4R6ZA

Crystal structure of cng mimicking nak mutant, nak-etpp, cs+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
FQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 33
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r6zA00
5EC1C 5KUKA 1XL4A 5CBHA 2HJFC 3LUTB 1K4DC 4MVRA 4BW5A 3KG2A 5E1AC 2NLJC 4QE9A 3E8BA 1G4YB 3ABMC 2DYRC 2HVJC 3FB7C 2ZD9A 3T4DA 5KUMA 3E86A 2EIMC 2Q68A 2X6CA 3JYCA 3SPCA 3SYPA 4MVZA 3OR6C 4WFGA 3SYQA 2WLNA 2DYSC 4RUFA 4H33A 4MTOA 4MW3A 3SYCA 4DXWA 2AHYA 4LCUC 4XDKA 4F4LA 3K08A 3E8HA 4HYOA 4MW8A 5J9PC 3RVZA 3IGAC 3F5WC 4J9YB 3R65A 4LP8A 2W0FC 4PDVA 4PDMA 2WLMA 4GX2A 4MVQA 4R8CA 3WG7C 2Y69C 4JTDB 4PDLA 3T4ZA 4MVMA 5EBMC 2EILC 4MSWC 4KFMA 5CBGA 3SPJA 2KB1A 4MTGA 3VOUA 2A9HA 1V54C 2P7TC 2WLIB 4I9WA 2HG5C 3LDDA 3RVYA 2WLIA 4R7CA 1R3KC 3SYAA 2WLKA 1OCZC 1XL6A 4QNHB 5B1AC 4GX0A 4PA7A 3K0GA 1J95A 3TCUA 2YEVA 2Q67A 3AG1C 3RBZA 3E89A 4JTAB 4MVUA 4OXSA 3SPGA 3SPIA 4RAIA 3BEHA 2R9RB 1M57C 2X6AA 3E8FA 5CBFA 2EIJC 5EK0A 3K03A 2K1EA 3FB5C 3IFXA 2WLLB 4PA9A 4WFEA 4X8AA 4WFFA 3E83A 3ABLC 4P9OA 3UKMA 4X88A 1OCOC 2HFEC 2IH1C 4H37A 3OUSA 4LBEC 5EC2C 3UM7A 1V55C 3AG2C 4XDLA 3SJQC 2DWDC 1P7BA 1LNQA 4GX5A 2JK5C 3FB6C 2ITCC 3OR7C 1ORQC 2WLHA 3SYOA 2AHZA 4WFHA 3F7YC 2ZXWC 3RW0A 1BL8A 2A0LA 2BOCC 1R3JC 2ATKC 3ABKC 3ASNC 3HPLC 3ZJZA 2Q6AA 2A79B 3K0DA 3T2MA 3E8GA 4GX1A 5B3SC 4TWKA 2DWEC 1S5HC 1ZWIC 4R6ZA 5BZBA 3AG3C 2ITDC 2WLJA 4XDJA 4PA6A 1M56C 4MS2A 4RO2A 5IY5C 4PA3A 3SPHA 2QTOA 4PDRA 3K06A 4G27B 1K4CC 3STLC 2WLLA 4J9ZB 3PJSK 4ZBMA 3X2QC 1R3LC 1JVMA 4MTFA 1R3IC 1QLEC 3ASOC 4HZ3A 2IH3C 2QKSA 3K04A 4QE7A 3GB7C 5B1BC 1OCRC 3AG4C 3OUFA 4UUJC 5EBLC 4P2ZA 2OCCC 3LNMB 1OCCC 3FB8C 4P9PA 2H8PC 2X6BA 4X89A 5EBWC 3LDEA 4P30A 4PA4A 3T1CA 3TETA 1KKDA 4R50A 2Q69A 3OGCC 3LDCA 3STZC 4CBCA 2EINC 2HVKC 3F7VC 4JTCB 3EFFK 3ZRSA 4EKWA 4MVOA 2EIKC 2BOBC 4MVSA 4G28B 4RUEA
chains in the Genus database with same CATH superfamily
5KUKA 4BW5A 1Q3EA 2NLJC 1TUBB 3FD9A 5LYJA 1XHZA 3W7XA 2WLNA 5A9GA 1AI5A 3K08A 4TV9A 3L9DA 1GMGA 2WA4A 3FKSG 1PL0A 2YXYA 4PDMA 1WP7A 2KG7B 5LHIA 3ETEA 1IXBA 2R9IA 4LFAB 2EIMB 3N2GA 4FM0A 3LDDA 1R6NA 4O2BB 1O9GA 1JX9A 2F4VB 1AROP 4LFAO 4GX0A 2QWPB 1IBKO 3SPGA 2XTAA 4QGPA 3K03A 4I4TA 4DW1A 2IJIA 4WCEV 4X8AA 3E22B 1K8AW 4YJ2A 3CRQA 4DR4B 3G4SV 3CC2V 3OT7A 1H2SB 1N32O 1AR1B 3FB6C 1M5IA 4OX9O 3W7UA 3RWRD 2YI9A 3JCZA 3HPLC 3AK3A 2EX3A 1FFXA 1SERA 5JQGA 3CCUV 3OFNG 3OAAG 3JATA 4TSFG 3K9SA 2E76B 2ZT9B 1SQXH 1EN4A 5KMGA 2QDOA 4IHJB 3CS5A 2QM8A 4NXMB 3LNMB 1F51A 4PJ0Z 4X89A 4P30A 3OEEG 5EYPB 2Q69A 1I0HA 2PF4E 5B66Z 2XOKG 3J80N 4I0XB 2ZNJA 4FLUA 3C90A 4LC1A 4UXNA 1D5NA 3M99B 2YI8A 1TUBA 4UV8A 4X1YA 4DV7B 1IX9A 1I94B 5B5EZ 1N36B 4YY3B 2QE7G 2X0LA 4HYOA 4GKKO 4ICGA 1KMIZ 2UUBO 2CAZC 1HWYA 4B3SO 4YJ3A 1VMGA 3ETDA 3T4ZA 4KFMA 4ZI7B 4B7EA 4X20B 3BABA 2Y48A 2WLKA 1MMMA 4N23A 1IBKB 4IYHA 2ZQMA 1SETA 2UUAO 5KX5A 3E8FA 2P06A 1MA1A 4O4HA 1SZXA 1Y76A 2B1IA 5JVDB 3K5NA 2HP8A 2UU9O 1I94O 4PA9A 4DV7O 2JS3A 2AZ0A 1I08A 4B3TB 4H44B 4FLXA 2Q8VA 2EIJB 2F93B 3CCEV 5CA0B 1TAEA 4PI2A 1BGYH 4TV8A 1BL8A 3D3QA 1P7GA 2A79B 5LMNO 1S76D 4GKJO 1OCRB 5DN6G 3G6BA 4LF4B 1M56C 1U96A 1OZ0A 3WU2Z 1FFTB 4NXNO 3N27A 1R3LC 4DUYB 1FKAO 2F43G 5IJ9A 2QKSA 1UJWB 1H8HG 1ZSPA 3QG5A 3K9AA 4P2ZA 4DV6B 1CXZB 1PPJH 3RYIB 3JATB 1ZX3A 4JZ2A 1YCIA 3UQ8A 4MVOA 2BOBC 5F2VO 4JV5O 1GN3A 3G71V 4ZHQA 3OW2U 3WFVA 2HHHO 4B7KA 4DRXB 2ARHA 4X64O 2ZD9A 2OIEA 4JAUA 4TQFA 3BCCH 4NTYA 1VF5B 2DYSC 4WBNB 4MW3A 1VQNV 1PP9H 4LCUC 4F4LA 3ZHQA 2VQEO 5JH7A 2KSDA 2B9ZA 4MVMA 1SQGA 3K5OA 2QGNA 4AQYB 3JCUZ 2Y4UA 1VQ5V 1LR1A 3MHHC 4A5UB 1Q6IA 2XAHA 1G1XB 3CP1A 4JTAB 3JSLA 2B1GA 5FL7G 5KHHA 1CP9A 2PYJA 1YDXA 5LMNB 3EVKA 5L3CA 2KG7A 4DR7B 4JI8B 4H0LB 1SQBH 2EINB 2DWDC 3KCYA 4UCRA 1L0LH 3R66A 5LA6B 4JYBA 4B08A 3TGUH 2WSSG 3ASNC 4LFBO 2CTWA 2JGDB 3JD4A 3KKYA 2PTMA 4FVMA 2HHHB 2Q5ZA 2JGDA 1RPRA 4F6RA 1AI4A 4J9ZB 4LR3A 1XNQB 2CH7B 2ZXWB 5IY5B 1BS3A 4FPPA 3AG4C 1QU7A 3ZMSA 2YIBD 3Q4HB 2AW9A 2L6LA 3LDEA 4FFBB 3T1CA 4JYYA 1HNXO 1EM1A 4DR6B 4CBCA 2EINC 3TJTA 1BHAA 3CHXA 4NB5A 1AJQA 1UPGA 3UT5A 3RYFA 4K0KB 4YJ3B 3RGBA 1YHQV 3JAKA 1GM7A 1DLBA 2GDSA 1F23A 3A0RA 4O4IB 4TUYB 2VQFB 4U3JA 3RFRA 3CMAV 1I7FA 2Q7EA 3CSXA 3ICXA 2BTQB 4X1IA 1U97A 2CUGA 2DQ3A 1FAFA 1QVGU 1G6UA 4I9WA 1FFXB 5L3BA 3JARB 1VQ8V 1XL6A 5KA6A 4PV1B 4X62B 1JOYA 1MOFA 3UT5B 3AK2A 2HEPA 1XMQB 4MVUA 2QWRB 4X65B 1ZL8A 2X6AA 3DGEA 5EK0A 2K1EA 4WFEA 3TXSA 5KHIA 1N34B 2IJJA 1Y67A 1COWG 4X88A 5GONB 1GK9A 1SQVH 4KL1A 2Q7HA 5JCOA 4JI3B 3CCRV 4QIWF 4WFHA 4BIOA 3A2FA 4YY3O 5GW7A 2R72A 2A0LA 4DV3O 1AP6A 3ZJZA 3CJHA 3CD6V 2BCCH 5DEDA 3DXRA 4RO2A 4NVPA 1N34O 3SJBC 1D2DA 3K06A 2QM7A 4RQFA 3X2QC 3B8NA 1GM8A 4I50A 1ZLZA 2OTLV 1VQ7V 5D5QA 1GO3F 2QKCA 2XASA 1IBMO 4KHPB 5JJJB 2UXBB 1GN2A 4B3SB 1R1BA 2H94A 1S77D 1VQPV 3HKDA 1W2BU 4BR6A 2VRZA 1P4RA 1S72V 4LNUB 3B4SA 1WPBA 1Q7YW 4FM2A 3RT3C 3BRCA 2PY5A 1N4CA 4O2AB 2CTRA 4DR1O 5H9CA 1YTFD 3SYPA 4IIJB 1ENVA 2YXLA 2ZDIA 2ZIOA 1YITV 2YS8A 4Q6GA 4PDVA 5J2TB 4GX2A 4NXMO 2G38A 1NTMH 4X1KA 1GRJA 1XNRB 2WLIB 4PI0A 1JR9A 4KUMA 2FTKA 3RVYA 3NR7A 2RNBA 4NYKA 1DGSA 4JZGA 2D3OW 2ODMA 5JWPA 2QA4V 2Z0AA 1M57C 2EIJC 1US6A 4IL6Z 2UXDB 3H9VA 2HLDG 2UUCO 4CH3A 4JGSA 4WFFA 2QEXV 4PELA 3UM7A 1KQSU 4BWAA 2AHZA 2BSKA 3RW0A 3D8CA 3ABKC 2ADQB 3PN1A 4Z1VA 3P30A 3E8GA 5E79Z 4JASA 2CDYA 2PZSA 2ITDC 4MS2A 3ASOB 4CH4A 5BY1A 4TV8B 1NTZH 3JAMN 3OTFA 1K4CC 4I7ZB 1EFRG 3ABKB 3T1HO 4JI6O 5LXTA 2ZCEA 2LP7A 2ZINA 4BW9A 4UCTA 2LGQA 4N21A 1VARA 3FB8C 3W7SA 2H8PC 1KC8W 2JDIG 4PA4A 5D5PA 3UO3A 1BCCH 2XAQA 5J2TA 1IBMB 4JTCB 2UXXA 4J11A 4JI2O 1XMOO 4MVSA 2P4VA 4LF5O 3K5LA 3M7MX 3ZHRA 2ZNIA 1KBHA 4OPAA 1IBLO 5KHJA 2NR5A 3ZRWA 2Q73A 5FNVA 2XAFA 4LF7B 1VF6A 4RUFA 3G6EV 4MTOA 1QBZA 2GV9A 1QR9A 4OGQB 1OCZB 1PNLA 1XILA 5CN0A 3IGAC 1Y4MA 3JD0A 1BE3H 4ZIBA 1KU9A 1KUQA 1DF5A 5EBMC 2KB1A 4X1KB 4FZ0A 3AG3B 4GT1A 5LOVA 3ABUA 1MG1A 1H38A 3CCLV 1ZAUA 1P84F 1XI1A 4PA7A 5JH7B 4Q20A 1MABG 2DOSA 2LGWA 3EXAA 5LGUA 1OV9A 5IYZA 5CBFA 3CC7V 3L72H 3ZMZA 4NXNB 4JAAA 3JD1A 1LUVA 1Q90D 2LJ2A 3OUSA 1H2NA 1NS1A 4ASUG 4XDLA 5BMVA 2WLHA 5J2UA 3ZMUA 3G80A 1YIJV 4PD4F 1FJGB 2LW1A 3T2MA 1HNWB 2DN9A 3AG3C 4JV5B 4U7OA 3VQXA 1NU1H 3SPHA 3P3NA 2WLLA 1B3QA 1JCHA 1AILA 1AB3A 1L8DA 1DF4A 4D6TH 5B1BC 3F5TA 2UXNA 3HKBB 1DTOA 4UUJC 4WF9V 2LFSA 2CK3G 4P9PA 1JPXA 5EYPA 4DR6O 1TUEB 1BZKA 4DV0B 1YXBA 5ITZB 2OYQA 4WFBV 3F7VC 2YIBA 3JAWA 1V55B 2F23A 1XUQA 4F6EA 3FAVB 4UB6Z 1XNQO 1A32A 5JJNB 3LUTB 4MVRA 1J5EB 1FJGO 1BHBA 1JFFA 2PUSA 4LF7O 1IZ3A 2YDEA 4MVZA 4QJFB 3SYCA 5H5NA 3L70H 2AHYA 3CCSV 4B3TO 5B1BB 4CS3A 2ETNA 1WA8B 2F1MA 1V54B 3OMAB 4CS4A 1PD3A 1TGOA 2QKAA 3ZMTA 4O4JA 1V54C 4X20A 1Y74B 2P67A 4X9QA 4G2KA 4KHPO 5BMVB 3LSUA 1N8RW 5CMUA 2AXTZ 1H2LA 4FLZA 2ILMA 3JAKB 1Z5VA 2GBOA 3ASNB 1M90W 3IFXA 2WLLB 5LMUO 3QO8A 3SR2C 3AK1A 5KAFZ 2BTQA 5IE9A 1OCOB 1VQOV 1AI7A 3SYOA 4K8XA 2ZXWC 4J7KA 3KCXA 1R3JC 1XBLA 4FFKA 2PYLA 4JF3A 2PGGA 1S5HC 1F4NA 2AGAA 2M7WA 1NVPB 1QLNA 1RM1C 1JVMA 1K73W 2FYUH 1FYJA 4MTFA 2IH3C 3K04A 1WB7A 5LA6A 3ZMVA 2EILB 5KX5B 3K58A 2A06H 3OGCC 2YUAA 4KXRA 3ABMB 3OGIB 4DV6O 4JI6B 3T1HB 3ZHSA 1CPYA 3BA8A 4LFCB 1NH2D 1SA0B 2RDCA 2N74A 3OE7G 2P22C 1K34A 3AG1B 2XHBA 1ZUQA 3JALA 4YIOA 4FM1A 4DRXA 4K35A 4LF4O 4NKGB 3T4DA 2GTAA 2EIMC 3BA9A 3JYCA 4JI1O 3ETGA 3CCVV 2IW5A 4QPKA 1PM9A 2LW7A 4X1YB 2P90A 3IAYA 1H2MA 4BIUA 1IVSA 4PDLA 3LNNA 4JYAB 1AP5A 1DK1A 1IBLB 2EJ7A 1S0VA 1GAXA 3ZRVA 5BXZA 4I5SA 4JI4B 5B1AC 4JYCA 3ZRXA 3VQWA 2UXBO 3E89A 2FKXA 1NH2B 4YJ2B 3CRCA 1Q6HA 3MDSA 3BY6A 3ZHTA 4DUZO 3CMEV 4W4LA 4JI5B 4AILC 1Y74A 4FIPC 4EEQA 1IXMA 5H2FZ 4JI5O 2JK5C 4GKKB 1D5AA 1ZL8B 2PI4A 3F7YC 1XMOB 5LMUB 1NVPD 2JS5A 1RSOA 3CEIA 4IGGA 5IYZB 5AG2A 3CRAA 2QTOA 1VQ9V 4DW0A 1H8EG 3OTOB 1VQ6V 2JEXA 1FD9A 3BFRA 3ASOC 1QLEC 1K97A 3QTCA 1PL4A 1XQ8A 1YTFB 4LF6B 1JJ2U 2OTJV 1HR0B 5IJ0B 4O4LB 1M57B 1EZJA 3ZHUA 2CGNA 4EFBA 1YJNV 4IYIA 5JJEB 5C8YA 2R70A 1KKCA 4DV1O 3H1IH 1Q5OA 3N2GB 3K3WA 4UV9A 1HNWO 2H3OA 1CEZA 2EIKB 3RN4A 1L1FA 5GONA 3U0ZA 1HNZB 1S5JA 4J7JA 4K3AA 1KYOF 2JVDA 4JI7O 4MW8A 1Q82W 2Y0IA 3RVZA 3SDLA 4ZOLB 4J9YB 1VQLV 2W0FC 2V4DA 3HR0A 1VP7A 3WG7C 1XOUA 2CH7A 2IU3A 3VOUA 3FYEB 2A9HA 1SF9A 2MW2B 1R3KC 4DV1B 5KMGB 4LF9O 4Z2WA 5TISZ 1E1QG 2Q67A 2EZOA 1VIBA 3LSQA 1N0JA 4RAIA 2R9RB 4HAMA 5EZYA 4LF8O 5JCOC 1XEQA 2BSKB 1N33B 4HBNA 4LBEC 3ML0A 4JPRA 1X59A 2VS0A 2XNDG 4DV5O 2FB5A 3GWKC 2XAGA 4U3FH 2ATKC 3H1JH 1WPXA 4Z1MG 3C3TA 5B3SC 4DV3B 3DTUB 4LF5B 1I5XA 1VEWA 1K7DA 2M6YA 4ZBMA 2JJ2G 5LP6C 4LF6O 1ROPA 4QE7A 5LP6A 3GB7C 5LL6Y 1K3EA 2P6JA 3I55V 5GTIZ 4DV0O 2FMLA 3O65A 5K1PA 1XMQO 1VQ4V 4I4TB 1W0JG 4BAYA 3M8AA 5EC1C 1FXKB 1XL4A 2HJFC 1BQ0A 3B2EE 3KG2A 3JAWB 3QNEA 3D3IA 2ZM6B 4U3JB 2CE4A 3RYIA 2N04A 1I5YA 3H1KH 2WPDG 4X66O 4WFGA 2QJ1A 5J9PC 3E8HA 3WG7B 2WAMA 1F4MA 5BR8O 1AVMA 2ZIMA 4JTDB 1AI6A 4MSWC 1SA0A 1Z5WA 2E3CA 5FNVB 1TVKA 3ZCCA 2ZKOA 1VF7A 1J95A 3APOA 3SGIA 5KLVH 2DMXA 1HR0O 5EIBD 4DV2O 2Y0PA 2OCHA 2Q9LA 3K79A 3FB5C 3CJHB 1JMKC 1B06A 3RYHB 3UKMA 2F95B 3HKDB 3H1LH 3FX7A 2LQTA 4JI7B 5LHHA 3S3XA 3OR7C 4K0KO 1Y6XA 4O4LA 3G67A 1NR7A 5GTHZ 3AG4B 1RPOA 4LWSA 3L71H 4DV5B 4I50B 5IY5C 4PDRA 2F66C 3A0BZ 5H6RA 5LBQA 1KB9F 4HZ3A 3ZBHA 4DR7O 3EHBB 3RYCB 4UVAA 1YSCA 3ZIAG 5EBWC 5LGTA 2Y69B 1KKDA 5BR8B 2Q0AA 4YIPA 1PNMA 4TT3G 4EB6B 3APQA 2Y4TA 1SC5B 3B09A 3ZRSA 4LFBB 2QR4A 4DR2O 5EIBC 5KAIZ 2UUBB 1NZ6A 5E1AC 4QE9A 1G4YB 4DR1B 1R73A 4GCZA 3JALB 3CC4V 5KUMA 3K5MA 2XT9A 2YICA 3I5DA 3VQVA 1RM1B 1K92A 3OR6C 1JA8A 1SS3A 5CA1B 3L73H 3JARA 2RJZA 1GTOA 4WFAV 1HNZO 2EILC 1F7YA 4MTGA 3HKCB 4PHZA 5LOVB 2HG5C 5FPOA 4TUYA 3H01A 2ZR3A 3TCUA 2GUZA 4OXSA 3SPIA 2VQEB 2DQ0A 1NI8A 3T1YO 2YIAA 2ZE8A 4ZOLA 4I55A 3UCSC 1GKFA 1MZFA 2W0XA 3IJ4A 4HNAB 1OCOC 5L3EA 4JI0O 1Q6UA 3SJQC 5IWAB 5FPRA 2UUCB 5IT9N 4CS2A 2BOCC 4OX9B 1FXVA 3VQYA 3CYOA 2GTSA 4YHHO 4GX1A 1SZTA 2DWEC 4XDJA 3MD0A 1LUWA 1OHHG 4X65O 3PJSK 3QO5A 2A3QA 1QCEA 1YZBA 3CCQV 1HNXB 2RMKB 5CA3A 1OCRC 4U7NA 2YIDA 3ZRWB 1URFA 3STZC 4ZKIA 4FK5C 5IJ9B 4FMTA 2Z5UA 2HKOA 3J81N 1K4DC 5L3GA 1V9PA 2OCCB 2KQXA 3E8BA 4J10A 5C8YB 3JD2A 2VWJA 4FJCC 4RQEA 2WWWA 3AEIA 2Q0OC 4H33A 3O9OA 1N33O 3BPZA 4JI8O 1THZA 5LHGA 1QLEB 4JI3O 2WLMA 5IYBO 3J7AU 1IURA 1K33A 1NQTA 1MZEA 5B3SB 2ZR2A 3OTOO 2YSUB 2YXHA 2RQ6A 3SYAA 2A7WA 1KP3A 2L35A 4NTXA 3QO7A 1JFFB 2OIGA 3AG1C 3ETQA 2GUZB 2IM9A 3E2EA 4FLVA 2E5LO 3D36A 4AI8A 5IYCO 1GN4A 1HP8A 1N36O 4EB6A 4E2LA 2RN9A 4X1IB 4P9OA 3WB2A 3B8MA 3KZIZ 3AG2C 3DC5A 3K59A 4CH6A 1P7BA 1LNQA 4B3MO 4O4IA 4DUZB 5CB4B 2XAJA 2LO1A 4DR3B 2DE0X 2QWOB 2CTPA 4L87A 1M93A 5IDJA 1K9MW 5H6QA 4DK0A 2EZPA 2V1DA 3MHSC 3U11A 4X62O 4PA6A 4NTWA 4PA3A 4H13B 3OM3B 2X7RB 3H1HH 4GZRB 1E1RG 4KP4A 3QF7A 3OUFA 5EBLC 3CXHF 4I9QA 5ITZA 3TETA 5LYJB 2VWKA 3ABLB 2K9PA 1QNMA 1SQFA 3LDCA 4LNUA 3EFFK 1NBMG 3JASB 2ZM6O 3U10A 1AJPA 3ABTA 2QTSA 5IWAO 1Q81W 2IBZH 1Y66A 2HVJC 3FB7C 2N05A 2NN4A 4OPHA 3ZX6A 2QM4A 1FXKA 1KP2A 3UO2A 3T1YB 4L8JA 3F5WC 1RSOB 4LP8A 1TVKB 4MT8A 3SPJA 2LFRA 2P7TC 2UUAB 3ZEDA 5HFMA 1GN6A 1XNRO 5CB4A 3K0GA 4AHCA 1W59A 2UXCB 1PKXA 1AR5A 2GHYA 5CA1A 4BIZA 5JQGB 4AQYO 1WAZA 2QWQB 1JJOA 2Q4PA 4H37A 5EC2C 3WB1A 2YEVB 3P32A 2OWOA 4YHHB 5L3DA 4D7TA 1E79G 2EULA 4LF8B 3TK1A 1T5EA 3N2KB 1MNGA 1IDSA 1JQ0A 1QHTA 2JGUA 3CXCU 2WLJA 4MTXA 4ZHQB 3Q4HA 3SJCC 3OMNB 4I0XA 1PNKA 1WP8A 3HKEA 1OCCC 1R6TA 2ZE6A 4YXWG 5K1XA 3RYHA 4WBNA 3GVMA 4R50A 4CH5A 2HVKC 3JD3A 5B1AB 2E74B 5LP6B 4G28B 4UCOA 2CTQA 4TQDA 5CBHA 3CRMA 3ABMC 2Z3YA 4DYLA 5LGNA 2YC0A 3E86A 5L3FA 3SPCA 1XDCA 4F6RB 3X2QB 1K5SA 4DXWA 1SKVA 3CE2A 1YI2V 2MK3A 2JEUA 2Q7GA 4JAVA 3THOA 4GYCB 4MVQA 4DO2A 4J41A 4CC6A 4GLXA 5CBGA 4K8ZA 2QWNB 4O4HB 1WN7A 4R7CA 1W0KG 3C3SA 2E5LB 3A0HZ 4TV9B 1RP3B 4D7SA 1S5LZ 3RBZA 4GKJB 5A2QN 1B6QA 4UCSA 1Q86W 1G8MA 2O57A 4FFBA 3CCJV 4HNAA 1SRYA 2OT5A 2IU0A 1Q43A 3BVOA 4B3MB 1SQQH 1YVWA 2JJ1G 3ABLC 3E83A 4JYAO 2IH1C 2EBOA 3L74H 4FLTA 5LXTB 4GX5A 2W6IG 4DR4O 4CC5A 4JI2B 1J5EO 5IJ0A 3DC6A 2PI5A 2DW4A 1NTKH 4GUNA 4RWUA 1WA8A 5KHKA 1R3IC 2UXCO 3DXRB 1S3JA 2OCCC 3E22A 2XUMA 3DSQA 2ADPA 1M56B 4E4EA 4JI4O 3LSSA 5KA5A 1P49A 1FPOA 4XBFA 2EIKC 3WB0A 1O9HA 3JSNA 2C2AA 4O4JB 1GM9A 3RYCA 4DR5O 1RFYA 2DYRC 2VQFO 1R6KA 4X64B 2Q68A 2X6CA 1NJIW 2HR3A 3SYQA 3P3PA 3SJAC 1EN5A 5FLXN 2ZE7A 4IHJA 3ZS8C 3D36C 2BE3A 3FAVA 1TA8A 4DV4B 3B77A 1BSMA 4QNHB 2NNUA 1EZVH 1H2GA 1MSWD 4FLYA 5JVDA 4UCVA 4UVCA 3BEHA 2JRIA 2DYRB 1VQKV 1N0NA 3W7TA 1WB8A 1M9NA 2DJVA 4IIJA 3CCMV 4LH7A 4DR3O 1V55C 3GWOA 1BT8A 5EZYB 3ZN0A 4DR5B 4QPJA 2ITCC 1FXKC 1EN6A 1X4TA 2UXDO 4DK1A 1VF6C 4J80A 2RCVA 3K0DA 4ZI7A 4NR1A 1Z2GA 4TWKA 1ZWIC 4FZ1A 1NR1A 1AJNA 4B3RO 1YF2A 1XREA 2KKWA 5C93A 3TXQA 4EFEA 1AR4A 3IC9A 3HKEB 1SQPH 4C7UA 1WNSA 3HKCA 2B5UA 1Y76B 2P5OA 4ABMA 4J42A 2JIZG 4TOIA 2DYSB 4UCUA 1QR8A 1FS0G 1B04A 4I55B 1M4UA 1YEWA 2EJRA 1KD1W 3I56V 1VQMV 4DR2B 2D2CB 1UFIA 3VBBA 4UB8Z 1SESA 3NXSA 3E35A 2WA3A 2UU9B 5KHGA 4XDKA 1M1KW 2E75B 3R65A 4JI1B 4R8CA 1EBOA 2Y69C 2P4KA 3CX5F 1BQZA 4O2BA 2BTOA 3N2KA 3MAQA 2WLIA 1K5QA 1WLEA 4LH6A 1NT2B 1OJHA 3ZHVA 1OCZC 4UFZA 5DM6V 3K57A 1PV0A 2GSMB 2IJKA 4LF9B 4DV2B 2YEVA 3AG7A 2AZ2A 1Q8IA 4DV4O 3B40A 3AG2B 4B3RB 3ZN1A 4DUYO 3IC7A 5J2UB 5B1OA 5IYDO 3S3WA 3OD4A 4O2AA 2HFEC 1QVFU 3L75H 3CWBH 3OMIB 3OEHG 2QSAA 1H2KA 3BAAA 1ORQC 4JI0B 1YJWV 5HFLA 3RYFB 4LFCO 4X66B 1OCCB 2Q6AA 2V7QG 3CRRA 1GH6A 1FXHA 2IJHA 3HKBA 4R6ZA 5BZBA 1YJ9V 1HDJA 2R9AA 1N32B 4G27B 3STLC 5DECA 3BHPA 4FLWA 5CA0A 4CZZA 4LWSB 4IT5A 1L0NH 1WJZA 2ZE5A 5B1NA 3A8TA 3FYIB 3HB3B 3CB2A 2HJDA 2X6BA 2ZDIC 3CPWU 1BMFG 2W6JG 1XHXA 3JASA 2CGOA 1NKDA 4J7ZA 1QQCA 3W7WA 1ZTEA 3QVNA 1MSDA 3FFQA 1KECA 1HW7A 4EKWA 4W4KA 2FL4A 2F4VO 4UVBA 4RUEA
chains in the Genus database with same CATH topology
3ABTA 5KUKA 3K3WA 4UV9A 1CEZA 4BW5A 2EIKB 1Q81W 2NLJC 1L1FA 1Y66A 2HVJC 3FB7C 5H9CA 1YTFD 3SYPA 1FXKA 1KP2A 3W7XA 2WLNA 1AI5A 1ENVA 3K08A 4MW8A 1Q82W 2ZDIA 3RVZA 1GMGA 3F5WC 3FKSG 4J9YB 1YITV 1PL0A 2W0FC 4LP8A 4PDMA 4PDVA 1VQLV 4GX2A 3WG7C 5LHIA 2IU3A 3ETEA 4MT8A 2R9IA 3SPJA 3VOUA 2EIMB 3FYEB 2A9HA 2LFRA 2P7TC 2WLIB 3LDDA 3RVYA 4KUMA 2FTKA 1R6NA 1R3KC 1JX9A 5HFMA 1AROP 4GX0A 3K0GA 1E1QG 2Q67A 2D3OW 1PKXA 2EZOA 3LSQA 3SPGA 2QA4V 4RAIA 2R9RB 1M57C 4HAMA 2GHYA 2EIJC 3K03A 4BIZA 2HLDG 2IJIA 4WCEV 4X8AA 4JGSA 4WFFA 1K8AW 2QEXV 4PELA 4H37A 4LBEC 5EC2C 3UM7A 1KQSU 3ML0A 2YEVB 3P32A 4JPRA 3G4SV 3CC2V 5L3DA 1E79G 1AR1B 3FB6C 2XNDG 3W7UA 2AHZA 3TK1A 3RW0A 3JCZA 2XAGA 3ABKC 2ATKC 3HPLC 1WPXA 4Z1MG 3P30A 1SERA 3E8GA 5B3SC 1JQ0A 3CCUV 3OFNG 4JASA 3OAAG 3CXCU 3DTUB 2ITDC 2WLJA 1I5XA 4MS2A 3ASOB 4MTXA 4TSFG 1K7DA 1K4CC 1EFRG 3OMNB 3ABKB 4ZBMA 2JJ2G 1ROPA 4QE7A 1PNKA 2LP7A 3GB7C 1K3EA 2QM8A 2P6JA 3I55V 4N21A 3LNMB 1OCCC 3FB8C 3W7SA 4YXWG 2H8PC 1F51A 4X89A 1KC8W 4P30A 2JDIG 3OEEG 4PA4A 4R50A 2Q69A 1VQ4V 2HVKC 3JD3A 5B1AB 2XAQA 1W0JG 4JTCB 2UXXA 2XOKG 4BAYA 4MVSA 4G28B 5EC1C 1FXKB 1XL4A 4LC1A 5CBHA 2HJFC 4UXNA 3KG2A 3M99B 3ABMC 2Z3YA 5LGNA 3QNEA 3D3IA 3ZRWA 4UV8A 3E86A 1I5YA 2XAFA 5L3FA 2WPDG 3SPCA 3X2QB 1K5SA 4WFGA 4RUFA 4DXWA 3G6EV 4MTOA 1QBZA 1QR9A 2QE7G 2X0LA 1OCZB 1PNLA 3E8HA 4HYOA 2WAMA 3WG7B 2MK3A 5J9PC 1F4MA 5CN0A 1YI2V 3IGAC 2JEUA 1Y4MA 1HWYA 3JD0A 4JAVA 4MVQA 4DO2A 4JTDB 1DF5A 3ETDA 3T4ZA 5EBMC 1AI6A 4MSWC 4KFMA 5CBGA 2KB1A 3AG3B 4GT1A 3ZCCA 3ABUA 1MG1A 4R7CA 1W0KG 3CCLV 2Y48A 1H38A 2WLKA 4N23A 4PA7A 4Q20A 1J95A 1MABG 2ZQMA 3RBZA 1SETA 1B6QA 1Q86W 1G8MA 3CCJV 5LGUA 1SRYA 3E8FA 2OT5A 2IU0A 5CBFA 3CC7V 3ZMZA 3K79A 2B1IA 3FB5C 3JD1A 4PA9A 2JJ1G 3ABLC 3E83A 3UKMA 2IH1C 3OUSA 2EBOA 4ASUG 5LHHA 4XDLA 2EIJB 4GX5A 3CCEV 2W6IG 3OR7C 2WLHA 3ZMUA 1BL8A 1NR7A 1YIJV 2A79B 3T2MA 1S76D 2PI5A 1OCRB 3AG4B 5DN6G 1RPOA 3AG3C 4U7OA 2DW4A 1M56C 5IY5C 1OZ0A 3SPHA 4PDRA 5H6RA 5LBQA 1FFTB 2WLLA 1R3LC 1JCHA 1R3IC 4HZ3A 2F43G 2QKSA 1DF4A 3EHBB 1S3JA 5B1BC 2UXNA 1UJWB 1DTOA 1H8HG 4UUJC 4WF9V 2LFSA 3K9AA 4UVAA 1YSCA 3ZIAG 4P2ZA 2OCCC 2CK3G 4P9PA 1JPXA 5EBWC 5LGTA 1TUEB 2Y69B 1KKDA 1M56B 3LSSA 5KA5A 1PNMA 4TT3G 4WFBV 3F7VC 3ZRSA 1V55B 4XBFA 4MVOA 2EIKC 2BOBC 2C2AA 3G71V 1GM9A 3LUTB 3OW2U 4MVRA 5E1AC 4QE9A 3WFVA 1G4YB 2DYRC 1R73A 4GCZA 1R6KA 2ZD9A 3CC4V 5KUMA 1BHBA 4JAUA 2Q68A 2X6CA 1NJIW 4MVZA 1RM1B 1K92A 2HR3A 3OR6C 3SYQA 4QJFB 2DYSC 3SYCA 4MW3A 1VQNV 2AHYA 3CCSV 4LCUC 4F4LA 5B1BB 1V54B 1GTOA 3OMAB 4WFAV 1PD3A 4MVMA 2EILC 3ZMTA 4MTGA 1V54C 2P67A 2HG5C 3B77A 4G2KA 1VQ5V 3H01A 3MHHC 4QNHB 2ZR3A 2NNUA 2XAHA 3TCUA 1H2GA 1MSWD 1N8RW 3CP1A 4JTAB 5CMUA 4UVCA 4OXSA 3SPIA 3BEHA 2DQ0A 2B1GA 5FL7G 2DYRB 1VQKV 1CP9A 3W7TA 3ASNB 1M90W 1GKFA 3IFXA 2WLLB 1M9NA 5L3CA 3CCMV 1OCOC 3QO8A 5L3EA 1V55C 3GWOA 2EINB 3ZN0A 3SJQC 2DWDC 4QPJA 1OCOB 1VQOV 2ITCC 1FXKC 1AI7A 3SYOA 2ZXWC 4JYBA 2BOCC 2WSSG 1R3JC 3ASNC 1FXVA 4JF3A 3CYOA 3K0DA 4GX1A 4TWKA 1SZTA 3JD4A 2DWEC 1S5HC 1ZWIC 4XDJA 1NR1A 1F4NA 1AJNA 2M7WA 1NVPB 3MD0A 1OHHG 1RPRA 1QLNA 1AI4A 5C93A 4J9ZB 3PJSK 1RM1C 3QO5A 1JVMA 1K73W 2ZXWB 4MTFA 5IY5B 2IH3C 1QCEA 3K04A 3CCQV 4FPPA 5CA3A 1OCRC 2B5UA 3AG4C 3ZMVA 3ZMSA 2EILB 3LDEA 3T1CA 4U7NA 3ZRWB 3OGCC 3STZC 4CBCA 2EINC 4ZKIA 2JIZG 3ABMB 4FK5C 1BHAA 1CPYA 4FMTA 2Z5UA 2DYSB 1AJQA 2HKOA 1NH2D 1QR8A 1FS0G 3OE7G 3AG1B 1K34A 1K4DC 5L3GA 2EJRA 2OCCB 3E8BA 1KD1W 3I56V 3JD2A 1VQMV 1YHQV 1GM7A 4FJCC 3T4DA 4RQEA 2WWWA 1DLBA 2EIMC 3VBBA 3AEIA 1SESA 3JYCA 3NXSA 3E35A 1F23A 3A0RA 4H33A 3ETGA 4XDKA 3CMAV 3CCVV 1M1KW 2IW5A 4QPKA 1THZA 5LHGA 3R65A 1QLEB 2WLMA 2P90A 4R8CA 1EBOA 2Y69C 4BIUA 4PDLA 5IYBO 2DQ3A 1QVGU 1S0VA 1K33A 1NQTA 4I9WA 3ZRVA 2ZR2A 5B3SB 2WLIA 1K5QA 1WLEA 2YSUB 4I5SA 5L3BA 3SYAA 1VQ8V 1OCZC 1XL6A 5KA6A 5DM6V 1KP3A 5B1AC 2GSMB 2IJKA 4JYCA 3ZRXA 1MOFA 2YEVA 3QO7A 1JOYA 3AG1C 3E89A 1NH2B 4MVUA 3E2EA 2X6AA 3AG2B 3BY6A 3ZN1A 3D36A 3DGEA 5EK0A 5IYCO 3IC7A 2K1EA 3CMEV 4WFEA 4E2LA 5B1OA 2IJJA 5IYDO 1COWG 4P9OA 4X88A 3B8MA 2HFEC 1GK9A 4FIPC 1QVFU 1IXMA 3AG2C 3CCRV 3OMIB 3OEHG 1P7BA 1LNQA 2JK5C 1ORQC 4QIWF 2PI4A 4WFHA 3F7YC 2XAJA 1YJWV 5HFLA 5GW7A 2A0LA 1NVPD 3ZJZA 4L87A 5IDJA 1K9MW 1OCCB 2Q6AA 2V7QG 5H6QA 3CD6V 1FXHA 2EZPA 2IJHA 4R6ZA 5BZBA 2V1DA 3MHSC 1YJ9V 4PA6A 4RO2A 4PA3A 2QTOA 1VQ9V 3K06A 4G27B 3STLC 2QM7A 1H8EG 4RQFA 3X2QC 1VQ6V 2JEXA 3B8NA 3OM3B 2X7RB 3ASOC 1GM8A 1K97A 1QLEC 1E1RG 4KP4A 1YTFB 4CZZA 2OTLV 1VQ7V 1JJ2U 2OTJV 3OUFA 1GO3F 2XASA 5B1NA 3FYIB 3HB3B 5EBLC 1M57B 3TETA 2H94A 2X6BA 2ZDIC 1BMFG 1EZJA 2W6JG 3CPWU 1S77D 1VQPV 3ABLB 1NKDA 3LDCA 1YJNV 1W2BU 3W7WA 1P4RA 3EFFK 1S72V 1KECA 4EKWA 1NBMG 4UVBA 4RUEA 1Q7YW 1AJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC1 C;  5KUK A;  1XL4 A;  5CBH A;  2HJF C;  3LUT B;  1K4D C;  4MVR A;  4BW5 A;  3KG2 A;  5E1A C;  2NLJ C;  4QE9 A;  3E8B A;  1G4Y B;  3ABM C;  2DYR C;  2HVJ C;  3FB7 C;  2ZD9 A;  3T4D A;  5KUM A;  3E86 A;  2EIM C;  2Q68 A;  2X6C A;  3JYC A;  3SPC A;  3SYP A;  4MVZ A;  3OR6 C;  4WFG A;  3SYQ A;  2WLN A;  2DYS C;  4RUF A;  4H33 A;  4MTO A;  4MW3 A;  3SYC A;  4DXW A;  2AHY A;  4LCU C;  4XDK A;  4F4L A;  3K08 A;  3E8H A;  4HYO A;  4MW8 A;  5J9P C;  3RVZ A;  3IGA C;  3F5W C;  4J9Y B;  3R65 A;  4LP8 A;  2W0F C;  4PDV A;  4PDM A;  2WLM A;  4GX2 A;  4MVQ A;  4R8C A;  3WG7 C;  2Y69 C;  4JTD B;  4PDL A;  3T4Z A;  4MVM A;  5EBM C;  2EIL C;  4MSW C;  4KFM A;  5CBG A;  3SPJ A;  2KB1 A;  4MTG A;  3VOU A;  2A9H A;  1V54 C;  2P7T C;  2WLI B;  4I9W A;  2HG5 C;  3LDD A;  3RVY A;  2WLI A;  4R7C A;  1R3K C;  3SYA A;  2WLK A;  1OCZ C;  1XL6 A;  4QNH B;  5B1A C;  4GX0 A;  4PA7 A;  3K0G A;  1J95 A;  3TCU A;  2YEV A;  2Q67 A;  3AG1 C;  3RBZ A;  3E89 A;  4JTA B;  4MVU A;  4OXS A;  3SPG A;  3SPI A;  4RAI A;  3BEH A;  2R9R B;  1M57 C;  2X6A A;  3E8F A;  5CBF A;  2EIJ C;  5EK0 A;  3K03 A;  2K1E A;  3FB5 C;  3IFX A;  2WLL B;  4PA9 A;  4WFE A;  4X8A A;  4WFF A;  3E83 A;  3ABL C;  4P9O A;  3UKM A;  4X88 A;  1OCO C;  2HFE C;  2IH1 C;  4H37 A;  3OUS A;  4LBE C;  5EC2 C;  3UM7 A;  1V55 C;  3AG2 C;  4XDL A;  3SJQ C;  2DWD C;  1P7B A;  1LNQ A;  4GX5 A;  2JK5 C;  3FB6 C;  2ITC C;  3OR7 C;  1ORQ C;  2WLH A;  3SYO A;  2AHZ A;  4WFH A;  3F7Y C;  2ZXW C;  3RW0 A;  1BL8 A;  2A0L A;  2BOC C;  1R3J C;  2ATK C;  3ABK C;  3ASN C;  3HPL C;  3ZJZ A;  2Q6A A;  2A79 B;  3K0D A;  3T2M A;  3E8G A;  4GX1 A;  5B3S C;  4TWK A;  2DWE C;  1S5H C;  1ZWI C;  4R6Z A;  5BZB A;  3AG3 C;  2ITD C;  2WLJ A;  4XDJ A;  4PA6 A;  1M56 C;  4MS2 A;  4RO2 A;  5IY5 C;  4PA3 A;  3SPH A;  2QTO A;  4PDR A;  3K06 A;  4G27 B;  1K4C C;  3STL C;  2WLL A;  4J9Z B;  3PJS K;  4ZBM A;  3X2Q C;  1R3L C;  1JVM A;  4MTF A;  1R3I C;  1QLE C;  3ASO C;  4HZ3 A;  2IH3 C;  2QKS A;  3K04 A;  4QE7 A;  3GB7 C;  5B1B C;  1OCR C;  3AG4 C;  3OUF A;  4UUJ C;  5EBL C;  4P2Z A;  2OCC C;  3LNM B;  1OCC C;  3FB8 C;  4P9P A;  2H8P C;  2X6B A;  4X89 A;  5EBW C;  3LDE A;  4P30 A;  4PA4 A;  3T1C A;  3TET A;  1KKD A;  4R50 A;  2Q69 A;  3OGC C;  3LDC A;  3STZ C;  4CBC A;  2EIN C;  2HVK C;  3F7V C;  4JTC B;  3EFF K;  3ZRS A;  4EKW A;  4MVO A;  2EIK C;  2BOB C;  4MVS A;  4G28 B;  4RUE A; 
#chains in the Genus database with same CATH topology
 5KUK A;  4BW5 A;  1Q3E A;  2NLJ C;  1TUB B;  3FD9 A;  5LYJ A;  1XHZ A;  3W7X A;  2WLN A;  5A9G A;  1AI5 A;  3K08 A;  4TV9 A;  3L9D A;  1GMG A;  2WA4 A;  3FKS G;  1PL0 A;  2YXY A;  4PDM A;  1WP7 A;  2KG7 B;  5LHI A;  3ETE A;  1IXB A;  2R9I A;  4LFA B;  2EIM B;  3N2G A;  4FM0 A;  3LDD A;  1R6N A;  4O2B B;  1O9G A;  1JX9 A;  2F4V B;  1ARO P;  4LFA O;  4GX0 A;  2QWP B;  1IBK O;  3SPG A;  2XTA A;  4QGP A;  3K03 A;  4I4T A;  4DW1 A;  2IJI A;  4WCE V;  4X8A A;  3E22 B;  1K8A W;  4YJ2 A;  3CRQ A;  4DR4 B;  3G4S V;  3CC2 V;  3OT7 A;  1H2S B;  1N32 O;  1AR1 B;  3FB6 C;  1M5I A;  4OX9 O;  3W7U A;  3RWR D;  2YI9 A;  3JCZ A;  3HPL C;  3AK3 A;  2EX3 A;  1FFX A;  1SER A;  5JQG A;  3CCU V;  3OFN G;  3OAA G;  3JAT A;  4TSF G;  3K9S A;  2E76 B;  2ZT9 B;  1SQX H;  1EN4 A;  5KMG A;  2QDO A;  4IHJ B;  3CS5 A;  2QM8 A;  4NXM B;  3LNM B;  1F51 A;  4PJ0 Z;  4X89 A;  4P30 A;  3OEE G;  5EYP B;  2Q69 A;  1I0H A;  2PF4 E;  5B66 Z;  2XOK G;  3J80 N;  4I0X B;  2ZNJ A;  4FLU A;  3C90 A;  4LC1 A;  4UXN A;  1D5N A;  3M99 B;  2YI8 A;  1TUB A;  4UV8 A;  4X1Y A;  4DV7 B;  1IX9 A;  1I94 B;  5B5E Z;  1N36 B;  4YY3 B;  2QE7 G;  2X0L A;  4HYO A;  4GKK O;  4ICG A;  1KMI Z;  2UUB O;  2CAZ C;  1HWY A;  4B3S O;  4YJ3 A;  1VMG A;  3ETD A;  3T4Z A;  4KFM A;  4ZI7 B;  4B7E A;  4X20 B;  3BAB A;  2Y48 A;  2WLK A;  1MMM A;  4N23 A;  1IBK B;  4IYH A;  2ZQM A;  1SET A;  2UUA O;  5KX5 A;  3E8F A;  2P06 A;  1MA1 A;  4O4H A;  1SZX A;  1Y76 A;  2B1I A;  5JVD B;  3K5N A;  2HP8 A;  2UU9 O;  1I94 O;  4PA9 A;  4DV7 O;  2JS3 A;  2AZ0 A;  1I08 A;  4B3T B;  4H44 B;  4FLX A;  2Q8V A;  2EIJ B;  2F93 B;  3CCE V;  5CA0 B;  1TAE A;  4PI2 A;  1BGY H;  4TV8 A;  1BL8 A;  3D3Q A;  1P7G A;  2A79 B;  5LMN O;  1S76 D;  4GKJ O;  1OCR B;  5DN6 G;  3G6B A;  4LF4 B;  1M56 C;  1U96 A;  1OZ0 A;  3WU2 Z;  1FFT B;  4NXN O;  3N27 A;  1R3L C;  4DUY B;  1FKA O;  2F43 G;  5IJ9 A;  2QKS A;  1UJW B;  1H8H G;  1ZSP A;  3QG5 A;  3K9A A;  4P2Z A;  4DV6 B;  1CXZ B;  1PPJ H;  3RYI B;  3JAT B;  1ZX3 A;  4JZ2 A;  1YCI A;  3UQ8 A;  4MVO A;  2BOB C;  5F2V O;  4JV5 O;  1GN3 A;  3G71 V;  4ZHQ A;  3OW2 U;  3WFV A;  2HHH O;  4B7K A;  4DRX B;  2ARH A;  4X64 O;  2ZD9 A;  2OIE A;  4JAU A;  4TQF A;  3BCC H;  4NTY A;  1VF5 B;  2DYS C;  4WBN B;  4MW3 A;  1VQN V;  1PP9 H;  4LCU C;  4F4L A;  3ZHQ A;  2VQE O;  5JH7 A;  2KSD A;  2B9Z A;  4MVM A;  1SQG A;  3K5O A;  2QGN A;  4AQY B;  3JCU Z;  2Y4U A;  1VQ5 V;  1LR1 A;  3MHH C;  4A5U B;  1Q6I A;  2XAH A;  1G1X B;  3CP1 A;  4JTA B;  3JSL A;  2B1G A;  5FL7 G;  5KHH A;  1CP9 A;  2PYJ A;  1YDX A;  5LMN B;  3EVK A;  5L3C A;  2KG7 A;  4DR7 B;  4JI8 B;  4H0L B;  1SQB H;  2EIN B;  2DWD C;  3KCY A;  4UCR A;  1L0L H;  3R66 A;  5LA6 B;  4JYB A;  4B08 A;  3TGU H;  2WSS G;  3ASN C;  4LFB O;  2CTW A;  2JGD B;  3JD4 A;  3KKY A;  2PTM A;  4FVM A;  2HHH B;  2Q5Z A;  2JGD A;  1RPR A;  4F6R A;  1AI4 A;  4J9Z B;  4LR3 A;  1XNQ B;  2CH7 B;  2ZXW B;  5IY5 B;  1BS3 A;  4FPP A;  3AG4 C;  1QU7 A;  3ZMS A;  2YIB D;  3Q4H B;  2AW9 A;  2L6L A;  3LDE A;  4FFB B;  3T1C A;  4JYY A;  1HNX O;  1EM1 A;  4DR6 B;  4CBC A;  2EIN C;  3TJT A;  1BHA A;  3CHX A;  4NB5 A;  1AJQ A;  1UPG A;  3UT5 A;  3RYF A;  4K0K B;  4YJ3 B;  3RGB A;  1YHQ V;  3JAK A;  1GM7 A;  1DLB A;  2GDS A;  1F23 A;  3A0R A;  4O4I B;  4TUY B;  2VQF B;  4U3J A;  3RFR A;  3CMA V;  1I7F A;  2Q7E A;  3CSX A;  3ICX A;  2BTQ B;  4X1I A;  1U97 A;  2CUG A;  2DQ3 A;  1FAF A;  1QVG U;  1G6U A;  4I9W A;  1FFX B;  5L3B A;  3JAR B;  1VQ8 V;  1XL6 A;  5KA6 A;  4PV1 B;  4X62 B;  1JOY A;  1MOF A;  3UT5 B;  3AK2 A;  2HEP A;  1XMQ B;  4MVU A;  2QWR B;  4X65 B;  1ZL8 A;  2X6A A;  3DGE A;  5EK0 A;  2K1E A;  4WFE A;  3TXS A;  5KHI A;  1N34 B;  2IJJ A;  1Y67 A;  1COW G;  4X88 A;  5GON B;  1GK9 A;  1SQV H;  4KL1 A;  2Q7H A;  5JCO A;  4JI3 B;  3CCR V;  4QIW F;  4WFH A;  4BIO A;  3A2F A;  4YY3 O;  5GW7 A;  2R72 A;  2A0L A;  4DV3 O;  1AP6 A;  3ZJZ A;  3CJH A;  3CD6 V;  2BCC H;  5DED A;  3DXR A;  4RO2 A;  4NVP A;  1N34 O;  3SJB C;  1D2D A;  3K06 A;  2QM7 A;  4RQF A;  3X2Q C;  3B8N A;  1GM8 A;  4I50 A;  1ZLZ A;  2OTL V;  1VQ7 V;  5D5Q A;  1GO3 F;  2QKC A;  2XAS A;  1IBM O;  4KHP B;  5JJJ B;  2UXB B;  1GN2 A;  4B3S B;  1R1B A;  2H94 A;  1S77 D;  1VQP V;  3HKD A;  1W2B U;  4BR6 A;  2VRZ A;  1P4R A;  1S72 V;  4LNU B;  3B4S A;  1WPB A;  1Q7Y W;  4FM2 A;  3RT3 C;  3BRC A;  2PY5 A;  1N4C A;  4O2A B;  2CTR A;  4DR1 O;  5H9C A;  1YTF D;  3SYP A;  4IIJ B;  1ENV A;  2YXL A;  2ZDI A;  2ZIO A;  1YIT V;  2YS8 A;  4Q6G A;  4PDV A;  5J2T B;  4GX2 A;  4NXM O;  2G38 A;  1NTM H;  4X1K A;  1GRJ A;  1XNR B;  2WLI B;  4PI0 A;  1JR9 A;  4KUM A;  2FTK A;  3RVY A;  3NR7 A;  2RNB A;  4NYK A;  1DGS A;  4JZG A;  2D3O W;  2ODM A;  5JWP A;  2QA4 V;  2Z0A A;  1M57 C;  2EIJ C;  1US6 A;  4IL6 Z;  2UXD B;  3H9V A;  2HLD G;  2UUC O;  4CH3 A;  4JGS A;  4WFF A;  2QEX V;  4PEL A;  3UM7 A;  1KQS U;  4BWA A;  2AHZ A;  2BSK A;  3RW0 A;  3D8C A;  3ABK C;  2ADQ B;  3PN1 A;  4Z1V A;  3P30 A;  3E8G A;  5E79 Z;  4JAS A;  2CDY A;  2PZS A;  2ITD C;  4MS2 A;  3ASO B;  4CH4 A;  5BY1 A;  4TV8 B;  1NTZ H;  3JAM N;  3OTF A;  1K4C C;  4I7Z B;  1EFR G;  3ABK B;  3T1H O;  4JI6 O;  5LXT A;  2ZCE A;  2LP7 A;  2ZIN A;  4BW9 A;  4UCT A;  2LGQ A;  4N21 A;  1VAR A;  3FB8 C;  3W7S A;  2H8P C;  1KC8 W;  2JDI G;  4PA4 A;  5D5P A;  3UO3 A;  1BCC H;  2XAQ A;  5J2T A;  1IBM B;  4JTC B;  2UXX A;  4J11 A;  4JI2 O;  1XMO O;  4MVS A;  2P4V A;  4LF5 O;  3K5L A;  3M7M X;  3ZHR A;  2ZNI A;  1KBH A;  4OPA A;  1IBL O;  5KHJ A;  2NR5 A;  3ZRW A;  2Q73 A;  5FNV A;  2XAF A;  4LF7 B;  1VF6 A;  4RUF A;  3G6E V;  4MTO A;  1QBZ A;  2GV9 A;  1QR9 A;  4OGQ B;  1OCZ B;  1PNL A;  1XIL A;  5CN0 A;  3IGA C;  1Y4M A;  3JD0 A;  1BE3 H;  4ZIB A;  1KU9 A;  1KUQ A;  1DF5 A;  5EBM C;  2KB1 A;  4X1K B;  4FZ0 A;  3AG3 B;  4GT1 A;  5LOV A;  3ABU A;  1MG1 A;  1H38 A;  3CCL V;  1ZAU A;  1P84 F;  1XI1 A;  4PA7 A;  5JH7 B;  4Q20 A;  1MAB G;  2DOS A;  2LGW A;  3EXA A;  5LGU A;  1OV9 A;  5IYZ A;  5CBF A;  3CC7 V;  3L72 H;  3ZMZ A;  4NXN B;  4JAA A;  3JD1 A;  1LUV A;  1Q90 D;  2LJ2 A;  3OUS A;  1H2N A;  1NS1 A;  4ASU G;  4XDL A;  5BMV A;  2WLH A;  5J2U A;  3ZMU A;  3G80 A;  1YIJ V;  4PD4 F;  1FJG B;  2LW1 A;  3T2M A;  1HNW B;  2DN9 A;  3AG3 C;  4JV5 B;  4U7O A;  3VQX A;  1NU1 H;  3SPH A;  3P3N A;  2WLL A;  1B3Q A;  1JCH A;  1AIL A;  1AB3 A;  1L8D A;  1DF4 A;  4D6T H;  5B1B C;  3F5T A;  2UXN A;  3HKB B;  1DTO A;  4UUJ C;  4WF9 V;  2LFS A;  2CK3 G;  4P9P A;  1JPX A;  5EYP A;  4DR6 O;  1TUE B;  1BZK A;  4DV0 B;  1YXB A;  5ITZ B;  2OYQ A;  4WFB V;  3F7V C;  2YIB A;  3JAW A;  1V55 B;  2F23 A;  1XUQ A;  4F6E A;  3FAV B;  4UB6 Z;  1XNQ O;  1A32 A;  5JJN B;  3LUT B;  4MVR A;  1J5E B;  1FJG O;  1BHB A;  1JFF A;  2PUS A;  4LF7 O;  1IZ3 A;  2YDE A;  4MVZ A;  4QJF B;  3SYC A;  5H5N A;  3L70 H;  2AHY A;  3CCS V;  4B3T O;  5B1B B;  4CS3 A;  2ETN A;  1WA8 B;  2F1M A;  1V54 B;  3OMA B;  4CS4 A;  1PD3 A;  1TGO A;  2QKA A;  3ZMT A;  4O4J A;  1V54 C;  4X20 A;  1Y74 B;  2P67 A;  4X9Q A;  4G2K A;  4KHP O;  5BMV B;  3LSU A;  1N8R W;  5CMU A;  2AXT Z;  1H2L A;  4FLZ A;  2ILM A;  3JAK B;  1Z5V A;  2GBO A;  3ASN B;  1M90 W;  3IFX A;  2WLL B;  5LMU O;  3QO8 A;  3SR2 C;  3AK1 A;  5KAF Z;  2BTQ A;  5IE9 A;  1OCO B;  1VQO V;  1AI7 A;  3SYO A;  4K8X A;  2ZXW C;  4J7K A;  3KCX A;  1R3J C;  1XBL A;  4FFK A;  2PYL A;  4JF3 A;  2PGG A;  1S5H C;  1F4N A;  2AGA A;  2M7W A;  1NVP B;  1QLN A;  1RM1 C;  1JVM A;  1K73 W;  2FYU H;  1FYJ A;  4MTF A;  2IH3 C;  3K04 A;  1WB7 A;  5LA6 A;  3ZMV A;  2EIL B;  5KX5 B;  3K58 A;  2A06 H;  3OGC C;  2YUA A;  4KXR A;  3ABM B;  3OGI B;  4DV6 O;  4JI6 B;  3T1H B;  3ZHS A;  1CPY A;  3BA8 A;  4LFC B;  1NH2 D;  1SA0 B;  2RDC A;  2N74 A;  3OE7 G;  2P22 C;  1K34 A;  3AG1 B;  2XHB A;  1ZUQ A;  3JAL A;  4YIO A;  4FM1 A;  4DRX A;  4K35 A;  4LF4 O;  4NKG B;  3T4D A;  2GTA A;  2EIM C;  3BA9 A;  3JYC A;  4JI1 O;  3ETG A;  3CCV V;  2IW5 A;  4QPK A;  1PM9 A;  2LW7 A;  4X1Y B;  2P90 A;  3IAY A;  1H2M A;  4BIU A;  1IVS A;  4PDL A;  3LNN A;  4JYA B;  1AP5 A;  1DK1 A;  1IBL B;  2EJ7 A;  1S0V A;  1GAX A;  3ZRV A;  5BXZ A;  4I5S A;  4JI4 B;  5B1A C;  4JYC A;  3ZRX A;  3VQW A;  2UXB O;  3E89 A;  2FKX A;  1NH2 B;  4YJ2 B;  3CRC A;  1Q6H A;  3MDS A;  3BY6 A;  3ZHT A;  4DUZ O;  3CME V;  4W4L A;  4JI5 B;  4AIL C;  1Y74 A;  4FIP C;  4EEQ A;  1IXM A;  5H2F Z;  4JI5 O;  2JK5 C;  4GKK B;  1D5A A;  1ZL8 B;  2PI4 A;  3F7Y C;  1XMO B;  5LMU B;  1NVP D;  2JS5 A;  1RSO A;  3CEI A;  4IGG A;  5IYZ B;  5AG2 A;  3CRA A;  2QTO A;  1VQ9 V;  4DW0 A;  1H8E G;  3OTO B;  1VQ6 V;  2JEX A;  1FD9 A;  3BFR A;  3ASO C;  1QLE C;  1K97 A;  3QTC A;  1PL4 A;  1XQ8 A;  1YTF B;  4LF6 B;  1JJ2 U;  2OTJ V;  1HR0 B;  5IJ0 B;  4O4L B;  1M57 B;  1EZJ A;  3ZHU A;  2CGN A;  4EFB A;  1YJN V;  4IYI A;  5JJE B;  5C8Y A;  2R70 A;  1KKC A;  4DV1 O;  3H1I H;  1Q5O A;  3N2G B;  3K3W A;  4UV9 A;  1HNW O;  2H3O A;  1CEZ A;  2EIK B;  3RN4 A;  1L1F A;  5GON A;  3U0Z A;  1HNZ B;  1S5J A;  4J7J A;  4K3A A;  1KYO F;  2JVD A;  4JI7 O;  4MW8 A;  1Q82 W;  2Y0I A;  3RVZ A;  3SDL A;  4ZOL B;  4J9Y B;  1VQL V;  2W0F C;  2V4D A;  3HR0 A;  1VP7 A;  3WG7 C;  1XOU A;  2CH7 A;  2IU3 A;  3VOU A;  3FYE B;  2A9H A;  1SF9 A;  2MW2 B;  1R3K C;  4DV1 B;  5KMG B;  4LF9 O;  4Z2W A;  5TIS Z;  1E1Q G;  2Q67 A;  2EZO A;  1VIB A;  3LSQ A;  1N0J A;  4RAI A;  2R9R B;  4HAM A;  5EZY A;  4LF8 O;  5JCO C;  1XEQ A;  2BSK B;  1N33 B;  4HBN A;  4LBE C;  3ML0 A;  4JPR A;  1X59 A;  2VS0 A;  2XND G;  4DV5 O;  2FB5 A;  3GWK C;  2XAG A;  4U3F H;  2ATK C;  3H1J H;  1WPX A;  4Z1M G;  3C3T A;  5B3S C;  4DV3 B;  3DTU B;  4LF5 B;  1I5X A;  1VEW A;  1K7D A;  2M6Y A;  4ZBM A;  2JJ2 G;  5LP6 C;  4LF6 O;  1ROP A;  4QE7 A;  5LP6 A;  3GB7 C;  5LL6 Y;  1K3E A;  2P6J A;  3I55 V;  5GTI Z;  4DV0 O;  2FML A;  3O65 A;  5K1P A;  1XMQ O;  1VQ4 V;  4I4T B;  1W0J G;  4BAY A;  3M8A A;  5EC1 C;  1FXK B;  1XL4 A;  2HJF C;  1BQ0 A;  3B2E E;  3KG2 A;  3JAW B;  3QNE A;  3D3I A;  2ZM6 B;  4U3J B;  2CE4 A;  3RYI A;  2N04 A;  1I5Y A;  3H1K H;  2WPD G;  4X66 O;  4WFG A;  2QJ1 A;  5J9P C;  3E8H A;  3WG7 B;  2WAM A;  1F4M A;  5BR8 O;  1AVM A;  2ZIM A;  4JTD B;  1AI6 A;  4MSW C;  1SA0 A;  1Z5W A;  2E3C A;  5FNV B;  1TVK A;  3ZCC A;  2ZKO A;  1VF7 A;  1J95 A;  3APO A;  3SGI A;  5KLV H;  2DMX A;  1HR0 O;  5EIB D;  4DV2 O;  2Y0P A;  2OCH A;  2Q9L A;  3K79 A;  3FB5 C;  3CJH B;  1JMK C;  1B06 A;  3RYH B;  3UKM A;  2F95 B;  3HKD B;  3H1L H;  3FX7 A;  2LQT A;  4JI7 B;  5LHH A;  3S3X A;  3OR7 C;  4K0K O;  1Y6X A;  4O4L A;  3G67 A;  1NR7 A;  5GTH Z;  3AG4 B;  1RPO A;  4LWS A;  3L71 H;  4DV5 B;  4I50 B;  5IY5 C;  4PDR A;  2F66 C;  3A0B Z;  5H6R A;  5LBQ A;  1KB9 F;  4HZ3 A;  3ZBH A;  4DR7 O;  3EHB B;  3RYC B;  4UVA A;  1YSC A;  3ZIA G;  5EBW C;  5LGT A;  2Y69 B;  1KKD A;  5BR8 B;  2Q0A A;  4YIP A;  1PNM A;  4TT3 G;  4EB6 B;  3APQ A;  2Y4T A;  1SC5 B;  3B09 A;  3ZRS A;  4LFB B;  2QR4 A;  4DR2 O;  5EIB C;  5KAI Z;  2UUB B;  1NZ6 A;  5E1A C;  4QE9 A;  1G4Y B;  4DR1 B;  1R73 A;  4GCZ A;  3JAL B;  3CC4 V;  5KUM A;  3K5M A;  2XT9 A;  2YIC A;  3I5D A;  3VQV A;  1RM1 B;  1K92 A;  3OR6 C;  1JA8 A;  1SS3 A;  5CA1 B;  3L73 H;  3JAR A;  2RJZ A;  1GTO A;  4WFA V;  1HNZ O;  2EIL C;  1F7Y A;  4MTG A;  3HKC B;  4PHZ A;  5LOV B;  2HG5 C;  5FPO A;  4TUY A;  3H01 A;  2ZR3 A;  3TCU A;  2GUZ A;  4OXS A;  3SPI A;  2VQE B;  2DQ0 A;  1NI8 A;  3T1Y O;  2YIA A;  2ZE8 A;  4ZOL A;  4I55 A;  3UCS C;  1GKF A;  1MZF A;  2W0X A;  3IJ4 A;  4HNA B;  1OCO C;  5L3E A;  4JI0 O;  1Q6U A;  3SJQ C;  5IWA B;  5FPR A;  2UUC B;  5IT9 N;  4CS2 A;  2BOC C;  4OX9 B;  1FXV A;  3VQY A;  3CYO A;  2GTS A;  4YHH O;  4GX1 A;  1SZT A;  2DWE C;  4XDJ A;  3MD0 A;  1LUW A;  1OHH G;  4X65 O;  3PJS K;  3QO5 A;  2A3Q A;  1QCE A;  1YZB A;  3CCQ V;  1HNX B;  2RMK B;  5CA3 A;  1OCR C;  4U7N A;  2YID A;  3ZRW B;  1URF A;  3STZ C;  4ZKI A;  4FK5 C;  5IJ9 B;  4FMT A;  2Z5U A;  2HKO A;  3J81 N;  1K4D C;  5L3G A;  1V9P A;  2OCC B;  2KQX A;  3E8B A;  4J10 A;  5C8Y B;  3JD2 A;  2VWJ A;  4FJC C;  4RQE A;  2WWW A;  3AEI A;  2Q0O C;  4H33 A;  3O9O A;  1N33 O;  3BPZ A;  4JI8 O;  1THZ A;  5LHG A;  1QLE B;  4JI3 O;  2WLM A;  5IYB O;  3J7A U;  1IUR A;  1K33 A;  1NQT A;  1MZE A;  5B3S B;  2ZR2 A;  3OTO O;  2YSU B;  2YXH A;  2RQ6 A;  3SYA A;  2A7W A;  1KP3 A;  2L35 A;  4NTX A;  3QO7 A;  1JFF B;  2OIG A;  3AG1 C;  3ETQ A;  2GUZ B;  2IM9 A;  3E2E A;  4FLV A;  2E5L O;  3D36 A;  4AI8 A;  5IYC O;  1GN4 A;  1HP8 A;  1N36 O;  4EB6 A;  4E2L A;  2RN9 A;  4X1I B;  4P9O A;  3WB2 A;  3B8M A;  3KZI Z;  3AG2 C;  3DC5 A;  3K59 A;  4CH6 A;  1P7B A;  1LNQ A;  4B3M O;  4O4I A;  4DUZ B;  5CB4 B;  2XAJ A;  2LO1 A;  4DR3 B;  2DE0 X;  2QWO B;  2CTP A;  4L87 A;  1M93 A;  5IDJ A;  1K9M W;  5H6Q A;  4DK0 A;  2EZP A;  2V1D A;  3MHS C;  3U11 A;  4X62 O;  4PA6 A;  4NTW A;  4PA3 A;  4H13 B;  3OM3 B;  2X7R B;  3H1H H;  4GZR B;  1E1R G;  4KP4 A;  3QF7 A;  3OUF A;  5EBL C;  3CXH F;  4I9Q A;  5ITZ A;  3TET A;  5LYJ B;  2VWK A;  3ABL B;  2K9P A;  1QNM A;  1SQF A;  3LDC A;  4LNU A;  3EFF K;  1NBM G;  3JAS B;  2ZM6 O;  3U10 A;  1AJP A;  3ABT A;  2QTS A;  5IWA O;  1Q81 W;  2IBZ H;  1Y66 A;  2HVJ C;  3FB7 C;  2N05 A;  2NN4 A;  4OPH A;  3ZX6 A;  2QM4 A;  1FXK A;  1KP2 A;  3UO2 A;  3T1Y B;  4L8J A;  3F5W C;  1RSO B;  4LP8 A;  1TVK B;  4MT8 A;  3SPJ A;  2LFR A;  2P7T C;  2UUA B;  3ZED A;  5HFM A;  1GN6 A;  1XNR O;  5CB4 A;  3K0G A;  4AHC A;  1W59 A;  2UXC B;  1PKX A;  1AR5 A;  2GHY A;  5CA1 A;  4BIZ A;  5JQG B;  4AQY O;  1WAZ A;  2QWQ B;  1JJO A;  2Q4P A;  4H37 A;  5EC2 C;  3WB1 A;  2YEV B;  3P32 A;  2OWO A;  4YHH B;  5L3D A;  4D7T A;  1E79 G;  2EUL A;  4LF8 B;  3TK1 A;  1T5E A;  3N2K B;  1MNG A;  1IDS A;  1JQ0 A;  1QHT A;  2JGU A;  3CXC U;  2WLJ A;  4MTX A;  4ZHQ B;  3Q4H A;  3SJC C;  3OMN B;  4I0X A;  1PNK A;  1WP8 A;  3HKE A;  1OCC C;  1R6T A;  2ZE6 A;  4YXW G;  5K1X A;  3RYH A;  4WBN A;  3GVM A;  4R50 A;  4CH5 A;  2HVK C;  3JD3 A;  5B1A B;  2E74 B;  5LP6 B;  4G28 B;  4UCO A;  2CTQ A;  4TQD A;  5CBH A;  3CRM A;  3ABM C;  2Z3Y A;  4DYL A;  5LGN A;  2YC0 A;  3E86 A;  5L3F A;  3SPC A;  1XDC A;  4F6R B;  3X2Q B;  1K5S A;  4DXW A;  1SKV A;  3CE2 A;  1YI2 V;  2MK3 A;  2JEU A;  2Q7G A;  4JAV A;  3THO A;  4GYC B;  4MVQ A;  4DO2 A;  4J41 A;  4CC6 A;  4GLX A;  5CBG A;  4K8Z A;  2QWN B;  4O4H B;  1WN7 A;  4R7C A;  1W0K G;  3C3S A;  2E5L B;  3A0H Z;  4TV9 B;  1RP3 B;  4D7S A;  1S5L Z;  3RBZ A;  4GKJ B;  5A2Q N;  1B6Q A;  4UCS A;  1Q86 W;  1G8M A;  2O57 A;  4FFB A;  3CCJ V;  4HNA A;  1SRY A;  2OT5 A;  2IU0 A;  1Q43 A;  3BVO A;  4B3M B;  1SQQ H;  1YVW A;  2JJ1 G;  3ABL C;  3E83 A;  4JYA O;  2IH1 C;  2EBO A;  3L74 H;  4FLT A;  5LXT B;  4GX5 A;  2W6I G;  4DR4 O;  4CC5 A;  4JI2 B;  1J5E O;  5IJ0 A;  3DC6 A;  2PI5 A;  2DW4 A;  1NTK H;  4GUN A;  4RWU A;  1WA8 A;  5KHK A;  1R3I C;  2UXC O;  3DXR B;  1S3J A;  2OCC C;  3E22 A;  2XUM A;  3DSQ A;  2ADP A;  1M56 B;  4E4E A;  4JI4 O;  3LSS A;  5KA5 A;  1P49 A;  1FPO A;  4XBF A;  2EIK C;  3WB0 A;  1O9H A;  3JSN A;  2C2A A;  4O4J B;  1GM9 A;  3RYC A;  4DR5 O;  1RFY A;  2DYR C;  2VQF O;  1R6K A;  4X64 B;  2Q68 A;  2X6C A;  1NJI W;  2HR3 A;  3SYQ A;  3P3P A;  3SJA C;  1EN5 A;  5FLX N;  2ZE7 A;  4IHJ A;  3ZS8 C;  3D36 C;  2BE3 A;  3FAV A;  1TA8 A;  4DV4 B;  3B77 A;  1BSM A;  4QNH B;  2NNU A;  1EZV H;  1H2G A;  1MSW D;  4FLY A;  5JVD A;  4UCV A;  4UVC A;  3BEH A;  2JRI A;  2DYR B;  1VQK V;  1N0N A;  3W7T A;  1WB8 A;  1M9N A;  2DJV A;  4IIJ A;  3CCM V;  4LH7 A;  4DR3 O;  1V55 C;  3GWO A;  1BT8 A;  5EZY B;  3ZN0 A;  4DR5 B;  4QPJ A;  2ITC C;  1FXK C;  1EN6 A;  1X4T A;  2UXD O;  4DK1 A;  1VF6 C;  4J80 A;  2RCV A;  3K0D A;  4ZI7 A;  4NR1 A;  1Z2G A;  4TWK A;  1ZWI C;  4FZ1 A;  1NR1 A;  1AJN A;  4B3R O;  1YF2 A;  1XRE A;  2KKW A;  5C93 A;  3TXQ A;  4EFE A;  1AR4 A;  3IC9 A;  3HKE B;  1SQP H;  4C7U A;  1WNS A;  3HKC A;  2B5U A;  1Y76 B;  2P5O A;  4ABM A;  4J42 A;  2JIZ G;  4TOI A;  2DYS B;  4UCU A;  1QR8 A;  1FS0 G;  1B04 A;  4I55 B;  1M4U A;  1YEW A;  2EJR A;  1KD1 W;  3I56 V;  1VQM V;  4DR2 B;  2D2C B;  1UFI A;  3VBB A;  4UB8 Z;  1SES A;  3NXS A;  3E35 A;  2WA3 A;  2UU9 B;  5KHG A;  4XDK A;  1M1K W;  2E75 B;  3R65 A;  4JI1 B;  4R8C A;  1EBO A;  2Y69 C;  2P4K A;  3CX5 F;  1BQZ A;  4O2B A;  2BTO A;  3N2K A;  3MAQ A;  2WLI A;  1K5Q A;  1WLE A;  4LH6 A;  1NT2 B;  1OJH A;  3ZHV A;  1OCZ C;  4UFZ A;  5DM6 V;  3K57 A;  1PV0 A;  2GSM B;  2IJK A;  4LF9 B;  4DV2 B;  2YEV A;  3AG7 A;  2AZ2 A;  1Q8I A;  4DV4 O;  3B40 A;  3AG2 B;  4B3R B;  3ZN1 A;  4DUY O;  3IC7 A;  5J2U B;  5B1O A;  5IYD O;  3S3W A;  3OD4 A;  4O2A A;  2HFE C;  1QVF U;  3L75 H;  3CWB H;  3OMI B;  3OEH G;  2QSA A;  1H2K A;  3BAA A;  1ORQ C;  4JI0 B;  1YJW V;  5HFL A;  3RYF B;  4LFC O;  4X66 B;  1OCC B;  2Q6A A;  2V7Q G;  3CRR A;  1GH6 A;  1FXH A;  2IJH A;  3HKB A;  4R6Z A;  5BZB A;  1YJ9 V;  1HDJ A;  2R9A A;  1N32 B;  4G27 B;  3STL C;  5DEC A;  3BHP A;  4FLW A;  5CA0 A;  4CZZ A;  4LWS B;  4IT5 A;  1L0N H;  1WJZ A;  2ZE5 A;  5B1N A;  3A8T A;  3FYI B;  3HB3 B;  3CB2 A;  2HJD A;  2X6B A;  2ZDI C;  3CPW U;  1BMF G;  2W6J G;  1XHX A;  3JAS A;  2CGO A;  1NKD A;  4J7Z A;  1QQC A;  3W7W A;  1ZTE A;  3QVN A;  1MSD A;  3FFQ A;  1KEC A;  1HW7 A;  4EKW A;  4W4K A;  2FL4 A;  2F4V O;  4UVB A;  4RUE A; 
#chains in the Genus database with same CATH homology
 3ABT A;  5KUK A;  3K3W A;  4UV9 A;  1CEZ A;  4BW5 A;  2EIK B;  1Q81 W;  2NLJ C;  1L1F A;  1Y66 A;  2HVJ C;  3FB7 C;  5H9C A;  1YTF D;  3SYP A;  1FXK A;  1KP2 A;  3W7X A;  2WLN A;  1AI5 A;  1ENV A;  3K08 A;  4MW8 A;  1Q82 W;  2ZDI A;  3RVZ A;  1GMG A;  3F5W C;  3FKS G;  4J9Y B;  1YIT V;  1PL0 A;  2W0F C;  4LP8 A;  4PDM A;  4PDV A;  1VQL V;  4GX2 A;  3WG7 C;  5LHI A;  2IU3 A;  3ETE A;  4MT8 A;  2R9I A;  3SPJ A;  3VOU A;  2EIM B;  3FYE B;  2A9H A;  2LFR A;  2P7T C;  2WLI B;  3LDD A;  3RVY A;  4KUM A;  2FTK A;  1R6N A;  1R3K C;  1JX9 A;  5HFM A;  1ARO P;  4GX0 A;  3K0G A;  1E1Q G;  2Q67 A;  2D3O W;  1PKX A;  2EZO A;  3LSQ A;  3SPG A;  2QA4 V;  4RAI A;  2R9R B;  1M57 C;  4HAM A;  2GHY A;  2EIJ C;  3K03 A;  4BIZ A;  2HLD G;  2IJI A;  4WCE V;  4X8A A;  4JGS A;  4WFF A;  1K8A W;  2QEX V;  4PEL A;  4H37 A;  4LBE C;  5EC2 C;  3UM7 A;  1KQS U;  3ML0 A;  2YEV B;  3P32 A;  4JPR A;  3G4S V;  3CC2 V;  5L3D A;  1E79 G;  1AR1 B;  3FB6 C;  2XND G;  3W7U A;  2AHZ A;  3TK1 A;  3RW0 A;  3JCZ A;  2XAG A;  3ABK C;  2ATK C;  3HPL C;  1WPX A;  4Z1M G;  3P30 A;  1SER A;  3E8G A;  5B3S C;  1JQ0 A;  3CCU V;  3OFN G;  4JAS A;  3OAA G;  3CXC U;  3DTU B;  2ITD C;  2WLJ A;  1I5X A;  4MS2 A;  3ASO B;  4MTX A;  4TSF G;  1K7D A;  1K4C C;  1EFR G;  3OMN B;  3ABK B;  4ZBM A;  2JJ2 G;  1ROP A;  4QE7 A;  1PNK A;  2LP7 A;  3GB7 C;  1K3E A;  2QM8 A;  2P6J A;  3I55 V;  4N21 A;  3LNM B;  1OCC C;  3FB8 C;  3W7S A;  4YXW G;  2H8P C;  1F51 A;  4X89 A;  1KC8 W;  4P30 A;  2JDI G;  3OEE G;  4PA4 A;  4R50 A;  2Q69 A;  1VQ4 V;  2HVK C;  3JD3 A;  5B1A B;  2XAQ A;  1W0J G;  4JTC B;  2UXX A;  2XOK G;  4BAY A;  4MVS A;  4G28 B;  5EC1 C;  1FXK B;  1XL4 A;  4LC1 A;  5CBH A;  2HJF C;  4UXN A;  3KG2 A;  3M99 B;  3ABM C;  2Z3Y A;  5LGN A;  3QNE A;  3D3I A;  3ZRW A;  4UV8 A;  3E86 A;  1I5Y A;  2XAF A;  5L3F A;  2WPD G;  3SPC A;  3X2Q B;  1K5S A;  4WFG A;  4RUF A;  4DXW A;  3G6E V;  4MTO A;  1QBZ A;  1QR9 A;  2QE7 G;  2X0L A;  1OCZ B;  1PNL A;  3E8H A;  4HYO A;  2WAM A;  3WG7 B;  2MK3 A;  5J9P C;  1F4M A;  5CN0 A;  1YI2 V;  3IGA C;  2JEU A;  1Y4M A;  1HWY A;  3JD0 A;  4JAV A;  4MVQ A;  4DO2 A;  4JTD B;  1DF5 A;  3ETD A;  3T4Z A;  5EBM C;  1AI6 A;  4MSW C;  4KFM A;  5CBG A;  2KB1 A;  3AG3 B;  4GT1 A;  3ZCC A;  3ABU A;  1MG1 A;  4R7C A;  1W0K G;  3CCL V;  2Y48 A;  1H38 A;  2WLK A;  4N23 A;  4PA7 A;  4Q20 A;  1J95 A;  1MAB G;  2ZQM A;  3RBZ A;  1SET A;  1B6Q A;  1Q86 W;  1G8M A;  3CCJ V;  5LGU A;  1SRY A;  3E8F A;  2OT5 A;  2IU0 A;  5CBF A;  3CC7 V;  3ZMZ A;  3K79 A;  2B1I A;  3FB5 C;  3JD1 A;  4PA9 A;  2JJ1 G;  3ABL C;  3E83 A;  3UKM A;  2IH1 C;  3OUS A;  2EBO A;  4ASU G;  5LHH A;  4XDL A;  2EIJ B;  4GX5 A;  3CCE V;  2W6I G;  3OR7 C;  2WLH A;  3ZMU A;  1BL8 A;  1NR7 A;  1YIJ V;  2A79 B;  3T2M A;  1S76 D;  2PI5 A;  1OCR B;  3AG4 B;  5DN6 G;  1RPO A;  3AG3 C;  4U7O A;  2DW4 A;  1M56 C;  5IY5 C;  1OZ0 A;  3SPH A;  4PDR A;  5H6R A;  5LBQ A;  1FFT B;  2WLL A;  1R3L C;  1JCH A;  1R3I C;  4HZ3 A;  2F43 G;  2QKS A;  1DF4 A;  3EHB B;  1S3J A;  5B1B C;  2UXN A;  1UJW B;  1DTO A;  1H8H G;  4UUJ C;  4WF9 V;  2LFS A;  3K9A A;  4UVA A;  1YSC A;  3ZIA G;  4P2Z A;  2OCC C;  2CK3 G;  4P9P A;  1JPX A;  5EBW C;  5LGT A;  1TUE B;  2Y69 B;  1KKD A;  1M56 B;  3LSS A;  5KA5 A;  1PNM A;  4TT3 G;  4WFB V;  3F7V C;  3ZRS A;  1V55 B;  4XBF A;  4MVO A;  2EIK C;  2BOB C;  2C2A A;  3G71 V;  1GM9 A;  3LUT B;  3OW2 U;  4MVR A;  5E1A C;  4QE9 A;  3WFV A;  1G4Y B;  2DYR C;  1R73 A;  4GCZ A;  1R6K A;  2ZD9 A;  3CC4 V;  5KUM A;  1BHB A;  4JAU A;  2Q68 A;  2X6C A;  1NJI W;  4MVZ A;  1RM1 B;  1K92 A;  2HR3 A;  3OR6 C;  3SYQ A;  4QJF B;  2DYS C;  3SYC A;  4MW3 A;  1VQN V;  2AHY A;  3CCS V;  4LCU C;  4F4L A;  5B1B B;  1V54 B;  1GTO A;  3OMA B;  4WFA V;  1PD3 A;  4MVM A;  2EIL C;  3ZMT A;  4MTG A;  1V54 C;  2P67 A;  2HG5 C;  3B77 A;  4G2K A;  1VQ5 V;  3H01 A;  3MHH C;  4QNH B;  2ZR3 A;  2NNU A;  2XAH A;  3TCU A;  1H2G A;  1MSW D;  1N8R W;  3CP1 A;  4JTA B;  5CMU A;  4UVC A;  4OXS A;  3SPI A;  3BEH A;  2DQ0 A;  2B1G A;  5FL7 G;  2DYR B;  1VQK V;  1CP9 A;  3W7T A;  3ASN B;  1M90 W;  1GKF A;  3IFX A;  2WLL B;  1M9N A;  5L3C A;  3CCM V;  1OCO C;  3QO8 A;  5L3E A;  1V55 C;  3GWO A;  2EIN B;  3ZN0 A;  3SJQ C;  2DWD C;  4QPJ A;  1OCO B;  1VQO V;  2ITC C;  1FXK C;  1AI7 A;  3SYO A;  2ZXW C;  4JYB A;  2BOC C;  2WSS G;  1R3J C;  3ASN C;  1FXV A;  4JF3 A;  3CYO A;  3K0D A;  4GX1 A;  4TWK A;  1SZT A;  3JD4 A;  2DWE C;  1S5H C;  1ZWI C;  4XDJ A;  1NR1 A;  1F4N A;  1AJN A;  2M7W A;  1NVP B;  3MD0 A;  1OHH G;  1RPR A;  1QLN A;  1AI4 A;  5C93 A;  4J9Z B;  3PJS K;  1RM1 C;  3QO5 A;  1JVM A;  1K73 W;  2ZXW B;  4MTF A;  5IY5 B;  2IH3 C;  1QCE A;  3K04 A;  3CCQ V;  4FPP A;  5CA3 A;  1OCR C;  2B5U A;  3AG4 C;  3ZMV A;  3ZMS A;  2EIL B;  3LDE A;  3T1C A;  4U7N A;  3ZRW B;  3OGC C;  3STZ C;  4CBC A;  2EIN C;  4ZKI A;  2JIZ G;  3ABM B;  4FK5 C;  1BHA A;  1CPY A;  4FMT A;  2Z5U A;  2DYS B;  1AJQ A;  2HKO A;  1NH2 D;  1QR8 A;  1FS0 G;  3OE7 G;  3AG1 B;  1K34 A;  1K4D C;  5L3G A;  2EJR A;  2OCC B;  3E8B A;  1KD1 W;  3I56 V;  3JD2 A;  1VQM V;  1YHQ V;  1GM7 A;  4FJC C;  3T4D A;  4RQE A;  2WWW A;  1DLB A;  2EIM C;  3VBB A;  3AEI A;  1SES A;  3JYC A;  3NXS A;  3E35 A;  1F23 A;  3A0R A;  4H33 A;  3ETG A;  4XDK A;  3CMA V;  3CCV V;  1M1K W;  2IW5 A;  4QPK A;  1THZ A;  5LHG A;  3R65 A;  1QLE B;  2WLM A;  2P90 A;  4R8C A;  1EBO A;  2Y69 C;  4BIU A;  4PDL A;  5IYB O;  2DQ3 A;  1QVG U;  1S0V A;  1K33 A;  1NQT A;  4I9W A;  3ZRV A;  2ZR2 A;  5B3S B;  2WLI A;  1K5Q A;  1WLE A;  2YSU B;  4I5S A;  5L3B A;  3SYA A;  1VQ8 V;  1OCZ C;  1XL6 A;  5KA6 A;  5DM6 V;  1KP3 A;  5B1A C;  2GSM B;  2IJK A;  4JYC A;  3ZRX A;  1MOF A;  2YEV A;  3QO7 A;  1JOY A;  3AG1 C;  3E89 A;  1NH2 B;  4MVU A;  3E2E A;  2X6A A;  3AG2 B;  3BY6 A;  3ZN1 A;  3D36 A;  3DGE A;  5EK0 A;  5IYC O;  3IC7 A;  2K1E A;  3CME V;  4WFE A;  4E2L A;  5B1O A;  2IJJ A;  5IYD O;  1COW G;  4P9O A;  4X88 A;  3B8M A;  2HFE C;  1GK9 A;  4FIP C;  1QVF U;  1IXM A;  3AG2 C;  3CCR V;  3OMI B;  3OEH G;  1P7B A;  1LNQ A;  2JK5 C;  1ORQ C;  4QIW F;  2PI4 A;  4WFH A;  3F7Y C;  2XAJ A;  1YJW V;  5HFL A;  5GW7 A;  2A0L A;  1NVP D;  3ZJZ A;  4L87 A;  5IDJ A;  1K9M W;  1OCC B;  2Q6A A;  2V7Q G;  5H6Q A;  3CD6 V;  1FXH A;  2EZP A;  2IJH A;  4R6Z A;  5BZB A;  2V1D A;  3MHS C;  1YJ9 V;  4PA6 A;  4RO2 A;  4PA3 A;  2QTO A;  1VQ9 V;  3K06 A;  4G27 B;  3STL C;  2QM7 A;  1H8E G;  4RQF A;  3X2Q C;  1VQ6 V;  2JEX A;  3B8N A;  3OM3 B;  2X7R B;  3ASO C;  1GM8 A;  1K97 A;  1QLE C;  1E1R G;  4KP4 A;  1YTF B;  4CZZ A;  2OTL V;  1VQ7 V;  1JJ2 U;  2OTJ V;  3OUF A;  1GO3 F;  2XAS A;  5B1N A;  3FYI B;  3HB3 B;  5EBL C;  1M57 B;  3TET A;  2H94 A;  2X6B A;  2ZDI C;  1BMF G;  1EZJ A;  2W6J G;  3CPW U;  1S77 D;  1VQP V;  3ABL B;  1NKD A;  3LDC A;  1YJN V;  1W2B U;  3W7W A;  1P4R A;  3EFF K;  1S72 V;  1KEC A;  4EKW A;  1NBM G;  4UVB A;  4RUE A;  1Q7Y W;  1AJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...