS6A 4R6HA 4RNSA 1UQWA 3UORA 3RN8A 3MZ9A 5FTHA 4I1DA 2DYXA 1PDAA 3PD8A 3FJGA 3C32A 3DELB 1GTKA 1TFDA 5FTIA 3T9XB 1MQGA 1B2HA 2Y7IA 1A40A 2O1LA 3ZKKA 4F1YA 1A7LA 4ECFA 2D21A 2GH9A 4FORA 3M8UA 2V93A 2RC9A 4ZEFA 2UVGA 3V83A 3V5AA 3V8XB 4EXLA 4RJZA 2H25A 2OK2A 2Z23A 4F2OA 1D9VA 4OZ9A 3SDFA 4ISUA 2UYFA 1XVYA 3K2DA 1PBPA 1MDQA 1B1HA 3D4GA 3T93B 3HHGA 4MFIA 4WEDA 2Z8FA 1OLAA 3T9HB 1FQDA 1HSEA 4R74A 1EH3A 4EQBA 3FV1A 2PVUA 1NNTA 4JSDA 4OETA 4F2QA 2UVJA 2HAUA 1ZTYA 2AYSA 5HPQA 3FXQA 3LBSA 3A3CA 3MVZA 4JB7A 1ZKBA 3K1MA 4QRZA 1O64A 1F9BA 3Q29A 1UTBA 3IAZA 2Y7PA 4Z0IA 3MPLA 3OXNA 1GR2A 4NF5B 3PMWA 1H76A 2DWHA 3OSQA 2I3VA 4OFLA 3G3GA 3K6WA 2E1SA 1R9QA 2QSXA 5H8NB 3TELA 5AA4A 1Y4TA 1OLCA 5KDTB 1QKAA 1A55A 4WEPA 5IKBA 1O7TA 3SEYA 2LAOA 4E0WA 3RGYA 4PFUA 4NMYA 3CIJA 1M5FA 4NE4A 3TUSA 4M1VA 2XXXA 2Q2AA 2O84X 2DXYA 1MQHA 3RT6B 1FTMA 2XXIA 4L17A 1M5EA 4NF6A 2XXVA 5EHMA 3Q28A 5I84A 4X9TA 3VVFA 5TU0A 4GFRA 3TCHA 3ZKLA 4NF8A 1POTA 2OWSA 3CR9A 3RTFB 1Y3PA 1VR5A 3IJXB 2G29A 1LAGE 3UIFA 5FHNA 1WDNA 4QFKA 3MUQA 3SETA 3BKIB 3G3KA 1MQJA 4NF5A 1QUIA 2PYYA 3VLUA 3LUYA 1B5JA 4PFWA 4MLQA 4KYDA 4BDLA 4FJPA 4Q0CA 3FATA 3U1OA 1FW0A 1D4NA 2A5TA 3TTNA 3EQ1A 1PB8A 4EF1A 2F78A 3R26A 5K2YA 1CB6A 2AL5A 1MRPA 2DVZA 4U4XA 4P0IA 5I58A 1LLSA 5CC2A 4JXIA 3RNNA 3I6VA 2HZKA 4I62A 4U1ZA 3BBRA 1S50A 2H9BA 4LZ5A 4PETA 5CMBA 3HCQA 1NKXA 4IY5A 3C9HA 3RTWB 3O9PA 2O1MA 4IO3A 3DLNA 4JWXA 4LA9A 1TXFA 1B51A 1LBBA 1SD3A 1WODA 3IB0A 4IGTA 2D5WA 3IB1A 1B5HA 1GGGA 1R6ZA 2QS2A 3K02A 1DTGA 2WKYA 5BUUA 4F19A 1CE2A 2B65A 4HCWA 1JEUA 4XKPA 4JBZA 1Y3QA 3FIRA 4G2ZA 1USYE 1UTHB 3R6UA 1AH5A 3RQTA 3MVWA 4QSCA 4F3SA 2ZNTA 3G3FA 5KCJB 3O6GA 2XX9A 1LCFA 3ONMA 3DM0A 1MS7A 4NTLA 3LC8A 5M2VA 1H3DA 2Y84A 3SESA 3P7IA 4OESA 3K6UA 1BIYA 4ELPA 3B6QA 2V3TA 4HTGA 5L9SA 1MPCA 3PMVA 1A8EA 1LSTA 4ZEKA 2I0BA 4F18A 4YMBA 2NVUB 4TOZA 4XTCQ 1YAEA 1BP5A 3B6TA 3G7WA 3VVDA 4GXSB 4ZEIA 3S4UA 2VOZA 1Y1ZA 2BJJX 3PPOA 2FNCA 3E9XA 3PPRA 1QUJA 1Y20A 5ICQA 3OO7A 1PB7A 1Z7NE 4ZZEA 1GVCA 2CMOA 1URGA 1P1QA 3PU5A 1MY2A 3TCFA 4R6YA 4IO6A 1P99A 3O6HA 3IB2A 4YB7A 2Z22A 1B1XA 4EQ9A 3PD9A 4H6DA 2DWJA 2ZXTA 1JVYA 4ESWA 2HQ0A 2AIXA 3Q25A 1MQIA 3TTRA 2RC7A 5TPAB 1TFAA 1I69A 5DEXB 4BDMA 3FXUA 3Q26A 4GWOA 2PT2A 3M3FA 2I48A 1EU8A 4R6KA 1B4ZA 4R2BA 2H4IA 4NF4B 2E0SA 3VV5A 2RCAA 2A5SA 3FJMA 1O63A 3CI8A 2XXWA 1EZOA 4YZZA 4PP0A 3TDJA 2VHAA 4YU0A 4ZDMA 4ZZAA 1FQAA 1DPEA 3PUZE 3H03A 4OQOA 2H5YA 2FA7A 2YJPA 4DXBA 4OEUA 4KCCA 5DVIA 1POY1 3G3JA 1PEBA 4F3PA 3MP8A 2I6EA 3MJNA 5IAIA 4Q30B 1SDXA 3USDA 2ZYNA 4YKIA 2X26A 3MBPA 4ZE9A 3FVNA 1A8FA 1LAXA 3IOTA 1LAFE 5FHOA 4XKNA 3FD3A 1AOVA 5DEXA 2DOJA 3TFLA 4YKJA 1LFGA 4JSOA 4ELRA 2V3UA 3JV9A 2DS9A 4DZ1A 3C34A 3VE1B 2QS3A 4NF4A 1LCTA 2VD2A 4H65A 1N3XA 2ESNA 4R75A 4RA1A 1P1UA 2GRVA 4IO4A 3S9MC 1H44A 4GOTA 3GXAA 4U4SA 4C1TA 4UACA 1NFTA 3A3UA 3B7DA 4ZS9A 1MQDA 1N7XA 1UTBB 2F7CA 4I9DA 1Y4CA 3KN7A 4HS7A 4XKQA 4U23A 1MXWA 4IY6A 4NWDA 2DE2A 3DP6A 1XT8A 2HZLA 5JTYA 4OFJA 1USYH 3T9UA 2XD3A 3QK6A 3IK6B 5H8QB 2REJA 5AA4B 5CMKA 1B6HA 4LVQA 4KFQA 4BDNA 3R7XA 3M3KA 4OTEA 3C36A 2P0SA 4OHNA 1B52A 4KQPA 4R72A 1M5DA 4TLMB 1AMFA 1QJMA 4F3BA 2XHDA 4DLDA 3UA8A 3RLFE 3D4CA 4DCXA 4LQ5A 1MG1A 4EF2A 1FQCA 5B70A 5BWJA 2XX8A 3KN3A 4NF6B 1US4A 4K3FA 3CFXA 4N6PA 1DPPA 5HM4B 3BFTA 1B3LA 1JNFA 3IR1A 3GLBA 4Q5TA 4NF8B 2QRYA 1TWYA 1KWHA 3TMGA 2I0CA 4R9GA 2REGA 3MP6A 4BDRA 1N3WA 3IL1B 3KSJA 5LOMA 1ELJA 4GL8A 4YMAA 1B3EA 1XHYA 1NNFA 2P2AA 3AXFA 1SW4A 1FTKA 4PFTA 1WVJA 5H8QA 4IO5A 2F34A 1JETA 3I5OA 1IUDA 4YICA 1QW0A 4FEDA 3E13X 4ZE8A 4MBPA 3JZJA 1MXZA 2A5TB 1B46A 3O97A 1FQFA 3HO7A 2ZNUA 3H3GA 1FTLA 3T9VA 1SI1A 1DOTA 4RYAA 2DE4A 4BDOA 2Q9TA 3MZBA 4RK9A 4O3CA 4X1DA 5A5XB 1IXHA 5I58B 2I4CA 3MP1A 4LP2B 3EHUA 3CVGA 2P1SA 2VGQA 2Y7KA 1A99A 1NH8A 1OQHA 4ESXA 1VE4A 2IA4A 1QULA 3KSXA 5AA2B 3O29A 3FZVA 1A54A 1XOCA 3UK4A 4XIGQ 1ZJLA 2THIA 3LSLA 4ELOA 1UIVA 1JW4A 3TPAA 5AA3A 3FVOA 4FECA 4GL0A 3VDFA 3U72A 4YB5A 3KG2A 2UXAA 2YPNA 2O7UA 2Q8JA 4LUBA 2DE3A 4F22A 1N7WA 1NH7A 4F1VA 3TCGA 2KLFA 2Z8DA 3IOWA 4GLIA 1JQFA 5H8FA 3QXMA 1YTVA 4YAHX 1NNKA 1D3KA 4KYEA 3K6VA 5A5XA 4KYSA 3LR1A 3TODA 1MM7A 1Y3NA 2RKMA 2QL3A 3K1NA 3TTLA 5I56A 5F7VA 1NMUA 3O66A 2DSFA 1SQYA 2QPQA 3QUFA 3FXRA 3OELA 4H1XA 2B3BA 4GRKA 3PGFA 5AA2A 5H8HA 1R1NA 1XS5A 3CFLA 5F1QA 4RXLA 2QS1A 4ZEBA 1IZ1A 3LSWA 2HAVA 1B40A 2OWTA 3K0VA 1B5IA 5B7DA 1S9TA 3EPEA 3KEIA 2Q88A 2O7IA 3QSLA 4LZ7A 3WAFA 2H98A 4P0GA 3KBRA 2R6GE 3K4UA 1OVBA 2DWAA 1L5TA 4HW8A 1MDP1 4GQOA 3IO6A 2RF1A 3PMXA 2HXWA 5CMMA 1PC3A 3CFZA 3OEMA 2RC8A 2DVCA 2PBWA 3SERA 3FUZA 3SEWA 1BTJA 3O6IA 4H5FA 3SEUA 3U93A 5L9OA 3RPWA 1IITA 3RY3A 2ZYMA 3THIA 4QFPA 1VSOA 4G4PA 1B4HA 2R71A 3DP4A 4LZ8A 1FTJA 3MZ1A 1LB8A 2V84A 1B7ZA 3U8QA 4LATA 3H4ZA 3UN6A 3T66A 2XXUA 3OSRA 1IQ7A 4GVOA 3T96B 1FQEA 3IOVA 4OERA 5EYFA 4ELQA 3OO8A 1PBQA 3M3LA 4OYVA 4OMBA 1T0KA 4WKMA 3VLVA 4H8JA 4ND9A 2Z8EA 4FATA 5ITPA 2G93A 3GBAA 5ITOA 4N13A 4OWDA 1DSNA 4XKRA 3OOAA 2XXPA 2RINA 3FGSA 1MH3A 3N94A 4O3AA 2OCUA 2VP1A 5EHSA 3VXBA 4G68C 3CG1A 4FIMA 1B7UA 1BKAA 1SW2A 4LQ2A 4P11A 1MY3A 1B32A 1OMPA 2CZLA 4RPOA 1Z7ME 3TAJA 3JYRA 5HBCA 2F7AA 3S2VA 3K6XA 2B3FA 1YPNA 1Y9UA 3H6TA 2RCBA 4IO2A 3E3KA 3SKPA 5JTYB 3V89B 5CM6A 4YKPA 2ZNSA 1SW1A 1QKBA 4H8IA 3KN8A 4QSEA 5I59A 1EZPA 4G8HA 1Q35A 1ZBMA 3PUVE 2F7BA 4F39A 1LAHE 4BDQA 1SW5A 2Y7WA 3DP8A 2DWIA 4E0XA 1Y1MA 1XVXA 2I3WA 3CG3A 5CBRA 4AB6A 3IORA 4U22A 2F36A 3G3HA 4DXUA 3VLWA 1RKMA 3UGWA 5DVFA 3H06B 2PX1A 1ZU0A 3F11A 5DTBA 1UIUA 1I6QA 3GBBA 3LSXA 4PE5B 2AL4A 4MH5A 5I57B 3OENA 3C31A 1IXCA 1MM6A 1MY4A 4YKKA 2QMWA 3KZGA 1DTZA 1D9YA 4RPNA 3BFUA 5L9MA 5JEIA 3A09A 4OEVA 3S9LC 3C33A 3TEPA 3CSGA 1LFIA 3TTMA 3HV1A 2F35A 2H99A 3GZGA 2OLBA 1H43A 1B7HA 1URDA 2ONKE 4POXA 1B0HA 4G8NA 2QJEA 4EUOA 2D3IA 1B3GA 4G8MA 3PPPA 1AL3A 3I3VA 3TQLA 1VFDA 3VXCA 1FQBA 1LBCA 5KZTA 3FVKA 2VD3A 5I2KA 4GIZA 4KHZE 3N5LA 1H45A 2GFEA 4RK2A 3N6TA 4C1UA 3S9EA 3FJ7A 1SYHA 3MAMA 1N04A 3RUMA 1EZ9A 4TLLB 5I57A 4GF8A 2HCAA 3KOTA 4THIA 4TQUQ 1RYOA 3HN0A 5L8DA 1OVTA 5FHMA 1MY1A 5DT6A 3MVYA 1FCKA 2ONSA 4G77A 3FV2A 1MPBA 3S9NC 3PPNA 4DDDA 5ELVA 1MXUA 1JVXA 4DIGA 2Y7RA 4NEDA 3OMBA 5H8SA 1IXIA 2OJTA 2XD2A 3OO6A 2IEEA 3CSBA 1MPDA 3W9WA 4IGRA 1S7YA 4FAJA 3W9VA 1GV8A 5H8FB 2O69A 3MWBA 4ONYA 1URSA 2XXHA 5DYHA 5I56B 3MC2A 3HHFA 4KD5A 1ZIUA 2I4BA 2X7QA 3L6GA 3VFJA 2V3QA 5CBSA 4OENA 4PFYA 2QMXA 4QSDA 5H8HB 3OD7A 1MXYA 3SEXA 3PPQA 3IJOB 4ZECA 1B0LA 4WXJA 4KCDA 1DMBA 2HEUA 1B3FA 3EF7A 2UYEA 3PUXE 4R73A 4Q8RA 3QIMA 1PB9A 3CRBA 1N0TA 4MF3A 5H8NA 2PT1A 4FE8A 1LGBC 5KDTA 3N26A 3PUWE 1P1NA 4LONB 2ZMBA 1SBPA 3EHTA 3KOSA 1NNPA 4DE8A 3UP9A 2UVIA 4X1BA 3B6WA 1SVXB 3ZSFA 4QF9A 2DQVA 1IXGA 2ONRA 3O28A 2PMSA 2Q2CA 5CI5A 1ZLQA 1N84A 5I2NB 3IOUA 2I49A 1MY0A 3IO4A 1SYIA 4R9FA 3H6WA 1FTOA 1ANFA 1ZMGA 1US5A 2NWJA 3C4MA 2F8DA 2YLNA 4N07A 4GD5A 2Q89A 1B9JA 2XXTA 4IB2A 1II5A 3VVEA 4BLAA 4OFOA 3PUYE
chains in the Genus database with same CATH superfamily
2XXRA 4F29A 2XA5A 4AB5A 2V25A 5AA1A 4N15A 4R2FA 1IMBA 3LSFB 2OBGA 4Z7EA 1LB9A 5ISUA 2DXRA 1P1WA 1I6BA 3KFMA 3OEKA 4QFOA 1LFHA 1RYXA 1R9LA 4MLVA 4M4GA 4MEVA 5IZZA 2O51A 1P1OA 5JK4A 3TKDA 2ALUA 4JWOA 3W15C 3C35A 4OXVA 4KR5A 4QFLA 3WAEA 4OA4A 3L6HA 3QAXA 2ZYOA 2UVHA 1BLFA 4PCDA 2ZYKA 5ESYA 1I6AA 1FPLA 3Q27A 3U94A 2GHAA 1BK4A 5I2NA 4U21A 4FEBA 2XWVA 3ECRA 1SPIA 3KGCA 1IIWA 2R9JA 4GBWA 4IO7A 1N76A 3QYTA 4F1UA 3TTKA 5AE4A 3EHSA 3TYHA 2GHBA 4F3GA 1IMCA 5ICTA 1FPBA 4PQJA 2NUVA 2F97A 3E4RA 3IFAA 1JEVA 4OVJA 5DVJA 4OVTA 4H0WA 2XWIA 4G68B 4EQ7A 1B3HA 5CRYA 3G3IA 2HFBA 2I58A 5ET8A 3SEVA 1M5CA 3K01A 4EXKA 1M5BA 2XXQA 5AA2D 1DCUA 3MQ9A 1IMFA 1B05A 5I59B 3TQWA 1UTHA 3ILTB 4C0RA 4N4UA 5KCJA 1OIBA 1VFEA 1IEJA 4RY1A 2X7PA 3H7MA 2F6GA 1XC1A 1HSJA 3KJTA 2F5XA 3T22A 1TT1A 4HE1A 2NOOA 4UA8A 1FBDA 4P8BA 3MW0A 4DCYA 1MXXA 4HCYA 4GXAA 5EYGA 4KI0E 5TP9B 4HE0A 4XFEA 4DXCA 5CMCA 2B4MA 2O68A 4U2RA 4PTKA 2CEXA 1AIVA 3FVGA 3RT8A 3PV0E 4P47A 4XXUA 1QUKA 4O3BA 3K1PA 1FPEA 4ZEDA 2OZZA 1NL5A 4MJOA 1J1NA 1Q9DA 4U1OA 2NXOA 4G68A 3OO9A 3U92A 4N8GA 4H45A 2FYIA 3IX1A 3HPIA 2QS4A 2XX7A 1FTAA 1QVSA 2ABHA 3QUJA 1JW1A 4F31B 5EYHA 4H67A 2O6AA 3RPLB 4OVSA 4EDPA 4QFNA 4X48A 4JDFA 4YB6A 4P1EA 3HSTA 2M8CA 3ILUB 5TPAA 1MH4A 1JW5A 2ANJA 2F6PA 5J1DA 1NV5A 2WEFA 3TZAA 1B58A 2DP8A 3MPKA 3KJ7A 1INPA 5K2XA 3EN3A 4JWYA 4JVCA 4H5GA 1Q1KA 2XXYA 4KPTA 4POWA 4QHQA 3H6UA 3MVXA 4PDDA 2W7YA 1ATGA 5TP9A 3N6UA 4NWCA 1YCJA 3K00A 5I2KB 1MXVA 4AQ4A 1SI0A 4I8CA 3O2AA 3FASA 3H6VA 1OQGA 1HSLA 3ODBA 3ZS6A 4R6HA 4RNSA 1UQWA 3UORA 3RN8A 3MZ9A 5FTHA 4I1DA 1K9ZA 2QFLA 2DYXA 1PDAA 3PD8A 3FJGA 4O8MA 2ZZXA 3C32A 3DELB 1GTKA 1TFDA 5FTIA 3T9XB 4I40A 1MQGA 1B2HA 2Y7IA 1A40A 2O1LA 3ZKKA 4F1YA 1A7LA 4ECFA 2D21A 2GH9A 4FORA 3M8UA 2V93A 2RC9A 2PFYA 4ZEFA 1FBPA 2UVGA 3V83A 3V5AA 3V8XB 4O7IA 4EXLA 1FPKA 4NX1A 4RJZA 2H25A 2OK2A 2Z23A 4F2OA 1FPJA 1D9VA 2V4CA 4PAKA 4OZ9A 3SDFA 4ISUA 2UYFA 1XVYA 3K2DA 5I3SA 1PBPA 2F3DA 1MDQA 1B1HA 2HHMA 3D4GA 3T93B 3HHGA 4MFIA 4WEDA 2Z8FA 1OLAA 4MNIA 3T9HB 1D9QA 1FQDA 1HSEA 4R74A 1EH3A 4EQBA 3FV1A 2PVUA 1NNTA 4JSDA 4OETA 4F2QA 2UVJA 2HAUA 1ZTYA 2AYSA 5HPQA 3FXQA 3LBSA 3A3CA 3MVZA 4JB7A 2FIXA 1ZKBA 3K1MA 4QRZA 1O64A 1F9BA 3Q29A 2FIEA 1UTBA 3IAZA 2Y7PA 4XF5A 4Z0IA 3MPLA 3OXNA 1GR2A 4NF5B 4GX6A 4MX6A 3PMWA 1H76A 2DWHA 3OSQA 2I3VA 4OFLA 3G3GA 3K6WA 5EQAA 2E1SA 1R9QA 2QSXA 5H8NB 1IMDA 1RDXA 3TELA 5AA4A 4GWZA 1Y4TA 1OLCA 5KDTB 1QKAA 1A55A 4WEPA 4QXDA 5IKBA 1O7TA 3SEYA 2LAOA 4E0WA 3RGYA 4PFUA 4NMYA 3CIJA 1M5FA 4NE4A 3TUSA 4PBQA 4M1VA 4PC9A 2XXXA 2Q2AA 2O84X 3EKIA 2DXYA 1KA1A 1MQHA 3RT6B 1FTMA 2XXIA 4L17A 1M5EA 4NF6A 2XXVA 5EHMA 3Q28A 5I84A 4X9TA 3VVFA 5TU0A 1LBVA 4GFRA 3TCHA 3ZKLA 4NF8A 4N17A 2VPOA 1POTA 2OWSA 3CR9A 3RTFB 1FBCA 4GX4A 1Y3PA 1VR5A 3IJXB 2G29A 1LAGE 3UIFA 2QVUA 5FHNA 1WDNA 4QFKA 3MUQA 3SETA 3BKIB 2GQ1A 3G3KA 1MQJA 4NF5A 1QUIA 2PYYA 3VLUA 3LUYA 1B5JA 4PFWA 4MLQA 4KYDA 4BDLA 3MSTA 4PGNA 5F24A 4FJPA 2CZHA 4Q0CA 3FATA 3U1OA 1YYZA 1FW0A 1D4NA 2A5TA 3TTNA 3EQ1A 1PB8A 2VPNA 4EF1A 2F78A 3R26A 5K2YA 1CB6A 2AL5A 4O94A 1CNQA 1MRPA 2DVZA 4U4XA 4P0IA 4GX3A 5I58A 1DBZA 4AS5A 1LLSA 5CC2A 4JXIA 3RNNA 3I6VA 2HXRA 2HZKA 4I62A 4U1ZA 3BBRA 1S50A 2H9BA 4LZ5A 4PETA 5CMBA 3HCQA 1NKXA 4IY5A 3C9HA 3RTWB 3O9PA 2O1MA 4IO3A 3DLNA 4JWXA 1NV2A 4LA9A 1VDWA 1TXFA 1B51A 1LBBA 1SD3A 1WODA 3IB0A 4IGTA 2D5WA 3IB1A 1NI9A 5T3JA 2ZZWA 1B5HA 1GGGA 1G0IA 1R6ZA 2QS2A 3K02A 5ET6A 5IM2A 2WYKA 1DTGA 2WKYA 5BUUA 2FVZA 4F19A 1IMEA 1CE2A 2B65A 4HCWA 1JEUA 4XKPA 4JBZA 3KBZA 1Y3QA 3FIRA 4G2ZA 1USYE 1UTHB 3R6UA 1AH5A 3RQTA 3MVWA 4QSCA 2QVVA 4F3SA 2ZNTA 3G3FA 5KCJB 3O6GA 2XX9A 1LCFA 3ONMA 3DM0A 1MS7A 4NTLA 3LC8A 1NUYA 5M2VA 1H3DA 2Y84A 3SESA 3P7IA 4OESA 3K6UA 1BIYA 4ELPA 3B6QA 2V3TA 4HTGA 5L9SA 1MPCA 3PMVA 4OANA 1A8EA 1LSTA 4ZEKA 2ZZVA 2I0BA 4F18A 4YMBA 2NVUB 4TOZA 4XTCQ 1YAEA 1BP5A 3B6TA 3G7WA 3VVDA 4GXSB 4ZEIA 3S4UA 2VOZA 1Y1ZA 2BJJX 3PPOA 2FNCA 3LV0A 3E9XA 3PPRA 1QUJA 1Y20A 5ICQA 3OO7A 1PB7A 1Z7NE 4ZZEA 1GVCA 2CMOA 1URGA 1P1QA 3PU5A 1MY2A 3TCFA 2WX9A 4R6YA 4IO6A 2CZKA 1P99A 3O6HA 3IB2A 4YB7A 2Z22A 1B1XA 4NGUA 4EQ9A 3PD9A 4H6DA 1FBFA 2DWJA 2ZXTA 1JVYA 4ESWA 2HQ0A 2AIXA 3Q25A 1MQIA 3TTRA 2RC7A 5TPAB 1TFAA 1I69A 5DEXB 3BIHA 4BDMA 3FXUA 3Q26A 4GWOA 2PT2A 4GWUA 3M3FA 2I48A 1EU8A 2R8TA 4R6KA 1NV1A 1B4ZA 4PAFA 4R2BA 5EQ9A 2H4IA 4NF4B 2E0SA 3VV5A 2RCAA 2A5SA 3FJMA 1O63A 3CI8A 2XXWA 1EZOA 4I3EA 4MCOA 4MNPA 4G61A 4YZZA 4PP0A 3TDJA 2VHAA 4YU0A 4ZDMA 1EYJA 2P3VA 4ZZAA 2L5VA 1FQAA 1DPEA 3PUZE 3H03A 4X8RA 4OQOA 2H5YA 2FA7A 4N6DA 2YJPA 4OVRA 4OEUA 4DXBA 4KCCA 5DVIA 1POY1 3G3JA 1PEBA 4F3PA 3MP8A 1XI6A 2I6EA 3MJNA 5IAIA 4NAPA 4Q30B 1SDXA 3USDA 2ZYNA 4YKIA 2X26A 3MBPA 4ZE9A 3FVNA 1A8FA 1LAXA 1JP4A 2Y5LA 4X04A 3IOTA 1LAFE 5FHOA 4PAIA 4XKNA 3FD3A 1AOVA 5DEXA 2DOJA 5DW8A 3TFLA 4YKJA 1LFGA 4JSOA 1FPGA 4ELRA 3PTYA 2V3UA 3JV9A 2DS9A 4DZ1A 3C34A 3VE1B 2QS3A 4NF4A 1LCTA 2VD2A 2XWOA 4H65A 1NV6A 1N3XA 2F3BA 2ESNA 2XXKA 1KA0A 4R75A 4RA1A 1P1UA 2GRVA 4IO4A 3S9MC 3FBPA 1H44A 2WBBA 2WBDA 5IGAA 4GOTA 4P9KA 3GXAA 4U4SA 4C1TA 4UACA 3FXBA 1FPDA 1NFTA 3A3UA 3B7DA 5I7IA 4XEQA 3A29A 1MQDA 1N7XA 4ZS9A 1UTBB 2F7CA 4I9DA 1Y4CA 3KN7A 4HS7A 4XKQA 4U23A 4NQ8A 1MXWA 4IY6A 4NWDA 2DE2A 3DP6A 1XT8A 1DK4A 2HZLA 5JTYA 4OFJA 1USYH 3T9UA 2XD3A 3QK6A 3IK6B 5H8QB 2REJA 5AA4B 5CMKA 1EYIA 3BIGA 1B6HA 4LVQA 4KFQA 4BDNA 3R7XA 1LEVA 3M3KA 4OTEA 3C36A 2P0SA 4OHNA 1B52A 4KQPA 4R72A 1M5DA 4TLMB 2CEYA 1AMFA 1QJMA 4F3BA 2XHDA 4DLDA 3UA8A 3RLFE 3D4CA 4DCXA 4LQ5A 1MG1A 4EF2A 1FQCA 5B70A 5BWJA 2KR0A 2XX8A 3KN3A 4NF6B 1US4A 4K3FA 3CFXA 2Q8MA 4N6PA 1DPPA 5HM4B 3U65A 3BFTA 1B3LA 1AWBA 1JNFA 3IR1A 3GLBA 4Q5TA 5J16A 4NF8B 2QRYA 1TWYA 1KWHA 3TMGA 2I0CA 4R9GA 2REGA 3MP6A 4BDRA 1RDYA 1N3WA 3IL1B 4DI3D 3KSJA 5LOMA 1ELJA 4GL8A 4YMAA 1B3EA 1XHYA 1NNFA 4OVPA 1QGXA 2P2AA 3AXFA 1SW4A 1FTKA 4PFTA 1WVJA 4P56A 5H8QA 4IO5A 5EQ7A 2F34A 1JETA 3I5OA 1IUDA 4YICA 1QW0A 3IFCA 4FEDA 3E13X 4HXVA 3GYYA 4ZE8A 4MBPA 3JZJA 1MXZA 2A5TB 1B46A 3O97A 1FQFA 3HO7A 2ZNUA 3H3GA 4PBHA 1FTLA 3NOHA 4OVQA 1YXIA 3T9VA 1SI1A 1DOTA 2B4LA 4RYAA 2DE4A 4BDOA 2Q9TA 4NN3A 3MZBA 4RK9A 4O3CA 4X1DA 5A5XB 1IXHA 5I58B 2I4CA 3T1BA 1FJ6A 3MP1A 4LP2B 3EHUA 3CVGA 3B8BA 1FPIA 2P1SA 2VGQA 2Y7KA 1A99A 1NH8A 1OQHA 4HE2A 4ESXA 1VE4A 2IA4A 1QULA 3KSXA 5AA2B 4MIJA 3O29A 3FZVA 4UABA 1IMAA 1NV4A 4N81A 1A54A 1XOCA 3UK4A 4XIGQ 1ZJLA 3HFUA 2THIA 3LSLA 4ELOA 1UIVA 1JW4A 3TPAA 5AA3A 3FVOA 4FECA 4GL0A 3VDFA 3U72A 4YB5A 3KG2A 2UXAA 2YPNA 2O7UA 2Q8JA 4LUBA 3ROJA 2DE3A 4F22A 1N7WA 1NH7A 4F1VA 3TCGA 2KLFA 2Z8DA 3IOWA 4GLIA 1JQFA 5H8FA 3QXMA 1YTVA 4YAHX 1NNKA 4PFRA 1NV0A 1D3KA 4KYEA 3K6VA 4KYSA 5A5XA 3LR1A 3TODA 1MM7A 1Y3NA 2RKMA 2QL3A 5LTCA 2BJIA 3K1NA 3TTLA 5I56A 5F7VA 1NMUA 3O66A 2DSFA 2JJKA 1SQYA 2QPQA 3QUFA 3FXRA 3OELA 4H1XA 2B3BA 4MNCA 4GRKA 3PGFA 5AA2A 5H8HA 1R1NA 1XS5A 3CFLA 5F1QA 2Q74A 4RXLA 2QS1A 4ZEBA 1IZ1A 3LSWA 2HAVA 1B40A 2OWTA 3K0VA 1B5IA 5B7DA 1S9TA 3EPEA 3RYDA 3KEIA 2Q88A 2O7IA 3QSLA 1RDZA 4LZ7A 3WAFA 2H98A 4P0GA 3KBRA 2R6GE 4PGPA 3K4UA 1OVBA 2DWAA 1FBHA 1L5TA 4O7MA 4HW8A 1FRPA 1MDP1 4GQOA 3IO6A 4GWSA 1FJ9A 2RF1A 4NHBA 4GWWA 3PMXA 2HXWA 5CMMA 4N6KA 4P3LA 1PC3A 3CFZA 5FBPA 3OEMA 2RC8A 3KC0A 2DVCA 2PBWA 3SERA 3FUZA 3SEWA 3E78A 1BTJA 3O6IA 4H5FA 3SEUA 4JVDA 3U93A 5L9OA 3RPWA 1IITA 3RY3A 4PDHA 2ZYMA 3THIA 4QFPA 1VSOA 4G4PA 1B4HA 2R71A 3DP4A 4LZ8A 4P1LA 1FTJA 3MZ1A 1LB8A 2V84A 4GWXA 1B7ZA 3U8QA 4LATA 3H4ZA 5ET7A 3T66A 3UN6A 2XXUA 3OSRA 1IQ7A 4GVOA 1FBGA 3QMFA 3T96B 1FQEA 3IOVA 4OERA 5EYFA 4ELQA 3OO8A 1PBQA 3M3LA 2HPGA 4OMBA 4OYVA 1T0KA 4WKMA 3VLVA 2VT5A 4H8JA 4ND9A 2Z8EA 4FATA 1LBZA 2G93A 4NG7A 5ITPA 3GBAA 5ITOA 4N13A 4OWDA 1YZ0A 1DSNA 4XKRA 3OOAA 2XXPA 2RINA 3FGSA 1FPFA 1MH3A 3N94A 4O3AA 4PFBA 2OCUA 2VP1A 5EHSA 3VXBA 4G68C 3D1RA 3CG1A 4FIMA 1B7UA 4LN5A 1BKAA 1SW2A 4LQ2A 4P11A 1MY3A 1B32A 1LBYA 1OMPA 2CZLA 4RPOA 1Z7ME 3TAJA 3JYRA 5HBCA 2F7AA 3S2VA 1FSAA 4PF8A 3K6XA 2B3FA 1YPNA 1Y9UA 3H6TA 2RCBA 4IO2A 3E3KA 3SKPA 5JTYB 3V89B 5CM6A 4YKPA 2ZNSA 1SW1A 3KC1A 1QKBA 4H8IA 4AS4A 3KN8A 2MKZA 4QSEA 2OX3A 5I59A 1EZPA 4G8HA 1Q35A 1ZBMA 3PUVE 1KZ8A 2F7BA 3MYUA 4F39A 1LAHE 4BDQA 1SW5A 2Y7WA 3DP8A 2DWIA 5ET5A 4MMPA 4E0XA 1Y1MA 1XVXA 2I3WA 3CG3A 5CBRA 5EQ8A 4AB6A 3IORA 4U22A 2F36A 3G3HA 4DXUA 3VLWA 1RKMA 3UGWA 5DVFA 3H06B 2PX1A 1ZU0A 3F11A 5DTBA 1UIUA 1I6QA 3GBBA 3LSXA 4PE5B 2AL4A 4MH5A 5I57B 3OENA 3C31A 1IXCA 3E79A 1MM6A 1MY4A 4YKKA 2QMWA 3KZGA 1DTZA 1D9YA 4RPNA 3BFUA 5L9MA 5JEIA 4DI4B 3A09A 4OEVA 3S9LC 3C33A 3TEPA 3CSGA 1LFIA 1G0HA 2WYPA 3TTMA 1FBEA 1NUXA 3HV1A 2F35A 5IZ1A 2H99A 3GZGA 2OLBA 1H43A 1B7HA 1URDA 2ONKE 4POXA 3RPLA 2CZIA 1B0HA 1EYKA 4I3YA 4G8NA 2QJEA 4EUOA 1NV7A 2D3IA 1B3GA 4G8MA 3PPPA 1AL3A 3I3VA 3SZPA 3TQLA 1NV3A 1VFDA 4GWYA 3VXCA 4MAGA 2KQZA 1FQBA 1LBCA 5KZTA 3FVKA 4N91A 2VD3A 5I2KA 4GIZA 4KHZE 3N5LA 1H45A 2GFEA 4RK2A 3N6TA 4C1UA 3S9EA 3FJ7A 1SYHA 3MAMA 1N04A 2DDKA 3RUMA 1EZ9A 4TLLB 4N8YA 5I57A 4GF8A 2HCAA 3KOTA 4THIA 4TQUQ 1RYOA 3HN0A 5L8DA 1OVTA 5FHMA 4FBPA 2PCRA 1MY1A 5DT6A 3MVYA 1FCKA 2ONSA 4G77A 3FV2A 1MPBA 3S9NC 2OWZA 3PPNA 4DDDA 2P3NA 5ELVA 1MXUA 1JVXA 4DIGA 2Y7RA 5IZ3B 4NEDA 3OMBA 5H8SA 1IXIA 2OJTA 2XD2A 3OO6A 2IEEA 2XWKA 3CSBA 1MPDA 3W9WA 4IGRA 4KXPA 1S7YA 4FAJA 3W9VA 1GV8A 5H8FB 2O69A 3MWBA 4ONYA 1URSA 2XXHA 5DYHA 5I56B 1NUWA 3MC2A 3HHFA 4KD5A 1K9YA 2Y5KA 1ZIUA 2I4BA 3B50A 2X7QA 3L6GA 3VFJA 2V3QA 5CBSA 4OENA 2QVRA 4PFIA 4PFYA 2QMXA 4QSDA 5I5PA 5H8HB 3OD7A 1MXYA 3SEXA 3PPQA 3IJOB 4ZECA 1B0LA 4WXJA 4KCDA 1DMBA 2HEUA 1B3FA 3EF7A 3CHGA 2UYEA 3PUXE 4R73A 4Q8RA 3QIMA 1PB9A 5LDZA 4PE3A 5IZ3A 3T0JA 4GBVA 5A5LA 3CRBA 1N0TA 4MF3A 5H8NA 3ISPA 1LBWA 2PT1A 4FE8A 1LGBC 5KDTA 3N26A 3PUWE 1P1NA 4LONB 2ZMBA 1SBPA 1NUZA 3EHTA 3KOSA 2PFZA 1NNPA 4DE8A 4IR8A 3LUZA 3UP9A 2FHYA 2UVIA 4X1BA 3B6WA 1SVXB 3ZSFA 4QBAA 4QF9A 2FBPA 2DQVA 1IXGA 2ONRA 3O28A 2PMSA 2Q2CA 4NF0A 4H46A 5CI5A 1ZLQA 1N84A 1LBXA 4MHFA 5I2NB 3IOUA 2I49A 1MY0A 3IO4A 1SYIA 4R9FA 4JVIA 3H6WA 1FTOA 1ANFA 1ZMGA 1US5A 2NWJA 4PF6A 3C4MA 2F8DA 2YLNA 4N07A 4GD5A 2Q89A 1B9JA 2XXTA 4IB2A 1II5A 3VVEA 4BLAA 4OFOA 3PUYE
chains in the Genus database with same CATH topology
2XXRA 4F29A 4AB5A 2V25A 5AA1A 4R2FA 3LSFB 2OBGA 4Z7EA 1LB9A 5ISUA 2DXRA 1P1WA 1I6BA 3KFMA 3OEKA 4QFOA 1LFHA 1RYXA 1R9LA 4MLVA 4M4GA 2O51A 1P1OA 5JK4A 3TKDA 2ALUA 4JWOA 3W15C 3C35A 4OXVA 4KR5A 4QFLA 3WAEA 3L6HA 3QAXA 2ZYOA 2UVHA 1BLFA 2ZYKA 1I6AA 3Q27A 3U94A 2GHAA 5I2NA 4U21A 4FEBA 3ECRA 3KGCA 1IIWA 2R9JA 4IO7A 1N76A 3QYTA 4F1UA 3TTKA 5AE4A 3EHSA 3TYHA 2GHBA 4F3GA 5ICTA 4PQJA 2NUVA 2F97A 3E4RA 1JEVA 4OVJA 5DVJA 4H0WA 4G68B 4EQ7A 1B3HA 5CRYA 3G3IA 2HFBA 2I58A 3SEVA 1M5CA 3K01A 4EXKA 1M5BA 2XXQA 5AA2D 3MQ9A 1B05A 5I59B 3TQWA 1UTHA 3ILTB 4C0RA 5KCJA 1OIBA 1VFEA 1IEJA 4RY1A 2X7PA 3H7MA 2F6GA 1XC1A 1HSJA 3KJTA 2F5XA 3T22A 1TT1A 2NOOA 4UA8A 3MW0A 4DCYA 1MXXA 4HCYA 4GXAA 4KI0E 5TP9B 4DXCA 5CMCA 2O68A 4U2RA 1AIVA 3FVGA 3RT8A 3PV0E 4XXUA 1QUKA 4O3BA 3K1PA 4ZEDA 2OZZA 1NL5A 1J1NA 4U1OA 2NXOA 4G68A 3OO9A 3U92A 2FYIA 3IX1A 3HPIA 2QS4A 2XX7A 1QVSA 2ABHA 3QUJA 1JW1A 4F31B 4H67A 2O6AA 4EDPA 4QFNA 4X48A 4JDFA 4YB6A 3HSTA 2M8CA 3ILUB 5TPAA 1MH4A 1JW5A 2ANJA 2F6PA 5J1DA 3TZAA 1B58A 2DP8A 3MPKA 3KJ7A 5K2XA 3EN3A 4JWYA 4H5GA 1Q1KA 2XXYA 4KPTA 4POWA 4QHQA 3H6UA 3MVXA 2W7YA 1ATGA 5TP9A 3N6UA 4NWCA 1YCJA 5I2KB 3K00A 1MXVA 4AQ4A 1SI0A 4I8CA 3O2AA 3FASA 3H6VA 1OQGA 1HSLA 3ODBA 3ZS6A 4R6HA 4RNSA 1UQWA 3UORA 3RN8A 3MZ9A 5FTHA 4I1DA 2DYXA 1PDAA 3PD8A 3FJGA 3C32A 3DELB 1GTKA 1TFDA 5FTIA 3T9XB 1MQGA 1B2HA 2Y7IA 1A40A 2O1LA 3ZKKA 4F1YA 1A7LA 4ECFA 2D21A 2GH9A 4FORA 3M8UA 2V93A 2RC9A 4ZEFA 2UVGA 3V83A 3V5AA 3V8XB 4EXLA 4RJZA 2H25A 2OK2A 2Z23A 4F2OA 1D9VA 4OZ9A 3SDFA 4ISUA 2UYFA 1XVYA 3K2DA 1PBPA 1MDQA 1B1HA 3D4GA 3T93B 3HHGA 4MFIA 4WEDA 2Z8FA 1OLAA 3T9HB 1FQDA 1HSEA 4R74A 1EH3A 4EQBA 3FV1A 2PVUA 1NNTA 4JSDA 4OETA 4F2QA 2UVJA 2HAUA 1ZTYA 2AYSA 5HPQA 3FXQA 3LBSA 3A3CA 3MVZA 4JB7A 1ZKBA 3K1MA 4QRZA 1O64A 1F9BA 3Q29A 1UTBA 3IAZA 2Y7PA 4Z0IA 3MPLA 3OXNA 1GR2A 4NF5B 3PMWA 1H76A 2DWHA 3OSQA 2I3VA 4OFLA 3G3GA 3K6WA 2E1SA 1R9QA 2QSXA 5H8NB 3TELA 5AA4A 1Y4TA 1OLCA 5KDTB 1QKAA 1A55A 4WEPA 5IKBA 1O7TA 3SEYA 2LAOA 4E0WA 3RGYA 4PFUA 4NMYA 3CIJA 1M5FA 4NE4A 3TUSA 4M1VA 2XXXA 2Q2AA 2O84X 2DXYA 1MQHA 3RT6B 1FTMA 2XXIA 4L17A 1M5EA 4NF6A 2XXVA 5EHMA 3Q28A 5I84A 4X9TA 3VVFA 5TU0A 4GFRA 3TCHA 3ZKLA 4NF8A 1POTA 2OWSA 3CR9A 3RTFB 1Y3PA 1VR5A 3IJXB 2G29A 1LAGE 3UIFA 5FHNA 1WDNA 4QFKA 3MUQA 3SETA 3BKIB 3G3KA 1MQJA 4NF5A 1QUIA 2PYYA 3VLUA 3LUYA 1B5JA 4PFWA 4MLQA 4KYDA 4BDLA 4FJPA 4Q0CA 3FATA 3U1OA 1FW0A 1D4NA 2A5TA 3TTNA 3EQ1A 1PB8A 4EF1A 2F78A 3R26A 5K2YA 1CB6A 2AL5A 1MRPA 2DVZA 4U4XA 4P0IA 5I58A 1LLSA 5CC2A 4JXIA 3RNNA 3I6VA 2HZKA 4I62A 4U1ZA 3BBRA 1S50A 2H9BA 4LZ5A 4PETA 5CMBA 3HCQA 1NKXA 4IY5A 3C9HA 3RTWB 3O9PA 2O1MA 4IO3A 3DLNA 4JWXA 4LA9A 1TXFA 1B51A 1LBBA 1SD3A 1WODA 3IB0A 4IGTA 2D5WA 3IB1A 1B5HA 1GGGA 1R6ZA 2QS2A 3K02A 1DTGA 2WKYA 5BUUA 4F19A 1CE2A 2B65A 4HCWA 1JEUA 4XKPA 4JBZA 1Y3QA 3FIRA 4G2ZA 1USYE 1UTHB 3R6UA 1AH5A 3RQTA 3MVWA 4QSCA 4F3SA 2ZNTA 3G3FA 5KCJB 3O6GA 2XX9A 1LCFA 3ONMA 3DM0A 1MS7A 4NTLA 3LC8A 5M2VA 1H3DA 2Y84A 3SESA 3P7IA 4OESA 3K6UA 1BIYA 4ELPA 3B6QA 2V3TA 4HTGA 5L9SA 1MPCA 3PMVA 1A8EA 1LSTA 4ZEKA 2I0BA 4F18A 4YMBA 2NVUB 4TOZA 4XTCQ 1YAEA 1BP5A 3B6TA 3G7WA 3VVDA 4GXSB 4ZEIA 3S4UA 2VOZA 1Y1ZA 2BJJX 3PPOA 2FNCA 3E9XA 3PPRA 1QUJA 1Y20A 5ICQA 3OO7A 1PB7A 1Z7NE 4ZZEA 1GVCA 2CMOA 1URGA 1P1QA 3PU5A 1MY2A 3TCFA 4R6YA 4IO6A 1P99A 3O6HA 3IB2A 4YB7A 2Z22A 1B1XA 4EQ9A 3PD9A 4H6DA 2DWJA 2ZXTA 1JVYA 4ESWA 2HQ0A 2AIXA 3Q25A 1MQIA 3TTRA 2RC7A 5TPAB 1TFAA 1I69A 5DEXB 4BDMA 3FXUA 3Q26A 4GWOA 2PT2A 3M3FA 2I48A 1EU8A 4R6KA 1B4ZA 4R2BA 2H4IA 4NF4B 2E0SA 3VV5A 2RCAA 2A5SA 3FJMA 1O63A 3CI8A 2XXWA 1EZOA 4YZZA 4PP0A 3TDJA 2VHAA 4YU0A 4ZDMA 4ZZAA 1FQAA 1DPEA 3PUZE 3H03A 4OQOA 2H5YA 2FA7A 2YJPA 4DXBA 4OEUA 4KCCA 5DVIA 1POY1 3G3JA 1PEBA 4F3PA 3MP8A 2I6EA 3MJNA 5IAIA 4Q30B 1SDXA 3USDA 2ZYNA 4YKIA 2X26A 3MBPA 4ZE9A 3FVNA 1A8FA 1LAXA 3IOTA 1LAFE 5FHOA 4XKNA 3FD3A 1AOVA 5DEXA 2DOJA 3TFLA 4YKJA 1LFGA 4JSOA 4ELRA 2V3UA 3JV9A 2DS9A 4DZ1A 3C34A 3VE1B 2QS3A 4NF4A 1LCTA 2VD2A 4H65A 1N3XA 2ESNA 4R75A 4RA1A 1P1UA 2GRVA 4IO4A 3S9MC 1H44A 4GOTA 3GXAA 4U4SA 4C1TA 4UACA 1NFTA 3A3UA 3B7DA 4ZS9A 1MQDA 1N7XA 1UTBB 2F7CA 4I9DA 1Y4CA 3KN7A 4HS7A 4XKQA 4U23A 1MXWA 4IY6A 4NWDA 2DE2A 3DP6A 1XT8A 2HZLA 5JTYA 4OFJA 1USYH 3T9UA 2XD3A 3QK6A 3IK6B 5H8QB 2REJA 5AA4B 5CMKA 1B6HA 4LVQA 4KFQA 4BDNA 3R7XA 3M3KA 4OTEA 3C36A 2P0SA 4OHNA 1B52A 4KQPA 4R72A 1M5DA 4TLMB 1AMFA 1QJMA 4F3BA 2XHDA 4DLDA 3UA8A 3RLFE 3D4CA 4DCXA 4LQ5A 1MG1A 4EF2A 1FQCA 5B70A 5BWJA 2XX8A 3KN3A 4NF6B 1US4A 4K3FA 3CFXA 4N6PA 1DPPA 5HM4B 3BFTA 1B3LA 1JNFA 3IR1A 3GLBA 4Q5TA 4NF8B 2QRYA 1TWYA 1KWHA 3TMGA 2I0CA 4R9GA 2REGA 3MP6A 4BDRA 1N3WA 3IL1B 3KSJA 5LOMA 1ELJA 4GL8A 4YMAA 1B3EA 1XHYA 1NNFA 2P2AA 3AXFA 1SW4A 1FTKA 4PFTA 1WVJA 5H8QA 4IO5A 2F34A 1JETA 3I5OA 1IUDA 4YICA 1QW0A 4FEDA 3E13X 4ZE8A 4MBPA 3JZJA 1MXZA 2A5TB 1B46A 3O97A 1FQFA 3HO7A 2ZNUA 3H3GA 1FTLA 3T9VA 1SI1A 1DOTA 4RYAA 2DE4A 4BDOA 2Q9TA 3MZBA 4RK9A 4O3CA 4X1DA 5A5XB 1IXHA 5I58B 2I4CA 3MP1A 4LP2B 3EHUA 3CVGA 2P1SA 2VGQA 2Y7KA 1A99A 1NH8A 1OQHA 4ESXA 1VE4A 2IA4A 1QULA 3KSXA 5AA2B 3O29A 3FZVA 1A54A 1XOCA 3UK4A 4XIGQ 1ZJLA 2THIA 3LSLA 4ELOA 1UIVA 1JW4A 3TPAA 5AA3A 3FVOA 4FECA 4GL0A 3VDFA 3U72A 4YB5A 3KG2A 2UXAA 2YPNA 2O7UA 2Q8JA 4LUBA 2DE3A 4F22A 1N7WA 1NH7A 4F1VA 3TCGA 2KLFA 2Z8DA 3IOWA 4GLIA 1JQFA 5H8FA 3QXMA 1YTVA 4YAHX 1NNKA 1D3KA 4KYEA 3K6VA 5A5XA 4KYSA 3LR1A 3TODA 1MM7A 1Y3NA 2RKMA 2QL3A 3K1NA 3TTLA 5I56A 5F7VA 1NMUA 3O66A 2DSFA 1SQYA 2QPQA 3QUFA 3FXRA 3OELA 4H1XA 2B3BA 4GRKA 3PGFA 5AA2A 5H8HA 1R1NA 1XS5A 3CFLA 5F1QA 4RXLA 2QS1A 4ZEBA 1IZ1A 3LSWA 2HAVA 1B40A 2OWTA 3K0VA 1B5IA 5B7DA 1S9TA 3EPEA 3KEIA 2Q88A 2O7IA 3QSLA 4LZ7A 3WAFA 2H98A 4P0GA 3KBRA 2R6GE 3K4UA 1OVBA 2DWAA 1L5TA 4HW8A 1MDP1 4GQOA 3IO6A 2RF1A 3PMXA 2HXWA 5CMMA 1PC3A 3CFZA 3OEMA 2RC8A 2DVCA 2PBWA 3SERA 3FUZA 3SEWA 1BTJA 3O6IA 4H5FA 3SEUA 3U93A 5L9OA 3RPWA 1IITA 3RY3A 2ZYMA 3THIA 4QFPA 1VSOA 4G4PA 1B4HA 2R71A 3DP4A 4LZ8A 1FTJA 3MZ1A 1LB8A 2V84A 1B7ZA 3U8QA 4LATA 3H4ZA 3UN6A 3T66A 2XXUA 3OSRA 1IQ7A 4GVOA 3T96B 1FQEA 3IOVA 4OERA 5EYFA 4ELQA 3OO8A 1PBQA 3M3LA 4OYVA 4OMBA 1T0KA 4WKMA 3VLVA 4H8JA 4ND9A 2Z8EA 4FATA 5ITPA 2G93A 3GBAA 5ITOA 4N13A 4OWDA 1DSNA 4XKRA 3OOAA 2XXPA 2RINA 3FGSA 1MH3A 3N94A 4O3AA 2OCUA 2VP1A 5EHSA 3VXBA 4G68C 3CG1A 4FIMA 1B7UA 1BKAA 1SW2A 4LQ2A 4P11A 1MY3A 1B32A 1OMPA 2CZLA 4RPOA 1Z7ME 3TAJA 3JYRA 5HBCA 2F7AA 3S2VA 3K6XA 2B3FA 1YPNA 1Y9UA 3H6TA 2RCBA 4IO2A 3E3KA 3SKPA 5JTYB 3V89B 5CM6A 4YKPA 2ZNSA 1SW1A 1QKBA 4H8IA 3KN8A 4QSEA 5I59A 1EZPA 4G8HA 1Q35A 1ZBMA 3PUVE 2F7BA 4F39A 1LAHE 4BDQA 1SW5A 2Y7WA 3DP8A 2DWIA 4E0XA 1Y1MA 1XVXA 2I3WA 3CG3A 5CBRA 4AB6A 3IORA 4U22A 2F36A 3G3HA 4DXUA 3VLWA 1RKMA 3UGWA 5DVFA 3H06B 2PX1A 1ZU0A 3F11A 5DTBA 1UIUA 1I6QA 3GBBA 3LSXA 4PE5B 2AL4A 4MH5A 5I57B 3OENA 3C31A 1IXCA 1MM6A 1MY4A 4YKKA 2QMWA 3KZGA 1DTZA 1D9YA 4RPNA 3BFUA 5L9MA 5JEIA 3A09A 4OEVA 3S9LC 3C33A 3TEPA 3CSGA 1LFIA 3TTMA 3HV1A 2F35A 2H99A 3GZGA 2OLBA 1H43A 1B7HA 1URDA 2ONKE 4POXA 1B0HA 4G8NA 2QJEA 4EUOA 2D3IA 1B3GA 4G8MA 3PPPA 1AL3A 3I3VA 3TQLA 1VFDA 3VXCA 1FQBA 1LBCA 5KZTA 3FVKA 2VD3A 5I2KA 4GIZA 4KHZE 3N5LA 1H45A 2GFEA 4RK2A 3N6TA 4C1UA 3S9EA 3FJ7A 1SYHA 3MAMA 1N04A 3RUMA 1EZ9A 4TLLB 5I57A 4GF8A 2HCAA 3KOTA 4THIA 4TQUQ 1RYOA 3HN0A 5L8DA 1OVTA 5FHMA 1MY1A 5DT6A 3MVYA 1FCKA 2ONSA 4G77A 3FV2A 1MPBA 3S9NC 3PPNA 4DDDA 5ELVA 1MXUA 1JVXA 4DIGA 2Y7RA 4NEDA 3OMBA 5H8SA 1IXIA 2OJTA 2XD2A 3OO6A 2IEEA 3CSBA 1MPDA 3W9WA 4IGRA 1S7YA 4FAJA 3W9VA 1GV8A 5H8FB 2O69A 3MWBA 4ONYA 1URSA 2XXHA 5DYHA 5I56B 3MC2A 3HHFA 4KD5A 1ZIUA 2I4BA 2X7QA 3L6GA 3VFJA 2V3QA 5CBSA 4OENA 4PFYA 2QMXA 4QSDA 5H8HB 3OD7A 1MXYA 3SEXA 3PPQA 3IJOB 4ZECA 1B0LA 4WXJA 4KCDA 1DMBA 2HEUA 1B3FA 3EF7A 2UYEA 3PUXE 4R73A 4Q8RA 3QIMA 1PB9A 3CRBA 1N0TA 4MF3A 5H8NA 2PT1A 4FE8A 1LGBC 5KDTA 3N26A 3PUWE 1P1NA 4LONB 2ZMBA 1SBPA 3EHTA 3KOSA 1NNPA 4DE8A 3UP9A 2UVIA 4X1BA 3B6WA 1SVXB 3ZSFA 4QF9A 2DQVA 1IXGA 2ONRA 3O28A 2PMSA 2Q2CA 5CI5A 1ZLQA 1N84A 5I2NB 3IOUA 2I49A 1MY0A 3IO4A 1SYIA 4R9FA 3H6WA 1FTOA 1ANFA 1ZMGA 1US5A 2NWJA 3C4MA 2F8DA 2YLNA 4N07A 4GD5A 2Q89A 1B9JA 2XXTA 4IB2A 1II5A 3VVEA 4BLAA 4OFOA 3PUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXR A;  4F29 A;  4AB5 A;  2V25 A;  5AA1 A;  4R2F A;  3LSF B;  2OBG A;  4Z7E A;  1LB9 A;  5ISU A;  2DXR A;  1P1W A;  1I6B A;  3KFM A;  3OEK A;  4QFO A;  1LFH A;  1RYX A;  1R9L A;  4MLV A;  4M4G A;  2O51 A;  1P1O A;  5JK4 A;  3TKD A;  2ALU A;  4JWO A;  3W15 C;  3C35 A;  4OXV A;  4KR5 A;  4QFL A;  3WAE A;  3L6H A;  3QAX A;  2ZYO A;  2UVH A;  1BLF A;  2ZYK A;  1I6A A;  3Q27 A;  3U94 A;  2GHA A;  5I2N A;  4U21 A;  4FEB A;  3ECR A;  3KGC A;  1IIW A;  2R9J A;  4IO7 A;  1N76 A;  3QYT A;  4F1U A;  3TTK A;  5AE4 A;  3EHS A;  3TYH A;  2GHB A;  4F3G A;  5ICT A;  4PQJ A;  2NUV A;  2F97 A;  3E4R A;  1JEV A;  4OVJ A;  5DVJ A;  4H0W A;  4G68 B;  4EQ7 A;  1B3H A;  5CRY A;  3G3I A;  2HFB A;  2I58 A;  3SEV A;  1M5C A;  3K01 A;  4EXK A;  1M5B A;  2XXQ A;  5AA2 D;  3MQ9 A;  1B05 A;  5I59 B;  3TQW A;  1UTH A;  3ILT B;  4C0R A;  5KCJ A;  1OIB A;  1VFE A;  1IEJ A;  4RY1 A;  2X7P A;  3H7M A;  2F6G A;  1XC1 A;  1HSJ A;  3KJT A;  2F5X A;  3T22 A;  1TT1 A;  2NOO A;  4UA8 A;  3MW0 A;  4DCY A;  1MXX A;  4HCY A;  4GXA A;  4KI0 E;  5TP9 B;  4DXC A;  5CMC A;  2O68 A;  4U2R A;  1AIV A;  3FVG A;  3RT8 A;  3PV0 E;  4XXU A;  1QUK A;  4O3B A;  3K1P A;  4ZED A;  2OZZ A;  1NL5 A;  1J1N A;  4U1O A;  2NXO A;  4G68 A;  3OO9 A;  3U92 A;  2FYI A;  3IX1 A;  3HPI A;  2QS4 A;  2XX7 A;  1QVS A;  2ABH A;  3QUJ A;  1JW1 A;  4F31 B;  4H67 A;  2O6A A;  4EDP A;  4QFN A;  4X48 A;  4JDF A;  4YB6 A;  3HST A;  2M8C A;  3ILU B;  5TPA A;  1MH4 A;  1JW5 A;  2ANJ A;  2F6P A;  5J1D A;  3TZA A;  1B58 A;  2DP8 A;  3MPK A;  3KJ7 A;  5K2X A;  3EN3 A;  4JWY A;  4H5G A;  1Q1K A;  2XXY A;  4KPT A;  4POW A;  4QHQ A;  3H6U A;  3MVX A;  2W7Y A;  1ATG A;  5TP9 A;  3N6U A;  4NWC A;  1YCJ A;  5I2K B;  3K00 A;  1MXV A;  4AQ4 A;  1SI0 A;  4I8C A;  3O2A A;  3FAS A;  3H6V A;  1OQG A;  1HSL A;  3ODB A;  3ZS6 A;  4R6H A;  4RNS A;  1UQW A;  3UOR A;  3RN8 A;  3MZ9 A;  5FTH A;  4I1D A;  2DYX A;  1PDA A;  3PD8 A;  3FJG A;  3C32 A;  3DEL B;  1GTK A;  1TFD A;  5FTI A;  3T9X B;  1MQG A;  1B2H A;  2Y7I A;  1A40 A;  2O1L A;  3ZKK A;  4F1Y A;  1A7L A;  4ECF A;  2D21 A;  2GH9 A;  4FOR A;  3M8U A;  2V93 A;  2RC9 A;  4ZEF A;  2UVG A;  3V83 A;  3V5A A;  3V8X B;  4EXL A;  4RJZ A;  2H25 A;  2OK2 A;  2Z23 A;  4F2O A;  1D9V A;  4OZ9 A;  3SDF A;  4ISU A;  2UYF A;  1XVY A;  3K2D A;  1PBP A;  1MDQ A;  1B1H A;  3D4G A;  3T93 B;  3HHG A;  4MFI A;  4WED A;  2Z8F A;  1OLA A;  3T9H B;  1FQD A;  1HSE A;  4R74 A;  1EH3 A;  4EQB A;  3FV1 A;  2PVU A;  1NNT A;  4JSD A;  4OET A;  4F2Q A;  2UVJ A;  2HAU A;  1ZTY A;  2AYS A;  5HPQ A;  3FXQ A;  3LBS A;  3A3C A;  3MVZ A;  4JB7 A;  1ZKB A;  3K1M A;  4QRZ A;  1O64 A;  1F9B A;  3Q29 A;  1UTB A;  3IAZ A;  2Y7P A;  4Z0I A;  3MPL A;  3OXN A;  1GR2 A;  4NF5 B;  3PMW A;  1H76 A;  2DWH A;  3OSQ A;  2I3V A;  4OFL A;  3G3G A;  3K6W A;  2E1S A;  1R9Q A;  2QSX A;  5H8N B;  3TEL A;  5AA4 A;  1Y4T A;  1OLC A;  5KDT B;  1QKA A;  1A55 A;  4WEP A;  5IKB A;  1O7T A;  3SEY A;  2LAO A;  4E0W A;  3RGY A;  4PFU A;  4NMY A;  3CIJ A;  1M5F A;  4NE4 A;  3TUS A;  4M1V A;  2XXX A;  2Q2A A;  2O84 X;  2DXY A;  1MQH A;  3RT6 B;  1FTM A;  2XXI A;  4L17 A;  1M5E A;  4NF6 A;  2XXV A;  5EHM A;  3Q28 A;  5I84 A;  4X9T A;  3VVF A;  5TU0 A;  4GFR A;  3TCH A;  3ZKL A;  4NF8 A;  1POT A;  2OWS A;  3CR9 A;  3RTF B;  1Y3P A;  1VR5 A;  3IJX B;  2G29 A;  1LAG E;  3UIF A;  5FHN A;  1WDN A;  4QFK A;  3MUQ A;  3SET A;  3BKI B;  3G3K A;  1MQJ A;  4NF5 A;  1QUI A;  2PYY A;  3VLU A;  3LUY A;  1B5J A;  4PFW A;  4MLQ A;  4KYD A;  4BDL A;  4FJP A;  4Q0C A;  3FAT A;  3U1O A;  1FW0 A;  1D4N A;  2A5T A;  3TTN A;  3EQ1 A;  1PB8 A;  4EF1 A;  2F78 A;  3R26 A;  5K2Y A;  1CB6 A;  2AL5 A;  1MRP A;  2DVZ A;  4U4X A;  4P0I A;  5I58 A;  1LLS A;  5CC2 A;  4JXI A;  3RNN A;  3I6V A;  2HZK A;  4I62 A;  4U1Z A;  3BBR A;  1S50 A;  2H9B A;  4LZ5 A;  4PET A;  5CMB A;  3HCQ A;  1NKX A;  4IY5 A;  3C9H A;  3RTW B;  3O9P A;  2O1M A;  4IO3 A;  3DLN A;  4JWX A;  4LA9 A;  1TXF A;  1B51 A;  1LBB A;  1SD3 A;  1WOD A;  3IB0 A;  4IGT A;  2D5W A;  3IB1 A;  1B5H A;  1GGG A;  1R6Z A;  2QS2 A;  3K02 A;  1DTG A;  2WKY A;  5BUU A;  4F19 A;  1CE2 A;  2B65 A;  4HCW A;  1JEU A;  4XKP A;  4JBZ A;  1Y3Q A;  3FIR A;  4G2Z A;  1USY E;  1UTH B;  3R6U A;  1AH5 A;  3RQT A;  3MVW A;  4QSC A;  4F3S A;  2ZNT A;  3G3F A;  5KCJ B;  3O6G A;  2XX9 A;  1LCF A;  3ONM A;  3DM0 A;  1MS7 A;  4NTL A;  3LC8 A;  5M2V A;  1H3D A;  2Y84 A;  3SES A;  3P7I A;  4OES A;  3K6U A;  1BIY A;  4ELP A;  3B6Q A;  2V3T A;  4HTG A;  5L9S A;  1MPC A;  3PMV A;  1A8E A;  1LST A;  4ZEK A;  2I0B A;  4F18 A;  4YMB A;  2NVU B;  4TOZ A;  4XTC Q;  1YAE A;  1BP5 A;  3B6T A;  3G7W A;  3VVD A;  4GXS B;  4ZEI A;  3S4U A;  2VOZ A;  1Y1Z A;  2BJJ X;  3PPO A;  2FNC A;  3E9X A;  3PPR A;  1QUJ A;  1Y20 A;  5ICQ A;  3OO7 A;  1PB7 A;  1Z7N E;  4ZZE A;  1GVC A;  2CMO A;  1URG A;  1P1Q A;  3PU5 A;  1MY2 A;  3TCF A;  4R6Y A;  4IO6 A;  1P99 A;  3O6H A;  3IB2 A;  4YB7 A;  2Z22 A;  1B1X A;  4EQ9 A;  3PD9 A;  4H6D A;  2DWJ A;  2ZXT A;  1JVY A;  4ESW A;  2HQ0 A;  2AIX A;  3Q25 A;  1MQI A;  3TTR A;  2RC7 A;  5TPA B;  1TFA A;  1I69 A;  5DEX B;  4BDM A;  3FXU A;  3Q26 A;  4GWO A;  2PT2 A;  3M3F A;  2I48 A;  1EU8 A;  4R6K A;  1B4Z A;  4R2B A;  2H4I A;  4NF4 B;  2E0S A;  3VV5 A;  2RCA A;  2A5S A;  3FJM A;  1O63 A;  3CI8 A;  2XXW A;  1EZO A;  4YZZ A;  4PP0 A;  3TDJ A;  2VHA A;  4YU0 A;  4ZDM A;  4ZZA A;  1FQA A;  1DPE A;  3PUZ E;  3H03 A;  4OQO A;  2H5Y A;  2FA7 A;  2YJP A;  4DXB A;  4OEU A;  4KCC A;  5DVI A;  1POY 1;  3G3J A;  1PEB A;  4F3P A;  3MP8 A;  2I6E A;  3MJN A;  5IAI A;  4Q30 B;  1SDX A;  3USD A;  2ZYN A;  4YKI A;  2X26 A;  3MBP A;  4ZE9 A;  3FVN A;  1A8F A;  1LAX A;  3IOT A;  1LAF E;  5FHO A;  4XKN A;  3FD3 A;  1AOV A;  5DEX A;  2DOJ A;  3TFL A;  4YKJ A;  1LFG A;  4JSO A;  4ELR A;  2V3U A;  3JV9 A;  2DS9 A;  4DZ1 A;  3C34 A;  3VE1 B;  2QS3 A;  4NF4 A;  1LCT A;  2VD2 A;  4H65 A;  1N3X A;  2ESN A;  4R75 A;  4RA1 A;  1P1U A;  2GRV A;  4IO4 A;  3S9M C;  1H44 A;  4GOT A;  3GXA A;  4U4S A;  4C1T A;  4UAC A;  1NFT A;  3A3U A;  3B7D A;  4ZS9 A;  1MQD A;  1N7X A;  1UTB B;  2F7C A;  4I9D A;  1Y4C A;  3KN7 A;  4HS7 A;  4XKQ A;  4U23 A;  1MXW A;  4IY6 A;  4NWD A;  2DE2 A;  3DP6 A;  1XT8 A;  2HZL A;  5JTY A;  4OFJ A;  1USY H;  3T9U A;  2XD3 A;  3QK6 A;  3IK6 B;  5H8Q B;  2REJ A;  5AA4 B;  5CMK A;  1B6H A;  4LVQ A;  4KFQ A;  4BDN A;  3R7X A;  3M3K A;  4OTE A;  3C36 A;  2P0S A;  4OHN A;  1B52 A;  4KQP A;  4R72 A;  1M5D A;  4TLM B;  1AMF A;  1QJM A;  4F3B A;  2XHD A;  4DLD A;  3UA8 A;  3RLF E;  3D4C A;  4DCX A;  4LQ5 A;  1MG1 A;  4EF2 A;  1FQC A;  5B70 A;  5BWJ A;  2XX8 A;  3KN3 A;  4NF6 B;  1US4 A;  4K3F A;  3CFX A;  4N6P A;  1DPP A;  5HM4 B;  3BFT A;  1B3L A;  1JNF A;  3IR1 A;  3GLB A;  4Q5T A;  4NF8 B;  2QRY A;  1TWY A;  1KWH A;  3TMG A;  2I0C A;  4R9G A;  2REG A;  3MP6 A;  4BDR A;  1N3W A;  3IL1 B;  3KSJ A;  5LOM A;  1ELJ A;  4GL8 A;  4YMA A;  1B3E A;  1XHY A;  1NNF A;  2P2A A;  3AXF A;  1SW4 A;  1FTK A;  4PFT A;  1WVJ A;  5H8Q A;  4IO5 A;  2F34 A;  1JET A;  3I5O A;  1IUD A;  4YIC A;  1QW0 A;  4FED A;  3E13 X;  4ZE8 A;  4MBP A;  3JZJ A;  1MXZ A;  2A5T B;  1B46 A;  3O97 A;  1FQF A;  3HO7 A;  2ZNU A;  3H3G A;  1FTL A;  3T9V A;  1SI1 A;  1DOT A;  4RYA A;  2DE4 A;  4BDO A;  2Q9T A;  3MZB A;  4RK9 A;  4O3C A;  4X1D A;  5A5X B;  1IXH A;  5I58 B;  2I4C A;  3MP1 A;  4LP2 B;  3EHU A;  3CVG A;  2P1S A;  2VGQ A;  2Y7K A;  1A99 A;  1NH8 A;  1OQH A;  4ESX A;  1VE4 A;  2IA4 A;  1QUL A;  3KSX A;  5AA2 B;  3O29 A;  3FZV A;  1A54 A;  1XOC A;  3UK4 A;  4XIG Q;  1ZJL A;  2THI A;  3LSL A;  4ELO A;  1UIV A;  1JW4 A;  3TPA A;  5AA3 A;  3FVO A;  4FEC A;  4GL0 A;  3VDF A;  3U72 A;  4YB5 A;  3KG2 A;  2UXA A;  2YPN A;  2O7U A;  2Q8J A;  4LUB A;  2DE3 A;  4F22 A;  1N7W A;  1NH7 A;  4F1V A;  3TCG A;  2KLF A;  2Z8D A;  3IOW A;  4GLI A;  1JQF A;  5H8F A;  3QXM A;  1YTV A;  4YAH X;  1NNK A;  1D3K A;  4KYE A;  3K6V A;  5A5X A;  4KYS A;  3LR1 A;  3TOD A;  1MM7 A;  1Y3N A;  2RKM A;  2QL3 A;  3K1N A;  3TTL A;  5I56 A;  5F7V A;  1NMU A;  3O66 A;  2DSF A;  1SQY A;  2QPQ A;  3QUF A;  3FXR A;  3OEL A;  4H1X A;  2B3B A;  4GRK A;  3PGF A;  5AA2 A;  5H8H A;  1R1N A;  1XS5 A;  3CFL A;  5F1Q A;  4RXL A;  2QS1 A;  4ZEB A;  1IZ1 A;  3LSW A;  2HAV A;  1B40 A;  2OWT A;  3K0V A;  1B5I A;  5B7D A;  1S9T A;  3EPE A;  3KEI A;  2Q88 A;  2O7I A;  3QSL A;  4LZ7 A;  3WAF A;  2H98 A;  4P0G A;  3KBR A;  2R6G E;  3K4U A;  1OVB A;  2DWA A;  1L5T A;  4HW8 A;  1MDP 1;  4GQO A;  3IO6 A;  2RF1 A;  3PMX A;  2HXW A;  5CMM A;  1PC3 A;  3CFZ A;  3OEM A;  2RC8 A;  2DVC A;  2PBW A;  3SER A;  3FUZ A;  3SEW A;  1BTJ A;  3O6I A;  4H5F A;  3SEU A;  3U93 A;  5L9O A;  3RPW A;  1IIT A;  3RY3 A;  2ZYM A;  3THI A;  4QFP A;  1VSO A;  4G4P A;  1B4H A;  2R71 A;  3DP4 A;  4LZ8 A;  1FTJ A;  3MZ1 A;  1LB8 A;  2V84 A;  1B7Z A;  3U8Q A;  4LAT A;  3H4Z A;  3UN6 A;  3T66 A;  2XXU A;  3OSR A;  1IQ7 A;  4GVO A;  3T96 B;  1FQE A;  3IOV A;  4OER A;  5EYF A;  4ELQ A;  3OO8 A;  1PBQ A;  3M3L A;  4OYV A;  4OMB A;  1T0K A;  4WKM A;  3VLV A;  4H8J A;  4ND9 A;  2Z8E A;  4FAT A;  5ITP A;  2G93 A;  3GBA A;  5ITO A;  4N13 A;  4OWD A;  1DSN A;  4XKR A;  3OOA A;  2XXP A;  2RIN A;  3FGS A;  1MH3 A;  3N94 A;  4O3A A;  2OCU A;  2VP1 A;  5EHS A;  3VXB A;  4G68 C;  3CG1 A;  4FIM A;  1B7U A;  1BKA A;  1SW2 A;  4LQ2 A;  4P11 A;  1MY3 A;  1B32 A;  1OMP A;  2CZL A;  4RPO A;  1Z7M E;  3TAJ A;  3JYR A;  5HBC A;  2F7A A;  3S2V A;  3K6X A;  2B3F A;  1YPN A;  1Y9U A;  3H6T A;  2RCB A;  4IO2 A;  3E3K A;  3SKP A;  5JTY B;  3V89 B;  5CM6 A;  4YKP A;  2ZNS A;  1SW1 A;  1QKB A;  4H8I A;  3KN8 A;  4QSE A;  5I59 A;  1EZP A;  4G8H A;  1Q35 A;  1ZBM A;  3PUV E;  2F7B A;  4F39 A;  1LAH E;  4BDQ A;  1SW5 A;  2Y7W A;  3DP8 A;  2DWI A;  4E0X A;  1Y1M A;  1XVX A;  2I3W A;  3CG3 A;  5CBR A;  4AB6 A;  3IOR A;  4U22 A;  2F36 A;  3G3H A;  4DXU A;  3VLW A;  1RKM A;  3UGW A;  5DVF A;  3H06 B;  2PX1 A;  1ZU0 A;  3F11 A;  5DTB A;  1UIU A;  1I6Q A;  3GBB A;  3LSX A;  4PE5 B;  2AL4 A;  4MH5 A;  5I57 B;  3OEN A;  3C31 A;  1IXC A;  1MM6 A;  1MY4 A;  4YKK A;  2QMW A;  3KZG A;  1DTZ A;  1D9Y A;  4RPN A;  3BFU A;  5L9M A;  5JEI A;  3A09 A;  4OEV A;  3S9L C;  3C33 A;  3TEP A;  3CSG A;  1LFI A;  3TTM A;  3HV1 A;  2F35 A;  2H99 A;  3GZG A;  2OLB A;  1H43 A;  1B7H A;  1URD A;  2ONK E;  4POX A;  1B0H A;  4G8N A;  2QJE A;  4EUO A;  2D3I A;  1B3G A;  4G8M A;  3PPP A;  1AL3 A;  3I3V A;  3TQL A;  1VFD A;  3VXC A;  1FQB A;  1LBC A;  5KZT A;  3FVK A;  2VD3 A;  5I2K A;  4GIZ A;  4KHZ E;  3N5L A;  1H45 A;  2GFE A;  4RK2 A;  3N6T A;  4C1U A;  3S9E A;  3FJ7 A;  1SYH A;  3MAM A;  1N04 A;  3RUM A;  1EZ9 A;  4TLL B;  5I57 A;  4GF8 A;  2HCA A;  3KOT A;  4THI A;  4TQU Q;  1RYO A;  3HN0 A;  5L8D A;  1OVT A;  5FHM A;  1MY1 A;  5DT6 A;  3MVY A;  1FCK A;  2ONS A;  4G77 A;  3FV2 A;  1MPB A;  3S9N C;  3PPN A;  4DDD A;  5ELV A;  1MXU A;  1JVX A;  4DIG A;  2Y7R A;  4NED A;  3OMB A;  5H8S A;  1IXI A;  2OJT A;  2XD2 A;  3OO6 A;  2IEE A;  3CSB A;  1MPD A;  3W9W A;  4IGR A;  1S7Y A;  4FAJ A;  3W9V A;  1GV8 A;  5H8F B;  2O69 A;  3MWB A;  4ONY A;  1URS A;  2XXH A;  5DYH A;  5I56 B;  3MC2 A;  3HHF A;  4KD5 A;  1ZIU A;  2I4B A;  2X7Q A;  3L6G A;  3VFJ A;  2V3Q A;  5CBS A;  4OEN A;  4PFY A;  2QMX A;  4QSD A;  5H8H B;  3OD7 A;  1MXY A;  3SEX A;  3PPQ A;  3IJO B;  4ZEC A;  1B0L A;  4WXJ A;  4KCD A;  1DMB A;  2HEU A;  1B3F A;  3EF7 A;  2UYE A;  3PUX E;  4R73 A;  4Q8R A;  3QIM A;  1PB9 A;  3CRB A;  1N0T A;  4MF3 A;  5H8N A;  2PT1 A;  4FE8 A;  1LGB C;  5KDT A;  3N26 A;  3PUW E;  1P1N A;  4LON B;  2ZMB A;  1SBP A;  3EHT A;  3KOS A;  1NNP A;  4DE8 A;  3UP9 A;  2UVI A;  4X1B A;  3B6W A;  1SVX B;  3ZSF A;  4QF9 A;  2DQV A;  1IXG A;  2ONR A;  3O28 A;  2PMS A;  2Q2C A;  5CI5 A;  1ZLQ A;  1N84 A;  5I2N B;  3IOU A;  2I49 A;  1MY0 A;  3IO4 A;  1SYI A;  4R9F A;  3H6W A;  1FTO A;  1ANF A;  1ZMG A;  1US5 A;  2NWJ A;  3C4M A;  2F8D A;  2YLN A;  4N07 A;  4GD5 A;  2Q89 A;  1B9J A;  2XXT A;  4IB2 A;  1II5 A;  3VVE A;  4BLA A;  4OFO A;  3PUY E; 
#chains in the Genus database with same CATH topology
 2XXR A;  4F29 A;  2XA5 A;  4AB5 A;  2V25 A;  5AA1 A;  4N15 A;  4R2F A;  1IMB A;  3LSF B;  2OBG A;  4Z7E A;  1LB9 A;  5ISU A;  2DXR A;  1P1W A;  1I6B A;  3KFM A;  3OEK A;  4QFO A;  1LFH A;  1RYX A;  1R9L A;  4MLV A;  4M4G A;  4MEV A;  5IZZ A;  2O51 A;  1P1O A;  5JK4 A;  3TKD A;  2ALU A;  4JWO A;  3W15 C;  3C35 A;  4OXV A;  4KR5 A;  4QFL A;  3WAE A;  4OA4 A;  3L6H A;  3QAX A;  2ZYO A;  2UVH A;  1BLF A;  4PCD A;  2ZYK A;  5ESY A;  1I6A A;  1FPL A;  3Q27 A;  3U94 A;  2GHA A;  1BK4 A;  5I2N A;  4U21 A;  4FEB A;  2XWV A;  3ECR A;  1SPI A;  3KGC A;  1IIW A;  2R9J A;  4GBW A;  4IO7 A;  1N76 A;  3QYT A;  4F1U A;  3TTK A;  5AE4 A;  3EHS A;  3TYH A;  2GHB A;  4F3G A;  1IMC A;  5ICT A;  1FPB A;  4PQJ A;  2NUV A;  2F97 A;  3E4R A;  3IFA A;  1JEV A;  4OVJ A;  5DVJ A;  4OVT A;  4H0W A;  2XWI A;  4G68 B;  4EQ7 A;  1B3H A;  5CRY A;  3G3I A;  2HFB A;  2I58 A;  5ET8 A;  3SEV A;  1M5C A;  3K01 A;  4EXK A;  1M5B A;  2XXQ A;  5AA2 D;  1DCU A;  3MQ9 A;  1IMF A;  1B05 A;  5I59 B;  3TQW A;  1UTH A;  3ILT B;  4C0R A;  4N4U A;  5KCJ A;  1OIB A;  1VFE A;  1IEJ A;  4RY1 A;  2X7P A;  3H7M A;  2F6G A;  1XC1 A;  1HSJ A;  3KJT A;  2F5X A;  3T22 A;  1TT1 A;  4HE1 A;  2NOO A;  4UA8 A;  1FBD A;  4P8B A;  3MW0 A;  4DCY A;  1MXX A;  4HCY A;  4GXA A;  5EYG A;  4KI0 E;  5TP9 B;  4HE0 A;  4XFE A;  4DXC A;  5CMC A;  2B4M A;  2O68 A;  4U2R A;  4PTK A;  2CEX A;  1AIV A;  3FVG A;  3RT8 A;  3PV0 E;  4P47 A;  4XXU A;  1QUK A;  4O3B A;  3K1P A;  1FPE A;  4ZED A;  2OZZ A;  1NL5 A;  4MJO A;  1J1N A;  1Q9D A;  4U1O A;  2NXO A;  4G68 A;  3OO9 A;  3U92 A;  4N8G A;  4H45 A;  2FYI A;  3IX1 A;  3HPI A;  2QS4 A;  2XX7 A;  1FTA A;  1QVS A;  2ABH A;  3QUJ A;  1JW1 A;  4F31 B;  5EYH A;  4H67 A;  2O6A A;  3RPL B;  4OVS A;  4EDP A;  4QFN A;  4X48 A;  4JDF A;  4YB6 A;  4P1E A;  3HST A;  2M8C A;  3ILU B;  5TPA A;  1MH4 A;  1JW5 A;  2ANJ A;  2F6P A;  5J1D A;  1NV5 A;  2WEF A;  3TZA A;  1B58 A;  2DP8 A;  3MPK A;  3KJ7 A;  1INP A;  5K2X A;  3EN3 A;  4JWY A;  4JVC A;  4H5G A;  1Q1K A;  2XXY A;  4KPT A;  4POW A;  4QHQ A;  3H6U A;  3MVX A;  4PDD A;  2W7Y A;  1ATG A;  5TP9 A;  3N6U A;  4NWC A;  1YCJ A;  3K00 A;  5I2K B;  1MXV A;  4AQ4 A;  1SI0 A;  4I8C A;  3O2A A;  3FAS A;  3H6V A;  1OQG A;  1HSL A;  3ODB A;  3ZS6 A;  4R6H A;  4RNS A;  1UQW A;  3UOR A;  3RN8 A;  3MZ9 A;  5FTH A;  4I1D A;  1K9Z A;  2QFL A;  2DYX A;  1PDA A;  3PD8 A;  3FJG A;  4O8M A;  2ZZX A;  3C32 A;  3DEL B;  1GTK A;  1TFD A;  5FTI A;  3T9X B;  4I40 A;  1MQG A;  1B2H A;  2Y7I A;  1A40 A;  2O1L A;  3ZKK A;  4F1Y A;  1A7L A;  4ECF A;  2D21 A;  2GH9 A;  4FOR A;  3M8U A;  2V93 A;  2RC9 A;  2PFY A;  4ZEF A;  1FBP A;  2UVG A;  3V83 A;  3V5A A;  3V8X B;  4O7I A;  4EXL A;  1FPK A;  4NX1 A;  4RJZ A;  2H25 A;  2OK2 A;  2Z23 A;  4F2O A;  1FPJ A;  1D9V A;  2V4C A;  4PAK A;  4OZ9 A;  3SDF A;  4ISU A;  2UYF A;  1XVY A;  3K2D A;  5I3S A;  1PBP A;  2F3D A;  1MDQ A;  1B1H A;  2HHM A;  3D4G A;  3T93 B;  3HHG A;  4MFI A;  4WED A;  2Z8F A;  1OLA A;  4MNI A;  3T9H B;  1D9Q A;  1FQD A;  1HSE A;  4R74 A;  1EH3 A;  4EQB A;  3FV1 A;  2PVU A;  1NNT A;  4JSD A;  4OET A;  4F2Q A;  2UVJ A;  2HAU A;  1ZTY A;  2AYS A;  5HPQ A;  3FXQ A;  3LBS A;  3A3C A;  3MVZ A;  4JB7 A;  2FIX A;  1ZKB A;  3K1M A;  4QRZ A;  1O64 A;  1F9B A;  3Q29 A;  2FIE A;  1UTB A;  3IAZ A;  2Y7P A;  4XF5 A;  4Z0I A;  3MPL A;  3OXN A;  1GR2 A;  4NF5 B;  4GX6 A;  4MX6 A;  3PMW A;  1H76 A;  2DWH A;  3OSQ A;  2I3V A;  4OFL A;  3G3G A;  3K6W A;  5EQA A;  2E1S A;  1R9Q A;  2QSX A;  5H8N B;  1IMD A;  1RDX A;  3TEL A;  5AA4 A;  4GWZ A;  1Y4T A;  1OLC A;  5KDT B;  1QKA A;  1A55 A;  4WEP A;  4QXD A;  5IKB A;  1O7T A;  3SEY A;  2LAO A;  4E0W A;  3RGY A;  4PFU A;  4NMY A;  3CIJ A;  1M5F A;  4NE4 A;  3TUS A;  4PBQ A;  4M1V A;  4PC9 A;  2XXX A;  2Q2A A;  2O84 X;  3EKI A;  2DXY A;  1KA1 A;  1MQH A;  3RT6 B;  1FTM A;  2XXI A;  4L17 A;  1M5E A;  4NF6 A;  2XXV A;  5EHM A;  3Q28 A;  5I84 A;  4X9T A;  3VVF A;  5TU0 A;  1LBV A;  4GFR A;  3TCH A;  3ZKL A;  4NF8 A;  4N17 A;  2VPO A;  1POT A;  2OWS A;  3CR9 A;  3RTF B;  1FBC A;  4GX4 A;  1Y3P A;  1VR5 A;  3IJX B;  2G29 A;  1LAG E;  3UIF A;  2QVU A;  5FHN A;  1WDN A;  4QFK A;  3MUQ A;  3SET A;  3BKI B;  2GQ1 A;  3G3K A;  1MQJ A;  4NF5 A;  1QUI A;  2PYY A;  3VLU A;  3LUY A;  1B5J A;  4PFW A;  4MLQ A;  4KYD A;  4BDL A;  3MST A;  4PGN A;  5F24 A;  4FJP A;  2CZH A;  4Q0C A;  3FAT A;  3U1O A;  1YYZ A;  1FW0 A;  1D4N A;  2A5T A;  3TTN A;  3EQ1 A;  1PB8 A;  2VPN A;  4EF1 A;  2F78 A;  3R26 A;  5K2Y A;  1CB6 A;  2AL5 A;  4O94 A;  1CNQ A;  1MRP A;  2DVZ A;  4U4X A;  4P0I A;  4GX3 A;  5I58 A;  1DBZ A;  4AS5 A;  1LLS A;  5CC2 A;  4JXI A;  3RNN A;  3I6V A;  2HXR A;  2HZK A;  4I62 A;  4U1Z A;  3BBR A;  1S50 A;  2H9B A;  4LZ5 A;  4PET A;  5CMB A;  3HCQ A;  1NKX A;  4IY5 A;  3C9H A;  3RTW B;  3O9P A;  2O1M A;  4IO3 A;  3DLN A;  4JWX A;  1NV2 A;  4LA9 A;  1VDW A;  1TXF A;  1B51 A;  1LBB A;  1SD3 A;  1WOD A;  3IB0 A;  4IGT A;  2D5W A;  3IB1 A;  1NI9 A;  5T3J A;  2ZZW A;  1B5H A;  1GGG A;  1G0I A;  1R6Z A;  2QS2 A;  3K02 A;  5ET6 A;  5IM2 A;  2WYK A;  1DTG A;  2WKY A;  5BUU A;  2FVZ A;  4F19 A;  1IME A;  1CE2 A;  2B65 A;  4HCW A;  1JEU A;  4XKP A;  4JBZ A;  3KBZ A;  1Y3Q A;  3FIR A;  4G2Z A;  1USY E;  1UTH B;  3R6U A;  1AH5 A;  3RQT A;  3MVW A;  4QSC A;  2QVV A;  4F3S A;  2ZNT A;  3G3F A;  5KCJ B;  3O6G A;  2XX9 A;  1LCF A;  3ONM A;  3DM0 A;  1MS7 A;  4NTL A;  3LC8 A;  1NUY A;  5M2V A;  1H3D A;  2Y84 A;  3SES A;  3P7I A;  4OES A;  3K6U A;  1BIY A;  4ELP A;  3B6Q A;  2V3T A;  4HTG A;  5L9S A;  1MPC A;  3PMV A;  4OAN A;  1A8E A;  1LST A;  4ZEK A;  2ZZV A;  2I0B A;  4F18 A;  4YMB A;  2NVU B;  4TOZ A;  4XTC Q;  1YAE A;  1BP5 A;  3B6T A;  3G7W A;  3VVD A;  4GXS B;  4ZEI A;  3S4U A;  2VOZ A;  1Y1Z A;  2BJJ X;  3PPO A;  2FNC A;  3LV0 A;  3E9X A;  3PPR A;  1QUJ A;  1Y20 A;  5ICQ A;  3OO7 A;  1PB7 A;  1Z7N E;  4ZZE A;  1GVC A;  2CMO A;  1URG A;  1P1Q A;  3PU5 A;  1MY2 A;  3TCF A;  2WX9 A;  4R6Y A;  4IO6 A;  2CZK A;  1P99 A;  3O6H A;  3IB2 A;  4YB7 A;  2Z22 A;  1B1X A;  4NGU A;  4EQ9 A;  3PD9 A;  4H6D A;  1FBF A;  2DWJ A;  2ZXT A;  1JVY A;  4ESW A;  2HQ0 A;  2AIX A;  3Q25 A;  1MQI A;  3TTR A;  2RC7 A;  5TPA B;  1TFA A;  1I69 A;  5DEX B;  3BIH A;  4BDM A;  3FXU A;  3Q26 A;  4GWO A;  2PT2 A;  4GWU A;  3M3F A;  2I48 A;  1EU8 A;  2R8T A;  4R6K A;  1NV1 A;  1B4Z A;  4PAF A;  4R2B A;  5EQ9 A;  2H4I A;  4NF4 B;  2E0S A;  3VV5 A;  2RCA A;  2A5S A;  3FJM A;  1O63 A;  3CI8 A;  2XXW A;  1EZO A;  4I3E A;  4MCO A;  4MNP A;  4G61 A;  4YZZ A;  4PP0 A;  3TDJ A;  2VHA A;  4YU0 A;  4ZDM A;  1EYJ A;  2P3V A;  4ZZA A;  2L5V A;  1FQA A;  1DPE A;  3PUZ E;  3H03 A;  4X8R A;  4OQO A;  2H5Y A;  2FA7 A;  4N6D A;  2YJP A;  4OVR A;  4OEU A;  4DXB A;  4KCC A;  5DVI A;  1POY 1;  3G3J A;  1PEB A;  4F3P A;  3MP8 A;  1XI6 A;  2I6E A;  3MJN A;  5IAI A;  4NAP A;  4Q30 B;  1SDX A;  3USD A;  2ZYN A;  4YKI A;  2X26 A;  3MBP A;  4ZE9 A;  3FVN A;  1A8F A;  1LAX A;  1JP4 A;  2Y5L A;  4X04 A;  3IOT A;  1LAF E;  5FHO A;  4PAI A;  4XKN A;  3FD3 A;  1AOV A;  5DEX A;  2DOJ A;  5DW8 A;  3TFL A;  4YKJ A;  1LFG A;  4JSO A;  1FPG A;  4ELR A;  3PTY A;  2V3U A;  3JV9 A;  2DS9 A;  4DZ1 A;  3C34 A;  3VE1 B;  2QS3 A;  4NF4 A;  1LCT A;  2VD2 A;  2XWO A;  4H65 A;  1NV6 A;  1N3X A;  2F3B A;  2ESN A;  2XXK A;  1KA0 A;  4R75 A;  4RA1 A;  1P1U A;  2GRV A;  4IO4 A;  3S9M C;  3FBP A;  1H44 A;  2WBB A;  2WBD A;  5IGA A;  4GOT A;  4P9K A;  3GXA A;  4U4S A;  4C1T A;  4UAC A;  3FXB A;  1FPD A;  1NFT A;  3A3U A;  3B7D A;  5I7I A;  4XEQ A;  3A29 A;  1MQD A;  1N7X A;  4ZS9 A;  1UTB B;  2F7C A;  4I9D A;  1Y4C A;  3KN7 A;  4HS7 A;  4XKQ A;  4U23 A;  4NQ8 A;  1MXW A;  4IY6 A;  4NWD A;  2DE2 A;  3DP6 A;  1XT8 A;  1DK4 A;  2HZL A;  5JTY A;  4OFJ A;  1USY H;  3T9U A;  2XD3 A;  3QK6 A;  3IK6 B;  5H8Q B;  2REJ A;  5AA4 B;  5CMK A;  1EYI A;  3BIG A;  1B6H A;  4LVQ A;  4KFQ A;  4BDN A;  3R7X A;  1LEV A;  3M3K A;  4OTE A;  3C36 A;  2P0S A;  4OHN A;  1B52 A;  4KQP A;  4R72 A;  1M5D A;  4TLM B;  2CEY A;  1AMF A;  1QJM A;  4F3B A;  2XHD A;  4DLD A;  3UA8 A;  3RLF E;  3D4C A;  4DCX A;  4LQ5 A;  1MG1 A;  4EF2 A;  1FQC A;  5B70 A;  5BWJ A;  2KR0 A;  2XX8 A;  3KN3 A;  4NF6 B;  1US4 A;  4K3F A;  3CFX A;  2Q8M A;  4N6P A;  1DPP A;  5HM4 B;  3U65 A;  3BFT A;  1B3L A;  1AWB A;  1JNF A;  3IR1 A;  3GLB A;  4Q5T A;  5J16 A;  4NF8 B;  2QRY A;  1TWY A;  1KWH A;  3TMG A;  2I0C A;  4R9G A;  2REG A;  3MP6 A;  4BDR A;  1RDY A;  1N3W A;  3IL1 B;  4DI3 D;  3KSJ A;  5LOM A;  1ELJ A;  4GL8 A;  4YMA A;  1B3E A;  1XHY A;  1NNF A;  4OVP A;  1QGX A;  2P2A A;  3AXF A;  1SW4 A;  1FTK A;  4PFT A;  1WVJ A;  4P56 A;  5H8Q A;  4IO5 A;  5EQ7 A;  2F34 A;  1JET A;  3I5O A;  1IUD A;  4YIC A;  1QW0 A;  3IFC A;  4FED A;  3E13 X;  4HXV A;  3GYY A;  4ZE8 A;  4MBP A;  3JZJ A;  1MXZ A;  2A5T B;  1B46 A;  3O97 A;  1FQF A;  3HO7 A;  2ZNU A;  3H3G A;  4PBH A;  1FTL A;  3NOH A;  4OVQ A;  1YXI A;  3T9V A;  1SI1 A;  1DOT A;  2B4L A;  4RYA A;  2DE4 A;  4BDO A;  2Q9T A;  4NN3 A;  3MZB A;  4RK9 A;  4O3C A;  4X1D A;  5A5X B;  1IXH A;  5I58 B;  2I4C A;  3T1B A;  1FJ6 A;  3MP1 A;  4LP2 B;  3EHU A;  3CVG A;  3B8B A;  1FPI A;  2P1S A;  2VGQ A;  2Y7K A;  1A99 A;  1NH8 A;  1OQH A;  4HE2 A;  4ESX A;  1VE4 A;  2IA4 A;  1QUL A;  3KSX A;  5AA2 B;  4MIJ A;  3O29 A;  3FZV A;  4UAB A;  1IMA A;  1NV4 A;  4N81 A;  1A54 A;  1XOC A;  3UK4 A;  4XIG Q;  1ZJL A;  3HFU A;  2THI A;  3LSL A;  4ELO A;  1UIV A;  1JW4 A;  3TPA A;  5AA3 A;  3FVO A;  4FEC A;  4GL0 A;  3VDF A;  3U72 A;  4YB5 A;  3KG2 A;  2UXA A;  2YPN A;  2O7U A;  2Q8J A;  4LUB A;  3ROJ A;  2DE3 A;  4F22 A;  1N7W A;  1NH7 A;  4F1V A;  3TCG A;  2KLF A;  2Z8D A;  3IOW A;  4GLI A;  1JQF A;  5H8F A;  3QXM A;  1YTV A;  4YAH X;  1NNK A;  4PFR A;  1NV0 A;  1D3K A;  4KYE A;  3K6V A;  4KYS A;  5A5X A;  3LR1 A;  3TOD A;  1MM7 A;  1Y3N A;  2RKM A;  2QL3 A;  5LTC A;  2BJI A;  3K1N A;  3TTL A;  5I56 A;  5F7V A;  1NMU A;  3O66 A;  2DSF A;  2JJK A;  1SQY A;  2QPQ A;  3QUF A;  3FXR A;  3OEL A;  4H1X A;  2B3B A;  4MNC A;  4GRK A;  3PGF A;  5AA2 A;  5H8H A;  1R1N A;  1XS5 A;  3CFL A;  5F1Q A;  2Q74 A;  4RXL A;  2QS1 A;  4ZEB A;  1IZ1 A;  3LSW A;  2HAV A;  1B40 A;  2OWT A;  3K0V A;  1B5I A;  5B7D A;  1S9T A;  3EPE A;  3RYD A;  3KEI A;  2Q88 A;  2O7I A;  3QSL A;  1RDZ A;  4LZ7 A;  3WAF A;  2H98 A;  4P0G A;  3KBR A;  2R6G E;  4PGP A;  3K4U A;  1OVB A;  2DWA A;  1FBH A;  1L5T A;  4O7M A;  4HW8 A;  1FRP A;  1MDP 1;  4GQO A;  3IO6 A;  4GWS A;  1FJ9 A;  2RF1 A;  4NHB A;  4GWW A;  3PMX A;  2HXW A;  5CMM A;  4N6K A;  4P3L A;  1PC3 A;  3CFZ A;  5FBP A;  3OEM A;  2RC8 A;  3KC0 A;  2DVC A;  2PBW A;  3SER A;  3FUZ A;  3SEW A;  3E78 A;  1BTJ A;  3O6I A;  4H5F A;  3SEU A;  4JVD A;  3U93 A;  5L9O A;  3RPW A;  1IIT A;  3RY3 A;  4PDH A;  2ZYM A;  3THI A;  4QFP A;  1VSO A;  4G4P A;  1B4H A;  2R71 A;  3DP4 A;  4LZ8 A;  4P1L A;  1FTJ A;  3MZ1 A;  1LB8 A;  2V84 A;  4GWX A;  1B7Z A;  3U8Q A;  4LAT A;  3H4Z A;  5ET7 A;  3T66 A;  3UN6 A;  2XXU A;  3OSR A;  1IQ7 A;  4GVO A;  1FBG A;  3QMF A;  3T96 B;  1FQE A;  3IOV A;  4OER A;  5EYF A;  4ELQ A;  3OO8 A;  1PBQ A;  3M3L A;  2HPG A;  4OMB A;  4OYV A;  1T0K A;  4WKM A;  3VLV A;  2VT5 A;  4H8J A;  4ND9 A;  2Z8E A;  4FAT A;  1LBZ A;  2G93 A;  4NG7 A;  5ITP A;  3GBA A;  5ITO A;  4N13 A;  4OWD A;  1YZ0 A;  1DSN A;  4XKR A;  3OOA A;  2XXP A;  2RIN A;  3FGS A;  1FPF A;  1MH3 A;  3N94 A;  4O3A A;  4PFB A;  2OCU A;  2VP1 A;  5EHS A;  3VXB A;  4G68 C;  3D1R A;  3CG1 A;  4FIM A;  1B7U A;  4LN5 A;  1BKA A;  1SW2 A;  4LQ2 A;  4P11 A;  1MY3 A;  1B32 A;  1LBY A;  1OMP A;  2CZL A;  4RPO A;  1Z7M E;  3TAJ A;  3JYR A;  5HBC A;  2F7A A;  3S2V A;  1FSA A;  4PF8 A;  3K6X A;  2B3F A;  1YPN A;  1Y9U A;  3H6T A;  2RCB A;  4IO2 A;  3E3K A;  3SKP A;  5JTY B;  3V89 B;  5CM6 A;  4YKP A;  2ZNS A;  1SW1 A;  3KC1 A;  1QKB A;  4H8I A;  4AS4 A;  3KN8 A;  2MKZ A;  4QSE A;  2OX3 A;  5I59 A;  1EZP A;  4G8H A;  1Q35 A;  1ZBM A;  3PUV E;  1KZ8 A;  2F7B A;  3MYU A;  4F39 A;  1LAH E;  4BDQ A;  1SW5 A;  2Y7W A;  3DP8 A;  2DWI A;  5ET5 A;  4MMP A;  4E0X A;  1Y1M A;  1XVX A;  2I3W A;  3CG3 A;  5CBR A;  5EQ8 A;  4AB6 A;  3IOR A;  4U22 A;  2F36 A;  3G3H A;  4DXU A;  3VLW A;  1RKM A;  3UGW A;  5DVF A;  3H06 B;  2PX1 A;  1ZU0 A;  3F11 A;  5DTB A;  1UIU A;  1I6Q A;  3GBB A;  3LSX A;  4PE5 B;  2AL4 A;  4MH5 A;  5I57 B;  3OEN A;  3C31 A;  1IXC A;  3E79 A;  1MM6 A;  1MY4 A;  4YKK A;  2QMW A;  3KZG A;  1DTZ A;  1D9Y A;  4RPN A;  3BFU A;  5L9M A;  5JEI A;  4DI4 B;  3A09 A;  4OEV A;  3S9L C;  3C33 A;  3TEP A;  3CSG A;  1LFI A;  1G0H A;  2WYP A;  3TTM A;  1FBE A;  1NUX A;  3HV1 A;  2F35 A;  5IZ1 A;  2H99 A;  3GZG A;  2OLB A;  1H43 A;  1B7H A;  1URD A;  2ONK E;  4POX A;  3RPL A;  2CZI A;  1B0H A;  1EYK A;  4I3Y A;  4G8N A;  2QJE A;  4EUO A;  1NV7 A;  2D3I A;  1B3G A;  4G8M A;  3PPP A;  1AL3 A;  3I3V A;  3SZP A;  3TQL A;  1NV3 A;  1VFD A;  4GWY A;  3VXC A;  4MAG A;  2KQZ A;  1FQB A;  1LBC A;  5KZT A;  3FVK A;  4N91 A;  2VD3 A;  5I2K A;  4GIZ A;  4KHZ E;  3N5L A;  1H45 A;  2GFE A;  4RK2 A;  3N6T A;  4C1U A;  3S9E A;  3FJ7 A;  1SYH A;  3MAM A;  1N04 A;  2DDK A;  3RUM A;  1EZ9 A;  4TLL B;  4N8Y A;  5I57 A;  4GF8 A;  2HCA A;  3KOT A;  4THI A;  4TQU Q;  1RYO A;  3HN0 A;  5L8D A;  1OVT A;  5FHM A;  4FBP A;  2PCR A;  1MY1 A;  5DT6 A;  3MVY A;  1FCK A;  2ONS A;  4G77 A;  3FV2 A;  1MPB A;  3S9N C;  2OWZ A;  3PPN A;  4DDD A;  2P3N A;  5ELV A;  1MXU A;  1JVX A;  4DIG A;  2Y7R A;  5IZ3 B;  4NED A;  3OMB A;  5H8S A;  1IXI A;  2OJT A;  2XD2 A;  3OO6 A;  2IEE A;  2XWK A;  3CSB A;  1MPD A;  3W9W A;  4IGR A;  4KXP A;  1S7Y A;  4FAJ A;  3W9V A;  1GV8 A;  5H8F B;  2O69 A;  3MWB A;  4ONY A;  1URS A;  2XXH A;  5DYH A;  5I56 B;  1NUW A;  3MC2 A;  3HHF A;  4KD5 A;  1K9Y A;  2Y5K A;  1ZIU A;  2I4B A;  3B50 A;  2X7Q A;  3L6G A;  3VFJ A;  2V3Q A;  5CBS A;  4OEN A;  2QVR A;  4PFI A;  4PFY A;  2QMX A;  4QSD A;  5I5P A;  5H8H B;  3OD7 A;  1MXY A;  3SEX A;  3PPQ A;  3IJO B;  4ZEC A;  1B0L A;  4WXJ A;  4KCD A;  1DMB A;  2HEU A;  1B3F A;  3EF7 A;  3CHG A;  2UYE A;  3PUX E;  4R73 A;  4Q8R A;  3QIM A;  1PB9 A;  5LDZ A;  4PE3 A;  5IZ3 A;  3T0J A;  4GBV A;  5A5L A;  3CRB A;  1N0T A;  4MF3 A;  5H8N A;  3ISP A;  1LBW A;  2PT1 A;  4FE8 A;  1LGB C;  5KDT A;  3N26 A;  3PUW E;  1P1N A;  4LON B;  2ZMB A;  1SBP A;  1NUZ A;  3EHT A;  3KOS A;  2PFZ A;  1NNP A;  4DE8 A;  4IR8 A;  3LUZ A;  3UP9 A;  2FHY A;  2UVI A;  4X1B A;  3B6W A;  1SVX B;  3ZSF A;  4QBA A;  4QF9 A;  2FBP A;  2DQV A;  1IXG A;  2ONR A;  3O28 A;  2PMS A;  2Q2C A;  4NF0 A;  4H46 A;  5CI5 A;  1ZLQ A;  1N84 A;  1LBX A;  4MHF A;  5I2N B;  3IOU A;  2I49 A;  1MY0 A;  3IO4 A;  1SYI A;  4R9F A;  4JVI A;  3H6W A;  1FTO A;  1ANF A;  1ZMG A;  1US5 A;  2NWJ A;  4PF6 A;  3C4M A;  2F8D A;  2YLN A;  4N07 A;  4GD5 A;  2Q89 A;  1B9J A;  2XXT A;  4IB2 A;  1II5 A;  3VVE A;  4BLA A;  4OFO A;  3PUY E; 
#chains in the Genus database with same CATH homology
 2XXR A;  4F29 A;  4AB5 A;  2V25 A;  5AA1 A;  4R2F A;  3LSF B;  2OBG A;  4Z7E A;  1LB9 A;  5ISU A;  2DXR A;  1P1W A;  1I6B A;  3KFM A;  3OEK A;  4QFO A;  1LFH A;  1RYX A;  1R9L A;  4MLV A;  4M4G A;  2O51 A;  1P1O A;  5JK4 A;  3TKD A;  2ALU A;  4JWO A;  3W15 C;  3C35 A;  4OXV A;  4KR5 A;  4QFL A;  3WAE A;  3L6H A;  3QAX A;  2ZYO A;  2UVH A;  1BLF A;  2ZYK A;  1I6A A;  3Q27 A;  3U94 A;  2GHA A;  5I2N A;  4U21 A;  4FEB A;  3ECR A;  3KGC A;  1IIW A;  2R9J A;  4IO7 A;  1N76 A;  3QYT A;  4F1U A;  3TTK A;  5AE4 A;  3EHS A;  3TYH A;  2GHB A;  4F3G A;  5ICT A;  4PQJ A;  2NUV A;  2F97 A;  3E4R A;  1JEV A;  4OVJ A;  5DVJ A;  4H0W A;  4G68 B;  4EQ7 A;  1B3H A;  5CRY A;  3G3I A;  2HFB A;  2I58 A;  3SEV A;  1M5C A;  3K01 A;  4EXK A;  1M5B A;  2XXQ A;  5AA2 D;  3MQ9 A;  1B05 A;  5I59 B;  3TQW A;  1UTH A;  3ILT B;  4C0R A;  5KCJ A;  1OIB A;  1VFE A;  1IEJ A;  4RY1 A;  2X7P A;  3H7M A;  2F6G A;  1XC1 A;  1HSJ A;  3KJT A;  2F5X A;  3T22 A;  1TT1 A;  2NOO A;  4UA8 A;  3MW0 A;  4DCY A;  1MXX A;  4HCY A;  4GXA A;  4KI0 E;  5TP9 B;  4DXC A;  5CMC A;  2O68 A;  4U2R A;  1AIV A;  3FVG A;  3RT8 A;  3PV0 E;  4XXU A;  1QUK A;  4O3B A;  3K1P A;  4ZED A;  2OZZ A;  1NL5 A;  1J1N A;  4U1O A;  2NXO A;  4G68 A;  3OO9 A;  3U92 A;  2FYI A;  3IX1 A;  3HPI A;  2QS4 A;  2XX7 A;  1QVS A;  2ABH A;  3QUJ A;  1JW1 A;  4F31 B;  4H67 A;  2O6A A;  4EDP A;  4QFN A;  4X48 A;  4JDF A;  4YB6 A;  3HST A;  2M8C A;  3ILU B;  5TPA A;  1MH4 A;  1JW5 A;  2ANJ A;  2F6P A;  5J1D A;  3TZA A;  1B58 A;  2DP8 A;  3MPK A;  3KJ7 A;  5K2X A;  3EN3 A;  4JWY A;  4H5G A;  1Q1K A;  2XXY A;  4KPT A;  4POW A;  4QHQ A;  3H6U A;  3MVX A;  2W7Y A;  1ATG A;  5TP9 A;  3N6U A;  4NWC A;  1YCJ A;  5I2K B;  3K00 A;  1MXV A;  4AQ4 A;  1SI0 A;  4I8C A;  3O2A A;  3FAS A;  3H6V A;  1OQG A;  1HSL A;  3ODB A;  3ZS6 A;  4R6H A;  4RNS A;  1UQW A;  3UOR A;  3RN8 A;  3MZ9 A;  5FTH A;  4I1D A;  2DYX A;  1PDA A;  3PD8 A;  3FJG A;  3C32 A;  3DEL B;  1GTK A;  1TFD A;  5FTI A;  3T9X B;  1MQG A;  1B2H A;  2Y7I A;  1A40 A;  2O1L A;  3ZKK A;  4F1Y A;  1A7L A;  4ECF A;  2D21 A;  2GH9 A;  4FOR A;  3M8U A;  2V93 A;  2RC9 A;  4ZEF A;  2UVG A;  3V83 A;  3V5A A;  3V8X B;  4EXL A;  4RJZ A;  2H25 A;  2OK2 A;  2Z23 A;  4F2O A;  1D9V A;  4OZ9 A;  3SDF A;  4ISU A;  2UYF A;  1XVY A;  3K2D A;  1PBP A;  1MDQ A;  1B1H A;  3D4G A;  3T93 B;  3HHG A;  4MFI A;  4WED A;  2Z8F A;  1OLA A;  3T9H B;  1FQD A;  1HSE A;  4R74 A;  1EH3 A;  4EQB A;  3FV1 A;  2PVU A;  1NNT A;  4JSD A;  4OET A;  4F2Q A;  2UVJ A;  2HAU A;  1ZTY A;  2AYS A;  5HPQ A;  3FXQ A;  3LBS A;  3A3C A;  3MVZ A;  4JB7 A;  1ZKB A;  3K1M A;  4QRZ A;  1O64 A;  1F9B A;  3Q29 A;  1UTB A;  3IAZ A;  2Y7P A;  4Z0I A;  3MPL A;  3OXN A;  1GR2 A;  4NF5 B;  3PMW A;  1H76 A;  2DWH A;  3OSQ A;  2I3V A;  4OFL A;  3G3G A;  3K6W A;  2E1S A;  1R9Q A;  2QSX A;  5H8N B;  3TEL A;  5AA4 A;  1Y4T A;  1OLC A;  5KDT B;  1QKA A;  1A55 A;  4WEP A;  5IKB A;  1O7T A;  3SEY A;  2LAO A;  4E0W A;  3RGY A;  4PFU A;  4NMY A;  3CIJ A;  1M5F A;  4NE4 A;  3TUS A;  4M1V A;  2XXX A;  2Q2A A;  2O84 X;  2DXY A;  1MQH A;  3RT6 B;  1FTM A;  2XXI A;  4L17 A;  1M5E A;  4NF6 A;  2XXV A;  5EHM A;  3Q28 A;  5I84 A;  4X9T A;  3VVF A;  5TU0 A;  4GFR A;  3TCH A;  3ZKL A;  4NF8 A;  1POT A;  2OWS A;  3CR9 A;  3RTF B;  1Y3P A;  1VR5 A;  3IJX B;  2G29 A;  1LAG E;  3UIF A;  5FHN A;  1WDN A;  4QFK A;  3MUQ A;  3SET A;  3BKI B;  3G3K A;  1MQJ A;  4NF5 A;  1QUI A;  2PYY A;  3VLU A;  3LUY A;  1B5J A;  4PFW A;  4MLQ A;  4KYD A;  4BDL A;  4FJP A;  4Q0C A;  3FAT A;  3U1O A;  1FW0 A;  1D4N A;  2A5T A;  3TTN A;  3EQ1 A;  1PB8 A;  4EF1 A;  2F78 A;  3R26 A;  5K2Y A;  1CB6 A;  2AL5 A;  1MRP A;  2DVZ A;  4U4X A;  4P0I A;  5I58 A;  1LLS A;  5CC2 A;  4JXI A;  3RNN A;  3I6V A;  2HZK A;  4I62 A;  4U1Z A;  3BBR A;  1S50 A;  2H9B A;  4LZ5 A;  4PET A;  5CMB A;  3HCQ A;  1NKX A;  4IY5 A;  3C9H A;  3RTW B;  3O9P A;  2O1M A;  4IO3 A;  3DLN A;  4JWX A;  4LA9 A;  1TXF A;  1B51 A;  1LBB A;  1SD3 A;  1WOD A;  3IB0 A;  4IGT A;  2D5W A;  3IB1 A;  1B5H A;  1GGG A;  1R6Z A;  2QS2 A;  3K02 A;  1DTG A;  2WKY A;  5BUU A;  4F19 A;  1CE2 A;  2B65 A;  4HCW A;  1JEU A;  4XKP A;  4JBZ A;  1Y3Q A;  3FIR A;  4G2Z A;  1USY E;  1UTH B;  3R6U A;  1AH5 A;  3RQT A;  3MVW A;  4QSC A;  4F3S A;  2ZNT A;  3G3F A;  5KCJ B;  3O6G A;  2XX9 A;  1LCF A;  3ONM A;  3DM0 A;  1MS7 A;  4NTL A;  3LC8 A;  5M2V A;  1H3D A;  2Y84 A;  3SES A;  3P7I A;  4OES A;  3K6U A;  1BIY A;  4ELP A;  3B6Q A;  2V3T A;  4HTG A;  5L9S A;  1MPC A;  3PMV A;  1A8E A;  1LST A;  4ZEK A;  2I0B A;  4F18 A;  4YMB A;  2NVU B;  4TOZ A;  4XTC Q;  1YAE A;  1BP5 A;  3B6T A;  3G7W A;  3VVD A;  4GXS B;  4ZEI A;  3S4U A;  2VOZ A;  1Y1Z A;  2BJJ X;  3PPO A;  2FNC A;  3E9X A;  3PPR A;  1QUJ A;  1Y20 A;  5ICQ A;  3OO7 A;  1PB7 A;  1Z7N E;  4ZZE A;  1GVC A;  2CMO A;  1URG A;  1P1Q A;  3PU5 A;  1MY2 A;  3TCF A;  4R6Y A;  4IO6 A;  1P99 A;  3O6H A;  3IB2 A;  4YB7 A;  2Z22 A;  1B1X A;  4EQ9 A;  3PD9 A;  4H6D A;  2DWJ A;  2ZXT A;  1JVY A;  4ESW A;  2HQ0 A;  2AIX A;  3Q25 A;  1MQI A;  3TTR A;  2RC7 A;  5TPA B;  1TFA A;  1I69 A;  5DEX B;  4BDM A;  3FXU A;  3Q26 A;  4GWO A;  2PT2 A;  3M3F A;  2I48 A;  1EU8 A;  4R6K A;  1B4Z A;  4R2B A;  2H4I A;  4NF4 B;  2E0S A;  3VV5 A;  2RCA A;  2A5S A;  3FJM A;  1O63 A;  3CI8 A;  2XXW A;  1EZO A;  4YZZ A;  4PP0 A;  3TDJ A;  2VHA A;  4YU0 A;  4ZDM A;  4ZZA A;  1FQA A;  1DPE A;  3PUZ E;  3H03 A;  4OQO A;  2H5Y A;  2FA7 A;  2YJP A;  4DXB A;  4OEU A;  4KCC A;  5DVI A;  1POY 1;  3G3J A;  1PEB A;  4F3P A;  3MP8 A;  2I6E A;  3MJN A;  5IAI A;  4Q30 B;  1SDX A;  3USD A;  2ZYN A;  4YKI A;  2X26 A;  3MBP A;  4ZE9 A;  3FVN A;  1A8F A;  1LAX A;  3IOT A;  1LAF E;  5FHO A;  4XKN A;  3FD3 A;  1AOV A;  5DEX A;  2DOJ A;  3TFL A;  4YKJ A;  1LFG A;  4JSO A;  4ELR A;  2V3U A;  3JV9 A;  2DS9 A;  4DZ1 A;  3C34 A;  3VE1 B;  2QS3 A;  4NF4 A;  1LCT A;  2VD2 A;  4H65 A;  1N3X A;  2ESN A;  4R75 A;  4RA1 A;  1P1U A;  2GRV A;  4IO4 A;  3S9M C;  1H44 A;  4GOT A;  3GXA A;  4U4S A;  4C1T A;  4UAC A;  1NFT A;  3A3U A;  3B7D A;  4ZS9 A;  1MQD A;  1N7X A;  1UTB B;  2F7C A;  4I9D A;  1Y4C A;  3KN7 A;  4HS7 A;  4XKQ A;  4U23 A;  1MXW A;  4IY6 A;  4NWD A;  2DE2 A;  3DP6 A;  1XT8 A;  2HZL A;  5JTY A;  4OFJ A;  1USY H;  3T9U A;  2XD3 A;  3QK6 A;  3IK6 B;  5H8Q B;  2REJ A;  5AA4 B;  5CMK A;  1B6H A;  4LVQ A;  4KFQ A;  4BDN A;  3R7X A;  3M3K A;  4OTE A;  3C36 A;  2P0S A;  4OHN A;  1B52 A;  4KQP A;  4R72 A;  1M5D A;  4TLM B;  1AMF A;  1QJM A;  4F3B A;  2XHD A;  4DLD A;  3UA8 A;  3RLF E;  3D4C A;  4DCX A;  4LQ5 A;  1MG1 A;  4EF2 A;  1FQC A;  5B70 A;  5BWJ A;  2XX8 A;  3KN3 A;  4NF6 B;  1US4 A;  4K3F A;  3CFX A;  4N6P A;  1DPP A;  5HM4 B;  3BFT A;  1B3L A;  1JNF A;  3IR1 A;  3GLB A;  4Q5T A;  4NF8 B;  2QRY A;  1TWY A;  1KWH A;  3TMG A;  2I0C A;  4R9G A;  2REG A;  3MP6 A;  4BDR A;  1N3W A;  3IL1 B;  3KSJ A;  5LOM A;  1ELJ A;  4GL8 A;  4YMA A;  1B3E A;  1XHY A;  1NNF A;  2P2A A;  3AXF A;  1SW4 A;  1FTK A;  4PFT A;  1WVJ A;  5H8Q A;  4IO5 A;  2F34 A;  1JET A;  3I5O A;  1IUD A;  4YIC A;  1QW0 A;  4FED A;  3E13 X;  4ZE8 A;  4MBP A;  3JZJ A;  1MXZ A;  2A5T B;  1B46 A;  3O97 A;  1FQF A;  3HO7 A;  2ZNU A;  3H3G A;  1FTL A;  3T9V A;  1SI1 A;  1DOT A;  4RYA A;  2DE4 A;  4BDO A;  2Q9T A;  3MZB A;  4RK9 A;  4O3C A;  4X1D A;  5A5X B;  1IXH A;  5I58 B;  2I4C A;  3MP1 A;  4LP2 B;  3EHU A;  3CVG A;  2P1S A;  2VGQ A;  2Y7K A;  1A99 A;  1NH8 A;  1OQH A;  4ESX A;  1VE4 A;  2IA4 A;  1QUL A;  3KSX A;  5AA2 B;  3O29 A;  3FZV A;  1A54 A;  1XOC A;  3UK4 A;  4XIG Q;  1ZJL A;  2THI A;  3LSL A;  4ELO A;  1UIV A;  1JW4 A;  3TPA A;  5AA3 A;  3FVO A;  4FEC A;  4GL0 A;  3VDF A;  3U72 A;  4YB5 A;  3KG2 A;  2UXA A;  2YPN A;  2O7U A;  2Q8J A;  4LUB A;  2DE3 A;  4F22 A;  1N7W A;  1NH7 A;  4F1V A;  3TCG A;  2KLF A;  2Z8D A;  3IOW A;  4GLI A;  1JQF A;  5H8F A;  3QXM A;  1YTV A;  4YAH X;  1NNK A;  1D3K A;  4KYE A;  3K6V A;  5A5X A;  4KYS A;  3LR1 A;  3TOD A;  1MM7 A;  1Y3N A;  2RKM A;  2QL3 A;  3K1N A;  3TTL A;  5I56 A;  5F7V A;  1NMU A;  3O66 A;  2DSF A;  1SQY A;  2QPQ A;  3QUF A;  3FXR A;  3OEL A;  4H1X A;  2B3B A;  4GRK A;  3PGF A;  5AA2 A;  5H8H A;  1R1N A;  1XS5 A;  3CFL A;  5F1Q A;  4RXL A;  2QS1 A;  4ZEB A;  1IZ1 A;  3LSW A;  2HAV A;  1B40 A;  2OWT A;  3K0V A;  1B5I A;  5B7D A;  1S9T A;  3EPE A;  3KEI A;  2Q88 A;  2O7I A;  3QSL A;  4LZ7 A;  3WAF A;  2H98 A;  4P0G A;  3KBR A;  2R6G E;  3K4U A;  1OVB A;  2DWA A;  1L5T A;  4HW8 A;  1MDP 1;  4GQO A;  3IO6 A;  2RF1 A;  3PMX A;  2HXW A;  5CMM A;  1PC3 A;  3CFZ A;  3OEM A;  2RC8 A;  2DVC A;  2PBW A;  3SER A;  3FUZ A;  3SEW A;  1BTJ A;  3O6I A;  4H5F A;  3SEU A;  3U93 A;  5L9O A;  3RPW A;  1IIT A;  3RY3 A;  2ZYM A;  3THI A;  4QFP A;  1VSO A;  4G4P A;  1B4H A;  2R71 A;  3DP4 A;  4LZ8 A;  1FTJ A;  3MZ1 A;  1LB8 A;  2V84 A;  1B7Z A;  3U8Q A;  4LAT A;  3H4Z A;  3UN6 A;  3T66 A;  2XXU A;  3OSR A;  1IQ7 A;  4GVO A;  3T96 B;  1FQE A;  3IOV A;  4OER A;  5EYF A;  4ELQ A;  3OO8 A;  1PBQ A;  3M3L A;  4OYV A;  4OMB A;  1T0K A;  4WKM A;  3VLV A;  4H8J A;  4ND9 A;  2Z8E A;  4FAT A;  5ITP A;  2G93 A;  3GBA A;  5ITO A;  4N13 A;  4OWD A;  1DSN A;  4XKR A;  3OOA A;  2XXP A;  2RIN A;  3FGS A;  1MH3 A;  3N94 A;  4O3A A;  2OCU A;  2VP1 A;  5EHS A;  3VXB A;  4G68 C;  3CG1 A;  4FIM A;  1B7U A;  1BKA A;  1SW2 A;  4LQ2 A;  4P11 A;  1MY3 A;  1B32 A;  1OMP A;  2CZL A;  4RPO A;  1Z7M E;  3TAJ A;  3JYR A;  5HBC A;  2F7A A;  3S2V A;  3K6X A;  2B3F A;  1YPN A;  1Y9U A;  3H6T A;  2RCB A;  4IO2 A;  3E3K A;  3SKP A;  5JTY B;  3V89 B;  5CM6 A;  4YKP A;  2ZNS A;  1SW1 A;  1QKB A;  4H8I A;  3KN8 A;  4QSE A;  5I59 A;  1EZP A;  4G8H A;  1Q35 A;  1ZBM A;  3PUV E;  2F7B A;  4F39 A;  1LAH E;  4BDQ A;  1SW5 A;  2Y7W A;  3DP8 A;  2DWI A;  4E0X A;  1Y1M A;  1XVX A;  2I3W A;  3CG3 A;  5CBR A;  4AB6 A;  3IOR A;  4U22 A;  2F36 A;  3G3H A;  4DXU A;  3VLW A;  1RKM A;  3UGW A;  5DVF A;  3H06 B;  2PX1 A;  1ZU0 A;  3F11 A;  5DTB A;  1UIU A;  1I6Q A;  3GBB A;  3LSX A;  4PE5 B;  2AL4 A;  4MH5 A;  5I57 B;  3OEN A;  3C31 A;  1IXC A;  1MM6 A;  1MY4 A;  4YKK A;  2QMW A;  3KZG A;  1DTZ A;  1D9Y A;  4RPN A;  3BFU A;  5L9M A;  5JEI A;  3A09 A;  4OEV A;  3S9L C;  3C33 A;  3TEP A;  3CSG A;  1LFI A;  3TTM A;  3HV1 A;  2F35 A;  2H99 A;  3GZG A;  2OLB A;  1H43 A;  1B7H A;  1URD A;  2ONK E;  4POX A;  1B0H A;  4G8N A;  2QJE A;  4EUO A;  2D3I A;  1B3G A;  4G8M A;  3PPP A;  1AL3 A;  3I3V A;  3TQL A;  1VFD A;  3VXC A;  1FQB A;  1LBC A;  5KZT A;  3FVK A;  2VD3 A;  5I2K A;  4GIZ A;  4KHZ E;  3N5L A;  1H45 A;  2GFE A;  4RK2 A;  3N6T A;  4C1U A;  3S9E A;  3FJ7 A;  1SYH A;  3MAM A;  1N04 A;  3RUM A;  1EZ9 A;  4TLL B;  5I57 A;  4GF8 A;  2HCA A;  3KOT A;  4THI A;  4TQU Q;  1RYO A;  3HN0 A;  5L8D A;  1OVT A;  5FHM A;  1MY1 A;  5DT6 A;  3MVY A;  1FCK A;  2ONS A;  4G77 A;  3FV2 A;  1MPB A;  3S9N C;  3PPN A;  4DDD A;  5ELV A;  1MXU A;  1JVX A;  4DIG A;  2Y7R A;  4NED A;  3OMB A;  5H8S A;  1IXI A;  2OJT A;  2XD2 A;  3OO6 A;  2IEE A;  3CSB A;  1MPD A;  3W9W A;  4IGR A;  1S7Y A;  4FAJ A;  3W9V A;  1GV8 A;  5H8F B;  2O69 A;  3MWB A;  4ONY A;  1URS A;  2XXH A;  5DYH A;  5I56 B;  3MC2 A;  3HHF A;  4KD5 A;  1ZIU A;  2I4B A;  2X7Q A;  3L6G A;  3VFJ A;  2V3Q A;  5CBS A;  4OEN A;  4PFY A;  2QMX A;  4QSD A;  5H8H B;  3OD7 A;  1MXY A;  3SEX A;  3PPQ A;  3IJO B;  4ZEC A;  1B0L A;  4WXJ A;  4KCD A;  1DMB A;  2HEU A;  1B3F A;  3EF7 A;  2UYE A;  3PUX E;  4R73 A;  4Q8R A;  3QIM A;  1PB9 A;  3CRB A;  1N0T A;  4MF3 A;  5H8N A;  2PT1 A;  4FE8 A;  1LGB C;  5KDT A;  3N26 A;  3PUW E;  1P1N A;  4LON B;  2ZMB A;  1SBP A;  3EHT A;  3KOS A;  1NNP A;  4DE8 A;  3UP9 A;  2UVI A;  4X1B A;  3B6W A;  1SVX B;  3ZSF A;  4QF9 A;  2DQV A;  1IXG A;  2ONR A;  3O28 A;  2PMS A;  2Q2C A;  5CI5 A;  1ZLQ A;  1N84 A;  5I2N B;  3IOU A;  2I49 A;  1MY0 A;  3IO4 A;  1SYI A;  4R9F A;  3H6W A;  1FTO A;  1ANF A;  1ZMG A;  1US5 A;  2NWJ A;  3C4M A;  2F8D A;  2YLN A;  4N07 A;  4GD5 A;  2Q89 A;  1B9J A;  2XXT A;  4IB2 A;  1II5 A;  3VVE A;  4BLA A;  4OFO A;  3PUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...