4R6ZA

Crystal structure of cng mimicking nak mutant, nak-etpp, cs+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
FQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 33
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r6zA00
2WLNA 2Q67A 1KKDA 3WG7C 4J9YB 4X89A 3AG4C 1QLEC 3K04A 4H33A 4MVUA 3E83A 2EINC 4MSWC 4X88A 3F5WC 4MVOA 3E8HA 4GX2A 1R3JC 3K0DA 2EILC 4JTDB 3TETA 3SYAA 3SPIA 2R9RB 3LDDA 2WLIA 1BL8A 4HYOA 3SPCA 3SYOA 3OGCC 2P7TC 4JTAB 3UKMA 5B1BC 3VOUA 3UM7A 4F4LA 4MVZA 4JTCB 2ZXWC 5J9PC 1M56C 3SPGA 2QKSA 2Y69C 2QTOA 1V55C 4GX5A 4MVSA 5EBMC 2WLHA 2ATKC 1XL6A 1XL4A 2H8PC 1P7BA 4WFEA 3ZJZA 3T1CA 2IH1C 4QE9A 1OCRC 3ASOC 2W0FC 2AHZA 2YEVA 3SJQC 3ZRSA 3SPHA 4P9OA 1S5HC 2WLLA 5EK0A 2EIKC 4CBCA 3SPJA 3AG2C 3FB5C 5EC1C 4EKWA 3TCUA 5EC2C 3ABKC 5CBHA 2DWDC 3AG1C 4MTOA 2NLJC 3EFFK 3K03A 5E1AC 4DXWA 3OR6C 5B1AC 2DWEC 1OCZC 4PA6A 1K4CC 2DYRC 4R8CA 4PDMA 2EIMC 1V54C 4PDRA 4RUFA 2ITDC 3T4ZA 2AHYA 3RW0A 3X2QC 2Q69A 1K4DC 4TWKA 4RUEA 4X8AA 4G27B 4PA7A 4WFFA 3STZC 2IH3C 2HVKC 4KFMA 4MVMA 3STLC 3BEHA 2K1EA 1JVMA 3FB8C 4LBEC 4QNHB 4MTFA 1G4YB 3SYQA 3E89A 4PDVA 4MW3A 2HG5C 3RVYA 1OCCC 4PA3A 4XDKA 1M57C 4XDLA 5B3SC 2X6BA 4I9WA 2WLIB 4LCUC 4OXSA 3OUSA 3FB6C 3OUFA 2BOBC 2Q6AA 2A9HA 2HFEC 4J9ZB 3R65A 4MVRA 3T2MA 3K08A 4P9PA 4R50A 4GX1A 4GX0A 3SYCA 3GB7C 3SYPA 4RO2A 3ABMC 3K06A 5IY5C 2HJFC 2Q68A 4HZ3A 2ITCC 3LNMB 1LNQA 5BZBA 4PA4A 3IFXA 3FB7C 4MW8A 4R6ZA 4XDJA 1ORQC 3E8FA 1R3KC 2WLLB 2X6CA 3ASNC 2WLJA 5CBFA 3AG3C 4PA9A 4UUJC 3E86A 2A0LA 3K0GA 4MS2A 3RVZA 2DYSC 2ZD9A 3JYCA 4P30A 1ZWIC 1OCOC 4WFHA 3HPLC 3T4DA 5CBGA 3E8GA 4MVQA 3F7VC 4P2ZA 2A79B 3OR7C 3ABLC 3LDCA 2WLKA 5EBWC 4QE7A 1J95A 2WLMA 2HVJC 3F7YC 3LUTB 2OCCC 4G28B 2BOCC 3LDEA 5KUMA 2EIJC 2KB1A 4RAIA 3KG2A 4WFGA 4MTGA 4ZBMA 2X6AA 3RBZA 5EBLC 4R7CA 5KUKA 1R3IC 1R3LC 4H37A 4LP8A 2JK5C 3IGAC 3E8BA 4BW5A 4PDLA 3PJSK
chains in the Genus database with same CATH superfamily
2YDEA 1XBLA 1MSDA 1Y74A 3W7XA 2Y69B 4LF6O 4LF7O 4DR5B 4X88A 2JIZG 1R3JC 1I7FA 4K3AA 3TETA 1NZ6A 4B3SB 4FFKA 3UM7A 5LP6B 4JTCB 4BIUA 3CS5A 4DR1B 2QTOA 4JI4B 4DV0O 2ZM6O 1GN4A 3FYIB 3T1CA 4O4JA 5LHGA 1FXKC 3JD0A 1QR8A 4JI5O 1N0NA 4KXRA 4FK5C 5GONA 2XOKG 1SC5B 1TVKB 2BTOA 2R9IA 3P3NA 3WFVA 1U97A 3U0ZA 1SKVA 5IDJA 4X1YB 5L3DA 4I0XB 4PA7A 2Q4PA 4X64O 3IAYA 1OHHG 4MVMA 2YIAA 3FB8C 3ZCCA 4LBEC 4CS2A 4QNHB 5JVDA 4MTFA 4I9QA 1OCCC 4WBNB 1BMFG 1F4MA 1IURA 4LCUC 2DOSA 1KD1W 1YZBA 2Q6AA 3THOA 2HFEC 2KKWA 2DN9A 3BA9A 3A0HZ 5IWAB 4J7ZA 1NR7A 4JI7B 1PP9H 4DK1A 4BWAA 4X20B 4IL6Z 3ZX6A 1LNQA 4XDJA 3E8FA 1R3KC 4CS4A 1YJWV 2B1GA 2KQXA 3JALB 3DXRA 2DYSC 4BIZA 2UXCB 2FL4A 5D5PA 2YXHA 2AXTZ 5KMGB 5DECA 2HR3A 1QCEA 1NVPD 2UUCO 1B6QA 4HNAB 3E22A 1R3LC 2RCVA 4PDLA 3ZS8C 2Q67A 3WG7C 3SJBC 1EN4A 3OTOO 5EYPB 2PGGA 4DV7O 1FXKB 1N32O 3F5TA 3E35A 4QIWF 3P32A 2EILB 4DRXA 3ZRWB 1P7BA 4L8JA 2IH1C 4TV9A 2VWJA 1W2BU 5H6QA 3IJ4A 5FPRA 3UO2A 3AG2C 1NBMG 4NB5A 5CBHA 3B8NA 1VQLV 1N0JA 1SA0B 2GTSA 1VQ6V 3PN1A 1NH2D 4AHCA 4PDRA 3ZMTA 3T4ZA 4X65O 2XAFA 4RUEA 2F93B 4I55B 1CP9A 2HVKC 4DR2O 1PNLA 2IW5A 2VRZA 1IBKB 4JGSA 1QU7A 4DR3O 4X1IB 3MDSA 1Z5VA 1YIJV 3C3SA 5K1PA 1Y76B 2PYJA 5C8YA 3B09A 2JEXA 3K08A 2FTKA 2W0XA 1J5EB 1L0NH 3CHXA 1YJ9V 1RPOA 1Q6IA 4I4TB 5ITZA 1M4UA 1VQ4V 1YTFB 2RDCA 2CGOA 2IU3A 2RJZA 2ZD9A 2BE3A 3CD6V 2ZE7A 4K0KO 4LWSA 4RWUA 4NTWA 3WG7B 2WLKA 2KB1A 1M1KW 1B04A 3ZN1A 2HP8A 3CMEV 5GW7A 2P90A 3OTFA 4AILC 3JD3A 4QJFB 4LFBB 2KG7A 1X59A 4GX2A 1XEQA 1NR1A 3AEIA 4Q20A 2WLIA 1BL8A 4TUYB 5B1BC 2VQFB 1M93A 4DYLA 1RSOA 2HLDG 2ZXWC 3AG2B 3SPGA 2DE0X 3BCCH 4UFZA 1XL4A 1D2DA 5KHGA 3APOA 1D5NA 3BAAA 5A2QN 3VQYA 1O9HA 4E2LA 5LYJA 2P22C 4NVPA 1WPXA 5EC2C 2DQ3A 4ZOLA 4LNUA 3UQ8A 4TQFA 1E1QG 1JCHA 1L0LH 3K03A 5B1AC 2DWEC 4PA6A 4PDMA 2EIMC 4U3JA 3CCLV 1GM9A 3T1HB 4YIPA 5IJ9B 2QR4A 2JJ2G 4PI2A 4JZGA 4KL1A 4AQYB 1KYOF 5H9CA 3E89A 5B3SC 4NTYA 5IJ0B 1P4RA 3FAVA 4DR4B 3G4SV 5LGTA 3JATA 1MA1A 4GX1A 3ZIAG 4O4JB 1KKCA 2NNUA 3JCZA 3N2KA 1FFTB 1LR1A 3K5MA 5HFLA 2ADQB 1OZ0A 2X6CA 2VQEO 5GONB 4JYBA 3K0GA 4K8XA 2F23A 4DV2O 4JI0O 5JJJB 1DF4A 3F7VC 3ABLC 2HVJC 1IBLO 2EIJC 2QE7G 2LJ2A 4MTGA 5JVDB 1YJNV 1HW7A 1BSMA 5BMVA 5B1BB 1VQ7V 2WLNA 4B3RO 1M5IA 2ZXWB 1SQFA 3A8TA 4YY3O 4H33A 1AJPA 2K9PA 4LF8O 3MD0A 1AP6A 5CA3A 2ZR2A 1GTOA 4LF4O 4F4LA 1AI6A 1IXBA 2DW4A 4OX9O 4GX5A 3DXRB 1WA8A 5B1AB 1VF5B 1YDXA 3CJHA 2EIMB 3TK1A 3ZRSA 1AR5A 1KP2A 2QM4A 1XUQA 2QA4V 1N36B 1S0VA 1XNRO 4WFBV 3CCRV 1MNGA 2DYRC 5B3SB 3CXHF 1NS1A 3GWKC 5H2FZ 1N8RW 1N33O 3B8MA 3JAMN 3LSUA 5J2TA 4XDLA 1KMIZ 4H0LB 4LF6B 4DUZB 3QVNA 4LF7B 3JALA 4PI0A 3LSQA 4GZRB 4DRXB 2QM7A 4TV9B 5CB4A 3RYFA 1BE3H 5BZBA 2EJRA 3FB7C 3ABLB 2FMLA 3CRCA 2PUSA 4DV0B 2WA3A 3AG3C 4UUJC 1R6KA 4TT3G 2ZM6B 2A0LA 2EIJB 4MS2A 3RVZA 4JI5B 1OCOC 1PPJH 5K1XA 5L3GA 5L3FA 2QJ1A 5EIBD 2P5OA 1ZX3A 2RN9A 1S5LZ 3F7YC 2QSAA 2QKCA 4LF9O 2BOCC 3LDEA 5EYPA 3VQXA 2XTAA 3WB1A 1GN2A 2HKOA 5EBLC 1ZLZA 1R3IC 2F66C 3ETEA 4X64B 3PJSK 3MHHC 1Q7YW 3ZRWA 5C8YB 4ZI7A 1FD9A 4MVOA 1H2MA 3D3QA 1MZFA 4JZ2A 3HKEA 4FZ1A 3VOUA 4HAMA 5ITZB 3OE7G 3H9VA 2IJJA 3ETDA 3FYEB 1WN7A 2DYRB 3DSQA 2ZE8A 2YEVA 3K9AA 5LA6A 2ZT9B 4LWSB 3KZIZ 1AP5A 1SF9A 4MTOA 3B40A 2LFSA 4X1IA 2QDOA 4FJCC 4Q6GA 1R1BA 1K97A 1BT8A 4JI6B 2BCCH 2IH3C 2XAHA 1RM1C 3BEHA 4DV5O 4TOIA 1DGSA 3LSSA 2WLIB 3Q4HA 3L72H 4I4TA 4E4EA 5KAIZ 3AG3B 5IYCO 1RSOB 1SZXA 1I94O 4DV7B 3RYIA 1QHTA 1N32B 1OCOB 1UJWB 2IJIA 3ABUA 3ZMZA 1L1FA 2ITCC 2QEXV 5LYJB 3D3IA 1WNSA 2JGDB 4ZOLB 4LNUB 2W6JG 1F23A 4ASUG 5LMNO 4P30A 3TXQA 2QWPB 1SS3A 3APQA 3CB2A 4N23A 2AGAA 2Q9LA 1ZAUA 4DV3O 2Q73A 4B3MO 1L8DA 2UXXA 4J10A 3I56V 4DR2B 4JYAO 1FAFA 3FAVB 1PNKA 1K73W 1NVPB 4DR3B 3JATB 5LGNA 4CC5A 4NXNO 3B77A 4GKJO 3WB0A 1PM9A 5LGUA 2H3OA 4MVZA 2X0LA 1P7GA 1SERA 2YIBA 2Q5ZA 5A9GA 1XMQO 4O2BA 4CH6A 1VP7A 2BTQB 3SJQC 5IJ9A 1AI5A 1S5JA 1EZJA 5F2VO 3DC5A 2EX3A 4JPRA 3M99B 4TV8A 3FB5C 4CBCA 3ETGA 1RM1B 1VQ9V 4K0KB 5IJ0A 5J2UA 3ZMUA 1F51A 1YCIA 3K9SA 4FZ0A 5BMVB 5L3BA 3OMAB 4G27B 3S3WA 1IZ3A 3ETQA 1VMGA 1EZVH 1H2GA 4X66O 3RVYA 4PA3A 4XDKA 1NH2B 4EFEA 2GSMB 1KUQA 4X9QA 4B08A 3OUFA 1EFRG 4ZHQA 2RQ6A 3T2MA 2YIDA 3L73H 1SRYA 4GX0A 1WA8B 3SYPA 4RO2A 3CJHB 3T1YB 4BR6A 4LFCO 3ICXA 3GWOA 4LF5B 3T4DA 1XHXA 4ABMA 2UXBO 2B1IA 3TXSA 2GTAA 1I08A 2ZDIA 4JI3O 1YXBA 4NKGB 2XAJA 5J2TB 1H2KA 2RNBA 2ZIOA 4JI1O 2V7QG 4FLZA 4FLWA 4JAAA 2C2AA 1MOFA 3J7AU 5CB4B 3RYFB 1G6UA 1H2NA 2F4VO 2YXYA 1F7YA 4F6EA 1GO3F 2CK3G 3CWBH 4IGGA 4NYKA 1BHBA 2JEUA 3CRAA 3ZJZA 4EFBA 4U7OA 1OCRC 3ASOC 2WA4A 1QBZA 2VQEB 3U10A 2EULA 4WCEV 1MMMA 2Q7EA 4DV2B 4CC6A 4JI0B 2CTRA 4KP4A 5JQGA 3CXCU 2V4DA 3SDLA 1XILA 4O4LB 4FM2A 1SESA 3B2EE 5FPOA 1I5YA 1I0HA 4GCZA 3X2QC 1IBLB 4ZI7B 2LQTA 1BHAA 4B3RB 2QGNA 2NN4A 3K3WA 3HKEB 4YY3B 3CC2V 3ABTA 3CP1A 4LF8B 5LMUO 1VF6A 2ZKOA 1T5EA 4TSFG 2PY5A 1SQPH 5C93A 4K35A 1GMGA 1KB9F 2JS3A 4LF4B 1OCCB 4WFAV 4NXMO 2YEVB 3BPZA 5LA6B 3L70H 1SQBH 2L6LA 3L71H 1H2SB 2EBOA 3UCSC 1SQQH 5EZYA 1PL4A 3CEIA 4UV8A 1ZWIC 4CH3A 1XMOB 1EN6A 5BXZA 1QVFU 1VQ5V 5LHHA 2AW9A 3JASA 1NQTA 4GYCB 4J7KA 1XNRB 2DYSB 3G71V 2ZNIA 1EBOA 4OPAA 4LP8A 3SGIA 3Q4HB 3OD4A 1YITV 2YI9A 2A06H 4B7EA 3RYIB 4UCUA 1Q3EA 1HNZO 3W7UA 3K0DA 1VQMV 1OCRB 3ASOB 3C3TA 4FLTA 3JAWA 1AROP 4MT8A 5GTHZ 3DTUB 3OGCC 5EIBC 1IDSA 3OGIB 4GUNA 4D6TH 2Z0AA 4FLXA 1MABG 3CMAV 1JJOA 1V55C 3RT3C 2H94A 1P49A 4DR5O 2LGWA 2UU9O 2CAZC 3JAKA 3X2QB 1ENVA 1S5HC 4GT1A 2EIKC 5EC1C 1VIBA 4UCOA 4B3SO 2Q7GA 3AG1C 3EFFK 5LL6Y 3OR6C 3H1JH 5IYZA 2A7WA 4LF9B 2HJDA 1GM7A 4TWKA 4X1KA 2ZINA 3L74H 2RMKB 3OAAG 2ZDIC 4LFAO 1YHQV 5KLVH 4KUMA 3L9DA 2CDYA 4UCVA 1YEWA 3OUSA 3FB6C 1FS0G 1IXMA 2BOBC 2JGDA 1R6NA 4UVCA 2CTQA 4O2BB 1KU9A 4JI8B 3NR7A 4R6ZA 3RFRA 4TV8B 5IE9A 5B1NA 2EZOA 3JCUZ 5J2UB 2M7WA 5KX5A 4P2ZA 5EBWC 4JI2O 4JI7O 2O57A 1W0JG 5KA5A 4DV4B 1K33A 3WU2Z 4EEQA 1GN6A 3CCEV 2IBZH 2LW7A 2CGNA 1KKDA 1Q43A 4ZHQB 5GTIZ 2EINC 4IIJB 3JSLA 3OT7A 3ZHSA 2BTQA 2CE4A 3S3XA 5L3CA 1WB8A 5B1OA 3UKMA 1I94B 1JOYA 2EIKB 1DF5A 1M56C 1VF6C 1Y67A 4MVSA 3AG1B 1JFFA 1XL6A 4DV6O 2UXDO 3BHPA 1NJIW 5CA1A 4QE9A 4DW0A 2PI5A 3KCXA 4X62O 4FM1A 2P4VA 3SPJA 5LMNB 1MG1A 1QQCA 4FM0A 4H13B 4R8CA 1Q8IA 4I5SA 3K79A 4B3MB 3IC9A 3STLC 1JVMA 3H01A 2Y0PA 5KHKA 5CA0A 4FIPC 3OMIB 5B5EZ 2ADPA 2E75B 2L35A 1WJZA 4IHJA 4D7TA 2N05A 1WLEA 3ZRVA 4P9PA 4DW1A 2OCHA 4GKJB 1VARA 5IY5C 2Q68A 3IFXA 4DR6O 1NKDA 3QTCA 5CBFA 2GUZA 1XMQB 3QG5A 3E86A 5JQGB 1SQVH 4DUYO 2HHHO 5CMUA 3E8GA 5FL7G 4JYYA 5KHHA 4FPPA 2CUGA 5KUMA 2EINB 5JH7A 1S76D 1G1XB 2BSKA 2LFRA 3M8AA 2FB5A 2DJVA 4J11A 3AG4C 4NTXA 5LOVA 1IBMO 4X66B 3N27A 3AK3A 3I5DA 2QKAA 1GH6A 4LFCB 1K92A 4IYIA 5EBMC 5EZYB 4O4LA 2JJ1G 3CCJV 4F6RA 4FLVA 2Q8VA 3J80N 2P6JA 1EM1A 4ZKIA 3JASB 2YS8A 1JA8A 3TCUA 5E79Z 5H6RA 2DWDC 4LH7A 2UXBB 1MZEA 1YSCA 2YICA 4O4IA 2LW1A 1AI7A 2ITDC 3OMNB 4KHPO 2XT9A 3VQWA 4IT5A 3QF7A 4JI3B 4A5UB 1GK9A 1XHZA 1K8AW 5IY5B 1GM8A 1QVGU 1M57C 3JAWB 4B3TO 1Q90D 4PJ0Z 4R50A 2VWKA 5JCOC 3KCYA 1URFA 4HZ3A 3QO7A 2UUCB 3JAKB 3U11A 2OT5A 3ZEDA 3O65A 2Q7HA 5IYZB 2M6YA 2QWQB 3FKSG 2EZPA 3G6EV 4MVQA 3ZHUA 3OTOB 3AG4B 4X1KB 2OCCC 2UUBO 1VQKV 4RAIA 1S72V 2EJ7A 2ZCEA 4ZBMA 2Z3YA 3RBZA 2OYQA 1KQSU 3HKDB 1XOUA 2Q0OC 3W7WA 2ILMA 2P67A 4U3FH 1B3QA 3OM3B 1N34O 3B4SA 3BFRA 2OTJV 2X7RB 2XASA 3AK1A 4JTDB 4RQFA 2F43G 5BY1A 1HNWO 5LMUB 3ZMSA 1FJGO 4NXMB 1K34A 1HWYA 3JD4A 1SQGA 1WAZA 4X65B 5BR8O 2JVDA 1HP8A 1JQ0A 1NT2B 5KX5B 3CPWU 3CCVV 5EK0A 3HKCA 3ABKC 4BAYA 4YHHO 1M57B 3A2FA 4C7UA 5FNVA 2ZNJA 4FMTA 3NXSA 4GKKO 3HB3B 4WFFA 3STZC 4XBFA 1CXZB 2F1MA 3ZRXA 4QPJA 1U96A 4I50A 2CTWA 1ZTEA 1IVSA 2QWNB 4OXSA 4DV1O 3OW2U 1NU1H 2MW2B 1HNZB 3CE2A 2OIEA 1K7DA 1JFFB 2IJKA 5CA1B 1LUVA 2QM8A 2CH7A 4ICGA 4PA4A 4YXWG 1S77D 4B7KA 1TA8A 3G6BA 3A0RA 3KKYA 2OCCB 2F95B 1NTMH 4DUZO 2UU9B 3HPLC 1QLNA 1R73A 1HNXO 1WB7A 1RPRA 1ZL8A 5KAFZ 3DC6A 4IIJA 1AR1B 2PI4A 2HEPA 3BVOA 4R7CA 1X4TA 5CA0B 4H37A 1Q6UA 1M9NA 4IHJB 4O2AA 1Q81W 3ZHQA 4PD4F 4LFAB 4U7NA 2EILC 1GRJA 1H38A 3QO8A 2P7TC 2YI8A 2GUZB 5J9PC 2QKSA 1HR0O 3ABKB 2PF4E 4Z1MG 3P3PA 1DLBA 3ML0A 2Y0IA 4GLXA 2ARHA 4JV5O 2WLLA 5FLXN 5JH7B 4J80A 3CSXA 1FPOA 2YC0A 2E5LO 4W4KA 3K5OA 2BSKB 2UUAO 1KBHA 4JI2B 1BGYH 1Y4MA 2AHYA 3G80A 4JYCA 1UFIA 1SQXH 4X8AA 1VQNV 2ZIMA 3TGUH 5LOVB 1AJNA 1AILA 3OEEG 1G4YB 2AZ0A 3N2GA 3G67A 4UCTA 4L87A 3CRQA 4Z1VA 1E1RG 1Z2GA 4J9ZB 2Z5UA 4MVRA 4FVMA 3GB7C 1TUBA 1XREA 2P4KA 1BS3A 4JI6O 1FXVA 1JPXA 2JS5A 1NTZH 4F6RB 4LC1A 5L3EA 4JAVA 1K9MW 1P84F 4DV6B 4TQDA 3LNNA 2UXDB 2D3OW 1XNQO 2ZE6A 3JYCA 4O4HA 1H8HG 4X62B 1YF2A 4O4IB 4AI8A 2A79B 4QE7A 3LUTB 3K58A 3IC7A 4IYHA 2PZSA 4J7JA 4FFBA 3FX7A 4YJ2A 1AB3A 3BA8A 1ROPA 2LO1A 1QR9A 3JSNA 3RGBA 3RWRD 4OX9B 1JMKC 4YJ3A 3HKBA 3AG7A 3K04A 3D36A 4MSWC 4DR7O 1DTOA 3CYOA 1W59A 3L75H 3SJAC 3MHSC 3UT5A 2G38A 1W0KG 1YVWA 2Q0AA 3VBBA 3JARA 3HR0A 4DR6B 1N33B 3ZHRA 2W0FC 2IU0A 5TISZ 3AK2A 3K5LA 1PV0A 3O9OA 4EKWA 3RYHA 4DUYB 2HHHB 1THZA 5E1AC 1FXHA 5KA6A 3W7SA 4WF9V 1K5SA 5IT9N 2ETNA 2Q69A 1Z5WA 2LP7A 4D7SA 2WWWA 1XDCA 1GAXA 5LBQA 4MW3A 1VQ8V 4I9WA 2JGUA 1IBMB 3UO3A 3OFNG 4MTXA 3R65A 1SZTA 3K57A 2R9AA 3SYCA 4DR1O 4JI4O 5KHJA 1TGOA 3ASNC 3ZHTA 3QNEA 1FFXA 3HKCB 1F4NA 3HKDA 5CBGA 2XUMA 5FNVB 1B06A 2XNDG 2DMXA 3T1YO 1J95A 1KECA 2WLMA 1JJ2U 1KC8W 3BRCA 5IYDO 2WSSG 4WFGA 2E3CA 4EB6A 4I50B 4KHPB 2FKXA 5LXTA 2PYLA 1VF7A 2QWRB 2OTLV 1KP3A 2MK3A 5D5QA 4BW5A 1BQ0A 3CC4V 2IM9A 4LF5O 4X89A 4UV9A 1Q82W 3EXAA 1OV9A 4B3TB 3BY6A 1US6A 3H1LH 3SYAA 2R9RB 2CH7B 5IWAO 4CZZA 2R72A 3FFQA 4QPKA 3SYOA 3CRRA 4JTAB 3RYCA 1Y74B 3J81N 1JR9A 2ATKC 2ZE5A 2OIGA 2ODMA 4K8ZA 2UXCO 3SPHA 1ZL8B 4LR3A 1AJQA 1V55B 4DV5B 5JCOA 4H44B 5CN0A 1AR4A 1Y6XA 5IYBO 1A32A 2UUBB 3TJTA 3RW0A 3CCMV 1ZSPA 3C90A 4O2AB 1E79G 3A0BZ 1GN3A 2R70A 1VEWA 1RP3B 4UXNA 4OPHA 4PDVA 3ZMVA 4YIOA 3ASNB 1N34B 4G2KA 1TUEB 2A9HA 1YTFD 3D36C 4QGPA 1IX9A 1HNWB 4PV1B 4FLYA 1SETA 4DV3B 1FJGB 2Y48A 4N21A 4MW8A 5LP6A 2WLLB 2WLJA 4BIOA 1Q5OA 3CCSV 5BR8B 1RFYA 4JYAB 4BW9A 2KSDA 3K5NA 2E74B 4NXNB 4YHHB 1ZUQA 1LUWA 4DO2A 1TVKA 2X6AA 3OEHG 1VQOV 2LGQA 1IBKO 2YXLA 3SJCC 1XQ8A 4GKKB 3N2GB 4G28B 4J9YB 1TAEA 2D2CB 3EHBB 4X1YA 4I0XA 1XMOO 4JASA 4MVUA 2VS0A 3RN4A 1MSWD 3F5WC 5H5NA 3E8HA 2A3QA 1OJHA 1TUBB 5AG2A 3CCQV 4DV1B 3SPIA 4WBNA 2OWOA 3E22B 4HYOA 1J5EO 2B5UA 1HDJA 4DK0A 4JF3A 2YIBD 2WLHA 2H8PC 1Y66A 4O4HB 1PNMA 2AHZA 2XAQA 4X20A 1NTKH 4CS3A 1M56B 4UCRA 4P9OA 3CCUV 1UPGA 1PL0A 1CEZA 1M90W 4DXWA 2GDSA 3K59A 1O9GA 4FFBB 1OCZC 1HNXB 4YJ2B 1V54C 2YSUB 4CH4A 5KMGA 4YJ3B 1K4DC 5DM6V 3HKBB 3MAQA 2K1EA 3CX5F 3BABA 1H2LA 3SYQA 4HNAA 1BZKA 3H1IH 2HG5C 4LFBO 2X6BA 2W6IG 3VQVA 3UT5B 5DN6G 1VQPV 2VQFO 2GV9A 3QO5A 1I5XA 2N04A 3JARB 3ABMC 1GKFA 1FXKA 2XAGA 2CTPA 2ZR3A 1HR0B 3EVKA 2QTSA 4PA9A 4Z2WA 3RYHB 4PELA 1BQZA 1WPBA 4WFHA 4JI1B 4JV5B 2E76B 2FYUH 4NR1A 1V9PA 3P30A 3OR7C 2B9ZA 3LDCA 1JX9A 2E5LB 1AVMA 3T1HO 3R66A 2UUAB 4JI8O 4UVAA 1SA0A 4OGQB 2F4VB 2QWOB 5KUKA 1K5QA 4PHZA 4AQYO 5JJNB 2JK5C 1COWG 3E8BA 1D5AA 4I55A 1QLEC 2NR5A 2XHBA 3E83A 5JJEB 4DR4O 2Y4TA 1FYJA 2DQ0A 3LDDA 4ZIBA 3SPCA 1K3EA 4UB6Z 1PKXA 2N74A 3CC7V 4DV4O 3E2EA 1Y76A 1FFXB 3CRMA 2Y69C 4UVBA 1OCZB 2P06A 2KG7B 4WFEA 3WB2A 1PD3A 1EN5A 3I55V 3H1KH 1V54B 1BCCH 1H8EG 1CPYA 5LP6C 2YUAA 2GHYA 1XNQB 3JD1A 4UCSA 3W7TA 5B66Z 2NLJC 4EB6B 2WAMA 2GBOA 4RQEA 1K4CC 1NI8A 1N4CA 5LXTB 3D8CA 4RUFA 5JWPA 4UB8Z 3DGEA 2Y4UA 3ZBHA 5LHIA 2IJHA 4KFMA 3M7MX 5DEDA 3H1HH 3ABMB 2V1DA 1S3JA 4J41A 3ZHVA 1AI4A 3JD2A 1Q86W 4U3JB 4HBNA 4DR7B 4JAUA 3RYCB 1DK1A 4I7ZB 1FKAO 3K06A 2HJFC 3FD9A 3LNMB 5HFMA 4W4LA 4TUYA 1ORQC 2PTMA 4LH6A 2UXNA 5KHIA 1WP7A 4J42A 1YI2V 1R6TA 1G8MA 4CH5A 1XI1A 1N36O 2JDIG 3N2KB 2WPDG 2JRIA 3ZN0A 1QLEB 1WP8A 2ZQMA 3KG2A 3GVMA 3SR2C 1Q6HA 2AZ2A 1QNMA 3IGAC 4FLUA
chains in the Genus database with same CATH topology
1KKDA 3MHHC 1Q7YW 3W7XA 3K04A 2Y69B 3D36A 3ZRWA 2EINC 4MSWC 4X88A 2JIZG 4MVOA 1R3JC 1DTOA 3TETA 3CYOA 3VOUA 5L3CA 5B1OA 3UKMA 3MHSC 3UM7A 1JOYA 4HAMA 2EIKB 1DF5A 4JTCB 1M56C 1W0KG 3OE7G 4BIUA 2IJJA 2QTOA 3ETDA 4MVSA 3AG1B 3VBBA 3FYEB 1XL6A 2DYRB 1NJIW 3FYIB 3T1CA 4QE9A 2PI5A 2W0FC 2YEVA 1FXKC 2IU0A 3JD0A 5LHGA 1QR8A 3K9AA 4FK5C 3SPJA 4EKWA 1MG1A 1THZA 2XOKG 4MTOA 5E1AC 2R9IA 2LFSA 4R8CA 3WFVA 4FJCC 1FXHA 5IDJA 5KA6A 3W7SA 4WF9V 1K5SA 4I5SA 2Q69A 1K97A 3K79A 2LP7A 5L3DA 4PA7A 2IH3C 1OHHG 2WWWA 4MVMA 3STLC 2XAHA 5LBQA 3BEHA 3FB8C 1JVMA 3ZCCA 1RM1C 4LBEC 4QNHB 4MTFA 3H01A 4FIPC 3OMIB 4MW3A 1OCCC 1BMFG 1F4MA 3LSSA 4I9WA 2WLIB 4LCUC 1VQ8V 1KD1W 3OFNG 3AG3B 5IYCO 2Q6AA 1WLEA 3ZRVA 4MTXA 2HFEC 3R65A 4P9PA 1SZTA 3SYCA 1OCOB 1NR7A 1UJWB 5IY5C 2IJIA 3ABUA 3ZMZA 2Q68A 1L1FA 2ITCC 1LNQA 3IFXA 1NKDA 4XDJA 3E8FA 1R3KC 3ASNC 5CBFA 3QNEA 2QEXV 1YJWV 3D3IA 2B1GA 3E86A 2W6JG 1F23A 4ASUG 2DYSC 4BIZA 4P30A 1F4NA 5CBGA 5CMUA 3E8GA 5FL7G 4N23A 4FPPA 2XNDG 2HR3A 1QCEA 1J95A 1KECA 2WLMA 1NVPD 1JJ2U 1KC8W 5KUMA 2EINB 5IYDO 1S76D 2WSSG 1B6QA 4WFGA 2LFRA 1R3LC 2UXXA 2OTLV 1KP3A 2MK3A 4BW5A 4PDLA 3CC4V 3I56V 2Q67A 3WG7C 1PNKA 3AG4C 4X89A 1K73W 1NVPB 4UV9A 5LGNA 1Q82W 3BY6A 1FXKB 3SYAA 2R9RB 3B77A 4CZZA 4QPKA 3SYOA 4JTAB 5LGUA 4MVZA 2X0LA 1SERA 3E35A 4QIWF 3P32A 1K92A 2EILB 5EBMC 3ZRWB 2ATKC 1P7BA 2IH1C 1W2BU 2JJ1G 5H6QA 3SJQC 1AI5A 3CCJV 1EZJA 3SPHA 4JPRA 2P6JA 3M99B 1AJQA 3AG2C 3FB5C 1NBMG 1V55B 4CBCA 4ZKIA 3TCUA 5CBHA 3ETGA 1RM1B 3B8NA 1VQLV 1VQ9V 5H6RA 2DWDC 1VQ6V 1YSCA 5CN0A 1F51A 3ZMUA 1NH2D 4PDRA 5IYBO 5L3BA 1AI7A 2ITDC 3OMNB 3ZMTA 3T4ZA 3RW0A 3CCMV 2XAFA 3OMAB 4RUEA 4G27B 1CP9A 2HVKC 1E79G 1PNLA 2IW5A 1GK9A 4JGSA 4UXNA 1H2GA 1K8AW 4PDVA 5IY5B 3RVYA 3ZMVA 1GM8A 4PA3A 4XDKA 1M57C 1NH2B 1QVGU 1YIJV 2GSMB 3ASNB 3OUFA 1EFRG 4G2KA 1TUEB 2A9HA 1YTFD 3T2MA 2JEXA 3K08A 4R50A 1SRYA 4GX0A 3SYPA 2FTKA 4RO2A 1SETA 4HZ3A 2Y48A 4N21A 3QO7A 1YJ9V 1RPOA 4MW8A 2WLLB 2WLJA 3CCSV 2OT5A 1VQ4V 3GWOA 1YTFB 2IU3A 2ZD9A 3CD6V 3T4DA 3G6EV 3FKSG 2EZPA 4MVQA 2B1IA 3WG7B 2WLKA 3AG4B 2OCCC 1VQKV 2KB1A 4RAIA 4DO2A 1S72V 1M1KW 2ZDIA 4ZBMA 2Z3YA 2X6AA 3OEHG 2XAJA 3RBZA 1VQOV 3ZN1A 1KQSU 3W7WA 4G28B 2P67A 4J9YB 3EHBB 5GW7A 3CMEV 2P90A 2V7QG 4JASA 4MVUA 2C2AA 3OM3B 1MOFA 3JD3A 4QJFB 1MSWD 3F5WC 3E8HA 4GX2A 2OTJV 2X7RB 1NR1A 3CCQV 2XASA 4JTDB 4RQFA 3SPIA 3AEIA 2F43G 4Q20A 2WLIA 1BL8A 4HYOA 5B1BC 1GO3F 2B5UA 2CK3G 3ZMSA 2ZXWC 2HLDG 3AG2B 3SPGA 4JF3A 1K34A 1HWYA 3JD4A 1BHBA 2WLHA 2JEUA 2H8PC 1XL4A 1Y66A 3ZJZA 4U7OA 1OCRC 1PNMA 3ASOC 2AHZA 2XAQA 1QBZA 1JQ0A 1M56B 3CPWU 4P9OA 4E2LA 4WCEV 3CCVV 5EK0A 3CCUV 1WPXA 5EC2C 2DQ3A 3ABKC 1PL0A 4BAYA 1CEZA 4KP4A 1M90W 4DXWA 1E1QG 1JCHA 3K03A 3CXCU 5B1AC 2DWEC 1OCZC 4PA6A 4PDMA 1M57B 2EIMC 1SESA 1V54C 1I5YA 2YSUB 3CCLV 1GM9A 4FMTA 4GCZA 3X2QC 1K4DC 3NXSA 5DM6V 2JJ2G 3HB3B 4WFFA 3STZC 4XBFA 3ZRXA 2K1EA 4QPJA 1BHAA 5H9CA 3SYQA 3E89A 2HG5C 5B3SC 2X6BA 3K3WA 4OXSA 2W6IG 1P4RA 3OW2U 3CC2V 3ABTA 5DN6G 3CP1A 1VQPV 3G4SV 5LGTA 4TSFG 5C93A 3QO5A 1GMGA 1I5XA 1K7DA 4GX1A 3ZIAG 2IJKA 1OCCB 4WFAV 3ABMC 1GKFA 1FXKA 2XAGA 2ZR3A 2NNUA 2QM8A 2YEVB 3JCZA 1FFTB 4PA4A 4YXWG 1S77D 5HFLA 1OZ0A 2X6CA 3A0RA 4PA9A 2OCCB 4JYBA 2EBOA 3K0GA 4PELA 4UV8A 1ZWIC 4WFHA 3HPLC 1QLNA 1QVFU 1R73A 1DF4A 3F7VC 3P30A 3OR7C 1RPRA 1VQ5V 3ABLC 3LDCA 1JX9A 5LHHA 2HVJC 1NQTA 1AR1B 2DYSB 2PI4A 2EIJC 2QE7G 3G71V 4UVAA 4MTGA 4R7CA 5KUKA 1YJNV 1EBOA 1K5QA 4H37A 4LP8A 2JK5C 1COWG 3E8BA 5B1BB 1VQ7V 1M9NA 2WLNA 1YITV 2ZXWB 1Q81W 1QLEC 4H33A 3E83A 1AJPA 4U7NA 3MD0A 3W7UA 3K0DA 5CA3A 1VQMV 2EILC 1OCRB 3ASOB 2DQ0A 1GTOA 2ZR2A 3LDDA 1H38A 1AROP 4MT8A 3SPCA 3DTUB 3QO8A 1K3EA 2P7TC 3OGCC 1PKXA 4F4LA 3CC7V 3E2EA 5J9PC 2QKSA 1MABG 3CMAV 1AI6A 2DW4A 2Y69C 3ABKB 4Z1MG 1V55C 4GX5A 4UVBA 5B1AB 1OCZB 4WFEA 1PD3A 2H94A 3I55V 2EIMB 1V54B 1DLBA 3TK1A 3ML0A 3ZRSA 3X2QB 1ENVA 1H8EG 1KP2A 1CPYA 1S5HC 2WLLA 4GT1A 2EIKC 2GHYA 5EC1C 3JD1A 3W7TA 2QA4V 1S0VA 3AG1C 2NLJC 3EFFK 2WAMA 3OR6C 4WFBV 3CCRV 4RQEA 1K4CC 2DYRC 5B3SB 4RUFA 1Y4MA 2AHYA 4JYCA 3DGEA 1GM7A 1N8RW 4TWKA 4X8AA 1VQNV 5LHIA 2IJHA 4KFMA 3B8MA 1AJNA 3OAAG 3OEEG 2ZDIC 1G4YB 1YHQV 3ABMB 2V1DA 4KUMA 1S3JA 4XDLA 4L87A 1AI4A 3JD2A 3OUSA 1Q86W 3FB6C 1E1RG 1IXMA 1FS0G 2BOBC 1R6NA 4UVCA 4J9ZB 2Z5UA 4MVRA 4JAUA 3LSQA 3GB7C 2QM7A 3K06A 2HJFC 1FXVA 1JPXA 3LNMB 5BZBA 5HFMA 2EJRA 3FB7C 4LC1A 4R6ZA 3ABLB 1ORQC 5L3EA 3AG3C 1R6KA 4JAVA 4TT3G 4UUJC 2A0LA 1K9MW 2EIJB 2UXNA 2D3OW 4MS2A 5B1NA 3RVZA 1YI2V 2EZOA 3JYCA 1H8HG 1OCOC 1G8MA 5L3GA 2JDIG 2M7WA 5L3FA 2WPDG 4P2ZA 2A79B 3ZN0A 5EBWC 4QE7A 3LUTB 3F7YC 1QLEB 2BOCC 3LDEA 3IC7A 2ZQMA 3KG2A 2HKOA 1W0JG 5KA5A 5EBLC 1K33A 1R3IC 1ROPA 1QR9A 3ETEA 3IGAC 3CCEV 3PJSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLN A;  2Q67 A;  1KKD A;  3WG7 C;  4J9Y B;  4X89 A;  3AG4 C;  1QLE C;  3K04 A;  4H33 A;  4MVU A;  3E83 A;  2EIN C;  4MSW C;  4X88 A;  3F5W C;  4MVO A;  3E8H A;  4GX2 A;  1R3J C;  3K0D A;  2EIL C;  4JTD B;  3TET A;  3SYA A;  3SPI A;  2R9R B;  3LDD A;  2WLI A;  1BL8 A;  4HYO A;  3SPC A;  3SYO A;  3OGC C;  2P7T C;  4JTA B;  3UKM A;  5B1B C;  3VOU A;  3UM7 A;  4F4L A;  4MVZ A;  4JTC B;  2ZXW C;  5J9P C;  1M56 C;  3SPG A;  2QKS A;  2Y69 C;  2QTO A;  1V55 C;  4GX5 A;  4MVS A;  5EBM C;  2WLH A;  2ATK C;  1XL6 A;  1XL4 A;  2H8P C;  1P7B A;  4WFE A;  3ZJZ A;  3T1C A;  2IH1 C;  4QE9 A;  1OCR C;  3ASO C;  2W0F C;  2AHZ A;  2YEV A;  3SJQ C;  3ZRS A;  3SPH A;  4P9O A;  1S5H C;  2WLL A;  5EK0 A;  2EIK C;  4CBC A;  3SPJ A;  3AG2 C;  3FB5 C;  5EC1 C;  4EKW A;  3TCU A;  5EC2 C;  3ABK C;  5CBH A;  2DWD C;  3AG1 C;  4MTO A;  2NLJ C;  3EFF K;  3K03 A;  5E1A C;  4DXW A;  3OR6 C;  5B1A C;  2DWE C;  1OCZ C;  4PA6 A;  1K4C C;  2DYR C;  4R8C A;  4PDM A;  2EIM C;  1V54 C;  4PDR A;  4RUF A;  2ITD C;  3T4Z A;  2AHY A;  3RW0 A;  3X2Q C;  2Q69 A;  1K4D C;  4TWK A;  4RUE A;  4X8A A;  4G27 B;  4PA7 A;  4WFF A;  3STZ C;  2IH3 C;  2HVK C;  4KFM A;  4MVM A;  3STL C;  3BEH A;  2K1E A;  1JVM A;  3FB8 C;  4LBE C;  4QNH B;  4MTF A;  1G4Y B;  3SYQ A;  3E89 A;  4PDV A;  4MW3 A;  2HG5 C;  3RVY A;  1OCC C;  4PA3 A;  4XDK A;  1M57 C;  4XDL A;  5B3S C;  2X6B A;  4I9W A;  2WLI B;  4LCU C;  4OXS A;  3OUS A;  3FB6 C;  3OUF A;  2BOB C;  2Q6A A;  2A9H A;  2HFE C;  4J9Z B;  3R65 A;  4MVR A;  3T2M A;  3K08 A;  4P9P A;  4R50 A;  4GX1 A;  4GX0 A;  3SYC A;  3GB7 C;  3SYP A;  4RO2 A;  3ABM C;  3K06 A;  5IY5 C;  2HJF C;  2Q68 A;  4HZ3 A;  2ITC C;  3LNM B;  1LNQ A;  5BZB A;  4PA4 A;  3IFX A;  3FB7 C;  4MW8 A;  4R6Z A;  4XDJ A;  1ORQ C;  3E8F A;  1R3K C;  2WLL B;  2X6C A;  3ASN C;  2WLJ A;  5CBF A;  3AG3 C;  4PA9 A;  4UUJ C;  3E86 A;  2A0L A;  3K0G A;  4MS2 A;  3RVZ A;  2DYS C;  2ZD9 A;  3JYC A;  4P30 A;  1ZWI C;  1OCO C;  4WFH A;  3HPL C;  3T4D A;  5CBG A;  3E8G A;  4MVQ A;  3F7V C;  4P2Z A;  2A79 B;  3OR7 C;  3ABL C;  3LDC A;  2WLK A;  5EBW C;  4QE7 A;  1J95 A;  2WLM A;  2HVJ C;  3F7Y C;  3LUT B;  2OCC C;  4G28 B;  2BOC C;  3LDE A;  5KUM A;  2EIJ C;  2KB1 A;  4RAI A;  3KG2 A;  4WFG A;  4MTG A;  4ZBM A;  2X6A A;  3RBZ A;  5EBL C;  4R7C A;  5KUK A;  1R3I C;  1R3L C;  4H37 A;  4LP8 A;  2JK5 C;  3IGA C;  3E8B A;  4BW5 A;  4PDL A;  3PJS K; 
#chains in the Genus database with same CATH topology
 2YDE A;  1XBL A;  1MSD A;  1Y74 A;  3W7X A;  2Y69 B;  4LF6 O;  4LF7 O;  4DR5 B;  4X88 A;  2JIZ G;  1R3J C;  1I7F A;  4K3A A;  3TET A;  1NZ6 A;  4B3S B;  4FFK A;  3UM7 A;  5LP6 B;  4JTC B;  4BIU A;  3CS5 A;  4DR1 B;  2QTO A;  4JI4 B;  4DV0 O;  2ZM6 O;  1GN4 A;  3FYI B;  3T1C A;  4O4J A;  5LHG A;  1FXK C;  3JD0 A;  1QR8 A;  4JI5 O;  1N0N A;  4KXR A;  4FK5 C;  5GON A;  2XOK G;  1SC5 B;  1TVK B;  2BTO A;  2R9I A;  3P3N A;  3WFV A;  1U97 A;  3U0Z A;  1SKV A;  5IDJ A;  4X1Y B;  5L3D A;  4I0X B;  4PA7 A;  2Q4P A;  4X64 O;  3IAY A;  1OHH G;  4MVM A;  2YIA A;  3FB8 C;  3ZCC A;  4LBE C;  4CS2 A;  4QNH B;  5JVD A;  4MTF A;  4I9Q A;  1OCC C;  4WBN B;  1BMF G;  1F4M A;  1IUR A;  4LCU C;  2DOS A;  1KD1 W;  1YZB A;  2Q6A A;  3THO A;  2HFE C;  2KKW A;  2DN9 A;  3BA9 A;  3A0H Z;  5IWA B;  4J7Z A;  1NR7 A;  4JI7 B;  1PP9 H;  4DK1 A;  4BWA A;  4X20 B;  4IL6 Z;  3ZX6 A;  1LNQ A;  4XDJ A;  3E8F A;  1R3K C;  4CS4 A;  1YJW V;  2B1G A;  2KQX A;  3JAL B;  3DXR A;  2DYS C;  4BIZ A;  2UXC B;  2FL4 A;  5D5P A;  2YXH A;  2AXT Z;  5KMG B;  5DEC A;  2HR3 A;  1QCE A;  1NVP D;  2UUC O;  1B6Q A;  4HNA B;  3E22 A;  1R3L C;  2RCV A;  4PDL A;  3ZS8 C;  2Q67 A;  3WG7 C;  3SJB C;  1EN4 A;  3OTO O;  5EYP B;  2PGG A;  4DV7 O;  1FXK B;  1N32 O;  3F5T A;  3E35 A;  4QIW F;  3P32 A;  2EIL B;  4DRX A;  3ZRW B;  1P7B A;  4L8J A;  2IH1 C;  4TV9 A;  2VWJ A;  1W2B U;  5H6Q A;  3IJ4 A;  5FPR A;  3UO2 A;  3AG2 C;  1NBM G;  4NB5 A;  5CBH A;  3B8N A;  1VQL V;  1N0J A;  1SA0 B;  2GTS A;  1VQ6 V;  3PN1 A;  1NH2 D;  4AHC A;  4PDR A;  3ZMT A;  3T4Z A;  4X65 O;  2XAF A;  4RUE A;  2F93 B;  4I55 B;  1CP9 A;  2HVK C;  4DR2 O;  1PNL A;  2IW5 A;  2VRZ A;  1IBK B;  4JGS A;  1QU7 A;  4DR3 O;  4X1I B;  3MDS A;  1Z5V A;  1YIJ V;  3C3S A;  5K1P A;  1Y76 B;  2PYJ A;  5C8Y A;  3B09 A;  2JEX A;  3K08 A;  2FTK A;  2W0X A;  1J5E B;  1L0N H;  3CHX A;  1YJ9 V;  1RPO A;  1Q6I A;  4I4T B;  5ITZ A;  1M4U A;  1VQ4 V;  1YTF B;  2RDC A;  2CGO A;  2IU3 A;  2RJZ A;  2ZD9 A;  2BE3 A;  3CD6 V;  2ZE7 A;  4K0K O;  4LWS A;  4RWU A;  4NTW A;  3WG7 B;  2WLK A;  2KB1 A;  1M1K W;  1B04 A;  3ZN1 A;  2HP8 A;  3CME V;  5GW7 A;  2P90 A;  3OTF A;  4AIL C;  3JD3 A;  4QJF B;  4LFB B;  2KG7 A;  1X59 A;  4GX2 A;  1XEQ A;  1NR1 A;  3AEI A;  4Q20 A;  2WLI A;  1BL8 A;  4TUY B;  5B1B C;  2VQF B;  1M93 A;  4DYL A;  1RSO A;  2HLD G;  2ZXW C;  3AG2 B;  3SPG A;  2DE0 X;  3BCC H;  4UFZ A;  1XL4 A;  1D2D A;  5KHG A;  3APO A;  1D5N A;  3BAA A;  5A2Q N;  3VQY A;  1O9H A;  4E2L A;  5LYJ A;  2P22 C;  4NVP A;  1WPX A;  5EC2 C;  2DQ3 A;  4ZOL A;  4LNU A;  3UQ8 A;  4TQF A;  1E1Q G;  1JCH A;  1L0L H;  3K03 A;  5B1A C;  2DWE C;  4PA6 A;  4PDM A;  2EIM C;  4U3J A;  3CCL V;  1GM9 A;  3T1H B;  4YIP A;  5IJ9 B;  2QR4 A;  2JJ2 G;  4PI2 A;  4JZG A;  4KL1 A;  4AQY B;  1KYO F;  5H9C A;  3E89 A;  5B3S C;  4NTY A;  5IJ0 B;  1P4R A;  3FAV A;  4DR4 B;  3G4S V;  5LGT A;  3JAT A;  1MA1 A;  4GX1 A;  3ZIA G;  4O4J B;  1KKC A;  2NNU A;  3JCZ A;  3N2K A;  1FFT B;  1LR1 A;  3K5M A;  5HFL A;  2ADQ B;  1OZ0 A;  2X6C A;  2VQE O;  5GON B;  4JYB A;  3K0G A;  4K8X A;  2F23 A;  4DV2 O;  4JI0 O;  5JJJ B;  1DF4 A;  3F7V C;  3ABL C;  2HVJ C;  1IBL O;  2EIJ C;  2QE7 G;  2LJ2 A;  4MTG A;  5JVD B;  1YJN V;  1HW7 A;  1BSM A;  5BMV A;  5B1B B;  1VQ7 V;  2WLN A;  4B3R O;  1M5I A;  2ZXW B;  1SQF A;  3A8T A;  4YY3 O;  4H33 A;  1AJP A;  2K9P A;  4LF8 O;  3MD0 A;  1AP6 A;  5CA3 A;  2ZR2 A;  1GTO A;  4LF4 O;  4F4L A;  1AI6 A;  1IXB A;  2DW4 A;  4OX9 O;  4GX5 A;  3DXR B;  1WA8 A;  5B1A B;  1VF5 B;  1YDX A;  3CJH A;  2EIM B;  3TK1 A;  3ZRS A;  1AR5 A;  1KP2 A;  2QM4 A;  1XUQ A;  2QA4 V;  1N36 B;  1S0V A;  1XNR O;  4WFB V;  3CCR V;  1MNG A;  2DYR C;  5B3S B;  3CXH F;  1NS1 A;  3GWK C;  5H2F Z;  1N8R W;  1N33 O;  3B8M A;  3JAM N;  3LSU A;  5J2T A;  4XDL A;  1KMI Z;  4H0L B;  4LF6 B;  4DUZ B;  3QVN A;  4LF7 B;  3JAL A;  4PI0 A;  3LSQ A;  4GZR B;  4DRX B;  2QM7 A;  4TV9 B;  5CB4 A;  3RYF A;  1BE3 H;  5BZB A;  2EJR A;  3FB7 C;  3ABL B;  2FML A;  3CRC A;  2PUS A;  4DV0 B;  2WA3 A;  3AG3 C;  4UUJ C;  1R6K A;  4TT3 G;  2ZM6 B;  2A0L A;  2EIJ B;  4MS2 A;  3RVZ A;  4JI5 B;  1OCO C;  1PPJ H;  5K1X A;  5L3G A;  5L3F A;  2QJ1 A;  5EIB D;  2P5O A;  1ZX3 A;  2RN9 A;  1S5L Z;  3F7Y C;  2QSA A;  2QKC A;  4LF9 O;  2BOC C;  3LDE A;  5EYP A;  3VQX A;  2XTA A;  3WB1 A;  1GN2 A;  2HKO A;  5EBL C;  1ZLZ A;  1R3I C;  2F66 C;  3ETE A;  4X64 B;  3PJS K;  3MHH C;  1Q7Y W;  3ZRW A;  5C8Y B;  4ZI7 A;  1FD9 A;  4MVO A;  1H2M A;  3D3Q A;  1MZF A;  4JZ2 A;  3HKE A;  4FZ1 A;  3VOU A;  4HAM A;  5ITZ B;  3OE7 G;  3H9V A;  2IJJ A;  3ETD A;  3FYE B;  1WN7 A;  2DYR B;  3DSQ A;  2ZE8 A;  2YEV A;  3K9A A;  5LA6 A;  2ZT9 B;  4LWS B;  3KZI Z;  1AP5 A;  1SF9 A;  4MTO A;  3B40 A;  2LFS A;  4X1I A;  2QDO A;  4FJC C;  4Q6G A;  1R1B A;  1K97 A;  1BT8 A;  4JI6 B;  2BCC H;  2IH3 C;  2XAH A;  1RM1 C;  3BEH A;  4DV5 O;  4TOI A;  1DGS A;  3LSS A;  2WLI B;  3Q4H A;  3L72 H;  4I4T A;  4E4E A;  5KAI Z;  3AG3 B;  5IYC O;  1RSO B;  1SZX A;  1I94 O;  4DV7 B;  3RYI A;  1QHT A;  1N32 B;  1OCO B;  1UJW B;  2IJI A;  3ABU A;  3ZMZ A;  1L1F A;  2ITC C;  2QEX V;  5LYJ B;  3D3I A;  1WNS A;  2JGD B;  4ZOL B;  4LNU B;  2W6J G;  1F23 A;  4ASU G;  5LMN O;  4P30 A;  3TXQ A;  2QWP B;  1SS3 A;  3APQ A;  3CB2 A;  4N23 A;  2AGA A;  2Q9L A;  1ZAU A;  4DV3 O;  2Q73 A;  4B3M O;  1L8D A;  2UXX A;  4J10 A;  3I56 V;  4DR2 B;  4JYA O;  1FAF A;  3FAV B;  1PNK A;  1K73 W;  1NVP B;  4DR3 B;  3JAT B;  5LGN A;  4CC5 A;  4NXN O;  3B77 A;  4GKJ O;  3WB0 A;  1PM9 A;  5LGU A;  2H3O A;  4MVZ A;  2X0L A;  1P7G A;  1SER A;  2YIB A;  2Q5Z A;  5A9G A;  1XMQ O;  4O2B A;  4CH6 A;  1VP7 A;  2BTQ B;  3SJQ C;  5IJ9 A;  1AI5 A;  1S5J A;  1EZJ A;  5F2V O;  3DC5 A;  2EX3 A;  4JPR A;  3M99 B;  4TV8 A;  3FB5 C;  4CBC A;  3ETG A;  1RM1 B;  1VQ9 V;  4K0K B;  5IJ0 A;  5J2U A;  3ZMU A;  1F51 A;  1YCI A;  3K9S A;  4FZ0 A;  5BMV B;  5L3B A;  3OMA B;  4G27 B;  3S3W A;  1IZ3 A;  3ETQ A;  1VMG A;  1EZV H;  1H2G A;  4X66 O;  3RVY A;  4PA3 A;  4XDK A;  1NH2 B;  4EFE A;  2GSM B;  1KUQ A;  4X9Q A;  4B08 A;  3OUF A;  1EFR G;  4ZHQ A;  2RQ6 A;  3T2M A;  2YID A;  3L73 H;  1SRY A;  4GX0 A;  1WA8 B;  3SYP A;  4RO2 A;  3CJH B;  3T1Y B;  4BR6 A;  4LFC O;  3ICX A;  3GWO A;  4LF5 B;  3T4D A;  1XHX A;  4ABM A;  2UXB O;  2B1I A;  3TXS A;  2GTA A;  1I08 A;  2ZDI A;  4JI3 O;  1YXB A;  4NKG B;  2XAJ A;  5J2T B;  1H2K A;  2RNB A;  2ZIO A;  4JI1 O;  2V7Q G;  4FLZ A;  4FLW A;  4JAA A;  2C2A A;  1MOF A;  3J7A U;  5CB4 B;  3RYF B;  1G6U A;  1H2N A;  2F4V O;  2YXY A;  1F7Y A;  4F6E A;  1GO3 F;  2CK3 G;  3CWB H;  4IGG A;  4NYK A;  1BHB A;  2JEU A;  3CRA A;  3ZJZ A;  4EFB A;  4U7O A;  1OCR C;  3ASO C;  2WA4 A;  1QBZ A;  2VQE B;  3U10 A;  2EUL A;  4WCE V;  1MMM A;  2Q7E A;  4DV2 B;  4CC6 A;  4JI0 B;  2CTR A;  4KP4 A;  5JQG A;  3CXC U;  2V4D A;  3SDL A;  1XIL A;  4O4L B;  4FM2 A;  1SES A;  3B2E E;  5FPO A;  1I5Y A;  1I0H A;  4GCZ A;  3X2Q C;  1IBL B;  4ZI7 B;  2LQT A;  1BHA A;  4B3R B;  2QGN A;  2NN4 A;  3K3W A;  3HKE B;  4YY3 B;  3CC2 V;  3ABT A;  3CP1 A;  4LF8 B;  5LMU O;  1VF6 A;  2ZKO A;  1T5E A;  4TSF G;  2PY5 A;  1SQP H;  5C93 A;  4K35 A;  1GMG A;  1KB9 F;  2JS3 A;  4LF4 B;  1OCC B;  4WFA V;  4NXM O;  2YEV B;  3BPZ A;  5LA6 B;  3L70 H;  1SQB H;  2L6L A;  3L71 H;  1H2S B;  2EBO A;  3UCS C;  1SQQ H;  5EZY A;  1PL4 A;  3CEI A;  4UV8 A;  1ZWI C;  4CH3 A;  1XMO B;  1EN6 A;  5BXZ A;  1QVF U;  1VQ5 V;  5LHH A;  2AW9 A;  3JAS A;  1NQT A;  4GYC B;  4J7K A;  1XNR B;  2DYS B;  3G71 V;  2ZNI A;  1EBO A;  4OPA A;  4LP8 A;  3SGI A;  3Q4H B;  3OD4 A;  1YIT V;  2YI9 A;  2A06 H;  4B7E A;  3RYI B;  4UCU A;  1Q3E A;  1HNZ O;  3W7U A;  3K0D A;  1VQM V;  1OCR B;  3ASO B;  3C3T A;  4FLT A;  3JAW A;  1ARO P;  4MT8 A;  5GTH Z;  3DTU B;  3OGC C;  5EIB C;  1IDS A;  3OGI B;  4GUN A;  4D6T H;  2Z0A A;  4FLX A;  1MAB G;  3CMA V;  1JJO A;  1V55 C;  3RT3 C;  2H94 A;  1P49 A;  4DR5 O;  2LGW A;  2UU9 O;  2CAZ C;  3JAK A;  3X2Q B;  1ENV A;  1S5H C;  4GT1 A;  2EIK C;  5EC1 C;  1VIB A;  4UCO A;  4B3S O;  2Q7G A;  3AG1 C;  3EFF K;  5LL6 Y;  3OR6 C;  3H1J H;  5IYZ A;  2A7W A;  4LF9 B;  2HJD A;  1GM7 A;  4TWK A;  4X1K A;  2ZIN A;  3L74 H;  2RMK B;  3OAA G;  2ZDI C;  4LFA O;  1YHQ V;  5KLV H;  4KUM A;  3L9D A;  2CDY A;  4UCV A;  1YEW A;  3OUS A;  3FB6 C;  1FS0 G;  1IXM A;  2BOB C;  2JGD A;  1R6N A;  4UVC A;  2CTQ A;  4O2B B;  1KU9 A;  4JI8 B;  3NR7 A;  4R6Z A;  3RFR A;  4TV8 B;  5IE9 A;  5B1N A;  2EZO A;  3JCU Z;  5J2U B;  2M7W A;  5KX5 A;  4P2Z A;  5EBW C;  4JI2 O;  4JI7 O;  2O57 A;  1W0J G;  5KA5 A;  4DV4 B;  1K33 A;  3WU2 Z;  4EEQ A;  1GN6 A;  3CCE V;  2IBZ H;  2LW7 A;  2CGN A;  1KKD A;  1Q43 A;  4ZHQ B;  5GTI Z;  2EIN C;  4IIJ B;  3JSL A;  3OT7 A;  3ZHS A;  2BTQ A;  2CE4 A;  3S3X A;  5L3C A;  1WB8 A;  5B1O A;  3UKM A;  1I94 B;  1JOY A;  2EIK B;  1DF5 A;  1M56 C;  1VF6 C;  1Y67 A;  4MVS A;  3AG1 B;  1JFF A;  1XL6 A;  4DV6 O;  2UXD O;  3BHP A;  1NJI W;  5CA1 A;  4QE9 A;  4DW0 A;  2PI5 A;  3KCX A;  4X62 O;  4FM1 A;  2P4V A;  3SPJ A;  5LMN B;  1MG1 A;  1QQC A;  4FM0 A;  4H13 B;  4R8C A;  1Q8I A;  4I5S A;  3K79 A;  4B3M B;  3IC9 A;  3STL C;  1JVM A;  3H01 A;  2Y0P A;  5KHK A;  5CA0 A;  4FIP C;  3OMI B;  5B5E Z;  2ADP A;  2E75 B;  2L35 A;  1WJZ A;  4IHJ A;  4D7T A;  2N05 A;  1WLE A;  3ZRV A;  4P9P A;  4DW1 A;  2OCH A;  4GKJ B;  1VAR A;  5IY5 C;  2Q68 A;  3IFX A;  4DR6 O;  1NKD A;  3QTC A;  5CBF A;  2GUZ A;  1XMQ B;  3QG5 A;  3E86 A;  5JQG B;  1SQV H;  4DUY O;  2HHH O;  5CMU A;  3E8G A;  5FL7 G;  4JYY A;  5KHH A;  4FPP A;  2CUG A;  5KUM A;  2EIN B;  5JH7 A;  1S76 D;  1G1X B;  2BSK A;  2LFR A;  3M8A A;  2FB5 A;  2DJV A;  4J11 A;  3AG4 C;  4NTX A;  5LOV A;  1IBM O;  4X66 B;  3N27 A;  3AK3 A;  3I5D A;  2QKA A;  1GH6 A;  4LFC B;  1K92 A;  4IYI A;  5EBM C;  5EZY B;  4O4L A;  2JJ1 G;  3CCJ V;  4F6R A;  4FLV A;  2Q8V A;  3J80 N;  2P6J A;  1EM1 A;  4ZKI A;  3JAS B;  2YS8 A;  1JA8 A;  3TCU A;  5E79 Z;  5H6R A;  2DWD C;  4LH7 A;  2UXB B;  1MZE A;  1YSC A;  2YIC A;  4O4I A;  2LW1 A;  1AI7 A;  2ITD C;  3OMN B;  4KHP O;  2XT9 A;  3VQW A;  4IT5 A;  3QF7 A;  4JI3 B;  4A5U B;  1GK9 A;  1XHZ A;  1K8A W;  5IY5 B;  1GM8 A;  1QVG U;  1M57 C;  3JAW B;  4B3T O;  1Q90 D;  4PJ0 Z;  4R50 A;  2VWK A;  5JCO C;  3KCY A;  1URF A;  4HZ3 A;  3QO7 A;  2UUC B;  3JAK B;  3U11 A;  2OT5 A;  3ZED A;  3O65 A;  2Q7H A;  5IYZ B;  2M6Y A;  2QWQ B;  3FKS G;  2EZP A;  3G6E V;  4MVQ A;  3ZHU A;  3OTO B;  3AG4 B;  4X1K B;  2OCC C;  2UUB O;  1VQK V;  4RAI A;  1S72 V;  2EJ7 A;  2ZCE A;  4ZBM A;  2Z3Y A;  3RBZ A;  2OYQ A;  1KQS U;  3HKD B;  1XOU A;  2Q0O C;  3W7W A;  2ILM A;  2P67 A;  4U3F H;  1B3Q A;  3OM3 B;  1N34 O;  3B4S A;  3BFR A;  2OTJ V;  2X7R B;  2XAS A;  3AK1 A;  4JTD B;  4RQF A;  2F43 G;  5BY1 A;  1HNW O;  5LMU B;  3ZMS A;  1FJG O;  4NXM B;  1K34 A;  1HWY A;  3JD4 A;  1SQG A;  1WAZ A;  4X65 B;  5BR8 O;  2JVD A;  1HP8 A;  1JQ0 A;  1NT2 B;  5KX5 B;  3CPW U;  3CCV V;  5EK0 A;  3HKC A;  3ABK C;  4BAY A;  4YHH O;  1M57 B;  3A2F A;  4C7U A;  5FNV A;  2ZNJ A;  4FMT A;  3NXS A;  4GKK O;  3HB3 B;  4WFF A;  3STZ C;  4XBF A;  1CXZ B;  2F1M A;  3ZRX A;  4QPJ A;  1U96 A;  4I50 A;  2CTW A;  1ZTE A;  1IVS A;  2QWN B;  4OXS A;  4DV1 O;  3OW2 U;  1NU1 H;  2MW2 B;  1HNZ B;  3CE2 A;  2OIE A;  1K7D A;  1JFF B;  2IJK A;  5CA1 B;  1LUV A;  2QM8 A;  2CH7 A;  4ICG A;  4PA4 A;  4YXW G;  1S77 D;  4B7K A;  1TA8 A;  3G6B A;  3A0R A;  3KKY A;  2OCC B;  2F95 B;  1NTM H;  4DUZ O;  2UU9 B;  3HPL C;  1QLN A;  1R73 A;  1HNX O;  1WB7 A;  1RPR A;  1ZL8 A;  5KAF Z;  3DC6 A;  4IIJ A;  1AR1 B;  2PI4 A;  2HEP A;  3BVO A;  4R7C A;  1X4T A;  5CA0 B;  4H37 A;  1Q6U A;  1M9N A;  4IHJ B;  4O2A A;  1Q81 W;  3ZHQ A;  4PD4 F;  4LFA B;  4U7N A;  2EIL C;  1GRJ A;  1H38 A;  3QO8 A;  2P7T C;  2YI8 A;  2GUZ B;  5J9P C;  2QKS A;  1HR0 O;  3ABK B;  2PF4 E;  4Z1M G;  3P3P A;  1DLB A;  3ML0 A;  2Y0I A;  4GLX A;  2ARH A;  4JV5 O;  2WLL A;  5FLX N;  5JH7 B;  4J80 A;  3CSX A;  1FPO A;  2YC0 A;  2E5L O;  4W4K A;  3K5O A;  2BSK B;  2UUA O;  1KBH A;  4JI2 B;  1BGY H;  1Y4M A;  2AHY A;  3G80 A;  4JYC A;  1UFI A;  1SQX H;  4X8A A;  1VQN V;  2ZIM A;  3TGU H;  5LOV B;  1AJN A;  1AIL A;  3OEE G;  1G4Y B;  2AZ0 A;  3N2G A;  3G67 A;  4UCT A;  4L87 A;  3CRQ A;  4Z1V A;  1E1R G;  1Z2G A;  4J9Z B;  2Z5U A;  4MVR A;  4FVM A;  3GB7 C;  1TUB A;  1XRE A;  2P4K A;  1BS3 A;  4JI6 O;  1FXV A;  1JPX A;  2JS5 A;  1NTZ H;  4F6R B;  4LC1 A;  5L3E A;  4JAV A;  1K9M W;  1P84 F;  4DV6 B;  4TQD A;  3LNN A;  2UXD B;  2D3O W;  1XNQ O;  2ZE6 A;  3JYC A;  4O4H A;  1H8H G;  4X62 B;  1YF2 A;  4O4I B;  4AI8 A;  2A79 B;  4QE7 A;  3LUT B;  3K58 A;  3IC7 A;  4IYH A;  2PZS A;  4J7J A;  4FFB A;  3FX7 A;  4YJ2 A;  1AB3 A;  3BA8 A;  1ROP A;  2LO1 A;  1QR9 A;  3JSN A;  3RGB A;  3RWR D;  4OX9 B;  1JMK C;  4YJ3 A;  3HKB A;  3AG7 A;  3K04 A;  3D36 A;  4MSW C;  4DR7 O;  1DTO A;  3CYO A;  1W59 A;  3L75 H;  3SJA C;  3MHS C;  3UT5 A;  2G38 A;  1W0K G;  1YVW A;  2Q0A A;  3VBB A;  3JAR A;  3HR0 A;  4DR6 B;  1N33 B;  3ZHR A;  2W0F C;  2IU0 A;  5TIS Z;  3AK2 A;  3K5L A;  1PV0 A;  3O9O A;  4EKW A;  3RYH A;  4DUY B;  2HHH B;  1THZ A;  5E1A C;  1FXH A;  5KA6 A;  3W7S A;  4WF9 V;  1K5S A;  5IT9 N;  2ETN A;  2Q69 A;  1Z5W A;  2LP7 A;  4D7S A;  2WWW A;  1XDC A;  1GAX A;  5LBQ A;  4MW3 A;  1VQ8 V;  4I9W A;  2JGU A;  1IBM B;  3UO3 A;  3OFN G;  4MTX A;  3R65 A;  1SZT A;  3K57 A;  2R9A A;  3SYC A;  4DR1 O;  4JI4 O;  5KHJ A;  1TGO A;  3ASN C;  3ZHT A;  3QNE A;  1FFX A;  3HKC B;  1F4N A;  3HKD A;  5CBG A;  2XUM A;  5FNV B;  1B06 A;  2XND G;  2DMX A;  3T1Y O;  1J95 A;  1KEC A;  2WLM A;  1JJ2 U;  1KC8 W;  3BRC A;  5IYD O;  2WSS G;  4WFG A;  2E3C A;  4EB6 A;  4I50 B;  4KHP B;  2FKX A;  5LXT A;  2PYL A;  1VF7 A;  2QWR B;  2OTL V;  1KP3 A;  2MK3 A;  5D5Q A;  4BW5 A;  1BQ0 A;  3CC4 V;  2IM9 A;  4LF5 O;  4X89 A;  4UV9 A;  1Q82 W;  3EXA A;  1OV9 A;  4B3T B;  3BY6 A;  1US6 A;  3H1L H;  3SYA A;  2R9R B;  2CH7 B;  5IWA O;  4CZZ A;  2R72 A;  3FFQ A;  4QPK A;  3SYO A;  3CRR A;  4JTA B;  3RYC A;  1Y74 B;  3J81 N;  1JR9 A;  2ATK C;  2ZE5 A;  2OIG A;  2ODM A;  4K8Z A;  2UXC O;  3SPH A;  1ZL8 B;  4LR3 A;  1AJQ A;  1V55 B;  4DV5 B;  5JCO A;  4H44 B;  5CN0 A;  1AR4 A;  1Y6X A;  5IYB O;  1A32 A;  2UUB B;  3TJT A;  3RW0 A;  3CCM V;  1ZSP A;  3C90 A;  4O2A B;  1E79 G;  3A0B Z;  1GN3 A;  2R70 A;  1VEW A;  1RP3 B;  4UXN A;  4OPH A;  4PDV A;  3ZMV A;  4YIO A;  3ASN B;  1N34 B;  4G2K A;  1TUE B;  2A9H A;  1YTF D;  3D36 C;  4QGP A;  1IX9 A;  1HNW B;  4PV1 B;  4FLY A;  1SET A;  4DV3 B;  1FJG B;  2Y48 A;  4N21 A;  4MW8 A;  5LP6 A;  2WLL B;  2WLJ A;  4BIO A;  1Q5O A;  3CCS V;  5BR8 B;  1RFY A;  4JYA B;  4BW9 A;  2KSD A;  3K5N A;  2E74 B;  4NXN B;  4YHH B;  1ZUQ A;  1LUW A;  4DO2 A;  1TVK A;  2X6A A;  3OEH G;  1VQO V;  2LGQ A;  1IBK O;  2YXL A;  3SJC C;  1XQ8 A;  4GKK B;  3N2G B;  4G28 B;  4J9Y B;  1TAE A;  2D2C B;  3EHB B;  4X1Y A;  4I0X A;  1XMO O;  4JAS A;  4MVU A;  2VS0 A;  3RN4 A;  1MSW D;  3F5W C;  5H5N A;  3E8H A;  2A3Q A;  1OJH A;  1TUB B;  5AG2 A;  3CCQ V;  4DV1 B;  3SPI A;  4WBN A;  2OWO A;  3E22 B;  4HYO A;  1J5E O;  2B5U A;  1HDJ A;  4DK0 A;  4JF3 A;  2YIB D;  2WLH A;  2H8P C;  1Y66 A;  4O4H B;  1PNM A;  2AHZ A;  2XAQ A;  4X20 A;  1NTK H;  4CS3 A;  1M56 B;  4UCR A;  4P9O A;  3CCU V;  1UPG A;  1PL0 A;  1CEZ A;  1M90 W;  4DXW A;  2GDS A;  3K59 A;  1O9G A;  4FFB B;  1OCZ C;  1HNX B;  4YJ2 B;  1V54 C;  2YSU B;  4CH4 A;  5KMG A;  4YJ3 B;  1K4D C;  5DM6 V;  3HKB B;  3MAQ A;  2K1E A;  3CX5 F;  3BAB A;  1H2L A;  3SYQ A;  4HNA A;  1BZK A;  3H1I H;  2HG5 C;  4LFB O;  2X6B A;  2W6I G;  3VQV A;  3UT5 B;  5DN6 G;  1VQP V;  2VQF O;  2GV9 A;  3QO5 A;  1I5X A;  2N04 A;  3JAR B;  3ABM C;  1GKF A;  1FXK A;  2XAG A;  2CTP A;  2ZR3 A;  1HR0 B;  3EVK A;  2QTS A;  4PA9 A;  4Z2W A;  3RYH B;  4PEL A;  1BQZ A;  1WPB A;  4WFH A;  4JI1 B;  4JV5 B;  2E76 B;  2FYU H;  4NR1 A;  1V9P A;  3P30 A;  3OR7 C;  2B9Z A;  3LDC A;  1JX9 A;  2E5L B;  1AVM A;  3T1H O;  3R66 A;  2UUA B;  4JI8 O;  4UVA A;  1SA0 A;  4OGQ B;  2F4V B;  2QWO B;  5KUK A;  1K5Q A;  4PHZ A;  4AQY O;  5JJN B;  2JK5 C;  1COW G;  3E8B A;  1D5A A;  4I55 A;  1QLE C;  2NR5 A;  2XHB A;  3E83 A;  5JJE B;  4DR4 O;  2Y4T A;  1FYJ A;  2DQ0 A;  3LDD A;  4ZIB A;  3SPC A;  1K3E A;  4UB6 Z;  1PKX A;  2N74 A;  3CC7 V;  4DV4 O;  3E2E A;  1Y76 A;  1FFX B;  3CRM A;  2Y69 C;  4UVB A;  1OCZ B;  2P06 A;  2KG7 B;  4WFE A;  3WB2 A;  1PD3 A;  1EN5 A;  3I55 V;  3H1K H;  1V54 B;  1BCC H;  1H8E G;  1CPY A;  5LP6 C;  2YUA A;  2GHY A;  1XNQ B;  3JD1 A;  4UCS A;  3W7T A;  5B66 Z;  2NLJ C;  4EB6 B;  2WAM A;  2GBO A;  4RQE A;  1K4C C;  1NI8 A;  1N4C A;  5LXT B;  3D8C A;  4RUF A;  5JWP A;  4UB8 Z;  3DGE A;  2Y4U A;  3ZBH A;  5LHI A;  2IJH A;  4KFM A;  3M7M X;  5DED A;  3H1H H;  3ABM B;  2V1D A;  1S3J A;  4J41 A;  3ZHV A;  1AI4 A;  3JD2 A;  1Q86 W;  4U3J B;  4HBN A;  4DR7 B;  4JAU A;  3RYC B;  1DK1 A;  4I7Z B;  1FKA O;  3K06 A;  2HJF C;  3FD9 A;  3LNM B;  5HFM A;  4W4L A;  4TUY A;  1ORQ C;  2PTM A;  4LH6 A;  2UXN A;  5KHI A;  1WP7 A;  4J42 A;  1YI2 V;  1R6T A;  1G8M A;  4CH5 A;  1XI1 A;  1N36 O;  2JDI G;  3N2K B;  2WPD G;  2JRI A;  3ZN0 A;  1QLE B;  1WP8 A;  2ZQM A;  3KG2 A;  3GVM A;  3SR2 C;  1Q6H A;  2AZ2 A;  1QNM A;  3IGA C;  4FLU A; 
#chains in the Genus database with same CATH homology
 1KKD A;  3MHH C;  1Q7Y W;  3W7X A;  3K04 A;  2Y69 B;  3D36 A;  3ZRW A;  2EIN C;  4MSW C;  4X88 A;  2JIZ G;  4MVO A;  1R3J C;  1DTO A;  3TET A;  3CYO A;  3VOU A;  5L3C A;  5B1O A;  3UKM A;  3MHS C;  3UM7 A;  1JOY A;  4HAM A;  2EIK B;  1DF5 A;  4JTC B;  1M56 C;  1W0K G;  3OE7 G;  4BIU A;  2IJJ A;  2QTO A;  3ETD A;  4MVS A;  3AG1 B;  3VBB A;  3FYE B;  1XL6 A;  2DYR B;  1NJI W;  3FYI B;  3T1C A;  4QE9 A;  2PI5 A;  2W0F C;  2YEV A;  1FXK C;  2IU0 A;  3JD0 A;  5LHG A;  1QR8 A;  3K9A A;  4FK5 C;  3SPJ A;  4EKW A;  1MG1 A;  1THZ A;  2XOK G;  4MTO A;  5E1A C;  2R9I A;  2LFS A;  4R8C A;  3WFV A;  4FJC C;  1FXH A;  5IDJ A;  5KA6 A;  3W7S A;  4WF9 V;  1K5S A;  4I5S A;  2Q69 A;  1K97 A;  3K79 A;  2LP7 A;  5L3D A;  4PA7 A;  2IH3 C;  1OHH G;  2WWW A;  4MVM A;  3STL C;  2XAH A;  5LBQ A;  3BEH A;  3FB8 C;  1JVM A;  3ZCC A;  1RM1 C;  4LBE C;  4QNH B;  4MTF A;  3H01 A;  4FIP C;  3OMI B;  4MW3 A;  1OCC C;  1BMF G;  1F4M A;  3LSS A;  4I9W A;  2WLI B;  4LCU C;  1VQ8 V;  1KD1 W;  3OFN G;  3AG3 B;  5IYC O;  2Q6A A;  1WLE A;  3ZRV A;  4MTX A;  2HFE C;  3R65 A;  4P9P A;  1SZT A;  3SYC A;  1OCO B;  1NR7 A;  1UJW B;  5IY5 C;  2IJI A;  3ABU A;  3ZMZ A;  2Q68 A;  1L1F A;  2ITC C;  1LNQ A;  3IFX A;  1NKD A;  4XDJ A;  3E8F A;  1R3K C;  3ASN C;  5CBF A;  3QNE A;  2QEX V;  1YJW V;  3D3I A;  2B1G A;  3E86 A;  2W6J G;  1F23 A;  4ASU G;  2DYS C;  4BIZ A;  4P30 A;  1F4N A;  5CBG A;  5CMU A;  3E8G A;  5FL7 G;  4N23 A;  4FPP A;  2XND G;  2HR3 A;  1QCE A;  1J95 A;  1KEC A;  2WLM A;  1NVP D;  1JJ2 U;  1KC8 W;  5KUM A;  2EIN B;  5IYD O;  1S76 D;  2WSS G;  1B6Q A;  4WFG A;  2LFR A;  1R3L C;  2UXX A;  2OTL V;  1KP3 A;  2MK3 A;  4BW5 A;  4PDL A;  3CC4 V;  3I56 V;  2Q67 A;  3WG7 C;  1PNK A;  3AG4 C;  4X89 A;  1K73 W;  1NVP B;  4UV9 A;  5LGN A;  1Q82 W;  3BY6 A;  1FXK B;  3SYA A;  2R9R B;  3B77 A;  4CZZ A;  4QPK A;  3SYO A;  4JTA B;  5LGU A;  4MVZ A;  2X0L A;  1SER A;  3E35 A;  4QIW F;  3P32 A;  1K92 A;  2EIL B;  5EBM C;  3ZRW B;  2ATK C;  1P7B A;  2IH1 C;  1W2B U;  2JJ1 G;  5H6Q A;  3SJQ C;  1AI5 A;  3CCJ V;  1EZJ A;  3SPH A;  4JPR A;  2P6J A;  3M99 B;  1AJQ A;  3AG2 C;  3FB5 C;  1NBM G;  1V55 B;  4CBC A;  4ZKI A;  3TCU A;  5CBH A;  3ETG A;  1RM1 B;  3B8N A;  1VQL V;  1VQ9 V;  5H6R A;  2DWD C;  1VQ6 V;  1YSC A;  5CN0 A;  1F51 A;  3ZMU A;  1NH2 D;  4PDR A;  5IYB O;  5L3B A;  1AI7 A;  2ITD C;  3OMN B;  3ZMT A;  3T4Z A;  3RW0 A;  3CCM V;  2XAF A;  3OMA B;  4RUE A;  4G27 B;  1CP9 A;  2HVK C;  1E79 G;  1PNL A;  2IW5 A;  1GK9 A;  4JGS A;  4UXN A;  1H2G A;  1K8A W;  4PDV A;  5IY5 B;  3RVY A;  3ZMV A;  1GM8 A;  4PA3 A;  4XDK A;  1M57 C;  1NH2 B;  1QVG U;  1YIJ V;  2GSM B;  3ASN B;  3OUF A;  1EFR G;  4G2K A;  1TUE B;  2A9H A;  1YTF D;  3T2M A;  2JEX A;  3K08 A;  4R50 A;  1SRY A;  4GX0 A;  3SYP A;  2FTK A;  4RO2 A;  1SET A;  4HZ3 A;  2Y48 A;  4N21 A;  3QO7 A;  1YJ9 V;  1RPO A;  4MW8 A;  2WLL B;  2WLJ A;  3CCS V;  2OT5 A;  1VQ4 V;  3GWO A;  1YTF B;  2IU3 A;  2ZD9 A;  3CD6 V;  3T4D A;  3G6E V;  3FKS G;  2EZP A;  4MVQ A;  2B1I A;  3WG7 B;  2WLK A;  3AG4 B;  2OCC C;  1VQK V;  2KB1 A;  4RAI A;  4DO2 A;  1S72 V;  1M1K W;  2ZDI A;  4ZBM A;  2Z3Y A;  2X6A A;  3OEH G;  2XAJ A;  3RBZ A;  1VQO V;  3ZN1 A;  1KQS U;  3W7W A;  4G28 B;  2P67 A;  4J9Y B;  3EHB B;  5GW7 A;  3CME V;  2P90 A;  2V7Q G;  4JAS A;  4MVU A;  2C2A A;  3OM3 B;  1MOF A;  3JD3 A;  4QJF B;  1MSW D;  3F5W C;  3E8H A;  4GX2 A;  2OTJ V;  2X7R B;  1NR1 A;  3CCQ V;  2XAS A;  4JTD B;  4RQF A;  3SPI A;  3AEI A;  2F43 G;  4Q20 A;  2WLI A;  1BL8 A;  4HYO A;  5B1B C;  1GO3 F;  2B5U A;  2CK3 G;  3ZMS A;  2ZXW C;  2HLD G;  3AG2 B;  3SPG A;  4JF3 A;  1K34 A;  1HWY A;  3JD4 A;  1BHB A;  2WLH A;  2JEU A;  2H8P C;  1XL4 A;  1Y66 A;  3ZJZ A;  4U7O A;  1OCR C;  1PNM A;  3ASO C;  2AHZ A;  2XAQ A;  1QBZ A;  1JQ0 A;  1M56 B;  3CPW U;  4P9O A;  4E2L A;  4WCE V;  3CCV V;  5EK0 A;  3CCU V;  1WPX A;  5EC2 C;  2DQ3 A;  3ABK C;  1PL0 A;  4BAY A;  1CEZ A;  4KP4 A;  1M90 W;  4DXW A;  1E1Q G;  1JCH A;  3K03 A;  3CXC U;  5B1A C;  2DWE C;  1OCZ C;  4PA6 A;  4PDM A;  1M57 B;  2EIM C;  1SES A;  1V54 C;  1I5Y A;  2YSU B;  3CCL V;  1GM9 A;  4FMT A;  4GCZ A;  3X2Q C;  1K4D C;  3NXS A;  5DM6 V;  2JJ2 G;  3HB3 B;  4WFF A;  3STZ C;  4XBF A;  3ZRX A;  2K1E A;  4QPJ A;  1BHA A;  5H9C A;  3SYQ A;  3E89 A;  2HG5 C;  5B3S C;  2X6B A;  3K3W A;  4OXS A;  2W6I G;  1P4R A;  3OW2 U;  3CC2 V;  3ABT A;  5DN6 G;  3CP1 A;  1VQP V;  3G4S V;  5LGT A;  4TSF G;  5C93 A;  3QO5 A;  1GMG A;  1I5X A;  1K7D A;  4GX1 A;  3ZIA G;  2IJK A;  1OCC B;  4WFA V;  3ABM C;  1GKF A;  1FXK A;  2XAG A;  2ZR3 A;  2NNU A;  2QM8 A;  2YEV B;  3JCZ A;  1FFT B;  4PA4 A;  4YXW G;  1S77 D;  5HFL A;  1OZ0 A;  2X6C A;  3A0R A;  4PA9 A;  2OCC B;  4JYB A;  2EBO A;  3K0G A;  4PEL A;  4UV8 A;  1ZWI C;  4WFH A;  3HPL C;  1QLN A;  1QVF U;  1R73 A;  1DF4 A;  3F7V C;  3P30 A;  3OR7 C;  1RPR A;  1VQ5 V;  3ABL C;  3LDC A;  1JX9 A;  5LHH A;  2HVJ C;  1NQT A;  1AR1 B;  2DYS B;  2PI4 A;  2EIJ C;  2QE7 G;  3G71 V;  4UVA A;  4MTG A;  4R7C A;  5KUK A;  1YJN V;  1EBO A;  1K5Q A;  4H37 A;  4LP8 A;  2JK5 C;  1COW G;  3E8B A;  5B1B B;  1VQ7 V;  1M9N A;  2WLN A;  1YIT V;  2ZXW B;  1Q81 W;  1QLE C;  4H33 A;  3E83 A;  1AJP A;  4U7N A;  3MD0 A;  3W7U A;  3K0D A;  5CA3 A;  1VQM V;  2EIL C;  1OCR B;  3ASO B;  2DQ0 A;  1GTO A;  2ZR2 A;  3LDD A;  1H38 A;  1ARO P;  4MT8 A;  3SPC A;  3DTU B;  3QO8 A;  1K3E A;  2P7T C;  3OGC C;  1PKX A;  4F4L A;  3CC7 V;  3E2E A;  5J9P C;  2QKS A;  1MAB G;  3CMA V;  1AI6 A;  2DW4 A;  2Y69 C;  3ABK B;  4Z1M G;  1V55 C;  4GX5 A;  4UVB A;  5B1A B;  1OCZ B;  4WFE A;  1PD3 A;  2H94 A;  3I55 V;  2EIM B;  1V54 B;  1DLB A;  3TK1 A;  3ML0 A;  3ZRS A;  3X2Q B;  1ENV A;  1H8E G;  1KP2 A;  1CPY A;  1S5H C;  2WLL A;  4GT1 A;  2EIK C;  2GHY A;  5EC1 C;  3JD1 A;  3W7T A;  2QA4 V;  1S0V A;  3AG1 C;  2NLJ C;  3EFF K;  2WAM A;  3OR6 C;  4WFB V;  3CCR V;  4RQE A;  1K4C C;  2DYR C;  5B3S B;  4RUF A;  1Y4M A;  2AHY A;  4JYC A;  3DGE A;  1GM7 A;  1N8R W;  4TWK A;  4X8A A;  1VQN V;  5LHI A;  2IJH A;  4KFM A;  3B8M A;  1AJN A;  3OAA G;  3OEE G;  2ZDI C;  1G4Y B;  1YHQ V;  3ABM B;  2V1D A;  4KUM A;  1S3J A;  4XDL A;  4L87 A;  1AI4 A;  3JD2 A;  3OUS A;  1Q86 W;  3FB6 C;  1E1R G;  1IXM A;  1FS0 G;  2BOB C;  1R6N A;  4UVC A;  4J9Z B;  2Z5U A;  4MVR A;  4JAU A;  3LSQ A;  3GB7 C;  2QM7 A;  3K06 A;  2HJF C;  1FXV A;  1JPX A;  3LNM B;  5BZB A;  5HFM A;  2EJR A;  3FB7 C;  4LC1 A;  4R6Z A;  3ABL B;  1ORQ C;  5L3E A;  3AG3 C;  1R6K A;  4JAV A;  4TT3 G;  4UUJ C;  2A0L A;  1K9M W;  2EIJ B;  2UXN A;  2D3O W;  4MS2 A;  5B1N A;  3RVZ A;  1YI2 V;  2EZO A;  3JYC A;  1H8H G;  1OCO C;  1G8M A;  5L3G A;  2JDI G;  2M7W A;  5L3F A;  2WPD G;  4P2Z A;  2A79 B;  3ZN0 A;  5EBW C;  4QE7 A;  3LUT B;  3F7Y C;  1QLE B;  2BOC C;  3LDE A;  3IC7 A;  2ZQM A;  3KG2 A;  2HKO A;  1W0J G;  5KA5 A;  5EBL C;  1K33 A;  1R3I C;  1ROP A;  1QR9 A;  3ETE A;  3IGA C;  3CCE V;  3PJS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...