4R6ZA

Crystal structure of cng mimicking nak mutant, nak-etpp, cs+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
b'FQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 33
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r6zA00
3VOUA 2EIMC 4LBEC 4LCUC 3SPHA 4MS2A 2H8PC 4P2ZA 1S5HC 4GX0A 4MVQA 2YEVA 3RBZA 2JK5C 2X6CA 3IFXA 1ZWIC 2X6AA 3OUFA 2OCCC 3E8HA 3SPGA 3STLC 2WLHA 3STZC 1M56C 4H33A 4EKWA 3LDCA 4MVOA 4MTFA 4XDLA 3AG4C 4J9YB 4P9PA 2HG5C 1XL6A 4CBCA 4QNHB 4JTAB 5EBWC 3ASOC 3SJQC 4DXWA 3AG1C 4UUJC 2EIKC 1R3LC 4G28B 2EINC 3OGCC 4I9WA 1KKDA 3JYCA 2ZD9A 2HVKC 4MVUA 3SYCA 1JVMA 2K1EA 4QE7A 3RVZA 1V54C 3E89A 2QTOA 2WLLA 4P30A 3IGAC 1R3KC 2WLIA 3F7YC 3SPIA 3E86A 4WFGA 5B1AC 4GX2A 2HFEC 3LDDA 2QKSA 3AG3C 5IY5C 5CBFA 3SYQA 1ORQC 4RAIA 5CBGA 5CBHA 5KUKA 5J9PC 4MTOA 2AHYA 4WFHA 1M57C 3GB7C 4R50A 5EK0A 4RUEA 3ABKC 4TWKA 2HJFC 3BEHA 3OR6C 4PA9A 1P7BA 2Q69A 2W0FC 3UKMA 2IH1C 4G27B 3R65A 1R3IC 2P7TC 4P9OA 4MTGA 3RW0A 4WFFA 4MVZA 4MVMA 2IH3C 3PJSK 4X89A 2WLLB 4WFEA 3EFFK 3FB6C 3T4ZA 4F4LA 1OCOC 3ZJZA 2DWDC 3LUTB 4PDLA 2HVJC 3LDEA 3K0GA 3ASNC 3RVYA 2A0LA 3E8BA 3F5WC 4H37A 1QLEC 2X6BA 4ZBMA 2Q67A 4R8CA 2NLJC 4GX5A 3TETA 2AHZA 4R7CA 3K0DA 4PA7A 4PDVA 1G4YB 3FB5C 2DYRC 3HPLC 4PA4A 1OCCC 3ABMC 2ITCC 2WLMA 3K04A 1LNQA 3X2QC 3WG7C 4X8AA 3SYPA 4PA3A 5EC1C 5EC2C 3K08A 4GX1A 2DWEC 5B1BC 1K4CC 3LNMB 3KG2A 4PDRA 4XDKA 3OR7C 5EBMC 2ITDC 3T2MA 4JTCB 2WLKA 3FB8C 4JTDB 3SYAA 3E8GA 5B3SC 4OXSA 4RO2A 2ZXWC 2KB1A 4X88A 4PDMA 3E83A 3F7VC 4LP8A 4HYOA 4MW8A 4QE9A 1K4DC 4KFMA 3T1CA 3E8FA 4MVSA 1R3JC 4MW3A 2A79B 2Q6AA 4HZ3A 4MVRA 2BOBC 5BZBA 1J95A 4XDJA 3K03A 4BW5A 2DYSC 3K06A 1OCZC 3T4DA 1XL4A 1V55C 5EBLC 2Q68A 4J9ZB 4R6ZA 3SPCA 3SPJA 3FB7C 4PA6A 3ABLC 3TCUA 2BOCC 2ATKC 1BL8A 3SYOA 2EIJC 5E1AC 2WLJA 2R9RB 4RUFA 2A9HA 3OUSA 1OCRC 4MSWC 2WLNA 2Y69C 3UM7A 5KUMA 2EILC 2WLIB 3AG2C 3ZRSA
chains in the Genus database with same CATH superfamily
5BXZA 3AG3B 3HKBB 4YY3O 2UUCO 3OMIB 3LSQA 4UCSA 1AILA 1FKAO 3BCCH 5KLVH 2C2AA 2CTRA 1IBLB 1YEWA 4I5SA 5IYCO 3A0HZ 3JYCA 4LR3A 2K1EA 3PN1A 4LFBO 3OW2U 1R3KC 2QWRB 2WLIA 2M7WA 1JMKC 1XDCA 4DV3O 2FMLA 1US6A 1SF9A 3SYQA 2Y4UA 1PPJH 2AHYA 4X20A 1WB7A 2PYJA 3QF7A 1Y74A 4G27B 5IJ9B 2IM9A 2WLLB 4JI3O 1XI1A 4LF5B 1Q6UA 2A0LA 2P67A 4IHJA 1NVPD 3QNEA 2B5UA 3ZRVA 2ARHA 4UB8Z 3UO3A 3MAQA 2WSSG 5J2TB 4K35A 4PI2A 3MDSA 4DR3B 1EBOA 4PA3A 2CH7A 1YF2A 5B1BC 1Y76B 3AG2B 2AZ2A 3OAAG 1I0HA 2ITDC 1ZL8A 1RM1C 3FFQA 5L3DA 1K4DC 3CE2A 5DM6V 2JEUA 4MVSA 3ZX6A 2DYSB 2RN9A 2WA4A 5LGUA 4XDJA 1N33B 5JVDB 3K06A 4JV5B 1OCZC 4J42A 2EINB 5KX5A 3FB7C 3TCUA 5J2UB 4DV0B 3L74H 2P4KA 4O4LB 1OCRB 1P4RA 1SA0A 4W4LA 1W2BU 3JD3A 3VOUA 4MS2A 1S5HC 2DW4A 4O2BA 3RBZA 3ABKB 2XAJA 3I55V 4UCUA 5KHHA 4TOIA 5LP6B 5ITZA 3ZHTA 3E35A 4CBCA 1NQTA 4AQYO 2XAGA 2R70A 4F6EA 4QE7A 4HNAA 4X64B 2EJRA 3JASB 4B3RB 1S77D 1SKVA 4YHHB 1M57C 2JEXA 2QJ1A 4LF4O 1TUBA 5KMGB 5CA1A 2UXXA 2IH3C 1BE3H 4LF8O 1I08A 1PKXA 1DGSA 5LOVA 3ZBHA 3ZHRA 4U7OA 5JQGB 2UXNA 1O9GA 3T1YB 2QSAA 2XAHA 2L35A 3TETA 4NYKA 4JI4B 4QPKA 2P06A 5IYDO 3N2GB 4I4TA 3BAAA 4JYAO 2YIBA 2HKOA 4DK1A 1Q3EA 2EZPA 2WLKA 1MABG 4RO2A 4FZ1A 5IWAB 3Q4HB 1IVSA 4GKJB 2ODMA 4MW8A 4X9QA 5TISZ 3W7UA 4DV5O 2OTJV 4N21A 3ZEDA 2AGAA 5EYPB 3CB2A 5JCOA 1H2NA 1QHTA 3AG4B 3J81N 2F43G 1RSOA 5AG2A 2EIKB 1FXKA 4FZ0A 2BTOA 2R9RB 4I50A 5FNVA 1VQOV 1PP9H 2GV9A 5BMVA 4O2AB 4XBFA 5KHJA 4MT8A 1M5IA 3LSUA 3CCRV 5KA5A 3SPHA 2QWQB 4B08A 1Y6XA 4NXNO 2ZDIC 2L6LA 3SPGA 5BY1A 1GKFA 5F2VO 1MG1A 1Q43A 2BTQB 4PHZA 3A2FA 4K0KB 3SJQC 2IJJA 4O4IB 1XMOB 1QCEA 4KHPO 4DK0A 2OWOA 3W7WA 1V54C 4X66B 5A9GA 5GTIZ 2DQ0A 1W59A 2LO1A 3WB0A 4RUEA 1FYJA 3JALA 1WP8A 4OPAA 2CTPA 2QKAA 3CXHF 1AB3A 4NXMO 4JI0O 1N32O 1F4NA 1H2KA 4J10A 5L3FA 3ABLB 3RWRD 2ITCC 1BGYH 1XNRO 4IT5A 1S72V 4I9QA 3CRRA 1N0JA 4LF6B 4DV6B 1AJNA 3H1HH 5K1XA 1F7YA 3ZRWB 1Q7YW 4C7UA 3T1CA 4DR5O 4PJ0Z 3RYFA 1HNZO 1M56B 1IXBA 5IJ0B 1D5NA 4DR1B 2QR4A 2PI4A 1V55C 2EIJB 3CCQV 3O9OA 2BSKB 5E1AC 3JATA 4UCRA 1I94B 2Y69C 1SQVH 5KUMA 2EILC 2N04A 1SS3A 3RYIB 4TV9A 2IJKA 2UXBO 4P2ZA 2JRIA 1WLEA 5LHGA 4J11A 4YIPA 3AK1A 3HKEA 4H33A 4JI1O 3AK3A 4MVOA 1QR8A 3ZHSA 2JDIG 3P30A 1L1FA 1I5YA 1JVMA 3ZMVA 2GHYA 1IXMA 5IY5B 1FJGO 2ZKOA 4FLVA 5KUKA 4OX9B 3WG7B 1VQ9V 1MOFA 2OT5A 4L87A 1PNKA 4F6RA 4LF7O 1MSDA 1Q8IA 4WFFA 2UUAB 1EM1A 5B3SB 3CCVV 1N4CA 2EX3A 1QBZA 5H6QA 3K5OA 4CH6A 2ZM6B 3HKCB 1HNXO 3AK2A 1UFIA 4PDVA 1NT2B 1PL0A 3FB5C 1BMFG 3ABMC 1K9MW 3K79A 5CB4B 4DUYB 2XASA 3CHXA 1XOUA 1YVWA 5LBQA 3T2MA 4OXSA 1ZLZA 2ZXWC 3ZMZA 3NR7A 4PDMA 4CH4A 1NI8A 2ILMA 1PD3A 3CRMA 3DXRA 1AR4A 1P49A 3E22A 1COWG 1U97A 1LUVA 3RFRA 2ZR3A 3BABA 2EIMC 4DV1B 2H8PC 5DEDA 3OT7A 1SESA 1VQ5V 4DUZB 1GN3A 3QO8A 2VQEO 4WBNB 3FAVB 4CZZA 4FLYA 1YJNV 1HR0B 1X59A 2F23A 2F4VO 2OYQA 1NZ6A 3JAWA 3W7SA 4JI2B 4LWSB 3ETEA 3DGEA 2JVDA 1NS1A 1SERA 1TA8A 3C90A 4Z1MG 3BY6A 3DSQA 1J5EO 4IYHA 5B1NA 1OHHG 1P7BA 4DR6B 4BIOA 5LMUB 1U96A 1BQ0A 1ZUQA 4P9OA 1SETA 3CC2V 1SQBH 5CN0A 4X1YA 1S3JA 1OCOC 1SQXH 2E5LB 1TUEB 2HHHO 1E79G 1M93A 1XEQA 5BR8O 2VS0A 3T1HB 1SQGA 3FKSG 4CS2A 2VWJA 1EN4A 2E3CA 1R73A 1JJOA 5JCOC 2ZIOA 3HPLC 4DV4B 1WNSA 3WB1A 1FXKC 2ZQMA 2GTAA 1Q86W 5IJ9A 4UV9A 3ABTA 2FL4A 3K58A 1YXBA 2Q5ZA 1I7FA 1KQSU 2QWNB 1LUWA 2XUMA 1W0JG 4MW3A 2BOBC 4E4EA 4FK5C 3VQXA 3SDLA 5J2TA 5GONB 1VARA 3DC6A 2XT9A 2YIDA 4LF9B 2IBZH 3UM7A 4UB6Z 3ZHQA 5H5NA 4DR7O 4BAYA 2A7WA 2FTKA 3ZS8C 1M57B 4PI0A 3L70H 4DW0A 2X6CA 4JV5O 1N0NA 1F51A 4MTFA 5JVDA 1NR7A 4DV0O 2HEPA 1XL6A 2D2CB 3ASOC 3CCJV 1Z5VA 2GDSA 1XNQB 3OGCC 3K5MA 4MVUA 3RVZA 4HAMA 2A06H 4JGSA 2MW2B 1ZTEA 2YXLA 4NKGB 4FLTA 3QTCA 3OM3B 1A32A 2QKSA 4CH5A 1KP3A 4QIWF 1YIJV 1KD1W 2CUGA 2Q0AA 2ZE7A 3RYCA 2CGNA 2HJFC 4EFEA 1AROP 1BHBA 5LP6A 2ADPA 2CTQA 2DMXA 2P7TC 4RQFA 3PJSK 5LXTA 1CPYA 1UJWB 4JI6B 3U0ZA 2QM7A 3ZJZA 2OTLV 2OIGA 1GK9A 5B1OA 4H37A 3JASA 4YHHO 4JI7O 4JI8B 1M4UA 4IGGA 1FD9A 1GM7A 1G4YB 3VQWA 2MK3A 2B1GA 3R66A 5LMNO 5KMGA 2WAMA 3RYHB 4GX1A 4D7TA 5C8YB 3CXCU 3VQVA 4B3TO 2QTSA 4I55B 1NBMG 1WPBA 5L3GA 2H3OA 3G6EV 2EULA 2V1DA 4FLUA 3MHSC 4J80A 5JQGA 4TQFA 4JI4O 5L3CA 5E79Z 4E2LA 2M6YA 4HZ3A 3EHBB 4BW5A 2QM4A 4J7KA 1VMGA 3N2GA 3H1LH 4UV8A 4DR4B 1SRYA 4QPJA 1V54B 1V9PA 1Y4MA 2GTSA 2XHBA 1QVFU 3CCEV 3L71H 1VIBA 4ZI7B 1M1KW 3G80A 1H38A 4FIPC 3IC7A 4IYIA 1MA1A 3DC5A 2IU0A 2PTMA 1ZWIC 4FVMA 3E8HA 2ZR2A 1OJHA 1YITV 4RWUA 3H1KH 2W0XA 4P9PA 1YSCA 5FL7G 4DXWA 3BVOA 2RNBA 3CC7V 2KG7A 1G6UA 5K1PA 3KKYA 4O2AA 4ASUG 2D3OW 5B1AC 1B6QA 1AI5A 4X1KB 3TXSA 4UCOA 4GYCB 2F1MA 4FPPA 2W6JG 1RPRA 1EN6A 2VQFB 4PA9A 2W0FC 1XMOO 4DV2O 2BTQA 1HWYA 4LC1A 4EEQA 4OPHA 3RVYA 2YIBD 3FX7A 4GT1A 2QEXV 1QU7A 4YY3B 2R9AA 2UUCB 3E2EA 5LA6B 2AHZA 1PM9A 4R7CA 3K0DA 3M8AA 1V55B 2ZCEA 3ZMUA 4EFBA 1LNQA 5EC2C 3K08A 2Y69B 1K5QA 2EILB 1JJ2U 1KECA 4JYYA 4LFBB 3ICXA 3QO5A 2ADQB 1FXVA 1B06A 4FMTA 4DR2O 1XQ8A 3AG7A 3E83A 1H2LA 4DV3B 1MSWD 4Z2WA 4X20B 4MVRA 1NH2D 1J95A 3K03A 3H1JH 3T4DA 1B04A 4R6ZA 4ZOLB 4PA6A 1QNMA 1VF6A 1NKDA 4WF9V 3GVMA 1ZAUA 4JI3B 1HDJA 1XHZA 3HKDA 1P7GA 3ZRWA 1BHAA 5DECA 1EN5A 5HFMA 2HLDG 4NB5A 2IJIA 1IBKO 1GRJA 3BPZA 3JAKB 1YTFD 5IJ0A 2Z5UA 1Y66A 5EZYB 3JCZA 4QNHB 3AG1B 3CC4V 3B4SA 3TK1A 3ZN1A 2G38A 1MMMA 1YCIA 3UT5B 2BSKA 2HVKC 1AI7A 1ZL8B 5B5EZ 3EVKA 4TUYA 4KUMA 3RYIA 1Z2GA 4GX2A 1SC5B 2LQTA 3B8NA 5GW7A 2IJHA 4MTOA 4WFHA 2GUZB 5KX5B 2IH1C 1TGOA 1FFXB 2UU9O 3RW0A 1NVPB 4LFAO 1BQZA 4O4HB 4F4LA 1F23A 3T4ZA 3ASNB 2ZXWB 4YJ2B 5LGNA 2QDOA 3CWBH 1PNMA 4O2BB 3N27A 1S5LZ 4OX9O 2LGQA 4X62B 4LFCO 1GM9A 1WPXA 1OCCB 1BS3A 1L0LH 1R1BA 1WA8A 3B40A 3ETDA 3SYPA 2ETNA 1O9HA 4AQYB 2JIZG 4HNAB 2E74B 5JH7B 3KG2A 4PDRA 3D36A 5EBMC 4X65B 3OGIB 1XUQA 4B7KA 3EXAA 3NXSA 3OFNG 1VQKV 2UXCO 3QVNA 1G8MA 3HKCA 3IJ4A 2HR3A 1RP3B 1IZ3A 2HJDA 1TUBB 2DYSC 4DUYO 1HP8A 1S5JA 4LF4B 1XBLA 2QKCA 2VRZA 1Q5OA 1YI2V 4D7SA 1OCRC 4IIJA 4LF8B 1Q6IA 3JARA 3I56V 3FD9A 3MD0A 1VP7A 3B09A 5EIBD 3TGUH 3JD4A 4I4TB 3VQYA 3OUFA 2B9ZA 2WLHA 1X4TA 4EB6B 4Q20A 4JYAB 3CX5F 2YICA 3ZRXA 1OCOB 4G28B 1SZXA 2ZD9A 3SYCA 4AI8A 1CEZA 3E89A 1AR5A 1R6TA 1SQQH 4A5UB 2P22C 4LH7A 4O4JB 3SJAC 4KL1A 1HNWB 5EK0A 2DN9A 1FXKB 1WP7A 4WBNA 4B3MB 3FAVA 1HR0O 4I50B 5FNVB 4WFAV 4H0LB 1E1RG 3APQA 5BMVB 3CS5A 3E8BA 3B8MA 3F5WC 1IURA 4LWSA 4NXNB 1GTOA 4FFBB 2DYRB 1KUQA 4PA4A 5L3EA 2LFSA 5EC1C 2LJ2A 4NVPA 2X0LA 2E5LO 2LW7A 4H13B 4JTCB 1NTZH 1EZJA 2CDYA 3A0RA 2LW1A 2YEVB 1IBMO 4HYOA 1MNGA 1R3JC 5JJEB 5FLXN 3ZIAG 5CA0B 4DV4O 3ASOB 2R72A 3JALB 1THZA 1VF5B 2BOCC 2ATKC 2E76B 4I0XB 3VBBA 2FKXA 2YUAA 1KP2A 3L9DA 1JFFB 2UXDB 3SPIA 3ZRSA 1TVKA 3S3XA 3KCXA 1R6KA 1Y67A 4MVQA 4DRXA 4NXMB 4DV7O 4JI0B 1N32B 4BIUA 2QWOB 4J9YB 2UUBB 1FFTB 3K9AA 5GONA 1DF4A 3UQ8A 2LP7A 4I9WA 5C93A 2NR5A 3K5LA 3TXQA 5IYBO 4YIOA 4WFGA 1AJQA 1N34O 1HNZB 5J9PC 1KB9F 1JOYA 3GB7C 4K8XA 5A2QN 1XMQB 5L3BA 3BEHA 3OR6C 2Q69A 1XNQO 5H2FZ 1UPGA 4JI5O 2BCCH 4B3SB 1QLEC 2X6BA 2JGDB 3B2EE 3HKBA 2OIEA 2RMKB 4R8CA 5LYJB 5IYZB 2NLJC 4PA7A 4GLXA 4U3JB 3P3NA 4UVCA 2BE3A 4ZHQB 1IBLO 3K04A 3X2QC 5B1BB 3CPWU 2YS8A 1VF6C 4JI6O 4UVAA 2EZOA 4GKKB 1RM1B 3ETQA 2K9PA 2Z3YA 4YXWG 4HBNA 3CMEV 1OCZB 2PUSA 1VQ6V 4F6RB 2PI5A 3KZIZ 1GO3F 1MZFA 1BL8A 3SYOA 2EIJC 3RYHA 4LF5O 2WLLA 5LHHA 2DE0X 3J80N 4FLXA 4CC6A 4FLWA 3FYEB 2VWKA 4DYLA 3CCUV 3W7TA 4DR3O 1H8HG 5JJNB 4DR4O 1VQ4V 1QVGU 4JPRA 4TV8B 3SJBC 1KYOF 1Y76A 4FFKA 4ZKIA 3F7YC 4BW9A 3G6BA 4ZI7A 5IY5C 5CBFA 4RAIA 3N2KB 4U7NA 3DXRB 1N33O 1F4MA 3JSNA 5B66Z 3E22B 3CRCA 1P84F 2IU3A 1MZEA 4PD4F 4JF3A 4CS4A 1FPOA 5J2UA 3UO2A 1BZKA 4O4LA 3D36C 1AJPA 1WB8A 1YZBA 1CXZB 1GN6A 4UCTA 1IDSA 2PZSA 1AVMA 4GX5A 4X1KA 3ABUA 2VQFO 3ZHVA 2RQ6A 3OEHG 1ZSPA 5KHGA 4X64O 3JAWB 2ZIMA 2O57A 5FPOA 5LGTA 4B3RO 3CP1A 4NTYA 2A79B 5LA6A 1AP5A 1JCHA 2R9IA 3OMNB 1J5EB 2FYUH 4K3AA 2A3QA 3RGBA 4X1YB 4I7ZB 1RPOA 2Q7GA 2GBOA 5HFLA 4MSWC 4LP8A 1CP9A 2HHHB 3T1YO 5BR8B 1DTOA 3BA9A 1I5XA 4GX0A 3CJHB 2N74A 3L75H 2X6AA 1ROPA 4UCVA 1BCCH 2P90A 4JTAB 5EBWC 4ZOLA 1R3LC 3ML0A 4X1IB 3ZMSA 2YXHA 2WPDG 4FLZA 5EIBC 2F66C 5IWAO 3OEEG 3E86A 4TQDA 4NTXA 1URFA 4GKJO 2JS5A 3K59A 3LDDA 3Q4HA 3SJCC 5EYPA 2OCHA 2IW5A 1R6NA 3JAKA 1L8DA 1OZ0A 4LNUB 5EZYA 1XILA 3UKMA 2CTWA 3R65A 2V7QG 4FM0A 2YDEA 4W4KA 4KP4A 4MVMA 4K8ZA 2CAZC 4WFEA 3UT5A 3EFFK 2XNDG 1QR9A 4PDLA 4AHCA 3SGIA 2HVJC 1DK1A 1KC8W 3AEIA 1PNLA 4ZBMA 4DR7B 2Q67A 1EZVH 3OD4A 3CRQA 2AW9A 3CEIA 4JZGA 2CGOA 2DOSA 1K5SA 3SR2C 2GUZA 3D3QA 2F93B 4X8AA 4K0KO 1N36B 2ZE6A 3M7MX 3LNNA 1FFXA 4BR6A 4QGPA 3IC9A 4O4IA 4YJ3B 3OR7C 4O4HA 3OTOB 4X66O 3GWKC 4YJ2A 2YXYA 4Z1VA 4KXRA 5KAFZ 4X62O 2RJZA 5DN6G 4KFMA 3HB3B 1VQPV 3RYCB 3M99B 2KSDA 2Q68A 3SPCA 3SPJA 4NR1A 5LXTB 2DQ3A 4OGQB 3G4SV 3JD1A 4RUFA 3BFRA 4X65O 5H6RA 5JH7A 3B77A 2WLIB 3QO7A 3L72H 4LBEC 1W0KG 4J7ZA 4JI7B 2QA4V 2OCCC 1Y74B 1KMIZ 2HG5C 1K97A 1K7DA 5LMNB 1DLBA 3H1IH 1GH6A 4CH3A 4B3TB 4LF6O 4DV6O 1FAFA 4IHJB 4P30A 3K57A 3OTFA 1D2DA 1IX9A 1NJIW 3AG3C 4Q6GA 1ORQC 4DR1O 4R50A 1VQ8V 1DF5A 4TT3G 4UVBA 4EB6A 2QWPB 2CH7B 1XHXA 3S3WA 1JR9A 5H9CA 1I94O 4X89A 3ETGA 2CE4A 2KKWA 3TJTA 4FM2A 2YI8A 1WJZA 4DW1A 4LH6A 2AZ0A 3WU2Z 4O4JA 1HNWO 3BHPA 5JJJB 1Z5WA 3ABMB 3CCLV 1PL4A 4B3MO 1H8EG 2WLMA 2W6IG 4GUNA 1XREA 2PGGA 2Q73A 1SA0B 1GMGA 2X7RB 2KG7B 3LNMB 2F95B 2QGNA 2P6JA 1VEWA 3KCYA 3APOA 4J41A 1FXHA 5FPRA 3P32A 1LR1A 4QE9A 4JYCA 2DJVA 3E8FA 2Q6AA 4FFBA 2PF4E 4UFZA 4JAUA 5ITZB 3OE7G 1XL4A 5EBLC 5CMUA 1AI4A 4DV2B 2UUAO 1VQMV 2A9HA 2EIMB 3AG2C 5IDJA 4LCUC 2ZM6O 4BIZA 1H2MA 2ZE8A 3THOA 3RN4A 2YEVA 2ZE5A 2QM8A 2LFRA 1OV9A 4PELA 2EJ7A 1K8AW 2Q0OC 3F5TA 4EKWA 1Q6HA 5CA0A 2P5OA 5CA1B 2XTAA 1NTMH 1TAEA 5CB4A 3MHHC 1SZTA 2EINC 4I0XA 1AR1B 4N23A 2UXDO 1E1QG 4TSFG 4PV1B 1M90W 1QLEB 1GM8A 5LOVB 2PY5A 1JFFA 2KQXA 5KA6A 2JJ1G 1Q82W 3CYOA 4DR2B 3JCUZ 1QQCA 3X2QB 1T5EA 3ABKC 1JA8A 4TWKA 2UUBO 2GSMB 2Q8VA 4GCZA 5LP6C 2WA3A 1R3IC 4MVZA 4RQEA 3HKDB 2DWDC 1AI6A 3K3WA 3LUTB 4AILC 2H94A 3K0GA 2YSUB 3I5DA 5GTHZ 1RFYA 4DV1O 3U10A 2YC0A 3CCSV 4DUZO 4CS3A 4L8JA 1XMQO 1BSMA 1SQPH 4JYBA 4DV5B 1RSOB 1IBKB 2WWWA 4JZ2A 4XDKA 4TUYB 5IT9N 2XOKG 4B3SO 3H9VA 1NH2B 4JI2O 4IL6Z 4JTDB 3E8GA 2Y0PA 3CD6V 3IAYA 2JGDA 5LYJA 5IYZA 3P3PA 5BZBA 1FS0G 4U3JA 2Q7HA 4DR6O 2CK3G 4ZHQA 5LMUO 4J9ZB 5D5PA 1VQLV 2WLJA 2UU9B 2RCVA 2F4VB 1NR1A 5D5QA 4GKKO 4KHPB 4LFAB 2P4VA 4H44B 2Q9LA 4WCEV 3T1HO 4FJCC 1WAZA 1YTFB 3D3IA 2JK5C 5KHKA 4LFCB 1Q90D 1K33A 1WA8B 4WFBV 3STLC 2ZNJA 3K9SA 3FYIB 1SQFA 3LDCA 5LHIA 3AG4C 2Q4PA 1WN7A 3AG1C 2EIKC 3BA8A 1JPXA 1KKCA 2V4DA 4DO2A 3W7XA 1GN4A 2ZT9B 5LL6Y 2HFEC 2UXCB 2XAFA 2YIAA 3GWOA 3K5NA 2Q7EA 1VQNV 2N05A 3OMAB 4MTGA 4IIJB 1XNRB 4LF9O 3FB6C 3JARB 4TV8A 3LDEA 3ASNC 3RYFB 3A8TA 4CC5A 1K73W 2NNUA 4NTWA 1EFRG 4DR5B 1K34A 1B3QA 3N2KA 1QLNA 3CMAV 1VQ7V 1OCCC 1D5AA 1K3EA 2LGWA 2E75B 2HP8A 3JATB 2NN4A 3JD0A 4JAVA 3BRCA 4TV9B 1GN2A 1S0VA 1M9NA 4X88A 2YI9A 3ZCCA 2UXBB 2Y4TA 1HW7A 3D8CA 4G2KA 4J7JA 3HKEB 4ICGA 4JI1B 3ABLC 2EBOA 2RDCA 2Y0IA 3O65A 3OUSA 2WLNA 2Z0AA 2Y48A 1VF7A 1G1XB 4JI8O 1FJGB 2PYLA 3C3SA 5JWPA 3IFXA 3STZC 1M56C 2ZINA 1KU9A 1BT8A 4XDLA 2AXTZ 1YDXA 4UUJC 4LF7B 1YHQV 1KKDA 3JAMN 2B1IA 3HR0A 3L73H 5C8YA 1N8RW 3ZMTA 4I55A 1ENVA 2QTOA 3CRAA 5B1AB 3IGAC 2FB5A 1H2GA 5KAIZ 2ZDIA 3A0BZ 4FM1A 1IBMB 3CJHA 5CBGA 5CBHA 1HNXB 3JSLA 3CCMV 4QJFB 3WFVA 3ZN0A 2JS3A 4JAAA 4GZRB 4ZIBA 1Q81W 4X1IA 1TVKB 2QE7G 4B7EA 1YJ9V 1NTKH 3QG5A 4DRXB 1AP6A 1GAXA 4UXNA 1YJWV 4DV7B 2JGUA 2DYRC 3ZHUA 5KHIA 3LSSA 1L0NH 3WG7C 3J7AU 4LNUA 3UCSC 1H2SB 2DWEC 4JASA 1K4CC 1K92A 3WB2A 3RT3C 3SYAA 5CA3A 3FB8C 5B3SC 2KB1A 3F7VC 1KBHA 4D6TH 2OCCB 4ABMA 1NU1H 1JX9A 4U3FH 1N34B 1JQ0A 2ZNIA 4MTXA 1S76D 5IE9A 1N36O 3DTUB 4BWAA 2VQEB 3H01A 3CSXA 1PV0A 2XAQA 3U11A 3G67A 3JD2A 3OTOO 3G71V 1ZX3A 3C3TA 4YJ3A 4JI5B 2JJ2G
chains in the Genus database with same CATH topology
2ZR3A 3QO7A 3AG3B 3I56V 2EIMC 4LBEC 3MD0A 1W0KG 2H8PC 3OMIB 3LSQA 3JD4A 1SESA 1VQ5V 2QA4V 3OUFA 2OCCC 3QO8A 2WLHA 2C2AA 4Q20A 2HG5C 4CZZA 1K97A 4I5SA 1K7DA 1DLBA 5IYCO 3ZRXA 1OCOB 1YJNV 4G28B 3JYCA 2ZD9A 3SYCA 1CEZA 2K1EA 3E89A 4P30A 3OW2U 1R3KC 2WLIA 3W7SA 2M7WA 3ETEA 3DGEA 1NJIW 3AG3C 1SERA 3SYQA 1ORQC 4Z1MG 2AHYA 3BY6A 4R50A 5EK0A 1DF5A 1VQ8V 1FXKB 4TT3G 5B1NA 1OHHG 1P7BA 4UVBA 4G27B 4WFAV 4P9OA 5H9CA 1E1RG 1SETA 4X89A 3ETGA 3CC2V 2WLLB 5CN0A 1S3JA 1OCOC 1TUEB 1E79G 2A0LA 2P67A 3B8MA 3E8BA 3F5WC 1NVPD 3FKSG 3QNEA 2B5UA 3ZRVA 1GTOA 1R73A 2DYRB 3ABMB 3CCLV 2WSSG 1H8EG 3HPLC 4PA4A 2WLMA 2W6IG 1EBOA 5L3EA 1FXKC 2LFSA 4PA3A 2ZQMA 5EC1C 1Q86W 2X0LA 4UV9A 2X7RB 1GMGA 3ABTA 5B1BC 3LNMB 3AG2B 3OAAG 2P6JA 2ITDC 4JTCB 1RM1C 1KQSU 1EZJA 3A0RA 1FXHA 5L3DA 2YEVB 3P32A 4HYOA 4QE9A 1K4DC 4JYCA 1W0JG 2JEUA 1R3JC 3E8FA 4MVSA 2Q6AA 4MW3A 5DM6V 2BOBC 2DYSB 5LGUA 3ZIAG 4XDJA 4JAUA 4FK5C 3K06A 1OCZC 3ASOB 3OE7G 1XL4A 5EBLC 2EINB 1THZA 5CMUA 3FB7C 3TCUA 1AI4A 2ATKC 2BOCC 1VQMV 1OCRB 3VBBA 1P4RA 2A9HA 3UM7A 1KP2A 2EIMB 1W2BU 3AG2C 3SPIA 3ZRSA 3JD3A 3VOUA 5IDJA 4LCUC 4BAYA 4MS2A 1R6KA 4BIZA 2FTKA 1S5HC 4MVQA 2DW4A 1M57B 2YEVA 3RBZA 2QM8A 2LFRA 2XAJA 3ABKB 2X6CA 4PELA 4BIUA 3I55V 1K8AW 1F51A 4EKWA 4MTFA 1NR7A 4J9YB 3E35A 1XL6A 4CBCA 1FFTB 1NQTA 3ASOC 3K9AA 3CCJV 3MHHC 1DF4A 1SZTA 2EINC 2LP7A 3OGCC 4I9WA 5C93A 2XAGA 1AR1B 4N23A 4MVUA 1E1QG 4TSFG 4QE7A 3RVZA 4HAMA 1M90W 1QLEB 1GM8A 4JGSA 2EJRA 5IYBO 5KA6A 2JJ1G 4WFGA 1Q82W 3CYOA 3OM3B 1S77D 2QKSA 1AJQA 1KP3A 4QIWF 1YIJV 1KD1W 5J9PC 1JOYA 1M57C 2JEXA 3GB7C 3X2QB 3ABKC 4TWKA 2GSMB 2HJFC 3BEHA 1AROP 3OR6C 5L3BA 1BHBA 2Q69A 4GCZA 1R3IC 2UXXA 2P7TC 4MVZA 4RQFA 2IH3C 3PJSK 4RQEA 1CPYA 1UJWB 2OTLV 2QM7A 2DWDC 1AI6A 3ZJZA 3K3WA 3LUTB 1PKXA 2H94A 3K0GA 2YSUB 1GK9A 5B1OA 4U7OA 4H37A 1QLEC 2X6BA 2UXNA 4R8CA 2XAHA 3CCSV 2NLJC 3TETA 1GM7A 4PA7A 1G4YB 4QPKA 4JYBA 4UVCA 5IYDO 2MK3A 3K04A 3X2QC 2WWWA 2B1GA 2WAMA 5B1BB 3CPWU 4GX1A 3CXCU 2HKOA 5L3GA 1NBMG 4XDKA 4UVAA 2XOKG 2EZOA 1RM1B 2EZPA 1NH2B 2WLKA 4JTDB 3E8GA 1MABG 2Z3YA 4RO2A 3G6EV 2V1DA 3CD6V 3MHSC 5L3CA 4MW8A 4YXWG 3CMEV 4E2LA 3W7UA 2OTJV 4N21A 4HZ3A 5BZBA 3EHBB 1OCZB 3AG4B 4BW5A 1FS0G 2F43G 1VQ6V 2CK3G 2PI5A 2EIKB 4J9ZB 1FXKA 1GO3F 4UV8A 1SRYA 1BL8A 3SYOA 2EIJC 1VQLV 4QPJA 2WLJA 2R9RB 1V54B 1Y4MA 1VQOV 1NR1A 1QVFU 3CCEV 2WLLA 4XBFA 4MT8A 4WCEV 5LHHA 3CCRV 4FJCC 5KA5A 1M1KW 3SPHA 1YTFB 1H38A 4FIPC 3IC7A 2ZDIC 3D3IA 2JK5C 2IU0A 1K33A 1ZWIC 3FYEB 3E8HA 4WFBV 3SPGA 3STLC 2ZR2A 1GKFA 1YITV 3CCUV 3FYIB 1MG1A 3LDCA 5LHIA 3W7TA 1H8HG 3AG4C 4P9PA 1YSCA 5FL7G 1VQ4V 1QVGU 4DXWA 3SJQC 2IJJA 3AG1C 2EIKC 1QCEA 1JPXA 3CC7V 3W7WA 4JPRA 4DO2A 3W7XA 1V54C 4ZKIA 4ASUG 3F7YC 2D3OW 5B1AC 2HFEC 1B6QA 5IY5C 1AI5A 5CBFA 2XAFA 2DQ0A 4RAIA 4U7NA 4FPPA 1F4MA 2W6JG 3GWOA 1RPRA 4RUEA 4PA9A 1VQNV 2W0FC 2IU3A 3OMAB 4MTGA 1HWYA 4JF3A 4LC1A 3FB6C 1AJPA 3LDEA 3RVYA 3ASNC 4GT1A 2QEXV 3E2EA 4GX5A 1K73W 2NNUA 2AHZA 1F4NA 4R7CA 3K0DA 1EFRG 3ABUA 1K34A 1V55B 1QLNA 3CMAV 1VQ7V 5L3FA 1OCCC 3ZMUA 3ABLB 2ITCC 1K3EA 1LNQA 5EC2C 3K08A 3OEHG 2Y69B 1K5QA 1S72V 2EILB 3JD0A 1JJ2U 4JAVA 1KECA 1AJNA 3ZRWB 3QO5A 1Q7YW 1FXVA 5LGTA 1S0VA 3CP1A 4FMTA 1M9NA 4X88A 3ZCCA 3E83A 1MSWD 3T1CA 1M56B 2A79B 4MVRA 1NH2D 4G2KA 1J95A 3K03A 1JCHA 2R9IA 3OMNB 3T4DA 2PI4A 1V55C 4R6ZA 2EIJB 3CCQV 4PA6A 3ABLC 5E1AC 1NKDA 1RPOA 2EBOA 4WF9V 3OUSA 5HFLA 4MSWC 2WLNA 2Y69C 2Y48A 5KUMA 2EILC 4LP8A 1CP9A 3ZRWA 2IJKA 1BHAA 1DTOA 4P2ZA 1I5XA 4GX0A 5HFMA 2HLDG 1WLEA 3IFXA 5LHGA 2IJIA 2X6AA 3STZC 1M56C 4H33A 1YTFD 1ROPA 1Y66A 2Z5UA 4MVOA 1QR8A 4XDLA 3JCZA 4QNHB 2P90A 3AG1B 2JDIG 3CC4V 4JTAB 5EBWC 4UUJC 3TK1A 3ZN1A 1R3LC 3ML0A 1YHQV 1KKDA 3P30A 2HVKC 3ZMSA 2B1IA 1L1FA 1N8RW 1AI7A 1I5YA 1JVMA 3ZMTA 2WPDG 1ENVA 2QTOA 3ZMVA 5B1AB 2GHYA 3IGAC 4KUMA 3OEEG 1IXMA 3E86A 5IY5B 1H2GA 4GX2A 3LDDA 3B8NA 5GW7A 2ZDIA 2IJHA 5CBGA 5CBHA 5KUKA 4MTOA 4WFHA 3WG7B 1VQ9V 3CCMV 1MOFA 4QJFB 2IW5A 1R6NA 2OT5A 1OZ0A 4L87A 1PNKA 3UKMA 3WFVA 2IH1C 3ZN0A 3R65A 2V7QG 4KP4A 3RW0A 4WFFA 1NVPB 4MVMA 4WFEA 3EFFK 4F4LA 1F23A 3T4ZA 2XNDG 1Q81W 3ASNB 5B3SB 1QR9A 2ZXWB 4PDLA 2QE7G 1QBZA 3CCVV 2HVJC 5LGNA 1KC8W 5H6QA 1YJ9V 3AEIA 1PNLA 1PNMA 4ZBMA 2Q67A 4UXNA 1YJWV 1GM9A 1WPXA 4PDVA 1OCCB 1K5SA 1PL0A 3FB5C 2DYRC 1BMFG 3ABMC 1K9MW 3LSSA 3K79A 4X8AA 3WG7C 3ETDA 3SYPA 2XASA 2DWEC 5LBQA 2JIZG 4JASA 1K4CC 3KG2A 4PDRA 1K92A 3D36A 3OR7C 5EBMC 3T2MA 3SYAA 5CA3A 3FB8C 5B3SC 3NXSA 4OXSA 2ZXWC 3OFNG 2KB1A 3ZMZA 1VQKV 4PDMA 3F7VC 1G8MA 5DN6G 2OCCB 4KFMA 3HB3B 2HR3A 1VQPV 1JX9A 1JQ0A 1PD3A 3M99B 2DYSC 4MTXA 1S76D 3DTUB 3H01A 2Q68A 3SPCA 3SPJA 2DQ3A 3G4SV 2XAQA 1COWG 3JD1A 1YI2V 4RUFA 3JD2A 5H6RA 3G71V 1OCRC 3B77A 2WLIB 2JJ2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOU A;  2EIM C;  4LBE C;  4LCU C;  3SPH A;  4MS2 A;  2H8P C;  4P2Z A;  1S5H C;  4GX0 A;  4MVQ A;  2YEV A;  3RBZ A;  2JK5 C;  2X6C A;  3IFX A;  1ZWI C;  2X6A A;  3OUF A;  2OCC C;  3E8H A;  3SPG A;  3STL C;  2WLH A;  3STZ C;  1M56 C;  4H33 A;  4EKW A;  3LDC A;  4MVO A;  4MTF A;  4XDL A;  3AG4 C;  4J9Y B;  4P9P A;  2HG5 C;  1XL6 A;  4CBC A;  4QNH B;  4JTA B;  5EBW C;  3ASO C;  3SJQ C;  4DXW A;  3AG1 C;  4UUJ C;  2EIK C;  1R3L C;  4G28 B;  2EIN C;  3OGC C;  4I9W A;  1KKD A;  3JYC A;  2ZD9 A;  2HVK C;  4MVU A;  3SYC A;  1JVM A;  2K1E A;  4QE7 A;  3RVZ A;  1V54 C;  3E89 A;  2QTO A;  2WLL A;  4P30 A;  3IGA C;  1R3K C;  2WLI A;  3F7Y C;  3SPI A;  3E86 A;  4WFG A;  5B1A C;  4GX2 A;  2HFE C;  3LDD A;  2QKS A;  3AG3 C;  5IY5 C;  5CBF A;  3SYQ A;  1ORQ C;  4RAI A;  5CBG A;  5CBH A;  5KUK A;  5J9P C;  4MTO A;  2AHY A;  4WFH A;  1M57 C;  3GB7 C;  4R50 A;  5EK0 A;  4RUE A;  3ABK C;  4TWK A;  2HJF C;  3BEH A;  3OR6 C;  4PA9 A;  1P7B A;  2Q69 A;  2W0F C;  3UKM A;  2IH1 C;  4G27 B;  3R65 A;  1R3I C;  2P7T C;  4P9O A;  4MTG A;  3RW0 A;  4WFF A;  4MVZ A;  4MVM A;  2IH3 C;  3PJS K;  4X89 A;  2WLL B;  4WFE A;  3EFF K;  3FB6 C;  3T4Z A;  4F4L A;  1OCO C;  3ZJZ A;  2DWD C;  3LUT B;  4PDL A;  2HVJ C;  3LDE A;  3K0G A;  3ASN C;  3RVY A;  2A0L A;  3E8B A;  3F5W C;  4H37 A;  1QLE C;  2X6B A;  4ZBM A;  2Q67 A;  4R8C A;  2NLJ C;  4GX5 A;  3TET A;  2AHZ A;  4R7C A;  3K0D A;  4PA7 A;  4PDV A;  1G4Y B;  3FB5 C;  2DYR C;  3HPL C;  4PA4 A;  1OCC C;  3ABM C;  2ITC C;  2WLM A;  3K04 A;  1LNQ A;  3X2Q C;  3WG7 C;  4X8A A;  3SYP A;  4PA3 A;  5EC1 C;  5EC2 C;  3K08 A;  4GX1 A;  2DWE C;  5B1B C;  1K4C C;  3LNM B;  3KG2 A;  4PDR A;  4XDK A;  3OR7 C;  5EBM C;  2ITD C;  3T2M A;  4JTC B;  2WLK A;  3FB8 C;  4JTD B;  3SYA A;  3E8G A;  5B3S C;  4OXS A;  4RO2 A;  2ZXW C;  2KB1 A;  4X88 A;  4PDM A;  3E83 A;  3F7V C;  4LP8 A;  4HYO A;  4MW8 A;  4QE9 A;  1K4D C;  4KFM A;  3T1C A;  3E8F A;  4MVS A;  1R3J C;  4MW3 A;  2A79 B;  2Q6A A;  4HZ3 A;  4MVR A;  2BOB C;  5BZB A;  1J95 A;  4XDJ A;  3K03 A;  4BW5 A;  2DYS C;  3K06 A;  1OCZ C;  3T4D A;  1XL4 A;  1V55 C;  5EBL C;  2Q68 A;  4J9Z B;  4R6Z A;  3SPC A;  3SPJ A;  3FB7 C;  4PA6 A;  3ABL C;  3TCU A;  2BOC C;  2ATK C;  1BL8 A;  3SYO A;  2EIJ C;  5E1A C;  2WLJ A;  2R9R B;  4RUF A;  2A9H A;  3OUS A;  1OCR C;  4MSW C;  2WLN A;  2Y69 C;  3UM7 A;  5KUM A;  2EIL C;  2WLI B;  3AG2 C;  3ZRS A; 
#chains in the Genus database with same CATH topology
 5BXZ A;  3AG3 B;  3HKB B;  4YY3 O;  2UUC O;  3OMI B;  3LSQ A;  4UCS A;  1AIL A;  1FKA O;  3BCC H;  5KLV H;  2C2A A;  2CTR A;  1IBL B;  1YEW A;  4I5S A;  5IYC O;  3A0H Z;  3JYC A;  4LR3 A;  2K1E A;  3PN1 A;  4LFB O;  3OW2 U;  1R3K C;  2QWR B;  2WLI A;  2M7W A;  1JMK C;  1XDC A;  4DV3 O;  2FML A;  1US6 A;  1SF9 A;  3SYQ A;  2Y4U A;  1PPJ H;  2AHY A;  4X20 A;  1WB7 A;  2PYJ A;  3QF7 A;  1Y74 A;  4G27 B;  5IJ9 B;  2IM9 A;  2WLL B;  4JI3 O;  1XI1 A;  4LF5 B;  1Q6U A;  2A0L A;  2P67 A;  4IHJ A;  1NVP D;  3QNE A;  2B5U A;  3ZRV A;  2ARH A;  4UB8 Z;  3UO3 A;  3MAQ A;  2WSS G;  5J2T B;  4K35 A;  4PI2 A;  3MDS A;  4DR3 B;  1EBO A;  4PA3 A;  2CH7 A;  1YF2 A;  5B1B C;  1Y76 B;  3AG2 B;  2AZ2 A;  3OAA G;  1I0H A;  2ITD C;  1ZL8 A;  1RM1 C;  3FFQ A;  5L3D A;  1K4D C;  3CE2 A;  5DM6 V;  2JEU A;  4MVS A;  3ZX6 A;  2DYS B;  2RN9 A;  2WA4 A;  5LGU A;  4XDJ A;  1N33 B;  5JVD B;  3K06 A;  4JV5 B;  1OCZ C;  4J42 A;  2EIN B;  5KX5 A;  3FB7 C;  3TCU A;  5J2U B;  4DV0 B;  3L74 H;  2P4K A;  4O4L B;  1OCR B;  1P4R A;  1SA0 A;  4W4L A;  1W2B U;  3JD3 A;  3VOU A;  4MS2 A;  1S5H C;  2DW4 A;  4O2B A;  3RBZ A;  3ABK B;  2XAJ A;  3I55 V;  4UCU A;  5KHH A;  4TOI A;  5LP6 B;  5ITZ A;  3ZHT A;  3E35 A;  4CBC A;  1NQT A;  4AQY O;  2XAG A;  2R70 A;  4F6E A;  4QE7 A;  4HNA A;  4X64 B;  2EJR A;  3JAS B;  4B3R B;  1S77 D;  1SKV A;  4YHH B;  1M57 C;  2JEX A;  2QJ1 A;  4LF4 O;  1TUB A;  5KMG B;  5CA1 A;  2UXX A;  2IH3 C;  1BE3 H;  4LF8 O;  1I08 A;  1PKX A;  1DGS A;  5LOV A;  3ZBH A;  3ZHR A;  4U7O A;  5JQG B;  2UXN A;  1O9G A;  3T1Y B;  2QSA A;  2XAH A;  2L35 A;  3TET A;  4NYK A;  4JI4 B;  4QPK A;  2P06 A;  5IYD O;  3N2G B;  4I4T A;  3BAA A;  4JYA O;  2YIB A;  2HKO A;  4DK1 A;  1Q3E A;  2EZP A;  2WLK A;  1MAB G;  4RO2 A;  4FZ1 A;  5IWA B;  3Q4H B;  1IVS A;  4GKJ B;  2ODM A;  4MW8 A;  4X9Q A;  5TIS Z;  3W7U A;  4DV5 O;  2OTJ V;  4N21 A;  3ZED A;  2AGA A;  5EYP B;  3CB2 A;  5JCO A;  1H2N A;  1QHT A;  3AG4 B;  3J81 N;  2F43 G;  1RSO A;  5AG2 A;  2EIK B;  1FXK A;  4FZ0 A;  2BTO A;  2R9R B;  4I50 A;  5FNV A;  1VQO V;  1PP9 H;  2GV9 A;  5BMV A;  4O2A B;  4XBF A;  5KHJ A;  4MT8 A;  1M5I A;  3LSU A;  3CCR V;  5KA5 A;  3SPH A;  2QWQ B;  4B08 A;  1Y6X A;  4NXN O;  2ZDI C;  2L6L A;  3SPG A;  5BY1 A;  1GKF A;  5F2V O;  1MG1 A;  1Q43 A;  2BTQ B;  4PHZ A;  3A2F A;  4K0K B;  3SJQ C;  2IJJ A;  4O4I B;  1XMO B;  1QCE A;  4KHP O;  4DK0 A;  2OWO A;  3W7W A;  1V54 C;  4X66 B;  5A9G A;  5GTI Z;  2DQ0 A;  1W59 A;  2LO1 A;  3WB0 A;  4RUE A;  1FYJ A;  3JAL A;  1WP8 A;  4OPA A;  2CTP A;  2QKA A;  3CXH F;  1AB3 A;  4NXM O;  4JI0 O;  1N32 O;  1F4N A;  1H2K A;  4J10 A;  5L3F A;  3ABL B;  3RWR D;  2ITC C;  1BGY H;  1XNR O;  4IT5 A;  1S72 V;  4I9Q A;  3CRR A;  1N0J A;  4LF6 B;  4DV6 B;  1AJN A;  3H1H H;  5K1X A;  1F7Y A;  3ZRW B;  1Q7Y W;  4C7U A;  3T1C A;  4DR5 O;  4PJ0 Z;  3RYF A;  1HNZ O;  1M56 B;  1IXB A;  5IJ0 B;  1D5N A;  4DR1 B;  2QR4 A;  2PI4 A;  1V55 C;  2EIJ B;  3CCQ V;  3O9O A;  2BSK B;  5E1A C;  3JAT A;  4UCR A;  1I94 B;  2Y69 C;  1SQV H;  5KUM A;  2EIL C;  2N04 A;  1SS3 A;  3RYI B;  4TV9 A;  2IJK A;  2UXB O;  4P2Z A;  2JRI A;  1WLE A;  5LHG A;  4J11 A;  4YIP A;  3AK1 A;  3HKE A;  4H33 A;  4JI1 O;  3AK3 A;  4MVO A;  1QR8 A;  3ZHS A;  2JDI G;  3P30 A;  1L1F A;  1I5Y A;  1JVM A;  3ZMV A;  2GHY A;  1IXM A;  5IY5 B;  1FJG O;  2ZKO A;  4FLV A;  5KUK A;  4OX9 B;  3WG7 B;  1VQ9 V;  1MOF A;  2OT5 A;  4L87 A;  1PNK A;  4F6R A;  4LF7 O;  1MSD A;  1Q8I A;  4WFF A;  2UUA B;  1EM1 A;  5B3S B;  3CCV V;  1N4C A;  2EX3 A;  1QBZ A;  5H6Q A;  3K5O A;  4CH6 A;  2ZM6 B;  3HKC B;  1HNX O;  3AK2 A;  1UFI A;  4PDV A;  1NT2 B;  1PL0 A;  3FB5 C;  1BMF G;  3ABM C;  1K9M W;  3K79 A;  5CB4 B;  4DUY B;  2XAS A;  3CHX A;  1XOU A;  1YVW A;  5LBQ A;  3T2M A;  4OXS A;  1ZLZ A;  2ZXW C;  3ZMZ A;  3NR7 A;  4PDM A;  4CH4 A;  1NI8 A;  2ILM A;  1PD3 A;  3CRM A;  3DXR A;  1AR4 A;  1P49 A;  3E22 A;  1COW G;  1U97 A;  1LUV A;  3RFR A;  2ZR3 A;  3BAB A;  2EIM C;  4DV1 B;  2H8P C;  5DED A;  3OT7 A;  1SES A;  1VQ5 V;  4DUZ B;  1GN3 A;  3QO8 A;  2VQE O;  4WBN B;  3FAV B;  4CZZ A;  4FLY A;  1YJN V;  1HR0 B;  1X59 A;  2F23 A;  2F4V O;  2OYQ A;  1NZ6 A;  3JAW A;  3W7S A;  4JI2 B;  4LWS B;  3ETE A;  3DGE A;  2JVD A;  1NS1 A;  1SER A;  1TA8 A;  3C90 A;  4Z1M G;  3BY6 A;  3DSQ A;  1J5E O;  4IYH A;  5B1N A;  1OHH G;  1P7B A;  4DR6 B;  4BIO A;  5LMU B;  1U96 A;  1BQ0 A;  1ZUQ A;  4P9O A;  1SET A;  3CC2 V;  1SQB H;  5CN0 A;  4X1Y A;  1S3J A;  1OCO C;  1SQX H;  2E5L B;  1TUE B;  2HHH O;  1E79 G;  1M93 A;  1XEQ A;  5BR8 O;  2VS0 A;  3T1H B;  1SQG A;  3FKS G;  4CS2 A;  2VWJ A;  1EN4 A;  2E3C A;  1R73 A;  1JJO A;  5JCO C;  2ZIO A;  3HPL C;  4DV4 B;  1WNS A;  3WB1 A;  1FXK C;  2ZQM A;  2GTA A;  1Q86 W;  5IJ9 A;  4UV9 A;  3ABT A;  2FL4 A;  3K58 A;  1YXB A;  2Q5Z A;  1I7F A;  1KQS U;  2QWN B;  1LUW A;  2XUM A;  1W0J G;  4MW3 A;  2BOB C;  4E4E A;  4FK5 C;  3VQX A;  3SDL A;  5J2T A;  5GON B;  1VAR A;  3DC6 A;  2XT9 A;  2YID A;  4LF9 B;  2IBZ H;  3UM7 A;  4UB6 Z;  3ZHQ A;  5H5N A;  4DR7 O;  4BAY A;  2A7W A;  2FTK A;  3ZS8 C;  1M57 B;  4PI0 A;  3L70 H;  4DW0 A;  2X6C A;  4JV5 O;  1N0N A;  1F51 A;  4MTF A;  5JVD A;  1NR7 A;  4DV0 O;  2HEP A;  1XL6 A;  2D2C B;  3ASO C;  3CCJ V;  1Z5V A;  2GDS A;  1XNQ B;  3OGC C;  3K5M A;  4MVU A;  3RVZ A;  4HAM A;  2A06 H;  4JGS A;  2MW2 B;  1ZTE A;  2YXL A;  4NKG B;  4FLT A;  3QTC A;  3OM3 B;  1A32 A;  2QKS A;  4CH5 A;  1KP3 A;  4QIW F;  1YIJ V;  1KD1 W;  2CUG A;  2Q0A A;  2ZE7 A;  3RYC A;  2CGN A;  2HJF C;  4EFE A;  1ARO P;  1BHB A;  5LP6 A;  2ADP A;  2CTQ A;  2DMX A;  2P7T C;  4RQF A;  3PJS K;  5LXT A;  1CPY A;  1UJW B;  4JI6 B;  3U0Z A;  2QM7 A;  3ZJZ A;  2OTL V;  2OIG A;  1GK9 A;  5B1O A;  4H37 A;  3JAS A;  4YHH O;  4JI7 O;  4JI8 B;  1M4U A;  4IGG A;  1FD9 A;  1GM7 A;  1G4Y B;  3VQW A;  2MK3 A;  2B1G A;  3R66 A;  5LMN O;  5KMG A;  2WAM A;  3RYH B;  4GX1 A;  4D7T A;  5C8Y B;  3CXC U;  3VQV A;  4B3T O;  2QTS A;  4I55 B;  1NBM G;  1WPB A;  5L3G A;  2H3O A;  3G6E V;  2EUL A;  2V1D A;  4FLU A;  3MHS C;  4J80 A;  5JQG A;  4TQF A;  4JI4 O;  5L3C A;  5E79 Z;  4E2L A;  2M6Y A;  4HZ3 A;  3EHB B;  4BW5 A;  2QM4 A;  4J7K A;  1VMG A;  3N2G A;  3H1L H;  4UV8 A;  4DR4 B;  1SRY A;  4QPJ A;  1V54 B;  1V9P A;  1Y4M A;  2GTS A;  2XHB A;  1QVF U;  3CCE V;  3L71 H;  1VIB A;  4ZI7 B;  1M1K W;  3G80 A;  1H38 A;  4FIP C;  3IC7 A;  4IYI A;  1MA1 A;  3DC5 A;  2IU0 A;  2PTM A;  1ZWI C;  4FVM A;  3E8H A;  2ZR2 A;  1OJH A;  1YIT V;  4RWU A;  3H1K H;  2W0X A;  4P9P A;  1YSC A;  5FL7 G;  4DXW A;  3BVO A;  2RNB A;  3CC7 V;  2KG7 A;  1G6U A;  5K1P A;  3KKY A;  4O2A A;  4ASU G;  2D3O W;  5B1A C;  1B6Q A;  1AI5 A;  4X1K B;  3TXS A;  4UCO A;  4GYC B;  2F1M A;  4FPP A;  2W6J G;  1RPR A;  1EN6 A;  2VQF B;  4PA9 A;  2W0F C;  1XMO O;  4DV2 O;  2BTQ A;  1HWY A;  4LC1 A;  4EEQ A;  4OPH A;  3RVY A;  2YIB D;  3FX7 A;  4GT1 A;  2QEX V;  1QU7 A;  4YY3 B;  2R9A A;  2UUC B;  3E2E A;  5LA6 B;  2AHZ A;  1PM9 A;  4R7C A;  3K0D A;  3M8A A;  1V55 B;  2ZCE A;  3ZMU A;  4EFB A;  1LNQ A;  5EC2 C;  3K08 A;  2Y69 B;  1K5Q A;  2EIL B;  1JJ2 U;  1KEC A;  4JYY A;  4LFB B;  3ICX A;  3QO5 A;  2ADQ B;  1FXV A;  1B06 A;  4FMT A;  4DR2 O;  1XQ8 A;  3AG7 A;  3E83 A;  1H2L A;  4DV3 B;  1MSW D;  4Z2W A;  4X20 B;  4MVR A;  1NH2 D;  1J95 A;  3K03 A;  3H1J H;  3T4D A;  1B04 A;  4R6Z A;  4ZOL B;  4PA6 A;  1QNM A;  1VF6 A;  1NKD A;  4WF9 V;  3GVM A;  1ZAU A;  4JI3 B;  1HDJ A;  1XHZ A;  3HKD A;  1P7G A;  3ZRW A;  1BHA A;  5DEC A;  1EN5 A;  5HFM A;  2HLD G;  4NB5 A;  2IJI A;  1IBK O;  1GRJ A;  3BPZ A;  3JAK B;  1YTF D;  5IJ0 A;  2Z5U A;  1Y66 A;  5EZY B;  3JCZ A;  4QNH B;  3AG1 B;  3CC4 V;  3B4S A;  3TK1 A;  3ZN1 A;  2G38 A;  1MMM A;  1YCI A;  3UT5 B;  2BSK A;  2HVK C;  1AI7 A;  1ZL8 B;  5B5E Z;  3EVK A;  4TUY A;  4KUM A;  3RYI A;  1Z2G A;  4GX2 A;  1SC5 B;  2LQT A;  3B8N A;  5GW7 A;  2IJH A;  4MTO A;  4WFH A;  2GUZ B;  5KX5 B;  2IH1 C;  1TGO A;  1FFX B;  2UU9 O;  3RW0 A;  1NVP B;  4LFA O;  1BQZ A;  4O4H B;  4F4L A;  1F23 A;  3T4Z A;  3ASN B;  2ZXW B;  4YJ2 B;  5LGN A;  2QDO A;  3CWB H;  1PNM A;  4O2B B;  3N27 A;  1S5L Z;  4OX9 O;  2LGQ A;  4X62 B;  4LFC O;  1GM9 A;  1WPX A;  1OCC B;  1BS3 A;  1L0L H;  1R1B A;  1WA8 A;  3B40 A;  3ETD A;  3SYP A;  2ETN A;  1O9H A;  4AQY B;  2JIZ G;  4HNA B;  2E74 B;  5JH7 B;  3KG2 A;  4PDR A;  3D36 A;  5EBM C;  4X65 B;  3OGI B;  1XUQ A;  4B7K A;  3EXA A;  3NXS A;  3OFN G;  1VQK V;  2UXC O;  3QVN A;  1G8M A;  3HKC A;  3IJ4 A;  2HR3 A;  1RP3 B;  1IZ3 A;  2HJD A;  1TUB B;  2DYS C;  4DUY O;  1HP8 A;  1S5J A;  4LF4 B;  1XBL A;  2QKC A;  2VRZ A;  1Q5O A;  1YI2 V;  4D7S A;  1OCR C;  4IIJ A;  4LF8 B;  1Q6I A;  3JAR A;  3I56 V;  3FD9 A;  3MD0 A;  1VP7 A;  3B09 A;  5EIB D;  3TGU H;  3JD4 A;  4I4T B;  3VQY A;  3OUF A;  2B9Z A;  2WLH A;  1X4T A;  4EB6 B;  4Q20 A;  4JYA B;  3CX5 F;  2YIC A;  3ZRX A;  1OCO B;  4G28 B;  1SZX A;  2ZD9 A;  3SYC A;  4AI8 A;  1CEZ A;  3E89 A;  1AR5 A;  1R6T A;  1SQQ H;  4A5U B;  2P22 C;  4LH7 A;  4O4J B;  3SJA C;  4KL1 A;  1HNW B;  5EK0 A;  2DN9 A;  1FXK B;  1WP7 A;  4WBN A;  4B3M B;  3FAV A;  1HR0 O;  4I50 B;  5FNV B;  4WFA V;  4H0L B;  1E1R G;  3APQ A;  5BMV B;  3CS5 A;  3E8B A;  3B8M A;  3F5W C;  1IUR A;  4LWS A;  4NXN B;  1GTO A;  4FFB B;  2DYR B;  1KUQ A;  4PA4 A;  5L3E A;  2LFS A;  5EC1 C;  2LJ2 A;  4NVP A;  2X0L A;  2E5L O;  2LW7 A;  4H13 B;  4JTC B;  1NTZ H;  1EZJ A;  2CDY A;  3A0R A;  2LW1 A;  2YEV B;  1IBM O;  4HYO A;  1MNG A;  1R3J C;  5JJE B;  5FLX N;  3ZIA G;  5CA0 B;  4DV4 O;  3ASO B;  2R72 A;  3JAL B;  1THZ A;  1VF5 B;  2BOC C;  2ATK C;  2E76 B;  4I0X B;  3VBB A;  2FKX A;  2YUA A;  1KP2 A;  3L9D A;  1JFF B;  2UXD B;  3SPI A;  3ZRS A;  1TVK A;  3S3X A;  3KCX A;  1R6K A;  1Y67 A;  4MVQ A;  4DRX A;  4NXM B;  4DV7 O;  4JI0 B;  1N32 B;  4BIU A;  2QWO B;  4J9Y B;  2UUB B;  1FFT B;  3K9A A;  5GON A;  1DF4 A;  3UQ8 A;  2LP7 A;  4I9W A;  5C93 A;  2NR5 A;  3K5L A;  3TXQ A;  5IYB O;  4YIO A;  4WFG A;  1AJQ A;  1N34 O;  1HNZ B;  5J9P C;  1KB9 F;  1JOY A;  3GB7 C;  4K8X A;  5A2Q N;  1XMQ B;  5L3B A;  3BEH A;  3OR6 C;  2Q69 A;  1XNQ O;  5H2F Z;  1UPG A;  4JI5 O;  2BCC H;  4B3S B;  1QLE C;  2X6B A;  2JGD B;  3B2E E;  3HKB A;  2OIE A;  2RMK B;  4R8C A;  5LYJ B;  5IYZ B;  2NLJ C;  4PA7 A;  4GLX A;  4U3J B;  3P3N A;  4UVC A;  2BE3 A;  4ZHQ B;  1IBL O;  3K04 A;  3X2Q C;  5B1B B;  3CPW U;  2YS8 A;  1VF6 C;  4JI6 O;  4UVA A;  2EZO A;  4GKK B;  1RM1 B;  3ETQ A;  2K9P A;  2Z3Y A;  4YXW G;  4HBN A;  3CME V;  1OCZ B;  2PUS A;  1VQ6 V;  4F6R B;  2PI5 A;  3KZI Z;  1GO3 F;  1MZF A;  1BL8 A;  3SYO A;  2EIJ C;  3RYH A;  4LF5 O;  2WLL A;  5LHH A;  2DE0 X;  3J80 N;  4FLX A;  4CC6 A;  4FLW A;  3FYE B;  2VWK A;  4DYL A;  3CCU V;  3W7T A;  4DR3 O;  1H8H G;  5JJN B;  4DR4 O;  1VQ4 V;  1QVG U;  4JPR A;  4TV8 B;  3SJB C;  1KYO F;  1Y76 A;  4FFK A;  4ZKI A;  3F7Y C;  4BW9 A;  3G6B A;  4ZI7 A;  5IY5 C;  5CBF A;  4RAI A;  3N2K B;  4U7N A;  3DXR B;  1N33 O;  1F4M A;  3JSN A;  5B66 Z;  3E22 B;  3CRC A;  1P84 F;  2IU3 A;  1MZE A;  4PD4 F;  4JF3 A;  4CS4 A;  1FPO A;  5J2U A;  3UO2 A;  1BZK A;  4O4L A;  3D36 C;  1AJP A;  1WB8 A;  1YZB A;  1CXZ B;  1GN6 A;  4UCT A;  1IDS A;  2PZS A;  1AVM A;  4GX5 A;  4X1K A;  3ABU A;  2VQF O;  3ZHV A;  2RQ6 A;  3OEH G;  1ZSP A;  5KHG A;  4X64 O;  3JAW B;  2ZIM A;  2O57 A;  5FPO A;  5LGT A;  4B3R O;  3CP1 A;  4NTY A;  2A79 B;  5LA6 A;  1AP5 A;  1JCH A;  2R9I A;  3OMN B;  1J5E B;  2FYU H;  4K3A A;  2A3Q A;  3RGB A;  4X1Y B;  4I7Z B;  1RPO A;  2Q7G A;  2GBO A;  5HFL A;  4MSW C;  4LP8 A;  1CP9 A;  2HHH B;  3T1Y O;  5BR8 B;  1DTO A;  3BA9 A;  1I5X A;  4GX0 A;  3CJH B;  2N74 A;  3L75 H;  2X6A A;  1ROP A;  4UCV A;  1BCC H;  2P90 A;  4JTA B;  5EBW C;  4ZOL A;  1R3L C;  3ML0 A;  4X1I B;  3ZMS A;  2YXH A;  2WPD G;  4FLZ A;  5EIB C;  2F66 C;  5IWA O;  3OEE G;  3E86 A;  4TQD A;  4NTX A;  1URF A;  4GKJ O;  2JS5 A;  3K59 A;  3LDD A;  3Q4H A;  3SJC C;  5EYP A;  2OCH A;  2IW5 A;  1R6N A;  3JAK A;  1L8D A;  1OZ0 A;  4LNU B;  5EZY A;  1XIL A;  3UKM A;  2CTW A;  3R65 A;  2V7Q G;  4FM0 A;  2YDE A;  4W4K A;  4KP4 A;  4MVM A;  4K8Z A;  2CAZ C;  4WFE A;  3UT5 A;  3EFF K;  2XND G;  1QR9 A;  4PDL A;  4AHC A;  3SGI A;  2HVJ C;  1DK1 A;  1KC8 W;  3AEI A;  1PNL A;  4ZBM A;  4DR7 B;  2Q67 A;  1EZV H;  3OD4 A;  3CRQ A;  2AW9 A;  3CEI A;  4JZG A;  2CGO A;  2DOS A;  1K5S A;  3SR2 C;  2GUZ A;  3D3Q A;  2F93 B;  4X8A A;  4K0K O;  1N36 B;  2ZE6 A;  3M7M X;  3LNN A;  1FFX A;  4BR6 A;  4QGP A;  3IC9 A;  4O4I A;  4YJ3 B;  3OR7 C;  4O4H A;  3OTO B;  4X66 O;  3GWK C;  4YJ2 A;  2YXY A;  4Z1V A;  4KXR A;  5KAF Z;  4X62 O;  2RJZ A;  5DN6 G;  4KFM A;  3HB3 B;  1VQP V;  3RYC B;  3M99 B;  2KSD A;  2Q68 A;  3SPC A;  3SPJ A;  4NR1 A;  5LXT B;  2DQ3 A;  4OGQ B;  3G4S V;  3JD1 A;  4RUF A;  3BFR A;  4X65 O;  5H6R A;  5JH7 A;  3B77 A;  2WLI B;  3QO7 A;  3L72 H;  4LBE C;  1W0K G;  4J7Z A;  4JI7 B;  2QA4 V;  2OCC C;  1Y74 B;  1KMI Z;  2HG5 C;  1K97 A;  1K7D A;  5LMN B;  1DLB A;  3H1I H;  1GH6 A;  4CH3 A;  4B3T B;  4LF6 O;  4DV6 O;  1FAF A;  4IHJ B;  4P30 A;  3K57 A;  3OTF A;  1D2D A;  1IX9 A;  1NJI W;  3AG3 C;  4Q6G A;  1ORQ C;  4DR1 O;  4R50 A;  1VQ8 V;  1DF5 A;  4TT3 G;  4UVB A;  4EB6 A;  2QWP B;  2CH7 B;  1XHX A;  3S3W A;  1JR9 A;  5H9C A;  1I94 O;  4X89 A;  3ETG A;  2CE4 A;  2KKW A;  3TJT A;  4FM2 A;  2YI8 A;  1WJZ A;  4DW1 A;  4LH6 A;  2AZ0 A;  3WU2 Z;  4O4J A;  1HNW O;  3BHP A;  5JJJ B;  1Z5W A;  3ABM B;  3CCL V;  1PL4 A;  4B3M O;  1H8E G;  2WLM A;  2W6I G;  4GUN A;  1XRE A;  2PGG A;  2Q73 A;  1SA0 B;  1GMG A;  2X7R B;  2KG7 B;  3LNM B;  2F95 B;  2QGN A;  2P6J A;  1VEW A;  3KCY A;  3APO A;  4J41 A;  1FXH A;  5FPR A;  3P32 A;  1LR1 A;  4QE9 A;  4JYC A;  2DJV A;  3E8F A;  2Q6A A;  4FFB A;  2PF4 E;  4UFZ A;  4JAU A;  5ITZ B;  3OE7 G;  1XL4 A;  5EBL C;  5CMU A;  1AI4 A;  4DV2 B;  2UUA O;  1VQM V;  2A9H A;  2EIM B;  3AG2 C;  5IDJ A;  4LCU C;  2ZM6 O;  4BIZ A;  1H2M A;  2ZE8 A;  3THO A;  3RN4 A;  2YEV A;  2ZE5 A;  2QM8 A;  2LFR A;  1OV9 A;  4PEL A;  2EJ7 A;  1K8A W;  2Q0O C;  3F5T A;  4EKW A;  1Q6H A;  5CA0 A;  2P5O A;  5CA1 B;  2XTA A;  1NTM H;  1TAE A;  5CB4 A;  3MHH C;  1SZT A;  2EIN C;  4I0X A;  1AR1 B;  4N23 A;  2UXD O;  1E1Q G;  4TSF G;  4PV1 B;  1M90 W;  1QLE B;  1GM8 A;  5LOV B;  2PY5 A;  1JFF A;  2KQX A;  5KA6 A;  2JJ1 G;  1Q82 W;  3CYO A;  4DR2 B;  3JCU Z;  1QQC A;  3X2Q B;  1T5E A;  3ABK C;  1JA8 A;  4TWK A;  2UUB O;  2GSM B;  2Q8V A;  4GCZ A;  5LP6 C;  2WA3 A;  1R3I C;  4MVZ A;  4RQE A;  3HKD B;  2DWD C;  1AI6 A;  3K3W A;  3LUT B;  4AIL C;  2H94 A;  3K0G A;  2YSU B;  3I5D A;  5GTH Z;  1RFY A;  4DV1 O;  3U10 A;  2YC0 A;  3CCS V;  4DUZ O;  4CS3 A;  4L8J A;  1XMQ O;  1BSM A;  1SQP H;  4JYB A;  4DV5 B;  1RSO B;  1IBK B;  2WWW A;  4JZ2 A;  4XDK A;  4TUY B;  5IT9 N;  2XOK G;  4B3S O;  3H9V A;  1NH2 B;  4JI2 O;  4IL6 Z;  4JTD B;  3E8G A;  2Y0P A;  3CD6 V;  3IAY A;  2JGD A;  5LYJ A;  5IYZ A;  3P3P A;  5BZB A;  1FS0 G;  4U3J A;  2Q7H A;  4DR6 O;  2CK3 G;  4ZHQ A;  5LMU O;  4J9Z B;  5D5P A;  1VQL V;  2WLJ A;  2UU9 B;  2RCV A;  2F4V B;  1NR1 A;  5D5Q A;  4GKK O;  4KHP B;  4LFA B;  2P4V A;  4H44 B;  2Q9L A;  4WCE V;  3T1H O;  4FJC C;  1WAZ A;  1YTF B;  3D3I A;  2JK5 C;  5KHK A;  4LFC B;  1Q90 D;  1K33 A;  1WA8 B;  4WFB V;  3STL C;  2ZNJ A;  3K9S A;  3FYI B;  1SQF A;  3LDC A;  5LHI A;  3AG4 C;  2Q4P A;  1WN7 A;  3AG1 C;  2EIK C;  3BA8 A;  1JPX A;  1KKC A;  2V4D A;  4DO2 A;  3W7X A;  1GN4 A;  2ZT9 B;  5LL6 Y;  2HFE C;  2UXC B;  2XAF A;  2YIA A;  3GWO A;  3K5N A;  2Q7E A;  1VQN V;  2N05 A;  3OMA B;  4MTG A;  4IIJ B;  1XNR B;  4LF9 O;  3FB6 C;  3JAR B;  4TV8 A;  3LDE A;  3ASN C;  3RYF B;  3A8T A;  4CC5 A;  1K73 W;  2NNU A;  4NTW A;  1EFR G;  4DR5 B;  1K34 A;  1B3Q A;  3N2K A;  1QLN A;  3CMA V;  1VQ7 V;  1OCC C;  1D5A A;  1K3E A;  2LGW A;  2E75 B;  2HP8 A;  3JAT B;  2NN4 A;  3JD0 A;  4JAV A;  3BRC A;  4TV9 B;  1GN2 A;  1S0V A;  1M9N A;  4X88 A;  2YI9 A;  3ZCC A;  2UXB B;  2Y4T A;  1HW7 A;  3D8C A;  4G2K A;  4J7J A;  3HKE B;  4ICG A;  4JI1 B;  3ABL C;  2EBO A;  2RDC A;  2Y0I A;  3O65 A;  3OUS A;  2WLN A;  2Z0A A;  2Y48 A;  1VF7 A;  1G1X B;  4JI8 O;  1FJG B;  2PYL A;  3C3S A;  5JWP A;  3IFX A;  3STZ C;  1M56 C;  2ZIN A;  1KU9 A;  1BT8 A;  4XDL A;  2AXT Z;  1YDX A;  4UUJ C;  4LF7 B;  1YHQ V;  1KKD A;  3JAM N;  2B1I A;  3HR0 A;  3L73 H;  5C8Y A;  1N8R W;  3ZMT A;  4I55 A;  1ENV A;  2QTO A;  3CRA A;  5B1A B;  3IGA C;  2FB5 A;  1H2G A;  5KAI Z;  2ZDI A;  3A0B Z;  4FM1 A;  1IBM B;  3CJH A;  5CBG A;  5CBH A;  1HNX B;  3JSL A;  3CCM V;  4QJF B;  3WFV A;  3ZN0 A;  2JS3 A;  4JAA A;  4GZR B;  4ZIB A;  1Q81 W;  4X1I A;  1TVK B;  2QE7 G;  4B7E A;  1YJ9 V;  1NTK H;  3QG5 A;  4DRX B;  1AP6 A;  1GAX A;  4UXN A;  1YJW V;  4DV7 B;  2JGU A;  2DYR C;  3ZHU A;  5KHI A;  3LSS A;  1L0N H;  3WG7 C;  3J7A U;  4LNU A;  3UCS C;  1H2S B;  2DWE C;  4JAS A;  1K4C C;  1K92 A;  3WB2 A;  3RT3 C;  3SYA A;  5CA3 A;  3FB8 C;  5B3S C;  2KB1 A;  3F7V C;  1KBH A;  4D6T H;  2OCC B;  4ABM A;  1NU1 H;  1JX9 A;  4U3F H;  1N34 B;  1JQ0 A;  2ZNI A;  4MTX A;  1S76 D;  5IE9 A;  1N36 O;  3DTU B;  4BWA A;  2VQE B;  3H01 A;  3CSX A;  1PV0 A;  2XAQ A;  3U11 A;  3G67 A;  3JD2 A;  3OTO O;  3G71 V;  1ZX3 A;  3C3T A;  4YJ3 A;  4JI5 B;  2JJ2 G; 
#chains in the Genus database with same CATH homology
 2ZR3 A;  3QO7 A;  3AG3 B;  3I56 V;  2EIM C;  4LBE C;  3MD0 A;  1W0K G;  2H8P C;  3OMI B;  3LSQ A;  3JD4 A;  1SES A;  1VQ5 V;  2QA4 V;  3OUF A;  2OCC C;  3QO8 A;  2WLH A;  2C2A A;  4Q20 A;  2HG5 C;  4CZZ A;  1K97 A;  4I5S A;  1K7D A;  1DLB A;  5IYC O;  3ZRX A;  1OCO B;  1YJN V;  4G28 B;  3JYC A;  2ZD9 A;  3SYC A;  1CEZ A;  2K1E A;  3E89 A;  4P30 A;  3OW2 U;  1R3K C;  2WLI A;  3W7S A;  2M7W A;  3ETE A;  3DGE A;  1NJI W;  3AG3 C;  1SER A;  3SYQ A;  1ORQ C;  4Z1M G;  2AHY A;  3BY6 A;  4R50 A;  5EK0 A;  1DF5 A;  1VQ8 V;  1FXK B;  4TT3 G;  5B1N A;  1OHH G;  1P7B A;  4UVB A;  4G27 B;  4WFA V;  4P9O A;  5H9C A;  1E1R G;  1SET A;  4X89 A;  3ETG A;  3CC2 V;  2WLL B;  5CN0 A;  1S3J A;  1OCO C;  1TUE B;  1E79 G;  2A0L A;  2P67 A;  3B8M A;  3E8B A;  3F5W C;  1NVP D;  3FKS G;  3QNE A;  2B5U A;  3ZRV A;  1GTO A;  1R73 A;  2DYR B;  3ABM B;  3CCL V;  2WSS G;  1H8E G;  3HPL C;  4PA4 A;  2WLM A;  2W6I G;  1EBO A;  5L3E A;  1FXK C;  2LFS A;  4PA3 A;  2ZQM A;  5EC1 C;  1Q86 W;  2X0L A;  4UV9 A;  2X7R B;  1GMG A;  3ABT A;  5B1B C;  3LNM B;  3AG2 B;  3OAA G;  2P6J A;  2ITD C;  4JTC B;  1RM1 C;  1KQS U;  1EZJ A;  3A0R A;  1FXH A;  5L3D A;  2YEV B;  3P32 A;  4HYO A;  4QE9 A;  1K4D C;  4JYC A;  1W0J G;  2JEU A;  1R3J C;  3E8F A;  4MVS A;  2Q6A A;  4MW3 A;  5DM6 V;  2BOB C;  2DYS B;  5LGU A;  3ZIA G;  4XDJ A;  4JAU A;  4FK5 C;  3K06 A;  1OCZ C;  3ASO B;  3OE7 G;  1XL4 A;  5EBL C;  2EIN B;  1THZ A;  5CMU A;  3FB7 C;  3TCU A;  1AI4 A;  2ATK C;  2BOC C;  1VQM V;  1OCR B;  3VBB A;  1P4R A;  2A9H A;  3UM7 A;  1KP2 A;  2EIM B;  1W2B U;  3AG2 C;  3SPI A;  3ZRS A;  3JD3 A;  3VOU A;  5IDJ A;  4LCU C;  4BAY A;  4MS2 A;  1R6K A;  4BIZ A;  2FTK A;  1S5H C;  4MVQ A;  2DW4 A;  1M57 B;  2YEV A;  3RBZ A;  2QM8 A;  2LFR A;  2XAJ A;  3ABK B;  2X6C A;  4PEL A;  4BIU A;  3I55 V;  1K8A W;  1F51 A;  4EKW A;  4MTF A;  1NR7 A;  4J9Y B;  3E35 A;  1XL6 A;  4CBC A;  1FFT B;  1NQT A;  3ASO C;  3K9A A;  3CCJ V;  3MHH C;  1DF4 A;  1SZT A;  2EIN C;  2LP7 A;  3OGC C;  4I9W A;  5C93 A;  2XAG A;  1AR1 B;  4N23 A;  4MVU A;  1E1Q G;  4TSF G;  4QE7 A;  3RVZ A;  4HAM A;  1M90 W;  1QLE B;  1GM8 A;  4JGS A;  2EJR A;  5IYB O;  5KA6 A;  2JJ1 G;  4WFG A;  1Q82 W;  3CYO A;  3OM3 B;  1S77 D;  2QKS A;  1AJQ A;  1KP3 A;  4QIW F;  1YIJ V;  1KD1 W;  5J9P C;  1JOY A;  1M57 C;  2JEX A;  3GB7 C;  3X2Q B;  3ABK C;  4TWK A;  2GSM B;  2HJF C;  3BEH A;  1ARO P;  3OR6 C;  5L3B A;  1BHB A;  2Q69 A;  4GCZ A;  1R3I C;  2UXX A;  2P7T C;  4MVZ A;  4RQF A;  2IH3 C;  3PJS K;  4RQE A;  1CPY A;  1UJW B;  2OTL V;  2QM7 A;  2DWD C;  1AI6 A;  3ZJZ A;  3K3W A;  3LUT B;  1PKX A;  2H94 A;  3K0G A;  2YSU B;  1GK9 A;  5B1O A;  4U7O A;  4H37 A;  1QLE C;  2X6B A;  2UXN A;  4R8C A;  2XAH A;  3CCS V;  2NLJ C;  3TET A;  1GM7 A;  4PA7 A;  1G4Y B;  4QPK A;  4JYB A;  4UVC A;  5IYD O;  2MK3 A;  3K04 A;  3X2Q C;  2WWW A;  2B1G A;  2WAM A;  5B1B B;  3CPW U;  4GX1 A;  3CXC U;  2HKO A;  5L3G A;  1NBM G;  4XDK A;  4UVA A;  2XOK G;  2EZO A;  1RM1 B;  2EZP A;  1NH2 B;  2WLK A;  4JTD B;  3E8G A;  1MAB G;  2Z3Y A;  4RO2 A;  3G6E V;  2V1D A;  3CD6 V;  3MHS C;  5L3C A;  4MW8 A;  4YXW G;  3CME V;  4E2L A;  3W7U A;  2OTJ V;  4N21 A;  4HZ3 A;  5BZB A;  3EHB B;  1OCZ B;  3AG4 B;  4BW5 A;  1FS0 G;  2F43 G;  1VQ6 V;  2CK3 G;  2PI5 A;  2EIK B;  4J9Z B;  1FXK A;  1GO3 F;  4UV8 A;  1SRY A;  1BL8 A;  3SYO A;  2EIJ C;  1VQL V;  4QPJ A;  2WLJ A;  2R9R B;  1V54 B;  1Y4M A;  1VQO V;  1NR1 A;  1QVF U;  3CCE V;  2WLL A;  4XBF A;  4MT8 A;  4WCE V;  5LHH A;  3CCR V;  4FJC C;  5KA5 A;  1M1K W;  3SPH A;  1YTF B;  1H38 A;  4FIP C;  3IC7 A;  2ZDI C;  3D3I A;  2JK5 C;  2IU0 A;  1K33 A;  1ZWI C;  3FYE B;  3E8H A;  4WFB V;  3SPG A;  3STL C;  2ZR2 A;  1GKF A;  1YIT V;  3CCU V;  3FYI B;  1MG1 A;  3LDC A;  5LHI A;  3W7T A;  1H8H G;  3AG4 C;  4P9P A;  1YSC A;  5FL7 G;  1VQ4 V;  1QVG U;  4DXW A;  3SJQ C;  2IJJ A;  3AG1 C;  2EIK C;  1QCE A;  1JPX A;  3CC7 V;  3W7W A;  4JPR A;  4DO2 A;  3W7X A;  1V54 C;  4ZKI A;  4ASU G;  3F7Y C;  2D3O W;  5B1A C;  2HFE C;  1B6Q A;  5IY5 C;  1AI5 A;  5CBF A;  2XAF A;  2DQ0 A;  4RAI A;  4U7N A;  4FPP A;  1F4M A;  2W6J G;  3GWO A;  1RPR A;  4RUE A;  4PA9 A;  1VQN V;  2W0F C;  2IU3 A;  3OMA B;  4MTG A;  1HWY A;  4JF3 A;  4LC1 A;  3FB6 C;  1AJP A;  3LDE A;  3RVY A;  3ASN C;  4GT1 A;  2QEX V;  3E2E A;  4GX5 A;  1K73 W;  2NNU A;  2AHZ A;  1F4N A;  4R7C A;  3K0D A;  1EFR G;  3ABU A;  1K34 A;  1V55 B;  1QLN A;  3CMA V;  1VQ7 V;  5L3F A;  1OCC C;  3ZMU A;  3ABL B;  2ITC C;  1K3E A;  1LNQ A;  5EC2 C;  3K08 A;  3OEH G;  2Y69 B;  1K5Q A;  1S72 V;  2EIL B;  3JD0 A;  1JJ2 U;  4JAV A;  1KEC A;  1AJN A;  3ZRW B;  3QO5 A;  1Q7Y W;  1FXV A;  5LGT A;  1S0V A;  3CP1 A;  4FMT A;  1M9N A;  4X88 A;  3ZCC A;  3E83 A;  1MSW D;  3T1C A;  1M56 B;  2A79 B;  4MVR A;  1NH2 D;  4G2K A;  1J95 A;  3K03 A;  1JCH A;  2R9I A;  3OMN B;  3T4D A;  2PI4 A;  1V55 C;  4R6Z A;  2EIJ B;  3CCQ V;  4PA6 A;  3ABL C;  5E1A C;  1NKD A;  1RPO A;  2EBO A;  4WF9 V;  3OUS A;  5HFL A;  4MSW C;  2WLN A;  2Y69 C;  2Y48 A;  5KUM A;  2EIL C;  4LP8 A;  1CP9 A;  3ZRW A;  2IJK A;  1BHA A;  1DTO A;  4P2Z A;  1I5X A;  4GX0 A;  5HFM A;  2HLD G;  1WLE A;  3IFX A;  5LHG A;  2IJI A;  2X6A A;  3STZ C;  1M56 C;  4H33 A;  1YTF D;  1ROP A;  1Y66 A;  2Z5U A;  4MVO A;  1QR8 A;  4XDL A;  3JCZ A;  4QNH B;  2P90 A;  3AG1 B;  2JDI G;  3CC4 V;  4JTA B;  5EBW C;  4UUJ C;  3TK1 A;  3ZN1 A;  1R3L C;  3ML0 A;  1YHQ V;  1KKD A;  3P30 A;  2HVK C;  3ZMS A;  2B1I A;  1L1F A;  1N8R W;  1AI7 A;  1I5Y A;  1JVM A;  3ZMT A;  2WPD G;  1ENV A;  2QTO A;  3ZMV A;  5B1A B;  2GHY A;  3IGA C;  4KUM A;  3OEE G;  1IXM A;  3E86 A;  5IY5 B;  1H2G A;  4GX2 A;  3LDD A;  3B8N A;  5GW7 A;  2ZDI A;  2IJH A;  5CBG A;  5CBH A;  5KUK A;  4MTO A;  4WFH A;  3WG7 B;  1VQ9 V;  3CCM V;  1MOF A;  4QJF B;  2IW5 A;  1R6N A;  2OT5 A;  1OZ0 A;  4L87 A;  1PNK A;  3UKM A;  3WFV A;  2IH1 C;  3ZN0 A;  3R65 A;  2V7Q G;  4KP4 A;  3RW0 A;  4WFF A;  1NVP B;  4MVM A;  4WFE A;  3EFF K;  4F4L A;  1F23 A;  3T4Z A;  2XND G;  1Q81 W;  3ASN B;  5B3S B;  1QR9 A;  2ZXW B;  4PDL A;  2QE7 G;  1QBZ A;  3CCV V;  2HVJ C;  5LGN A;  1KC8 W;  5H6Q A;  1YJ9 V;  3AEI A;  1PNL A;  1PNM A;  4ZBM A;  2Q67 A;  4UXN A;  1YJW V;  1GM9 A;  1WPX A;  4PDV A;  1OCC B;  1K5S A;  1PL0 A;  3FB5 C;  2DYR C;  1BMF G;  3ABM C;  1K9M W;  3LSS A;  3K79 A;  4X8A A;  3WG7 C;  3ETD A;  3SYP A;  2XAS A;  2DWE C;  5LBQ A;  2JIZ G;  4JAS A;  1K4C C;  3KG2 A;  4PDR A;  1K92 A;  3D36 A;  3OR7 C;  5EBM C;  3T2M A;  3SYA A;  5CA3 A;  3FB8 C;  5B3S C;  3NXS A;  4OXS A;  2ZXW C;  3OFN G;  2KB1 A;  3ZMZ A;  1VQK V;  4PDM A;  3F7V C;  1G8M A;  5DN6 G;  2OCC B;  4KFM A;  3HB3 B;  2HR3 A;  1VQP V;  1JX9 A;  1JQ0 A;  1PD3 A;  3M99 B;  2DYS C;  4MTX A;  1S76 D;  3DTU B;  3H01 A;  2Q68 A;  3SPC A;  3SPJ A;  2DQ3 A;  3G4S V;  2XAQ A;  1COW G;  3JD1 A;  1YI2 V;  4RUF A;  3JD2 A;  5H6R A;  3G71 V;  1OCR C;  3B77 A;  2WLI B;  2JJ2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...