4R6ZA

Crystal structure of cng mimicking nak mutant, nak-etpp, cs+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
b'FQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
molecule tags Transport protein
source organism Bacillus cereus atcc 14579
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
total genus 33
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r6zA00
3ABLC 4HZ3A 2KB1A 2EIKC 2Q6AA 1V54C 3FB6C 4GX5A 4I9WA 3SYCA 2NLJC 2WLLA 3HPLC 1OCCC 2EIJC 3AG1C 2BOCC 4H33A 2QKSA 4P30A 2DWDC 4PDVA 3ZJZA 4CBCA 5B3SC 4WFHA 2IH3C 3E8GA 4R50A 2IH1C 3LDCA 3ZRSA 4R6ZA 3IFXA 4P2ZA 3E86A 4P9OA 4RUEA 4XDLA 2HJFC 3E8FA 2Q67A 4JTAB 1ORQC 1P7BA 4MVSA 3RVZA 2A79B 1M56C 3OR7C 3SPGA 4PA7A 3F7YC 3K0GA 5E1AC 2WLMA 2WLJA 4MVQA 4MW3A 5CBFA 3R65A 4MSWC 2HFEC 3GB7C 3JYCA 4RUFA 1XL6A 1R3LC 3FB7C 4MVRA 2ZD9A 1KKDA 3AG3C 4WFGA 1J95A 1ZWIC 3LNMB 3E8HA 5B1AC 2DYSC 2WLNA 3T2MA 4DXWA 3TETA 3KG2A 3FB8C 1G4YB 3T4DA 3K04A 4QE7A 2X6BA 3LDEA 4QE9A 2ITCC 3TCUA 1R3KC 2BOBC 5J9PC 3OUFA 2Q69A 2W0FC 3ASNC 3STZC 4R7CA 5CBGA 3K06A 4MVMA 5B1BC 2R9RB 3F5WC 4TWKA 1LNQA 5IY5C 2Q68A 4J9YB 1OCRC 2EIMC 3STLC 4LCUC 5BZBA 3RVYA 4PA3A 2EILC 5EBLC 3EFFK 3LDDA 2HVJC 5EBMC 3ABMC 3FB5C 4EKWA 4ZBMA 2P7TC 3E89A 1K4CC 4PDRA 4J9ZB 4BW5A 4R8CA 2EINC 2ZXWC 3VOUA 1R3IC 4RAIA 5KUKA 4GX1A 5KUMA 5EC2C 2Y69C 3SYOA 1K4DC 3SPCA 3E8BA 4PA6A 4OXSA 4JTDB 3OGCC 3WG7C 4KFMA 3E83A 1XL4A 4G28B 4MW8A 2HG5C 2YEVA 4PA9A 3T1CA 1V55C 2X6CA 3UKMA 2WLIA 3PJSK 4MS2A 2X6AA 4JTCB 4WFEA 4WFFA 3RW0A 2DWEC 4RO2A 3LUTB 4QNHB 1S5HC 2HVKC 1QLEC 3SYPA 4F4LA 2H8PC 4MTOA 4P9PA 3UM7A 3ABKC 3K08A 4X89A 4MVOA 5CBHA 3K0DA 3IGAC 2DYRC 2JK5C 2WLLB 4GX0A 4MVUA 4X8AA 5EC1C 3AG2C 4XDKA 4LP8A 3SPHA 2ATKC 2WLKA 4H37A 4XDJA 3SPJA 1BL8A 2ITDC 4HYOA 2QTOA 4LBEC 2OCCC 3SYQA 3X2QC 1JVMA 4PA4A 5EBWC 3AG4C 2A9HA 3F7VC 3OUSA 3T4ZA 5EK0A 4MTFA 4GX2A 4X88A 3SPIA 1M57C 4MTGA 3BEHA 1OCZC 4PDLA 4UUJC 1OCOC 3ASOC 1R3JC 2K1EA 4PDMA 3RBZA 2WLIB 2WLHA 2A0LA 3OR6C 2AHYA 4MVZA 3SYAA 2AHZA 3K03A 3SJQC 4G27B
chains in the Genus database with same CATH superfamily
3ABLC 4GKKO 2GHYA 4AHCA 2WLLA 4FFBB 2QKSA 2HHHB 2ZDIC 3X2QB 1V9PA 3KZIZ 1YITV 2PUSA 1H8HG 4GKJO 4IGGA 3ZX6A 4FLZA 3U11A 3L71H 4EFEA 1WJZA 3R65A 2HFEC 1N0NA 5FL7G 2XAJA 5B1AC 3SJCC 4CH3A 5LYJB 1PNLA 4WFAV 5KA5A 4B3SB 4CS4A 1JFFA 1ZAUA 5CBGA 2QTSA 1Q3EA 2P5OA 3P3PA 2RDCA 1VF6C 3FAVB 1KECA 2JGDA 2L6LA 4R8CA 5HFMA 3MDSA 1NJIW 3AEIA 2ILMA 3BVOA 4LF9O 5KHGA 3ABMB 1P49A 3JAWA 4BIZA 2HG5C 3K9AA 4PELA 1XILA 1AR5A 3UKMA 4LFAB 4YXWG 3RW0A 2DWEC 1FXKA 3CHXA 4MT8A 3SYPA 4F4LA 5D5PA 3SJBC 1SQBH 3H9VA 3M8AA 1AI6A 4O4LA 1YF2A 3BA8A 4LP8A 1DLBA 1M93A 2GUZA 4MTFA 3K58A 1UPGA 4IIJA 2ZM6B 3CS5A 2B1IA 4JI0B 1IXMA 3B4SA 4HZ3A 1N8RW 3H1HH 1AROP 5B3SC 4WFHA 4DR6B 4R50A 1M4UA 2Q7EA 1XNRO 1AI7A 2PGGA 1K3EA 4UCUA 1Q81W 1H8EG 5JJJB 5FNVB 1GRJA 2CTQA 5DEDA 4JI3B 3TJTA 1KU9A 4J41A 1BSMA 2G38A 1SQPH 2XAHA 1SZTA 1EBOA 1CEZA 2VQFO 4FLYA 5EYPA 3RWRD 1W2BU 1S0VA 3RT3C 5B1BC 3F5WC 1XBLA 1LNQA 1FFXB 4JYBA 1XDCA 3UT5B 2EIMC 1E1QG 4PA3A 4DV0B 3IJ4A 2EJ7A 4LFBB 1GM7A 2CH7A 5E79Z 1K5SA 3N27A 5LGUA 1N34B 4JASA 1S5JA 4GLXA 1I08A 2H94A 1DTOA 5IDJA 2O57A 3CJHA 2YUAA 1AILA 1HP8A 1ZTEA 3D3IA 4JTCB 2XUMA 1EFRG 3K5NA 4PV1B 2HVKC 1XQ8A 3ASNB 2AZ2A 1RM1C 1EZVH 4UB6Z 1NQTA 2PF4E 1NVPB 1XUQA 1KB9F 2EINB 4J7ZA 5KHJA 1K92A 4DV7O 4X1IA 2QM7A 3ETEA 1VQ7V 3AG4C 4DR4B 1EM1A 1SF9A 2OIEA 1R3JC 5IYDO 3QG5A 2DQ3A 1D2DA 3K03A 4EKWA 1WB8A 1NH2B 4DK1A 4TSFG 3CEIA 4BIUA 1IXBA 2Q6AA 1V54C 2QR4A 3FYEB 2Y4UA 5IJ9A 3OE7G 4BAYA 3IFXA 1QVFU 3UCSC 1F7YA 4RUEA 2Q67A 2JJ2G 4JI4O 2Q9LA 3ZMVA 1K34A 3Q4HA 1O9GA 4X64O 2E75B 4YY3O 5CBFA 2ZDIA 3OMIB 4NTYA 5IE9A 1R3LC 2AW9A 2XASA 1NH2D 3LSSA 2JRIA 2CAZC 5EYPB 2Z3YA 4QPJA 2ITCC 2LW7A 3OUFA 2DE0X 2P22C 4HAMA 1KYOF 4PJ0Z 4GKJB 4DV5O 3BY6A 3VQYA 4JI0O 1KP2A 2Q68A 1OCRC 3KKYA 4UXNA 1GN6A 2EJRA 1DGSA 3K79A 2Q7HA 4TV9A 4DR1O 4I5SA 2BSKB 1GM9A 3OEHG 3GWOA 4ZBMA 2HP8A 3VOUA 1FXHA 3QNEA 1BHBA 3SJAC 2UXDB 2Y69C 1K33A 3ZCCA 4OXSA 3WG7C 1MABG 2Y0PA 3WB1A 5LHIA 1MSDA 5K1XA 4WCEV 5H2FZ 3L70H 3K59A 1DF5A 3DSQA 4LF6B 1P84F 5CA0A 1W59A 2IJHA 2BCCH 3NR7A 1SQQH 5JVDA 4JI5B 2YXHA 4L87A 1F51A 4AQYO 4EB6A 3ETDA 5LGNA 2XHBA 3I56V 3G80A 5CA1B 4N23A 2OT5A 3H1LH 4YJ3B 5IWAO 3ZMUA 2AHYA 3W7WA 2VS0A 1WP8A 3BHPA 4Z1MG 3JD3A 1SQXH 5H6RA 2NLJC 3HPLC 2CE4A 4H33A 1O9HA 5J9PC 4X1KA 5B1NA 4CS3A 5EZYA 5GW7A 1MZFA 3RFRA 1OHHG 5LYJA 1THZA 4LWSA 3CMEV 2BSKA 2FL4A 1WA8A 1ZX3A 4LF7O 3HR0A 3ZBHA 3LDEA 5J2UB 4Q20A 1IBMO 1R3KC 1SKVA 4UVAA 1XNRB 1F4MA 1N32O 3ZMSA 1EN5A 3D36C 1TVKB 1JOYA 4CS2A 4J9YB 1U97A 4X65B 2LGWA 1MNGA 4JZGA 2N74A 3UO3A 1BQZA 1US6A 4FLUA 3T1HO 2DN9A 3FB5C 3CCQV 1IBMB 1K4CC 2KG7B 3B09A 2OTJV 2JVDA 5J2UA 5JCOA 4JI8O 3CSXA 4RAIA 4DK0A 2F43G 2ETNA 4YHHB 1XMQO 3RYIA 1K4DC 4FM2A 3G67A 1GN4A 4NTXA 3QO5A 3OGCC 2QKAA 3M7MX 4H44B 2W6IG 4YJ3A 4WFEA 5IJ0A 4K3AA 3WB2A 4NVPA 4JAVA 3L74H 2Y69B 3ZS8C 1Q6IA 5FPRA 3IGAC 3ZIAG 1Y74B 4F6RA 4ZI7B 3W7TA 3SPJA 3CC7V 1MZEA 2QTOA 4I55B 4PA4A 5EK0A 1VARA 5LXTB 3APQA 2W0XA 1JQ0A 2Q4PA 4DR5B 4NXNO 1XMOO 5KHKA 4MVZA 3SYAA 1DF4A 4BR6A 2JEXA 1X4TA 4FLWA 1H2KA 2DWDC 3IC9A 1ZUQA 3E8GA 3JAMN 3U0ZA 1BCCH 5IJ0B 1J5EO 4DR7B 3JSNA 4O2AA 3K0GA 5E1AC 4TV9B 3ETQA 2RQ6A 4U3JB 3SR2C 5L3CA 4WFGA 4ZOLB 3FB8C 1G4YB 2ODMA 1Q86W 2LFSA 5H9CA 1COWG 1M56B 2K9PA 4KHPB 2GTSA 3ZHRA 2JDIG 5L3DA 4G2KA 1OCZB 3A0BZ 2XT9A 1K5QA 2F4VO 5BY1A 2UXXA 4DW0A 3N2KA 3CCMV 4ZKIA 3BABA 4LC1A 2QEXV 2VRZA 1NVPD 4J11A 2F4VB 4JI6B 3ML0A 4JI7O 2Q0OC 1WB7A 1HWYA 1Q7YW 4G28B 1V55C 2X6CA 4LF8B 2YXLA 3CD6V 2VWKA 3VQVA 3L72H 1KMIZ 3JD1A 3D3QA 1MOFA 4AILC 1XHXA 2X7RB 4JI1O 1M5IA 2V1DA 2H8PC 1KUQA 1WNSA 2UXCB 3K0DA 3RN4A 2PYJA 4IT5A 3SGIA 4DRXA 3TK1A 3T1YB 2ATKC 1HNWB 4LF9B 4DV6O 1N0JA 5EBWC 1JJOA 2A9HA 5JJNB 1M57C 4MTGA 1OCOC 1SA0B 4UVBA 3B2EE 4X62O 2AHZA 5KHIA 4G27B 2P90A 2UUBB 2JGDB 2EIKC 2WWWA 2RJZA 3JAWB 4K8ZA 1RP3B 3ZJZA 3OEEG 3RYFB 1VQ8V 2A7WA 2WA3A 2RCVA 4DUYO 4MW3A 1VEWA 3AG4B 3HB3B 1AJPA 1XL6A 2PI4A 2DYSB 3K3WA 1J95A 1VIBA 4YY3B 3APOA 2N05A 3K04A 1B04A 1YCIA 1H2LA 5LP6A 3W7XA 2LGQA 1QLNA 2LW1A 1Z5VA 1JX9A 2VQEO 5LMNO 2QJ1A 3CX5F 5DN6G 1XHZA 1HR0B 1FXKC 5JWPA 1YXBA 3BRCA 4HNAA 1OCCB 4PD4F 3FX7A 4DUZO 2AGAA 4LF4O 2OIGA 2EIJB 3JCUZ 3OD4A 2Y0IA 3JD4A 2Q7GA 3ZRWA 4C7UA 4NR1A 2LP7A 4K0KB 2YIBA 1UJWB 3I5DA 4FFBA 4DW1A 3OMNB 1PPJH 3C3TA 3AG2B 2F93B 1H2NA 3CC2V 3JD0A 4Z2WA 4GKKB 1QLEC 2UXBB 4U7NA 2YI9A 1GKFA 1L0NH 4WBNB 4HBNA 4ZI7A 1N36O 4UV8A 1TA8A 4OX9B 1ZLZA 1L8DA 1M9NA 3R66A 2ITDC 3LSUA 1BT8A 4EFBA 2OCCC 3CCJV 5CA0B 1XNQO 3GVMA 4X1YA 2LFRA 4O4IA 5IYZA 5JQGA 3BFRA 1I5YA 1DK1A 1QLEB 3ZN0A 2OWOA 2EIJC 2BOCC 3BPZA 3CCLV 1GO3F 4JTAB 5KMGB 4LFAO 4ABMA 3K57A 4MVSA 1HDJA 4W4LA 1M56C 3UQ8A 4AQYB 4FLTA 2RMKB 3FKSG 2ZXWB 3G71V 2ZCEA 3OFNG 4JYCA 1M90W 1JMKC 3DXRA 4KUMA 3RYIB 3HKBB 3B77A 1CPYA 1V54B 2XAFA 3S3XA 1PKXA 3C3SA 1GM8A 1WA8B 4O2BB 3OM3B 3DC6A 4FPPA 1I5XA 5EIBD 1TVKA 3MHHC 3ABMC 2YICA 3G6BA 4UCTA 2CUGA 2UXNA 4BW5A 1I94O 4I55A 2QGNA 4AI8A 4LF7B 1IX9A 4N21A 3SPCA 3DTUB 1BZKA 4KFMA 3E22A 4KP4A 1B3QA 4GUNA 3NXSA 1N32B 5CN0A 5KX5A 4JYYA 2ZM6O 4O4IB 4DV6B 3H1IH 4IYHA 2QWRB 2GUZB 1WLEA 4P9PA 4L8JA 4LF8O 2VQFB 3KCXA 1SERA 4FVMA 2IW5A 1FYJA 1QU7A 1AI5A 3AG2C 3E35A 4XDKA 3VBBA 2PY5A 3QTCA 2CDYA 4E2LA 4GX2A 2KG7A 2WPDG 4EEQA 3RYHB 4E4EA 5B1BB 2P06A 4GT1A 1XMQB 1OCCC 3AG1C 5GONB 4J7JA 2OCCB 3RGBA 1AVMA 4TV8A 4DV4B 1ORQC 1P7BA 2ZKOA 3OR7C 4I9QA 4PA7A 4MVQA 2VQEB 3G6EV 3RYCB 2HKOA 2E3CA 2KSDA 2N04A 4UCOA 4DO2A 3E8HA 1FFXA 2DYSC 3O65A 2UUBO 1GAXA 4IHJA 1NTKH 3PN1A 4ICGA 3TCUA 3AK2A 5JH7B 3N2GA 5IT9N 4YIOA 4CH6A 2UUCB 2R9RB 4TWKA 2F95B 4K0KO 5B1OA 2ZINA 5EBLC 3EFFK 1YJNV 2EIKB 1ZL8B 5J2TA 4GCZA 1HW7A 5FLXN 1VQ6V 1V55B 4TV8B 1SQVH 4H13B 4B7KA 3FFQA 1Q43A 4JI4B 2NNUA 1AI4A 3JCZA 4JI2B 2DJVA 4PA9A 2E74B 4WFFA 2P4VA 3JATA 4TUYA 2B5UA 1TGOA 1FJGB 5C8YA 4OPAA 2HEPA 1VP7A 2IU0A 3L9DA 5ITZB 3P32A 2WA4A 1FJGO 1MMMA 3J81N 4YHHO 1N36B 3JAKA 3TXQA 1TUBA 4X66O 3A2FA 4PDLA 3ASOC 3RBZA 2FMLA 3AK3A 3SJQC 4UFZA 4D6TH 2E5LB 4DV2O 1M57B 1BE3H 1AR1B 5A2QN 1SC5B 3N2GB 4OX9O 2DQ0A 3LSQA 1YTFB 4FIPC 1E1RG 3BAAA 4DR1B 4DV2B 1LUWA 1U96A 3UT5A 4ZHQB 5LOVA 3FB7C 3JARA 1VQLV 1TAEA 1VF6A 2YIAA 4I50B 1FAFA 4JV5B 3MAQA 1KD1W 2ARHA 2IJJA 4K35A 5A9GA 3P3NA 2AZ0A 4LNUB 1I94B 3ZN1A 1QCEA 1X59A 2EILC 3A0RA 4NKGB 1QR9A 2YIDA 4O2AB 3JASA 1KBHA 1R3IC 2JJ1G 2CTRA 4LF5O 2ZE8A 5LL6Y 1NS1A 5IJ9B 3WB0A 2BE3A 3CRRA 4I4TB 4LH6A 4DR5O 4NXNB 2YXYA 4MW8A 3T1CA 4DR7O 3HKDA 4I0XA 5EZYB 3FD9A 3ABKC 3K08A 4MVOA 1S76D 2WSSG 3W7SA 3ABLB 4X8AA 1UFIA 4I4TA 5EC1C 3K5OA 1T5EA 2WLKA 4H37A 2Y48A 4DRXB 4J80A 1XMOB 2WLIB 4OPHA 3ZRVA 5KLVH 3B8MA 3QF7A 2YEVB 2QE7G 1N33B 4KXRA 1F4NA 4JAUA 4QPKA 3VQWA 1WPBA 1WPXA 2IH1C 2H3OA 4X64B 4XDLA 3O9OA 2KQXA 3HKDB 4I0XB 3JYCA 3AK1A 1R73A 1KKDA 3AG3C 3ZMTA 3CCEV 3HKEB 3TXSA 1BGYH 3T2MA 4DXWA 1Z2GA 4DUZB 1TUEB 3L75H 3ZHSA 1Q6UA 1S72V 3CE2A 1AB3A 4FLXA 2W0FC 3HKBA 1N34O 2YDEA 1QHTA 4LCUC 3RVYA 4B7EA 4DR3B 5EBMC 5LA6A 1JR9A 1JFFB 1D5AA 5KMGA 3CWBH 3BA9A 5LHGA 5KUKA 4BWAA 3QO7A 1GTOA 3AG7A 3UO2A 3E8BA 4JTDB 3ZHTA 5IWAB 2HR3A 1YZBA 1PNMA 2IM9A 4B3SO 2WLIA 3PJSK 4X9QA 3A8TA 4FLVA 2UXCO 3LUTB 4DV3O 1E79G 4BIOA 1NR7A 4LF4B 3T1YO 3CXCU 3JAKB 5GTHZ 4DV3B 3E2EA 3QVNA 3ZRXA 4JI2O 4UVCA 2ZIOA 4LBEC 1KP3A 4CZZA 3OT7A 3ICXA 1VQ9V 2QWOB 1B06A 1VQ5V 1A32A 1OCZC 3JATB 4TUYB 3K9SA 3FYIB 5H5NA 2WLHA 3W7UA 2R9IA 1VF7A 1K9MW 5BR8B 1SQFA 1IZ3A 4O4HA 1SETA 1B6QA 3SYCA 4YJ2A 5BXZA 3B40A 2GBOA 4FFKA 4KHPO 5L3FA 1Q8IA 4BW9A 1VQNV 2EZOA 3SPGA 1EN6A 4I50A 1SZXA 4JYAO 3GB7C 1IDSA 3HKCB 1PP9H 2Z0AA 2ADPA 2XOKG 2ZR3A 1OV9A 4IYIA 2WLNA 3EHBB 3TETA 3CRQA 4QE7A 2QA4V 3LNNA 4LNUA 1Q6HA 2D2CB 5CA3A 2BOBC 2D3OW 4X20A 4R7CA 5L3EA 3K06A 4UCVA 3J7AU 4IHJB 1ZL8A 1SS3A 3F5TA 3L73H 4CC6A 5IY5B 1YSCA 3CXHF 3CRCA 4ZHQA 5LOVB 3CB2A 5LGTA 1KKCA 1IBLO 5CB4B 5LMUO 4DV5B 4JV5O 1Q5OA 1JPXA 1SA0A 5KAFZ 3AG1B 2ZE7A 1H2MA 4JAAA 4GX1A 4F6EA 1JA8A 2YSUB 2XTAA 4DUYB 2ADQB 2Z5UA 5IYZB 5FNVA 1VQ4V 3A0HZ 4FM1A 1YJ9V 3CRMA 5C93A 4FM0A 1P4RA 2QWPB 3JD2A 2E76B 2QM4A 1R6TA 1LUVA 2DOSA 3ABKB 4CH4A 2JS3A 2QDOA 3CJHB 4TQFA 4DYLA 4DV0O 2R9AA 1JJ2U 1NKDA 1YTFD 1QVGU 1JVMA 1ENVA 2RN9A 3T4ZA 1S3JA 3QO8A 2EULA 3H1JH 4O4JA 2K1EA 4DV1O 4MTXA 2QKCA 1HNZB 1W0KG 1GN2A 2DYRB 3IAYA 3OMAB 2ZR2A 2JEUA 3I55V 5JVDB 3ZRWB 4WBNA 4P2ZA 1N33O 4P9OA 1FD9A 3E8FA 2FB5A 5C8YB 2EBOA 1HNXO 4A5UB 5IYBO 3G4SV 4DR2O 2UUAO 3HKEA 1K8AW 1Y76B 5BMVA 3BCCH 3D8CA 1Y6XA 1IVSA 1G6UA 1ZWIC 3LNMB 3ZHVA 2Q8VA 1NI8A 3JALA 2M7WA 1XEQA 5B1AB 2VWJA 1BQ0A 4QE9A 1P7GA 4LR3A 3OW2U 3ZMZA 5IYCO 3STZC 1R1BA 3MD0A 1FS0G 2HHHO 2ZNIA 4D7TA 2PI5A 3ZEDA 1Y66A 2UXBO 3LDDA 4NB5A 3EXAA 3EVKA 2X0LA 3E89A 4J9ZB 1FPOA 5B66Z 2EZPA 3SDLA 1VF5B 2A3QA 4LFBO 1K97A 1GH6A 5TISZ 1JCHA 3ASOB 2F23A 4LF5B 1F23A 3B8NA 4U3FH 1L1FA 1Y76A 2YEVA 4DV4O 4DR3O 1MG1A 1NBMG 4MS2A 1YI2V 3AG3B 4JPRA 4FZ0A 3H1KH 1AJQA 2EILB 1SQGA 1H2GA 3D36A 2XAGA 3H01A 4JF3A 5AG2A 4JI5O 1Y74A 1I7FA 4CC5A 5ITZA 4OGQB 5CBHA 1PNKA 1N4CA 4PHZA 2UU9O 4GZRB 2V7QG 2Y4TA 1FXVA 5CMUA 1AP5A 2XAQA 2OCHA 3ABUA 1LR1A 3ABTA 2KB1A 2LQTA 2QM8A 2P67A 4PDVA 1I0HA 1VQOV 4B3RB 4DV7B 3LDCA 1YVWA 3ZRSA 2CTPA 3E86A 1K73W 1FXKB 2A79B 2JGUA 1FKAO 1Z5WA 2WLMA 4FJCC 4JGSA 4MSWC 4RUFA 2PZSA 4U3JA 2OTLV 1Q90D 2NR5A 5L3BA 1HNWO 4X20B 4TOIA 3T4DA 2X6BA 2IJIA 1QNMA 1H38A 2Q69A 3KCYA 2BTQA 2IU3A 4J10A 5LA6B 3VQXA 5GONA 2PYLA 3JARB 3OTOB 2GDSA 5LP6C 1WP7A 2ZQMA 3CCSV 4LWSB 3RYHA 2P7TC 1URFA 2EX3A 4X1KB 5HFLA 4ZOLA 2R70A 1BS3A 4RQFA 3DGEA 5EIBC 1XL4A 4O4LB 5L3GA 3CCRV 4B3RO 5JQGB 2Q5ZA 3OAAG 4IL6Z 5JCOC 1S5HC 1PV0A 1NT2B 4CH5A 4X65O 3UM7A 1EN4A 1Y67A 1OJHA 5DM6V 4F6RB 3SPHA 3ETGA 4DR6O 4HYOA 4H0LB 4LH7A 2CTWA 3JASB 2ZIMA 4X88A 5EC2C 2CH7B 1G1XB 3MHSC 3CCVV 1HNXB 2JIZG 4EB6B 2HLDG 1NTMH 1RFYA 3FAVA 5KHHA 3FB6C 2LO1A 3CMAV 3C90A 1PL0A 2ZT9B 5LP6B 2L35A 2A06H 3JSLA 4ZIBA 5B3SB 1S5LZ 2GSMB 2WAMA 2IJKA 4DV1B 4JI7B 3ZHQA 2R72A 2MK3A 2XNDG 4W4KA 1KC8W 2ZD9A 4HNAB 4JYAB 2BTOA 4J7KA 4JZ2A 4DR2B 2UUAB 2YIBD 3K5LA 5F2VO 1NR1A 2ZNJA 5D5QA 1YHQV 1PM9A 1Y4MA 1RSOA 4MVMA 1NZ6A 2GTAA 1IBKO 4B3MB 2AXTZ 3STLC 1XREA 5BZBA 5KA6A 4O2BA 1ZSPA 5BMVB 2OYQA 1J5EB 2YS8A 4UV9A 2ZXWC 4B3MO 5B5EZ 1R6NA 2Q0AA 3U10A 4RQEA 1D5NA 2QWNB 2UXDO 2JS5A 3HKCA 4DR4O 4J42A 3T1HB 4RO2A 4QNHB 4YIPA 1YDXA 2E5LO 1G8MA 5GTIZ 4LFCO 4MTOA 1XNQB 2B9ZA 4FK5C 2DMXA 2P6JA 4X1IB 2JK5C 1M1KW 4LFCB 4NXMO 1CP9A 5H6QA 2KKWA 4FZ1A 2CGOA 4IIJB 4TQDA 1IURA 2ZE6A 1NU1H 2PTMA 2A0LA 4B08A 4JI6O 5LMNB 4GYCB 4GX5A 1YIJV 5LHHA 1NTZH 4CBCA 2IH3C 2LJ2A 4JI8B 4R6ZA 3THOA 2UU9B 2HJFC 1SESA 3P30A 4KL1A 4LF6O 3JALB 4WFBV 4UB8Z 5J2TB 4NTWA 3CP1A 3CCUV 3OTOO 1W0JG 3RYCA 1GN3A 5LMUB 3KG2A 2BTQB 2B1GA 2YI8A 5DECA 1QR8A 1KQSU 1YJWV 2IBZH 1VMGA 3CYOA 4UCSA 2ZE5A 4Q6GA 5IY5C 3M99B 4ASUG 4NXMB 1BHAA 3TGUH 3ZHUA 2Q73A 4PDRA 2DW4A 2EINC 2FKXA 5BR8O 3SYOA 3WFVA 1QBZA 2GV9A 4O4HB 4X66B 1S77D 4PA6A 4TT3G 2QWQB 3DC5A 1K7DA 3CC4V 1VQMV 2F1MA 4XBFA 1WN7A 2X6AA 1PD3A 2CGNA 4PI0A 2MW2B 5KAIZ 5JJEB 3OGIB 3CRAA 1MA1A 5CA1A 4WF9V 1HNZO 4X89A 1QQCA 2NN4A 1OCOB 2P4KA 4K8XA 1PL4A 2FYUH 3K5MA 2QSAA 2CK3G 5FPOA 3X2QC 3F7VC 1WAZA 4X1YB 1VQKV 3BEHA 4UUJC 3WG7B 4PDMA 4JI1B 3WU2Z 1YEWA 3N2KB 4PI2A 1R6KA 1MSWD 5KX5B 3IC7A 1EZJA 4I9WA 1RPOA 2FTKA 4P30A 2W6JG 1BMFG 1CXZB 1ROPA 2F66C 4I7ZB 4D7SA 1VQPV 3RVZA 5CB4A 3F7YC 1AR4A 3GWKC 1GK9A 2WLJA 1RPRA 1H2SB 4MVRA 2YC0A 1RSOB 3Q4HB 1OZ0A 1OCRB 5JH7A 1GMGA 2C2AA 3ASNC 1XOUA 2V4DA 4UCRA 2EIMB 3S3WA 4NYKA 2HJDA 3DXRB 4QIWF 4RWUA 2HVJC 2UUCO 5LBQA 5K1PA 4X62B 4O4JB 4QGPA 1XI1A 3RYFA 1FFTB 5KUMA 4YJ2B 3E83A 1IBKB 2RNBA 2M6YA 1HR0O 4Z1VA 1SRYA 3OTFA 4B3TB 4U7OA 5LXTA 3J80N 1Q82W 3CPWU 2DYRC 4FMTA 3E22B 2WLLB 4GX0A 4MVUA 4B3TO 4QJFB 4XDJA 1BL8A 3SYQA 4JI3O 1AP6A 3OUSA 1L0LH 3SPIA 1IBLB 1TUBB 1AJNA 3OR6C 1RM1B
chains in the Genus database with same CATH topology
3ABUA 3ABLC 3ABTA 2GHYA 2KB1A 1M57B 2QM8A 2JEXA 2P67A 2WLLA 1AR1B 4PDVA 1VQOV 2QKSA 2DWDC 2ZDIC 3X2QB 3E8GA 3LDCA 3ZRSA 1YITV 1H8HG 2DQ0A 3E86A 3LSQA 1YTFB 1K73W 1FXKB 4FIPC 2A79B 1E1RG 3K0GA 5E1AC 2WLMA 4FJCC 4JGSA 3R65A 4MSWC 2HFEC 4RUFA 1VQLV 5FL7G 3FB7C 5L3CA 2OTLV 4WFGA 2XAJA 5L3BA 5B1AC 3FB8C 1G4YB 1PNLA 3T4DA 1KD1W 1Q86W 2X6BA 4WFAV 2IJJA 2LFSA 2IJIA 5KA5A 5H9CA 1COWG 1M56B 1H38A 2Q69A 5CBGA 2IU3A 3ZN1A 2JDIG 5L3DA 4G2KA 1QCEA 1OCZB 1KECA 2EILC 2ZQMA 1K5QA 3CCSV 2UXXA 3A0RA 3CCMV 4ZKIA 2P7TC 1QR9A 4LC1A 2QEXV 4R8CA 1NVPD 5HFMA 1R3IC 1NJIW 2JJ1G 3AEIA 5HFLA 3ML0A 4RQFA 3ABMB 3DGEA 1XL4A 1HWYA 4BIZA 1Q7YW 4G28B 4MW8A 2HG5C 3K9AA 5L3GA 4PELA 3T1CA 1V55C 2X6CA 3CCRV 3UKMA 3CD6V 3JD1A 4YXWG 1MOFA 3RW0A 2DWEC 3OAAG 1FXKA 2X7RB 1S5HC 2V1DA 4MT8A 3SYPA 4F4LA 2H8PC 3UM7A 3ABKC 3K08A 4MVOA 1S76D 3K0DA 2WSSG 3W7SA 1AI6A 3ABLB 3TK1A 4X8AA 5DM6V 5EC1C 4LP8A 3SPHA 1DLBA 2ATKC 2WLKA 3ETGA 4H37A 2Y48A 4HYOA 5EBWC 2A9HA 4MTFA 4X88A 1M57C 4MTGA 5EC2C 1OCOC 4UVBA 2WLIB 3MHSC 3ZRVA 3B8MA 3CCVV 2JIZG 2AHZA 2YEVB 2QE7G 4G27B 2B1IA 2P90A 1IXMA 4HZ3A 2HLDG 1N8RW 2EIKC 2WWWA 1F4NA 3FB6C 1AROP 4JAUA 3ZJZA 4QPKA 3OEEG 5B3SC 3CMAV 1WPXA 4WFHA 1PL0A 4R50A 2IH1C 1VQ8V 1AI7A 4XDLA 5B3SB 1K3EA 1Q81W 2GSMB 2WAMA 2IJKA 1H8EG 4MW3A 3AG4B 3HB3B 2MK3A 2XNDG 3JYCA 1AJPA 1XL6A 1KC8W 2PI4A 1R73A 2DYSB 2ZD9A 3K3WA 1KKDA 3AG3C 3ZMTA 3CCEV 1J95A 3T2MA 4DXWA 1TUEB 2XAHA 1SZTA 3K04A 1S72V 1EBOA 1CEZA 3W7XA 1QLNA 1NR1A 1YHQV 2W0FC 1W2BU 1Y4MA 1S0VA 4MVMA 1JX9A 5B1BC 3F5WC 5DN6G 1LNQA 4JYBA 1FXKC 2EIMC 1E1QG 3STLC 4LCUC 5BZBA 3RVYA 4PA3A 5KA6A 1OCCB 5EBMC 4UV9A 1GM7A 2EIJB 1K5SA 3JD4A 2ZXWC 3ZRWA 5LGUA 4JASA 5LHGA 5KUKA 2H94A 1R6NA 3QO7A 1GTOA 2LP7A 4RQEA 1DTOA 3E8BA 5IDJA 1UJWB 4JTDB 3OMNB 2HR3A 3AG2B 1PNMA 3CC2V 2WLIA 3JD0A 3D3IA 3PJSK 4JTCB 1EFRG 4RO2A 3LUTB 4QNHB 1G8MA 1QLEC 1E79G 2HVKC 4MTOA 4U7NA 1GKFA 1NR7A 3ASNB 4FK5C 4UV8A 1RM1C 3CXCU 1NQTA 2P6JA 2JK5C 1NVPB 3E2EA 2EINB 1M1KW 3ZRXA 1K92A 1M9NA 1CP9A 4UVCA 5H6QA 2ITDC 4LBEC 2QM7A 2OCCC 1KP3A 3CCJV 3ETEA 1VQ7V 3AG4C 4CZZA 1VQ9V 1VQ5V 1OCZC 1R3JC 5IYDO 3FYIB 2WLHA 3W7UA 2A0LA 2DQ3A 2LFRA 3K03A 4EKWA 2R9IA 1NH2B 1I5YA 4TSFG 1K9MW 4BIUA 1QLEB 2Q6AA 1V54C 4GX5A 1SETA 1B6QA 3SYCA 3ZN0A 1YIJV 2EIJC 2BOCC 5LHHA 4CBCA 3FYEB 2IH3C 3OE7G 4BAYA 3CCLV 1GO3F 4R6ZA 3IFXA 1QVFU 4RUEA 2HJFC 2Q67A 4JTAB 1SESA 2JJ2G 5L3FA 1VQNV 3P30A 4MVSA 1M56C 2EZOA 3ZMVA 3SPGA 1K34A 4WFBV 5CBFA 2ZDIA 3FKSG 3CP1A 3OMIB 3CCUV 3GB7C 2ZXWB 3G71V 1R3LC 3OFNG 1W0JG 2XASA 4JYCA 1M90W 2XOKG 2ZR3A 4KUMA 1NH2D 2WLNA 3EHBB 3LSSA 3TETA 3KG2A 4QE7A 3B77A 2QA4V 2Z3YA 4QPJA 2B1GA 2ITCC 5CA3A 1CPYA 2BOBC 1QR8A 1V54B 2XAFA 3OUFA 2D3OW 1KQSU 1YJWV 4R7CA 4HAMA 5L3EA 1PKXA 3K06A 3CYOA 3BY6A 1GM8A 1KP2A 5IY5B 5IY5C 1YSCA 2Q68A 1OCRC 3M99B 4UXNA 4ASUG 3OM3B 2EJRA 4FPPA 1I5XA 3K79A 5LGTA 1BHAA 4I5SA 1GM9A 3MHHC 3ABMC 3GWOA 3OEHG 4ZBMA 1JPXA 3AG1B 4PDRA 2DW4A 2UXNA 3VOUA 2EINC 4BW5A 1FXHA 3QNEA 1BHBA 4GX1A 2Y69C 3SYOA 1K33A 1QBZA 3WFVA 4N21A 3SPCA 3ZCCA 1S77D 4PA6A 3DTUB 4OXSA 4TT3G 3WG7C 4KFMA 1MABG 2YSUB 1K7DA 4KP4A 3CC4V 5LHIA 1VQMV 3NXSA 2Z5UA 4XBFA 5CN0A 4WCEV 2X6AA 1DF5A 1PD3A 1VQ4V 1YJ9V 2IJHA 4WF9V 1WLEA 5C93A 1P4RA 3JD2A 4P9PA 4X89A 1SERA 3ABKB 2IW5A 1OCOB 1AI5A 4L87A 3AG2C 3E35A 1F51A 4XDKA 1JJ2U 1NKDA 3VBBA 1YTFD 2CK3G 3ETDA 1QVGU 3X2QC 5LGNA 1JVMA 1ENVA 3F7VC 3T4ZA 1S3JA 4E2LA 3QO8A 4GX2A 3I56V 1VQKV 3BEHA 4N23A 2OT5A 4UUJC 3WG7B 2K1EA 4PDMA 2WPDG 4MTXA 3ZMUA 2AHYA 1MSWD 1R6KA 3W7WA 5B1BB 1W0KG 2DYRB 4Z1MG 3IC7A 3JD3A 3OMAB 5H6RA 1EZJA 4I9WA 2NLJC 2ZR2A 3HPLC 1OCCC 1RPOA 2FTKA 3AG1C 2W6JG 4GT1A 4H33A 4P30A 2JEUA 1BMFG 2OCCB 3I55V 5B1NA 3ZRWB 4P2ZA 1ROPA 4P9OA 3E8FA 2EBOA 1ORQC 1P7BA 1VQPV 3RVZA 5GW7A 3OR7C 1OHHG 5IYBO 4PA7A 3F7YC 3G4SV 1THZA 1GK9A 4MVQA 2WLJA 3CMEV 3G6EV 1K8AW 1RPRA 2HKOA 4MVRA 4DO2A 1ZWIC 3LNMB 3E8HA 2DYSC 2M7WA 5B1AB 3LDEA 4Q20A 1OZ0A 1OCRB 4QE9A 3TCUA 1R3KC 4UVAA 5J9PC 1F4MA 1GMGA 3OW2U 2C2AA 3ZMSA 3ASNC 3ZMZA 3STZC 5IYCO 3MD0A 1FS0G 2R9RB 2EIMB 4TWKA 1JOYA 2PI5A 4J9YB 4QIWF 1Y66A 5B1OA 5EBLC 3EFFK 3LDDA 2HVJC 1YJNV 5LBQA 2EIKB 4GCZA 3FB5C 2X0LA 3CCQV 3E89A 1K4CC 1VQ6V 4J9ZB 2OTJV 2EZPA 1V55B 4RAIA 2F43G 1FFTB 5KUMA 1K97A 1K4DC 2NNUA 1AI4A 1JCHA 3QO5A 3ASOB 3JCZA 3OGCC 1F23A 3B8NA 3E83A 1L1FA 2YEVA 4PA9A 2W6IG 1MG1A 1NBMG 4MS2A 4WFEA 4WFFA 1YI2V 3AG3B 4JPRA 2B5UA 1SRYA 4U7OA 1AJQA 2EILB 4JAVA 1Q82W 2Y69B 1H2GA 3D36A 3IGAC 2IU0A 3CPWU 2DYRC 3P32A 4FMTA 3ZIAG 2XAGA 2WLLB 4GX0A 4MVUA 3H01A 4JF3A 4QJFB 4XDJA 3SPJA 1BL8A 3SYQA 5CBHA 2QTOA 3W7TA 3CC7V 1PNKA 4PA4A 3OUSA 5EK0A 3SPIA 2V7QG 4PDLA 3ASOC 1JQ0A 3RBZA 1FXVA 1AJNA 3OR6C 5CMUA 1RM1B 4MVZA 2XAQA 3SYAA 3SJQC 1DF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL C;  4HZ3 A;  2KB1 A;  2EIK C;  2Q6A A;  1V54 C;  3FB6 C;  4GX5 A;  4I9W A;  3SYC A;  2NLJ C;  2WLL A;  3HPL C;  1OCC C;  2EIJ C;  3AG1 C;  2BOC C;  4H33 A;  2QKS A;  4P30 A;  2DWD C;  4PDV A;  3ZJZ A;  4CBC A;  5B3S C;  4WFH A;  2IH3 C;  3E8G A;  4R50 A;  2IH1 C;  3LDC A;  3ZRS A;  4R6Z A;  3IFX A;  4P2Z A;  3E86 A;  4P9O A;  4RUE A;  4XDL A;  2HJF C;  3E8F A;  2Q67 A;  4JTA B;  1ORQ C;  1P7B A;  4MVS A;  3RVZ A;  2A79 B;  1M56 C;  3OR7 C;  3SPG A;  4PA7 A;  3F7Y C;  3K0G A;  5E1A C;  2WLM A;  2WLJ A;  4MVQ A;  4MW3 A;  5CBF A;  3R65 A;  4MSW C;  2HFE C;  3GB7 C;  3JYC A;  4RUF A;  1XL6 A;  1R3L C;  3FB7 C;  4MVR A;  2ZD9 A;  1KKD A;  3AG3 C;  4WFG A;  1J95 A;  1ZWI C;  3LNM B;  3E8H A;  5B1A C;  2DYS C;  2WLN A;  3T2M A;  4DXW A;  3TET A;  3KG2 A;  3FB8 C;  1G4Y B;  3T4D A;  3K04 A;  4QE7 A;  2X6B A;  3LDE A;  4QE9 A;  2ITC C;  3TCU A;  1R3K C;  2BOB C;  5J9P C;  3OUF A;  2Q69 A;  2W0F C;  3ASN C;  3STZ C;  4R7C A;  5CBG A;  3K06 A;  4MVM A;  5B1B C;  2R9R B;  3F5W C;  4TWK A;  1LNQ A;  5IY5 C;  2Q68 A;  4J9Y B;  1OCR C;  2EIM C;  3STL C;  4LCU C;  5BZB A;  3RVY A;  4PA3 A;  2EIL C;  5EBL C;  3EFF K;  3LDD A;  2HVJ C;  5EBM C;  3ABM C;  3FB5 C;  4EKW A;  4ZBM A;  2P7T C;  3E89 A;  1K4C C;  4PDR A;  4J9Z B;  4BW5 A;  4R8C A;  2EIN C;  2ZXW C;  3VOU A;  1R3I C;  4RAI A;  5KUK A;  4GX1 A;  5KUM A;  5EC2 C;  2Y69 C;  3SYO A;  1K4D C;  3SPC A;  3E8B A;  4PA6 A;  4OXS A;  4JTD B;  3OGC C;  3WG7 C;  4KFM A;  3E83 A;  1XL4 A;  4G28 B;  4MW8 A;  2HG5 C;  2YEV A;  4PA9 A;  3T1C A;  1V55 C;  2X6C A;  3UKM A;  2WLI A;  3PJS K;  4MS2 A;  2X6A A;  4JTC B;  4WFE A;  4WFF A;  3RW0 A;  2DWE C;  4RO2 A;  3LUT B;  4QNH B;  1S5H C;  2HVK C;  1QLE C;  3SYP A;  4F4L A;  2H8P C;  4MTO A;  4P9P A;  3UM7 A;  3ABK C;  3K08 A;  4X89 A;  4MVO A;  5CBH A;  3K0D A;  3IGA C;  2DYR C;  2JK5 C;  2WLL B;  4GX0 A;  4MVU A;  4X8A A;  5EC1 C;  3AG2 C;  4XDK A;  4LP8 A;  3SPH A;  2ATK C;  2WLK A;  4H37 A;  4XDJ A;  3SPJ A;  1BL8 A;  2ITD C;  4HYO A;  2QTO A;  4LBE C;  2OCC C;  3SYQ A;  3X2Q C;  1JVM A;  4PA4 A;  5EBW C;  3AG4 C;  2A9H A;  3F7V C;  3OUS A;  3T4Z A;  5EK0 A;  4MTF A;  4GX2 A;  4X88 A;  3SPI A;  1M57 C;  4MTG A;  3BEH A;  1OCZ C;  4PDL A;  4UUJ C;  1OCO C;  3ASO C;  1R3J C;  2K1E A;  4PDM A;  3RBZ A;  2WLI B;  2WLH A;  2A0L A;  3OR6 C;  2AHY A;  4MVZ A;  3SYA A;  2AHZ A;  3K03 A;  3SJQ C;  4G27 B; 
#chains in the Genus database with same CATH topology
 3ABL C;  4GKK O;  2GHY A;  4AHC A;  2WLL A;  4FFB B;  2QKS A;  2HHH B;  2ZDI C;  3X2Q B;  1V9P A;  3KZI Z;  1YIT V;  2PUS A;  1H8H G;  4GKJ O;  4IGG A;  3ZX6 A;  4FLZ A;  3U11 A;  3L71 H;  4EFE A;  1WJZ A;  3R65 A;  2HFE C;  1N0N A;  5FL7 G;  2XAJ A;  5B1A C;  3SJC C;  4CH3 A;  5LYJ B;  1PNL A;  4WFA V;  5KA5 A;  4B3S B;  4CS4 A;  1JFF A;  1ZAU A;  5CBG A;  2QTS A;  1Q3E A;  2P5O A;  3P3P A;  2RDC A;  1VF6 C;  3FAV B;  1KEC A;  2JGD A;  2L6L A;  4R8C A;  5HFM A;  3MDS A;  1NJI W;  3AEI A;  2ILM A;  3BVO A;  4LF9 O;  5KHG A;  3ABM B;  1P49 A;  3JAW A;  4BIZ A;  2HG5 C;  3K9A A;  4PEL A;  1XIL A;  1AR5 A;  3UKM A;  4LFA B;  4YXW G;  3RW0 A;  2DWE C;  1FXK A;  3CHX A;  4MT8 A;  3SYP A;  4F4L A;  5D5P A;  3SJB C;  1SQB H;  3H9V A;  3M8A A;  1AI6 A;  4O4L A;  1YF2 A;  3BA8 A;  4LP8 A;  1DLB A;  1M93 A;  2GUZ A;  4MTF A;  3K58 A;  1UPG A;  4IIJ A;  2ZM6 B;  3CS5 A;  2B1I A;  4JI0 B;  1IXM A;  3B4S A;  4HZ3 A;  1N8R W;  3H1H H;  1ARO P;  5B3S C;  4WFH A;  4DR6 B;  4R50 A;  1M4U A;  2Q7E A;  1XNR O;  1AI7 A;  2PGG A;  1K3E A;  4UCU A;  1Q81 W;  1H8E G;  5JJJ B;  5FNV B;  1GRJ A;  2CTQ A;  5DED A;  4JI3 B;  3TJT A;  1KU9 A;  4J41 A;  1BSM A;  2G38 A;  1SQP H;  2XAH A;  1SZT A;  1EBO A;  1CEZ A;  2VQF O;  4FLY A;  5EYP A;  3RWR D;  1W2B U;  1S0V A;  3RT3 C;  5B1B C;  3F5W C;  1XBL A;  1LNQ A;  1FFX B;  4JYB A;  1XDC A;  3UT5 B;  2EIM C;  1E1Q G;  4PA3 A;  4DV0 B;  3IJ4 A;  2EJ7 A;  4LFB B;  1GM7 A;  2CH7 A;  5E79 Z;  1K5S A;  3N27 A;  5LGU A;  1N34 B;  4JAS A;  1S5J A;  4GLX A;  1I08 A;  2H94 A;  1DTO A;  5IDJ A;  2O57 A;  3CJH A;  2YUA A;  1AIL A;  1HP8 A;  1ZTE A;  3D3I A;  4JTC B;  2XUM A;  1EFR G;  3K5N A;  4PV1 B;  2HVK C;  1XQ8 A;  3ASN B;  2AZ2 A;  1RM1 C;  1EZV H;  4UB6 Z;  1NQT A;  2PF4 E;  1NVP B;  1XUQ A;  1KB9 F;  2EIN B;  4J7Z A;  5KHJ A;  1K92 A;  4DV7 O;  4X1I A;  2QM7 A;  3ETE A;  1VQ7 V;  3AG4 C;  4DR4 B;  1EM1 A;  1SF9 A;  2OIE A;  1R3J C;  5IYD O;  3QG5 A;  2DQ3 A;  1D2D A;  3K03 A;  4EKW A;  1WB8 A;  1NH2 B;  4DK1 A;  4TSF G;  3CEI A;  4BIU A;  1IXB A;  2Q6A A;  1V54 C;  2QR4 A;  3FYE B;  2Y4U A;  5IJ9 A;  3OE7 G;  4BAY A;  3IFX A;  1QVF U;  3UCS C;  1F7Y A;  4RUE A;  2Q67 A;  2JJ2 G;  4JI4 O;  2Q9L A;  3ZMV A;  1K34 A;  3Q4H A;  1O9G A;  4X64 O;  2E75 B;  4YY3 O;  5CBF A;  2ZDI A;  3OMI B;  4NTY A;  5IE9 A;  1R3L C;  2AW9 A;  2XAS A;  1NH2 D;  3LSS A;  2JRI A;  2CAZ C;  5EYP B;  2Z3Y A;  4QPJ A;  2ITC C;  2LW7 A;  3OUF A;  2DE0 X;  2P22 C;  4HAM A;  1KYO F;  4PJ0 Z;  4GKJ B;  4DV5 O;  3BY6 A;  3VQY A;  4JI0 O;  1KP2 A;  2Q68 A;  1OCR C;  3KKY A;  4UXN A;  1GN6 A;  2EJR A;  1DGS A;  3K79 A;  2Q7H A;  4TV9 A;  4DR1 O;  4I5S A;  2BSK B;  1GM9 A;  3OEH G;  3GWO A;  4ZBM A;  2HP8 A;  3VOU A;  1FXH A;  3QNE A;  1BHB A;  3SJA C;  2UXD B;  2Y69 C;  1K33 A;  3ZCC A;  4OXS A;  3WG7 C;  1MAB G;  2Y0P A;  3WB1 A;  5LHI A;  1MSD A;  5K1X A;  4WCE V;  5H2F Z;  3L70 H;  3K59 A;  1DF5 A;  3DSQ A;  4LF6 B;  1P84 F;  5CA0 A;  1W59 A;  2IJH A;  2BCC H;  3NR7 A;  1SQQ H;  5JVD A;  4JI5 B;  2YXH A;  4L87 A;  1F51 A;  4AQY O;  4EB6 A;  3ETD A;  5LGN A;  2XHB A;  3I56 V;  3G80 A;  5CA1 B;  4N23 A;  2OT5 A;  3H1L H;  4YJ3 B;  5IWA O;  3ZMU A;  2AHY A;  3W7W A;  2VS0 A;  1WP8 A;  3BHP A;  4Z1M G;  3JD3 A;  1SQX H;  5H6R A;  2NLJ C;  3HPL C;  2CE4 A;  4H33 A;  1O9H A;  5J9P C;  4X1K A;  5B1N A;  4CS3 A;  5EZY A;  5GW7 A;  1MZF A;  3RFR A;  1OHH G;  5LYJ A;  1THZ A;  4LWS A;  3CME V;  2BSK A;  2FL4 A;  1WA8 A;  1ZX3 A;  4LF7 O;  3HR0 A;  3ZBH A;  3LDE A;  5J2U B;  4Q20 A;  1IBM O;  1R3K C;  1SKV A;  4UVA A;  1XNR B;  1F4M A;  1N32 O;  3ZMS A;  1EN5 A;  3D36 C;  1TVK B;  1JOY A;  4CS2 A;  4J9Y B;  1U97 A;  4X65 B;  2LGW A;  1MNG A;  4JZG A;  2N74 A;  3UO3 A;  1BQZ A;  1US6 A;  4FLU A;  3T1H O;  2DN9 A;  3FB5 C;  3CCQ V;  1IBM B;  1K4C C;  2KG7 B;  3B09 A;  2OTJ V;  2JVD A;  5J2U A;  5JCO A;  4JI8 O;  3CSX A;  4RAI A;  4DK0 A;  2F43 G;  2ETN A;  4YHH B;  1XMQ O;  3RYI A;  1K4D C;  4FM2 A;  3G67 A;  1GN4 A;  4NTX A;  3QO5 A;  3OGC C;  2QKA A;  3M7M X;  4H44 B;  2W6I G;  4YJ3 A;  4WFE A;  5IJ0 A;  4K3A A;  3WB2 A;  4NVP A;  4JAV A;  3L74 H;  2Y69 B;  3ZS8 C;  1Q6I A;  5FPR A;  3IGA C;  3ZIA G;  1Y74 B;  4F6R A;  4ZI7 B;  3W7T A;  3SPJ A;  3CC7 V;  1MZE A;  2QTO A;  4I55 B;  4PA4 A;  5EK0 A;  1VAR A;  5LXT B;  3APQ A;  2W0X A;  1JQ0 A;  2Q4P A;  4DR5 B;  4NXN O;  1XMO O;  5KHK A;  4MVZ A;  3SYA A;  1DF4 A;  4BR6 A;  2JEX A;  1X4T A;  4FLW A;  1H2K A;  2DWD C;  3IC9 A;  1ZUQ A;  3E8G A;  3JAM N;  3U0Z A;  1BCC H;  5IJ0 B;  1J5E O;  4DR7 B;  3JSN A;  4O2A A;  3K0G A;  5E1A C;  4TV9 B;  3ETQ A;  2RQ6 A;  4U3J B;  3SR2 C;  5L3C A;  4WFG A;  4ZOL B;  3FB8 C;  1G4Y B;  2ODM A;  1Q86 W;  2LFS A;  5H9C A;  1COW G;  1M56 B;  2K9P A;  4KHP B;  2GTS A;  3ZHR A;  2JDI G;  5L3D A;  4G2K A;  1OCZ B;  3A0B Z;  2XT9 A;  1K5Q A;  2F4V O;  5BY1 A;  2UXX A;  4DW0 A;  3N2K A;  3CCM V;  4ZKI A;  3BAB A;  4LC1 A;  2QEX V;  2VRZ A;  1NVP D;  4J11 A;  2F4V B;  4JI6 B;  3ML0 A;  4JI7 O;  2Q0O C;  1WB7 A;  1HWY A;  1Q7Y W;  4G28 B;  1V55 C;  2X6C A;  4LF8 B;  2YXL A;  3CD6 V;  2VWK A;  3VQV A;  3L72 H;  1KMI Z;  3JD1 A;  3D3Q A;  1MOF A;  4AIL C;  1XHX A;  2X7R B;  4JI1 O;  1M5I A;  2V1D A;  2H8P C;  1KUQ A;  1WNS A;  2UXC B;  3K0D A;  3RN4 A;  2PYJ A;  4IT5 A;  3SGI A;  4DRX A;  3TK1 A;  3T1Y B;  2ATK C;  1HNW B;  4LF9 B;  4DV6 O;  1N0J A;  5EBW C;  1JJO A;  2A9H A;  5JJN B;  1M57 C;  4MTG A;  1OCO C;  1SA0 B;  4UVB A;  3B2E E;  4X62 O;  2AHZ A;  5KHI A;  4G27 B;  2P90 A;  2UUB B;  2JGD B;  2EIK C;  2WWW A;  2RJZ A;  3JAW B;  4K8Z A;  1RP3 B;  3ZJZ A;  3OEE G;  3RYF B;  1VQ8 V;  2A7W A;  2WA3 A;  2RCV A;  4DUY O;  4MW3 A;  1VEW A;  3AG4 B;  3HB3 B;  1AJP A;  1XL6 A;  2PI4 A;  2DYS B;  3K3W A;  1J95 A;  1VIB A;  4YY3 B;  3APO A;  2N05 A;  3K04 A;  1B04 A;  1YCI A;  1H2L A;  5LP6 A;  3W7X A;  2LGQ A;  1QLN A;  2LW1 A;  1Z5V A;  1JX9 A;  2VQE O;  5LMN O;  2QJ1 A;  3CX5 F;  5DN6 G;  1XHZ A;  1HR0 B;  1FXK C;  5JWP A;  1YXB A;  3BRC A;  4HNA A;  1OCC B;  4PD4 F;  3FX7 A;  4DUZ O;  2AGA A;  4LF4 O;  2OIG A;  2EIJ B;  3JCU Z;  3OD4 A;  2Y0I A;  3JD4 A;  2Q7G A;  3ZRW A;  4C7U A;  4NR1 A;  2LP7 A;  4K0K B;  2YIB A;  1UJW B;  3I5D A;  4FFB A;  4DW1 A;  3OMN B;  1PPJ H;  3C3T A;  3AG2 B;  2F93 B;  1H2N A;  3CC2 V;  3JD0 A;  4Z2W A;  4GKK B;  1QLE C;  2UXB B;  4U7N A;  2YI9 A;  1GKF A;  1L0N H;  4WBN B;  4HBN A;  4ZI7 A;  1N36 O;  4UV8 A;  1TA8 A;  4OX9 B;  1ZLZ A;  1L8D A;  1M9N A;  3R66 A;  2ITD C;  3LSU A;  1BT8 A;  4EFB A;  2OCC C;  3CCJ V;  5CA0 B;  1XNQ O;  3GVM A;  4X1Y A;  2LFR A;  4O4I A;  5IYZ A;  5JQG A;  3BFR A;  1I5Y A;  1DK1 A;  1QLE B;  3ZN0 A;  2OWO A;  2EIJ C;  2BOC C;  3BPZ A;  3CCL V;  1GO3 F;  4JTA B;  5KMG B;  4LFA O;  4ABM A;  3K57 A;  4MVS A;  1HDJ A;  4W4L A;  1M56 C;  3UQ8 A;  4AQY B;  4FLT A;  2RMK B;  3FKS G;  2ZXW B;  3G71 V;  2ZCE A;  3OFN G;  4JYC A;  1M90 W;  1JMK C;  3DXR A;  4KUM A;  3RYI B;  3HKB B;  3B77 A;  1CPY A;  1V54 B;  2XAF A;  3S3X A;  1PKX A;  3C3S A;  1GM8 A;  1WA8 B;  4O2B B;  3OM3 B;  3DC6 A;  4FPP A;  1I5X A;  5EIB D;  1TVK A;  3MHH C;  3ABM C;  2YIC A;  3G6B A;  4UCT A;  2CUG A;  2UXN A;  4BW5 A;  1I94 O;  4I55 A;  2QGN A;  4AI8 A;  4LF7 B;  1IX9 A;  4N21 A;  3SPC A;  3DTU B;  1BZK A;  4KFM A;  3E22 A;  4KP4 A;  1B3Q A;  4GUN A;  3NXS A;  1N32 B;  5CN0 A;  5KX5 A;  4JYY A;  2ZM6 O;  4O4I B;  4DV6 B;  3H1I H;  4IYH A;  2QWR B;  2GUZ B;  1WLE A;  4P9P A;  4L8J A;  4LF8 O;  2VQF B;  3KCX A;  1SER A;  4FVM A;  2IW5 A;  1FYJ A;  1QU7 A;  1AI5 A;  3AG2 C;  3E35 A;  4XDK A;  3VBB A;  2PY5 A;  3QTC A;  2CDY A;  4E2L A;  4GX2 A;  2KG7 A;  2WPD G;  4EEQ A;  3RYH B;  4E4E A;  5B1B B;  2P06 A;  4GT1 A;  1XMQ B;  1OCC C;  3AG1 C;  5GON B;  4J7J A;  2OCC B;  3RGB A;  1AVM A;  4TV8 A;  4DV4 B;  1ORQ C;  1P7B A;  2ZKO A;  3OR7 C;  4I9Q A;  4PA7 A;  4MVQ A;  2VQE B;  3G6E V;  3RYC B;  2HKO A;  2E3C A;  2KSD A;  2N04 A;  4UCO A;  4DO2 A;  3E8H A;  1FFX A;  2DYS C;  3O65 A;  2UUB O;  1GAX A;  4IHJ A;  1NTK H;  3PN1 A;  4ICG A;  3TCU A;  3AK2 A;  5JH7 B;  3N2G A;  5IT9 N;  4YIO A;  4CH6 A;  2UUC B;  2R9R B;  4TWK A;  2F95 B;  4K0K O;  5B1O A;  2ZIN A;  5EBL C;  3EFF K;  1YJN V;  2EIK B;  1ZL8 B;  5J2T A;  4GCZ A;  1HW7 A;  5FLX N;  1VQ6 V;  1V55 B;  4TV8 B;  1SQV H;  4H13 B;  4B7K A;  3FFQ A;  1Q43 A;  4JI4 B;  2NNU A;  1AI4 A;  3JCZ A;  4JI2 B;  2DJV A;  4PA9 A;  2E74 B;  4WFF A;  2P4V A;  3JAT A;  4TUY A;  2B5U A;  1TGO A;  1FJG B;  5C8Y A;  4OPA A;  2HEP A;  1VP7 A;  2IU0 A;  3L9D A;  5ITZ B;  3P32 A;  2WA4 A;  1FJG O;  1MMM A;  3J81 N;  4YHH O;  1N36 B;  3JAK A;  3TXQ A;  1TUB A;  4X66 O;  3A2F A;  4PDL A;  3ASO C;  3RBZ A;  2FML A;  3AK3 A;  3SJQ C;  4UFZ A;  4D6T H;  2E5L B;  4DV2 O;  1M57 B;  1BE3 H;  1AR1 B;  5A2Q N;  1SC5 B;  3N2G B;  4OX9 O;  2DQ0 A;  3LSQ A;  1YTF B;  4FIP C;  1E1R G;  3BAA A;  4DR1 B;  4DV2 B;  1LUW A;  1U96 A;  3UT5 A;  4ZHQ B;  5LOV A;  3FB7 C;  3JAR A;  1VQL V;  1TAE A;  1VF6 A;  2YIA A;  4I50 B;  1FAF A;  4JV5 B;  3MAQ A;  1KD1 W;  2ARH A;  2IJJ A;  4K35 A;  5A9G A;  3P3N A;  2AZ0 A;  4LNU B;  1I94 B;  3ZN1 A;  1QCE A;  1X59 A;  2EIL C;  3A0R A;  4NKG B;  1QR9 A;  2YID A;  4O2A B;  3JAS A;  1KBH A;  1R3I C;  2JJ1 G;  2CTR A;  4LF5 O;  2ZE8 A;  5LL6 Y;  1NS1 A;  5IJ9 B;  3WB0 A;  2BE3 A;  3CRR A;  4I4T B;  4LH6 A;  4DR5 O;  4NXN B;  2YXY A;  4MW8 A;  3T1C A;  4DR7 O;  3HKD A;  4I0X A;  5EZY B;  3FD9 A;  3ABK C;  3K08 A;  4MVO A;  1S76 D;  2WSS G;  3W7S A;  3ABL B;  4X8A A;  1UFI A;  4I4T A;  5EC1 C;  3K5O A;  1T5E A;  2WLK A;  4H37 A;  2Y48 A;  4DRX B;  4J80 A;  1XMO B;  2WLI B;  4OPH A;  3ZRV A;  5KLV H;  3B8M A;  3QF7 A;  2YEV B;  2QE7 G;  1N33 B;  4KXR A;  1F4N A;  4JAU A;  4QPK A;  3VQW A;  1WPB A;  1WPX A;  2IH1 C;  2H3O A;  4X64 B;  4XDL A;  3O9O A;  2KQX A;  3HKD B;  4I0X B;  3JYC A;  3AK1 A;  1R73 A;  1KKD A;  3AG3 C;  3ZMT A;  3CCE V;  3HKE B;  3TXS A;  1BGY H;  3T2M A;  4DXW A;  1Z2G A;  4DUZ B;  1TUE B;  3L75 H;  3ZHS A;  1Q6U A;  1S72 V;  3CE2 A;  1AB3 A;  4FLX A;  2W0F C;  3HKB A;  1N34 O;  2YDE A;  1QHT A;  4LCU C;  3RVY A;  4B7E A;  4DR3 B;  5EBM C;  5LA6 A;  1JR9 A;  1JFF B;  1D5A A;  5KMG A;  3CWB H;  3BA9 A;  5LHG A;  5KUK A;  4BWA A;  3QO7 A;  1GTO A;  3AG7 A;  3UO2 A;  3E8B A;  4JTD B;  3ZHT A;  5IWA B;  2HR3 A;  1YZB A;  1PNM A;  2IM9 A;  4B3S O;  2WLI A;  3PJS K;  4X9Q A;  3A8T A;  4FLV A;  2UXC O;  3LUT B;  4DV3 O;  1E79 G;  4BIO A;  1NR7 A;  4LF4 B;  3T1Y O;  3CXC U;  3JAK B;  5GTH Z;  4DV3 B;  3E2E A;  3QVN A;  3ZRX A;  4JI2 O;  4UVC A;  2ZIO A;  4LBE C;  1KP3 A;  4CZZ A;  3OT7 A;  3ICX A;  1VQ9 V;  2QWO B;  1B06 A;  1VQ5 V;  1A32 A;  1OCZ C;  3JAT B;  4TUY B;  3K9S A;  3FYI B;  5H5N A;  2WLH A;  3W7U A;  2R9I A;  1VF7 A;  1K9M W;  5BR8 B;  1SQF A;  1IZ3 A;  4O4H A;  1SET A;  1B6Q A;  3SYC A;  4YJ2 A;  5BXZ A;  3B40 A;  2GBO A;  4FFK A;  4KHP O;  5L3F A;  1Q8I A;  4BW9 A;  1VQN V;  2EZO A;  3SPG A;  1EN6 A;  4I50 A;  1SZX A;  4JYA O;  3GB7 C;  1IDS A;  3HKC B;  1PP9 H;  2Z0A A;  2ADP A;  2XOK G;  2ZR3 A;  1OV9 A;  4IYI A;  2WLN A;  3EHB B;  3TET A;  3CRQ A;  4QE7 A;  2QA4 V;  3LNN A;  4LNU A;  1Q6H A;  2D2C B;  5CA3 A;  2BOB C;  2D3O W;  4X20 A;  4R7C A;  5L3E A;  3K06 A;  4UCV A;  3J7A U;  4IHJ B;  1ZL8 A;  1SS3 A;  3F5T A;  3L73 H;  4CC6 A;  5IY5 B;  1YSC A;  3CXH F;  3CRC A;  4ZHQ A;  5LOV B;  3CB2 A;  5LGT A;  1KKC A;  1IBL O;  5CB4 B;  5LMU O;  4DV5 B;  4JV5 O;  1Q5O A;  1JPX A;  1SA0 A;  5KAF Z;  3AG1 B;  2ZE7 A;  1H2M A;  4JAA A;  4GX1 A;  4F6E A;  1JA8 A;  2YSU B;  2XTA A;  4DUY B;  2ADQ B;  2Z5U A;  5IYZ B;  5FNV A;  1VQ4 V;  3A0H Z;  4FM1 A;  1YJ9 V;  3CRM A;  5C93 A;  4FM0 A;  1P4R A;  2QWP B;  3JD2 A;  2E76 B;  2QM4 A;  1R6T A;  1LUV A;  2DOS A;  3ABK B;  4CH4 A;  2JS3 A;  2QDO A;  3CJH B;  4TQF A;  4DYL A;  4DV0 O;  2R9A A;  1JJ2 U;  1NKD A;  1YTF D;  1QVG U;  1JVM A;  1ENV A;  2RN9 A;  3T4Z A;  1S3J A;  3QO8 A;  2EUL A;  3H1J H;  4O4J A;  2K1E A;  4DV1 O;  4MTX A;  2QKC A;  1HNZ B;  1W0K G;  1GN2 A;  2DYR B;  3IAY A;  3OMA B;  2ZR2 A;  2JEU A;  3I55 V;  5JVD B;  3ZRW B;  4WBN A;  4P2Z A;  1N33 O;  4P9O A;  1FD9 A;  3E8F A;  2FB5 A;  5C8Y B;  2EBO A;  1HNX O;  4A5U B;  5IYB O;  3G4S V;  4DR2 O;  2UUA O;  3HKE A;  1K8A W;  1Y76 B;  5BMV A;  3BCC H;  3D8C A;  1Y6X A;  1IVS A;  1G6U A;  1ZWI C;  3LNM B;  3ZHV A;  2Q8V A;  1NI8 A;  3JAL A;  2M7W A;  1XEQ A;  5B1A B;  2VWJ A;  1BQ0 A;  4QE9 A;  1P7G A;  4LR3 A;  3OW2 U;  3ZMZ A;  5IYC O;  3STZ C;  1R1B A;  3MD0 A;  1FS0 G;  2HHH O;  2ZNI A;  4D7T A;  2PI5 A;  3ZED A;  1Y66 A;  2UXB O;  3LDD A;  4NB5 A;  3EXA A;  3EVK A;  2X0L A;  3E89 A;  4J9Z B;  1FPO A;  5B66 Z;  2EZP A;  3SDL A;  1VF5 B;  2A3Q A;  4LFB O;  1K97 A;  1GH6 A;  5TIS Z;  1JCH A;  3ASO B;  2F23 A;  4LF5 B;  1F23 A;  3B8N A;  4U3F H;  1L1F A;  1Y76 A;  2YEV A;  4DV4 O;  4DR3 O;  1MG1 A;  1NBM G;  4MS2 A;  1YI2 V;  3AG3 B;  4JPR A;  4FZ0 A;  3H1K H;  1AJQ A;  2EIL B;  1SQG A;  1H2G A;  3D36 A;  2XAG A;  3H01 A;  4JF3 A;  5AG2 A;  4JI5 O;  1Y74 A;  1I7F A;  4CC5 A;  5ITZ A;  4OGQ B;  5CBH A;  1PNK A;  1N4C A;  4PHZ A;  2UU9 O;  4GZR B;  2V7Q G;  2Y4T A;  1FXV A;  5CMU A;  1AP5 A;  2XAQ A;  2OCH A;  3ABU A;  1LR1 A;  3ABT A;  2KB1 A;  2LQT A;  2QM8 A;  2P67 A;  4PDV A;  1I0H A;  1VQO V;  4B3R B;  4DV7 B;  3LDC A;  1YVW A;  3ZRS A;  2CTP A;  3E86 A;  1K73 W;  1FXK B;  2A79 B;  2JGU A;  1FKA O;  1Z5W A;  2WLM A;  4FJC C;  4JGS A;  4MSW C;  4RUF A;  2PZS A;  4U3J A;  2OTL V;  1Q90 D;  2NR5 A;  5L3B A;  1HNW O;  4X20 B;  4TOI A;  3T4D A;  2X6B A;  2IJI A;  1QNM A;  1H38 A;  2Q69 A;  3KCY A;  2BTQ A;  2IU3 A;  4J10 A;  5LA6 B;  3VQX A;  5GON A;  2PYL A;  3JAR B;  3OTO B;  2GDS A;  5LP6 C;  1WP7 A;  2ZQM A;  3CCS V;  4LWS B;  3RYH A;  2P7T C;  1URF A;  2EX3 A;  4X1K B;  5HFL A;  4ZOL A;  2R70 A;  1BS3 A;  4RQF A;  3DGE A;  5EIB C;  1XL4 A;  4O4L B;  5L3G A;  3CCR V;  4B3R O;  5JQG B;  2Q5Z A;  3OAA G;  4IL6 Z;  5JCO C;  1S5H C;  1PV0 A;  1NT2 B;  4CH5 A;  4X65 O;  3UM7 A;  1EN4 A;  1Y67 A;  1OJH A;  5DM6 V;  4F6R B;  3SPH A;  3ETG A;  4DR6 O;  4HYO A;  4H0L B;  4LH7 A;  2CTW A;  3JAS B;  2ZIM A;  4X88 A;  5EC2 C;  2CH7 B;  1G1X B;  3MHS C;  3CCV V;  1HNX B;  2JIZ G;  4EB6 B;  2HLD G;  1NTM H;  1RFY A;  3FAV A;  5KHH A;  3FB6 C;  2LO1 A;  3CMA V;  3C90 A;  1PL0 A;  2ZT9 B;  5LP6 B;  2L35 A;  2A06 H;  3JSL A;  4ZIB A;  5B3S B;  1S5L Z;  2GSM B;  2WAM A;  2IJK A;  4DV1 B;  4JI7 B;  3ZHQ A;  2R72 A;  2MK3 A;  2XND G;  4W4K A;  1KC8 W;  2ZD9 A;  4HNA B;  4JYA B;  2BTO A;  4J7K A;  4JZ2 A;  4DR2 B;  2UUA B;  2YIB D;  3K5L A;  5F2V O;  1NR1 A;  2ZNJ A;  5D5Q A;  1YHQ V;  1PM9 A;  1Y4M A;  1RSO A;  4MVM A;  1NZ6 A;  2GTA A;  1IBK O;  4B3M B;  2AXT Z;  3STL C;  1XRE A;  5BZB A;  5KA6 A;  4O2B A;  1ZSP A;  5BMV B;  2OYQ A;  1J5E B;  2YS8 A;  4UV9 A;  2ZXW C;  4B3M O;  5B5E Z;  1R6N A;  2Q0A A;  3U10 A;  4RQE A;  1D5N A;  2QWN B;  2UXD O;  2JS5 A;  3HKC A;  4DR4 O;  4J42 A;  3T1H B;  4RO2 A;  4QNH B;  4YIP A;  1YDX A;  2E5L O;  1G8M A;  5GTI Z;  4LFC O;  4MTO A;  1XNQ B;  2B9Z A;  4FK5 C;  2DMX A;  2P6J A;  4X1I B;  2JK5 C;  1M1K W;  4LFC B;  4NXM O;  1CP9 A;  5H6Q A;  2KKW A;  4FZ1 A;  2CGO A;  4IIJ B;  4TQD A;  1IUR A;  2ZE6 A;  1NU1 H;  2PTM A;  2A0L A;  4B08 A;  4JI6 O;  5LMN B;  4GYC B;  4GX5 A;  1YIJ V;  5LHH A;  1NTZ H;  4CBC A;  2IH3 C;  2LJ2 A;  4JI8 B;  4R6Z A;  3THO A;  2UU9 B;  2HJF C;  1SES A;  3P30 A;  4KL1 A;  4LF6 O;  3JAL B;  4WFB V;  4UB8 Z;  5J2T B;  4NTW A;  3CP1 A;  3CCU V;  3OTO O;  1W0J G;  3RYC A;  1GN3 A;  5LMU B;  3KG2 A;  2BTQ B;  2B1G A;  2YI8 A;  5DEC A;  1QR8 A;  1KQS U;  1YJW V;  2IBZ H;  1VMG A;  3CYO A;  4UCS A;  2ZE5 A;  4Q6G A;  5IY5 C;  3M99 B;  4ASU G;  4NXM B;  1BHA A;  3TGU H;  3ZHU A;  2Q73 A;  4PDR A;  2DW4 A;  2EIN C;  2FKX A;  5BR8 O;  3SYO A;  3WFV A;  1QBZ A;  2GV9 A;  4O4H B;  4X66 B;  1S77 D;  4PA6 A;  4TT3 G;  2QWQ B;  3DC5 A;  1K7D A;  3CC4 V;  1VQM V;  2F1M A;  4XBF A;  1WN7 A;  2X6A A;  1PD3 A;  2CGN A;  4PI0 A;  2MW2 B;  5KAI Z;  5JJE B;  3OGI B;  3CRA A;  1MA1 A;  5CA1 A;  4WF9 V;  1HNZ O;  4X89 A;  1QQC A;  2NN4 A;  1OCO B;  2P4K A;  4K8X A;  1PL4 A;  2FYU H;  3K5M A;  2QSA A;  2CK3 G;  5FPO A;  3X2Q C;  3F7V C;  1WAZ A;  4X1Y B;  1VQK V;  3BEH A;  4UUJ C;  3WG7 B;  4PDM A;  4JI1 B;  3WU2 Z;  1YEW A;  3N2K B;  4PI2 A;  1R6K A;  1MSW D;  5KX5 B;  3IC7 A;  1EZJ A;  4I9W A;  1RPO A;  2FTK A;  4P30 A;  2W6J G;  1BMF G;  1CXZ B;  1ROP A;  2F66 C;  4I7Z B;  4D7S A;  1VQP V;  3RVZ A;  5CB4 A;  3F7Y C;  1AR4 A;  3GWK C;  1GK9 A;  2WLJ A;  1RPR A;  1H2S B;  4MVR A;  2YC0 A;  1RSO B;  3Q4H B;  1OZ0 A;  1OCR B;  5JH7 A;  1GMG A;  2C2A A;  3ASN C;  1XOU A;  2V4D A;  4UCR A;  2EIM B;  3S3W A;  4NYK A;  2HJD A;  3DXR B;  4QIW F;  4RWU A;  2HVJ C;  2UUC O;  5LBQ A;  5K1P A;  4X62 B;  4O4J B;  4QGP A;  1XI1 A;  3RYF A;  1FFT B;  5KUM A;  4YJ2 B;  3E83 A;  1IBK B;  2RNB A;  2M6Y A;  1HR0 O;  4Z1V A;  1SRY A;  3OTF A;  4B3T B;  4U7O A;  5LXT A;  3J80 N;  1Q82 W;  3CPW U;  2DYR C;  4FMT A;  3E22 B;  2WLL B;  4GX0 A;  4MVU A;  4B3T O;  4QJF B;  4XDJ A;  1BL8 A;  3SYQ A;  4JI3 O;  1AP6 A;  3OUS A;  1L0L H;  3SPI A;  1IBL B;  1TUB B;  1AJN A;  3OR6 C;  1RM1 B; 
#chains in the Genus database with same CATH homology
 3ABU A;  3ABL C;  3ABT A;  2GHY A;  2KB1 A;  1M57 B;  2QM8 A;  2JEX A;  2P67 A;  2WLL A;  1AR1 B;  4PDV A;  1VQO V;  2QKS A;  2DWD C;  2ZDI C;  3X2Q B;  3E8G A;  3LDC A;  3ZRS A;  1YIT V;  1H8H G;  2DQ0 A;  3E86 A;  3LSQ A;  1YTF B;  1K73 W;  1FXK B;  4FIP C;  2A79 B;  1E1R G;  3K0G A;  5E1A C;  2WLM A;  4FJC C;  4JGS A;  3R65 A;  4MSW C;  2HFE C;  4RUF A;  1VQL V;  5FL7 G;  3FB7 C;  5L3C A;  2OTL V;  4WFG A;  2XAJ A;  5L3B A;  5B1A C;  3FB8 C;  1G4Y B;  1PNL A;  3T4D A;  1KD1 W;  1Q86 W;  2X6B A;  4WFA V;  2IJJ A;  2LFS A;  2IJI A;  5KA5 A;  5H9C A;  1COW G;  1M56 B;  1H38 A;  2Q69 A;  5CBG A;  2IU3 A;  3ZN1 A;  2JDI G;  5L3D A;  4G2K A;  1QCE A;  1OCZ B;  1KEC A;  2EIL C;  2ZQM A;  1K5Q A;  3CCS V;  2UXX A;  3A0R A;  3CCM V;  4ZKI A;  2P7T C;  1QR9 A;  4LC1 A;  2QEX V;  4R8C A;  1NVP D;  5HFM A;  1R3I C;  1NJI W;  2JJ1 G;  3AEI A;  5HFL A;  3ML0 A;  4RQF A;  3ABM B;  3DGE A;  1XL4 A;  1HWY A;  4BIZ A;  1Q7Y W;  4G28 B;  4MW8 A;  2HG5 C;  3K9A A;  5L3G A;  4PEL A;  3T1C A;  1V55 C;  2X6C A;  3CCR V;  3UKM A;  3CD6 V;  3JD1 A;  4YXW G;  1MOF A;  3RW0 A;  2DWE C;  3OAA G;  1FXK A;  2X7R B;  1S5H C;  2V1D A;  4MT8 A;  3SYP A;  4F4L A;  2H8P C;  3UM7 A;  3ABK C;  3K08 A;  4MVO A;  1S76 D;  3K0D A;  2WSS G;  3W7S A;  1AI6 A;  3ABL B;  3TK1 A;  4X8A A;  5DM6 V;  5EC1 C;  4LP8 A;  3SPH A;  1DLB A;  2ATK C;  2WLK A;  3ETG A;  4H37 A;  2Y48 A;  4HYO A;  5EBW C;  2A9H A;  4MTF A;  4X88 A;  1M57 C;  4MTG A;  5EC2 C;  1OCO C;  4UVB A;  2WLI B;  3MHS C;  3ZRV A;  3B8M A;  3CCV V;  2JIZ G;  2AHZ A;  2YEV B;  2QE7 G;  4G27 B;  2B1I A;  2P90 A;  1IXM A;  4HZ3 A;  2HLD G;  1N8R W;  2EIK C;  2WWW A;  1F4N A;  3FB6 C;  1ARO P;  4JAU A;  3ZJZ A;  4QPK A;  3OEE G;  5B3S C;  3CMA V;  1WPX A;  4WFH A;  1PL0 A;  4R50 A;  2IH1 C;  1VQ8 V;  1AI7 A;  4XDL A;  5B3S B;  1K3E A;  1Q81 W;  2GSM B;  2WAM A;  2IJK A;  1H8E G;  4MW3 A;  3AG4 B;  3HB3 B;  2MK3 A;  2XND G;  3JYC A;  1AJP A;  1XL6 A;  1KC8 W;  2PI4 A;  1R73 A;  2DYS B;  2ZD9 A;  3K3W A;  1KKD A;  3AG3 C;  3ZMT A;  3CCE V;  1J95 A;  3T2M A;  4DXW A;  1TUE B;  2XAH A;  1SZT A;  3K04 A;  1S72 V;  1EBO A;  1CEZ A;  3W7X A;  1QLN A;  1NR1 A;  1YHQ V;  2W0F C;  1W2B U;  1Y4M A;  1S0V A;  4MVM A;  1JX9 A;  5B1B C;  3F5W C;  5DN6 G;  1LNQ A;  4JYB A;  1FXK C;  2EIM C;  1E1Q G;  3STL C;  4LCU C;  5BZB A;  3RVY A;  4PA3 A;  5KA6 A;  1OCC B;  5EBM C;  4UV9 A;  1GM7 A;  2EIJ B;  1K5S A;  3JD4 A;  2ZXW C;  3ZRW A;  5LGU A;  4JAS A;  5LHG A;  5KUK A;  2H94 A;  1R6N A;  3QO7 A;  1GTO A;  2LP7 A;  4RQE A;  1DTO A;  3E8B A;  5IDJ A;  1UJW B;  4JTD B;  3OMN B;  2HR3 A;  3AG2 B;  1PNM A;  3CC2 V;  2WLI A;  3JD0 A;  3D3I A;  3PJS K;  4JTC B;  1EFR G;  4RO2 A;  3LUT B;  4QNH B;  1G8M A;  1QLE C;  1E79 G;  2HVK C;  4MTO A;  4U7N A;  1GKF A;  1NR7 A;  3ASN B;  4FK5 C;  4UV8 A;  1RM1 C;  3CXC U;  1NQT A;  2P6J A;  2JK5 C;  1NVP B;  3E2E A;  2EIN B;  1M1K W;  3ZRX A;  1K92 A;  1M9N A;  1CP9 A;  4UVC A;  5H6Q A;  2ITD C;  4LBE C;  2QM7 A;  2OCC C;  1KP3 A;  3CCJ V;  3ETE A;  1VQ7 V;  3AG4 C;  4CZZ A;  1VQ9 V;  1VQ5 V;  1OCZ C;  1R3J C;  5IYD O;  3FYI B;  2WLH A;  3W7U A;  2A0L A;  2DQ3 A;  2LFR A;  3K03 A;  4EKW A;  2R9I A;  1NH2 B;  1I5Y A;  4TSF G;  1K9M W;  4BIU A;  1QLE B;  2Q6A A;  1V54 C;  4GX5 A;  1SET A;  1B6Q A;  3SYC A;  3ZN0 A;  1YIJ V;  2EIJ C;  2BOC C;  5LHH A;  4CBC A;  3FYE B;  2IH3 C;  3OE7 G;  4BAY A;  3CCL V;  1GO3 F;  4R6Z A;  3IFX A;  1QVF U;  4RUE A;  2HJF C;  2Q67 A;  4JTA B;  1SES A;  2JJ2 G;  5L3F A;  1VQN V;  3P30 A;  4MVS A;  1M56 C;  2EZO A;  3ZMV A;  3SPG A;  1K34 A;  4WFB V;  5CBF A;  2ZDI A;  3FKS G;  3CP1 A;  3OMI B;  3CCU V;  3GB7 C;  2ZXW B;  3G71 V;  1R3L C;  3OFN G;  1W0J G;  2XAS A;  4JYC A;  1M90 W;  2XOK G;  2ZR3 A;  4KUM A;  1NH2 D;  2WLN A;  3EHB B;  3LSS A;  3TET A;  3KG2 A;  4QE7 A;  3B77 A;  2QA4 V;  2Z3Y A;  4QPJ A;  2B1G A;  2ITC C;  5CA3 A;  1CPY A;  2BOB C;  1QR8 A;  1V54 B;  2XAF A;  3OUF A;  2D3O W;  1KQS U;  1YJW V;  4R7C A;  4HAM A;  5L3E A;  1PKX A;  3K06 A;  3CYO A;  3BY6 A;  1GM8 A;  1KP2 A;  5IY5 B;  5IY5 C;  1YSC A;  2Q68 A;  1OCR C;  3M99 B;  4UXN A;  4ASU G;  3OM3 B;  2EJR A;  4FPP A;  1I5X A;  3K79 A;  5LGT A;  1BHA A;  4I5S A;  1GM9 A;  3MHH C;  3ABM C;  3GWO A;  3OEH G;  4ZBM A;  1JPX A;  3AG1 B;  4PDR A;  2DW4 A;  2UXN A;  3VOU A;  2EIN C;  4BW5 A;  1FXH A;  3QNE A;  1BHB A;  4GX1 A;  2Y69 C;  3SYO A;  1K33 A;  1QBZ A;  3WFV A;  4N21 A;  3SPC A;  3ZCC A;  1S77 D;  4PA6 A;  3DTU B;  4OXS A;  4TT3 G;  3WG7 C;  4KFM A;  1MAB G;  2YSU B;  1K7D A;  4KP4 A;  3CC4 V;  5LHI A;  1VQM V;  3NXS A;  2Z5U A;  4XBF A;  5CN0 A;  4WCE V;  2X6A A;  1DF5 A;  1PD3 A;  1VQ4 V;  1YJ9 V;  2IJH A;  4WF9 V;  1WLE A;  5C93 A;  1P4R A;  3JD2 A;  4P9P A;  4X89 A;  1SER A;  3ABK B;  2IW5 A;  1OCO B;  1AI5 A;  4L87 A;  3AG2 C;  3E35 A;  1F51 A;  4XDK A;  1JJ2 U;  1NKD A;  3VBB A;  1YTF D;  2CK3 G;  3ETD A;  1QVG U;  3X2Q C;  5LGN A;  1JVM A;  1ENV A;  3F7V C;  3T4Z A;  1S3J A;  4E2L A;  3QO8 A;  4GX2 A;  3I56 V;  1VQK V;  3BEH A;  4N23 A;  2OT5 A;  4UUJ C;  3WG7 B;  2K1E A;  4PDM A;  2WPD G;  4MTX A;  3ZMU A;  2AHY A;  1MSW D;  1R6K A;  3W7W A;  5B1B B;  1W0K G;  2DYR B;  4Z1M G;  3IC7 A;  3JD3 A;  3OMA B;  5H6R A;  1EZJ A;  4I9W A;  2NLJ C;  2ZR2 A;  3HPL C;  1OCC C;  1RPO A;  2FTK A;  3AG1 C;  2W6J G;  4GT1 A;  4H33 A;  4P30 A;  2JEU A;  1BMF G;  2OCC B;  3I55 V;  5B1N A;  3ZRW B;  4P2Z A;  1ROP A;  4P9O A;  3E8F A;  2EBO A;  1ORQ C;  1P7B A;  1VQP V;  3RVZ A;  5GW7 A;  3OR7 C;  1OHH G;  5IYB O;  4PA7 A;  3F7Y C;  3G4S V;  1THZ A;  1GK9 A;  4MVQ A;  2WLJ A;  3CME V;  3G6E V;  1K8A W;  1RPR A;  2HKO A;  4MVR A;  4DO2 A;  1ZWI C;  3LNM B;  3E8H A;  2DYS C;  2M7W A;  5B1A B;  3LDE A;  4Q20 A;  1OZ0 A;  1OCR B;  4QE9 A;  3TCU A;  1R3K C;  4UVA A;  5J9P C;  1F4M A;  1GMG A;  3OW2 U;  2C2A A;  3ZMS A;  3ASN C;  3ZMZ A;  3STZ C;  5IYC O;  3MD0 A;  1FS0 G;  2R9R B;  2EIM B;  4TWK A;  1JOY A;  2PI5 A;  4J9Y B;  4QIW F;  1Y66 A;  5B1O A;  5EBL C;  3EFF K;  3LDD A;  2HVJ C;  1YJN V;  5LBQ A;  2EIK B;  4GCZ A;  3FB5 C;  2X0L A;  3CCQ V;  3E89 A;  1K4C C;  1VQ6 V;  4J9Z B;  2OTJ V;  2EZP A;  1V55 B;  4RAI A;  2F43 G;  1FFT B;  5KUM A;  1K97 A;  1K4D C;  2NNU A;  1AI4 A;  1JCH A;  3QO5 A;  3ASO B;  3JCZ A;  3OGC C;  1F23 A;  3B8N A;  3E83 A;  1L1F A;  2YEV A;  4PA9 A;  2W6I G;  1MG1 A;  1NBM G;  4MS2 A;  4WFE A;  4WFF A;  1YI2 V;  3AG3 B;  4JPR A;  2B5U A;  1SRY A;  4U7O A;  1AJQ A;  2EIL B;  4JAV A;  1Q82 W;  2Y69 B;  1H2G A;  3D36 A;  3IGA C;  2IU0 A;  3CPW U;  2DYR C;  3P32 A;  4FMT A;  3ZIA G;  2XAG A;  2WLL B;  4GX0 A;  4MVU A;  3H01 A;  4JF3 A;  4QJF B;  4XDJ A;  3SPJ A;  1BL8 A;  3SYQ A;  5CBH A;  2QTO A;  3W7T A;  3CC7 V;  1PNK A;  4PA4 A;  3OUS A;  5EK0 A;  3SPI A;  2V7Q G;  4PDL A;  3ASO C;  1JQ0 A;  3RBZ A;  1FXV A;  1AJN A;  3OR6 C;  5CMU A;  1RM1 B;  4MVZ A;  2XAQ A;  3SYA A;  3SJQ C;  1DF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...