4R6ZA

Crystal structure of cng mimicking nak mutant, nak-etpp, cs+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
FQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 33
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r6zA00
1ORQC 2WLKA 1V55C 3E86A 2HVJC 3LDDA 1M56C 4JTAB 4R8CA 4MW3A 2A79B 3X2QC 3E8GA 2HVKC 4XDJA 5CBHA 2QTOA 3K06A 3WG7C 4MVUA 4P2ZA 2DYRC 4DXWA 4MVMA 2ITCC 4WFGA 5EBMC 3SPGA 4H33A 4RAIA 2DYSC 5EBWC 2Q68A 3FB7C 1XL4A 3ABKC 2K1EA 3LNMB 2EIJC 3GB7C 3ZJZA 4J9ZB 5B1AC 5IY5C 3ASNC 1R3KC 3SYOA 4MTFA 1J95A 3LUTB 4LP8A 2ATKC 3R65A 3F5WC 3VOUA 3KG2A 4KFMA 4MTGA 4PA4A 5B3SC 3JYCA 3IGAC 5BZBA 3T1CA 3ZRSA 5EBLC 3FB8C 2WLJA 3E8BA 3SYQA 1XL6A 3K03A 3AG4C 3SPHA 4H37A 2Q6AA 2DWDC 4MVZA 1G4YB 3OR7C 2AHZA 2IH1C 2EILC 4XDKA 3OR6C 4QE9A 2WLNA 2W0FC 2A0LA 2JK5C 3ABLC 3HPLC 2EIKC 4I9WA 2WLLA 4RUFA 4X8AA 3SPCA 3ASOC 2OCCC 2WLIB 3K0DA 5EC1C 4PDVA 3K04A 5EK0A 5B1BC 4R6ZA 2WLHA 3AG2C 2HJFC 3E8FA 5J9PC 3LDEA 3UKMA 4GX1A 2IH3C 2R9RB 4G27B 4X88A 4HZ3A 3UM7A 3OUFA 4BW5A 1JVMA 1OCZC 3LDCA 1BL8A 2BOCC 3K08A 3FB5C 2X6AA 3SPIA 3TETA 2ZXWC 4PA9A 2QKSA 3BEHA 3STZC 5CBFA 3OGCC 1R3IC 4UUJC 3F7YC 1OCRC 4JTCB 2WLIA 4PDRA 3RVYA 3SYPA 1K4CC 3F7VC 3STLC 2EINC 4QE7A 2DWEC 3E89A 3E8HA 2EIMC 2X6CA 1R3LC 4J9YB 4P30A 4MVSA 4EKWA 5KUMA 4MVRA 2AHYA 1S5HC 1KKDA 4GX0A 4RO2A 4QNHB 2ITDC 3AG1C 4MTOA 4LCUC 5CBGA 4JTDB 4OXSA 3T4DA 4ZBMA 1OCCC 3IFXA 4MSWC 1K4DC 4LBEC 3TCUA 4PDLA 4MVQA 2H8PC 3SJQC 2Q67A 4P9PA 4XDLA 5E1AC 5KUKA 4TWKA 4R7CA 1P7BA 4WFFA 1V54C 4PA3A 4PA6A 2NLJC 2WLLB 3E83A 3EFFK 3RBZA 5EC2C 4R50A 4WFEA 3SYAA 4G28B 1QLEC 3SPJA 4MVOA 3T2MA 2P7TC 2Q69A 1ZWIC 3AG3C 4GX5A 3OUSA 2KB1A 2YEVA 2HG5C 4P9OA 3T4ZA 2WLMA 3K0GA 4GX2A 3ABMC 2X6BA 4MS2A 4CBCA 4PDMA 1R3JC 4HYOA 2BOBC 4RUEA 2A9HA 1M57C 4MW8A 2Y69C 1LNQA 3RVZA 4PA7A 3RW0A 4WFHA 1OCOC 3SYCA 4F4LA 2ZD9A 3PJSK 3FB6C 4X89A 2HFEC
chains in the Genus database with same CATH superfamily
1ORQC 4ZKIA 1O9GA 3ABTA 4MW3A 5C93A 4XDJA 4FLXA 3OTFA 2EBOA 5CA0B 2W6JG 4U7NA 5DEDA 1Q5OA 5GTHZ 1KBHA 3IJ4A 2VQEB 2F1MA 3RYCB 1RSOA 2Q68A 1YTFB 1YIJV 3E22B 4ASUG 3RYIB 2FYUH 2CTRA 1K5SA 2PGGA 3ZX6A 1W0JG 4YJ3A 3W7TA 3JYCA 5JJJB 4K8ZA 4DRXB 5IY5B 3SPHA 4IYIA 2JVDA 3JAWA 4B3RO 1J5EB 2PF4E 4I5SA 1QR9A 2YC0A 3ABLC 1I7FA 3CEIA 3K5LA 2VQFO 4YJ2A 5JH7A 5LA6B 2LW1A 4X88A 5BXZA 1GKFA 3LDCA 3RYFB 1BL8A 3L75H 5LHIA 2B1IA 3OAAG 3STZC 3T1YB 2IJJA 1XNQO 1LUWA 3BFRA 1NVPB 1HNZB 3L70H 4QIWF 1VQPV 2WWWA 1FFXB 5ITZB 1KKDA 4GX0A 4UB6Z 4LCUC 2JRIA 1S5LZ 2NNUA 2JDIG 4PDLA 2H8PC 1KP3A 4XDLA 4CS3A 1VF6A 4BIUA 2XAHA 1KQSU 1X4TA 1L1FA 3TJTA 4O4LA 1D5AA 3RFRA 2VWJA 1XNRO 5KAFZ 5B1OA 2A7WA 3NR7A 1LR1A 3X2QB 4UCRA 5BY1A 4HBNA 4HYOA 4JV5B 4ICGA 3DC5A 2XAJA 2ZM6B 1WPBA 4EEQA 2Q4PA 2WA4A 3VQXA 2ILMA 4X62O 3QO8A 4HAMA 2UUAO 1P84F 4DK1A 4IIJB 1YDXA 2MW2B 4I0XA 3B77A 2AZ0A 3ZS8C 1SA0B 2YIBD 1P7GA 3C3SA 2QM4A 4LFBB 4X20A 4H33A 1K33A 4IIJA 5EBWC 1XL4A 2UXNA 4U7OA 1IDSA 3FFQA 1Q6IA 5EIBC 4DV3B 1N8RW 4X9QA 3VQVA 4OX9B 4E4EA 5JWPA 3JARB 1SQVH 4I9QA 2QSAA 1XMOO 2XTAA 4Q20A 1IURA 2WLIB 1FXKC 2L35A 3K04A 5J9PC 2V1DA 3CCSV 4LF8O 4Q6GA 2EJ7A 3RYFA 4ZHQB 4OPAA 1XHXA 1ZL8B 4CH3A 3TXQA 4LFCO 3CCUV 3ZHUA 1M4UA 1QNMA 2IJHA 1KYOF 3D3IA 4EKWA 1BHBA 1VF7A 1Y66A 4L8JA 2QM8A 1FJGB 2ZKOA 1VQLV 2ARHA 1M57B 4FFBB 2VRZA 1V54C 3OE7G 1QQCA 1B3QA 4UB8Z 1FFTB 2E76B 1YITV 1QBZA 2YEVA 5EYPB 1WB8A 5CA0A 4DO2A 5BR8O 3DTUB 4PELA 4DV4B 2H3OA 3HKBB 4DUYB 1MMMA 2Q0OC 4E2LA 5IWAB 2WAMA 4CH6A 5LMNO 4NXMO 1H2GA 3A0RA 1BCCH 5B1NA 1G8MA 2CGOA 4MVUA 3L71H 1SESA 1KECA 3THOA 1JX9A 2CGNA 3CP1A 4O4IB 5BMVA 3CXHF 4X1KA 4ZOLB 2QKAA 1KD1W 4TQFA 5IJ0B 3KG2A 1AJQA 1X59A 5BMVB 3T1CA 4B3SO 1EFRG 1VQ8V 1EN6A 2V4DA 5LMUO 4DV6B 4NTWA 2UUCO 2AHZA 3A8TA 3JCZA 2A0LA 4AILC 1WPXA 3ZRWB 4LF6B 1XUQA 3N27A 3UT5B 1K73W 4R6ZA 1VQNV 4WFAV 3B4SA 1BSMA 2LJ2A 2BE3A 2Z0AA 2Y4UA 1MA1A 4UCVA 3IAYA 5L3DA 5L3BA 3JALA 2ZXWC 3BEHA 2CTPA 2G38A 2P67A 4NXMB 3CMEV 4JTCB 5JVDA 3F7VC 4J7ZA 4QE7A 3SGIA 4UCUA 2BSKA 2ZDIC 4J9YB 1ZTEA 4I7ZB 4YIOA 1L8DA 1VF6C 3ZHQA 3P3PA 3A0BZ 4PI2A 2E3CA 5HFLA 5IYBO 2GTAA 3BHPA 1K4DC 4B3SB 4K0KO 4I50A 1DF4A 4NTXA 1A32A 3EFFK 4JASA 1FJGO 4QGPA 1EN4A 1LUVA 3LSSA 2Q69A 1JA8A 5KHIA 5LHGA 3RGBA 4Z2WA 2Y4TA 4EFBA 2WLMA 4F6EA 3G71V 5B66Z 3UT5A 2PY5A 4MT8A 4AI8A 1BHAA 2HFEC 3RN4A 1K5QA 3X2QC 2P5OA 2HKOA 5IWAO 3D36A 4LFAO 4K35A 3J7AU 1YF2A 5H2FZ 1F7YA 2KQXA 2UXCB 4YHHO 4F6RB 3OGIB 5J2UA 3ABLB 4ZOLA 3UO3A 3FKSG 3ZEDA 5KMGA 3OMAB 4DV5B 4DR5O 4UVAA 1WA8B 4JPRA 4TUYA 1H2SB 3E8BA 3SYQA 1S72V 4JI7B 5B5EZ 1E1RG 1JMKC 3HPLC 1HWYA 3CS5A 4I9WA 2ZIOA 2PYLA 5EC1C 5B1BC 2F23A 4LFBO 3CPWU 4N21A 4FVMA 3N2GB 4B3RB 1H2LA 2E75B 4BW5A 2C2AA 2X6AA 2YS8A 2QKSA 3OGCC 3MHHC 1TUEB 2OWOA 1I5YA 2XASA 4LH6A 3E89A 1FD9A 3ABMB 3OMNB 1R3LC 2ZIMA 5KUMA 1BZKA 2M6YA 4ZI7B 4G2KA 4LF7O 1PKXA 4TV9B 3SDLA 4TUYB 3B8MA 1GO3F 3ETGA 4UV9A 5JCOC 4MVOA 1K3EA 5LP6C 4DV4O 1IX9A 3TK1A 1IBLB 2HHHB 3ABMC 5H9CA 1COWG 1Q6HA 2BOBC 2UXDB 3OEHG 1S0VA 1SQXH 4WFHA 4FM0A 2YIAA 2OIEA 5B1BB 1VQ7V 1XILA 4DRXA 2RJZA 3HKDA 2Y0PA 4LFCB 1N33B 1WN7A 4PJ0Z 2ITCC 3K59A 1QCEA 3T1HO 1B06A 5KAIZ 5GONB 1MZEA 3CE2A 4WBNA 3FB7C 5CMUA 1NS1A 2Q73A 3OTOO 3GB7C 4TQDA 2CH7B 3K79A 2WPDG 4JI5B 1Q86W 1Y76A 3CCRV 4NKGB 3ZRSA 4X1IB 3OMIB 1H8EG 5JQGB 5B1AB 4JZ2A 4JYCA 1BMFG 1VIBA 2QWPB 1V9PA 2OTLV 3JARA 3HB3B 3ASOC 2FB5A 3BCCH 2P06A 4JI2O 1DLBA 5KHHA 3CXCU 3AG7A 3JD3A 4HZ3A 4J80A 3OUFA 2ZDIA 1YHQV 3H1KH 4YHHB 3TGUH 2KKWA 3WB0A 4KHPO 1JFFB 3CWBH 1OCZB 3J80N 2W0XA 4JI1O 4IHJB 2Q0AA 2Q7HA 3G6BA 2Z3YA 4LFAB 4OXSA 2LGQA 3JATA 4MTXA 1ZLZA 2F93B 1OCCC 4KL1A 3A0HZ 1K8AW 4O4HA 2Q7EA 4FLTA 4NVPA 1VP7A 2PI4A 4KXRA 1SC5B 5JJNB 1ZL8A 2Q7GA 3K5OA 1QLEC 1AILA 4GX5A 4AQYO 2QM7A 2HG5C 1BGYH 5CA3A 4X64B 1BS3A 1XNRB 1RM1B 5JCOA 4O2AA 1RPRA 5LP6A 4LWSA 4UVBA 1TAEA 1CXZB 1V55C 2AW9A 2YIBA 1Y4MA 4CS4A 4WBNB 4FJCC 4WFGA 1GN3A 1JCHA 3HR0A 1F23A 4DV3O 1Y74B 3ETDA 4UXNA 4JYYA 4FLVA 2JIZG 2GBOA 4LP8A 1IBKB 2QE7G 5B3SC 2BTQA 5BZBA 4ZI7A 1KMIZ 1GRJA 2UUCB 2P90A 4TV8B 2DQ0A 2JJ1G 3VBBA 1QHTA 4JI5O 5LOVA 3OR6C 1WJZA 1KU9A 1XREA 4DV1B 3K0DA 1P49A 4A5UB 1GH6A 4DV7B 3QF7A 1J5EO 2HJFC 2HEPA 4X1YA 5LMUB 1QLEB 4DV6O 4G27B 3CD6V 2LP7A 3UCSC 1GM9A 2EX3A 4QJFB 4DR7O 4DR3O 3B40A 3CC4V 1OHHG 3AG3B 4DV0B 1D2DA 4GUNA 3BRCA 3UO2A 5H6QA 2P22C 4LNUB 3A2FA 2VQEO 4MTOA 2XNDG 3CJHB 2QKCA 1Q3EA 1IXBA 3LNNA 5JJEB 2NLJC 2CUGA 2XOKG 3MAQA 2LW7A 4P9OA 2CTWA 2KB1A 3HKDB 4GX2A 4CC6A 3BA9A 1OV9A 2ZT9B 1NT2B 1OCCB 1LNQA 3MHSC 3ZHSA 3RW0A 1US6A 5LP6B 2A3QA 2WLKA 3LDDA 5C8YA 2OT5A 4KUMA 3K3WA 4J10A 3NXSA 1FAFA 1SRYA 1GN2A 3ABKC 1N36O 3APQA 1WLEA 2KG7B 5LGUA 2CK3G 3LUTB 4X65B 3F5WC 2D3OW 3ZCCA 2DMXA 1S76D 2WLJA 3ASOB 2KSDA 4I55A 2CAZC 2QR4A 3CB2A 1WAZA 3AG4C 4D7TA 1PL4A 2JJ2G 1JR9A 3MD0A 4O2AB 2Q8VA 3ZIAG 1XMOB 4DV1O 5EK0A 4DUYO 1SERA 3JALB 1N32B 5CB4A 4GKKB 1ZX3A 3L74H 4BIOA 2D2CB 2JGDB 4JAAA 4U3JA 1EN5A 3F7YC 2IU3A 2ZE7A 1N0NA 1WNSA 4FFKA 4O4HB 4YXWG 1M90W 2ADPA 3CJHA 4JYAO 4IL6Z 4Z1VA 1W2BU 3T4DA 4DR2B 3K9SA 2QEXV 4JI4O 4MSWC 1YI2V 2QWNB 3C90A 4R7CA 5KHGA 4WFFA 1M5IA 1KUQA 3E83A 2QWQB 1AR5A 1Q6UA 3BPZA 5EC2C 2QGNA 1URFA 1UJWB 3D3QA 1H2KA 1IVSA 1F4MA 1VMGA 3JD1A 1H38A 4X66O 5CB4B 3R66A 1R6KA 3C3TA 4X1KB 4YY3B 4U3JB 3K06A 3EXAA 3T1YO 1XNQB 5IYZB 3CRAA 3SPGA 1Z5WA 2DOSA 3CMAV 1XBLA 2FTKA 1FFXA 1XEQA 2YEVB 2KG7A 2RCVA 1JQ0A 2ATKC 3QO5A 1AP5A 1I08A 1ROPA 2DJVA 5KX5B 3JD0A 5EYPA 2EILC 2ZR3A 2Y69B 1YTFD 5FPOA 4X1IA 2JK5C 1Y67A 1MABG 4I4TB 2PYJA 1WB7A 3ZMTA 2CE4A 3RYCA 2QWRB 3CCMV 1Z2GA 2BOCC 1FXKB 4HNAB 4JI6B 1R3IC 4LF5B 2Q5ZA 1SQQH 3JAKB 3G6EV 3M99B 1AJNA 2QDOA 3ZRWA 3WB1A 1UFIA 3G80A 3IC9A 4RO2A 5FNVA 5FL7G 1SZXA 1JJOA 1SS3A 5CBGA 1U97A 3K9AA 2F43G 3CYOA 5E1AC 2XAGA 3H01A 2JGUA 1FYJA 3SYAA 4G28B 1IXMA 1DF5A 3FYEB 5JVDB 5GW7A 3JASA 1GM7A 2IJIA 5KA5A 4JV5O 1V54B 3AK3A 4X66B 1N32O 2R9AA 1R3JC 1D5NA 4JF3A 2Y69C 1B04A 2WSSG 1ZUQA 3PJSK 2JS5A 3E8GA 4HNAA 4LF5O 5GONA 5LYJB 4DXWA 3B8NA 4QPJA 4JI4B 3P32A 1TGOA 2K1EA 4LNUA 4X65O 5CA1A 3ZHRA 1VQ6V 1N34O 3ICXA 4DV0O 4I50B 3GWKC 4XBFA 1TUBA 4MTGA 1F51A 1KP2A 1OJHA 4O2BB 2ZE8A 4LF9B 1ZAUA 2BTQB 3OR7C 4DV7O 1AR4A 2DYRB 1IBKO 3CSXA 1IZ3A 4GKKO 2RMKB 4YJ2B 4OGQB 4K3AA 5KMGB 3DGEA 4GX1A 4FM2A 1IBMO 5LXTB 5CN0A 1XQ8A 2AGAA 1NJIW 1K97A 3S3XA 4PA9A 3TETA 5LXTA 2UUAB 2WLIA 3SYPA 3ASNB 3CC7V 2RNBA 1L0NH 4P30A 3JATB 3ZBHA 5A9GA 1PV0A 3AG1C 4NYKA 4UCOA 4JTDB 1HNWB 3VQYA 3EVKA 2UUBB 3BABA 4NXNB 4PA3A 4LF7B 4X64O 3HKEA 1SA0A 3QG5A 4B08A 1BQ0A 2R72A 3N2GA 4FPPA 3FAVA 4JI8B 2UXBB 3SJBC 1R1BA 2LO1A 4EB6A 4MW8A 4QPKA 2GHYA 1NKDA 2EZPA 3SYCA 1Z5VA 2ODMA 2P4KA 3K57A 4R8CA 1NTMH 2A79B 1SQGA 3E35A 4DR6O 2XAQA 1VQMV 5JQGA 2DYSC 3L73H 2EIJC 1PNMA 3F5TA 2RDCA 3ZJZA 5FPRA 1AI5A 1VQOV 3ASNC 1MZFA 2N04A 3ZRVA 3N2KA 3CCLV 4PA4A 4FIPC 1KC8W 5EBLC 4TV8A 3FYIB 1SETA 2F95B 2MK3A 4B3TB 2EIMB 2ZXWB 4XDKA 1VARA 2WLNA 4RUFA 3SPCA 1QLNA 3U0ZA 3JCUZ 1FXVA 3JAKA 1SKVA 3WG7B 4DR3B 5IJ9A 3ETQA 1VQ9V 4YJ3B 3T1HB 4ABMA 3W7SA 5B3SB 2OTJV 3H9VA 4PDRA 3QO7A 1SQPH 1THZA 3OT7A 4NB5A 2DE0X 4YIPA 4TOIA 3M7MX 4PV1B 2AHYA 4DR4B 2ITDC 2Y0IA 3HKBA 4JI7O 3N2KB 3CCVV 1GM8A 2EIJB 1K92A 1T5EA 3JD4A 4JZGA 4WFEA 5KHJA 4PHZA 1FXHA 1ZWIC 2BTOA 4O2BA 5LYJA 4IHJA 2F66C 4GT1A 1OCOC 4KHPB 2ZD9A 3DSQA 3BA8A 4UCSA 1OZ0A 2HVKC 2QTOA 3CCJV 2IM9A 2DN9A 2YXLA 5EBMC 4TT3G 1H8HG 1XMQB 4PD4F 5HFMA 4JI3B 3FD9A 5B1AC 3K5MA 3ZHVA 3S3WA 3R65A 4DR7B 4RWUA 2VS0A 3QNEA 2W6IG 3OD4A 1EM1A 4WFBV 2JGDA 4FLWA 1NTKH 1RSOB 1NR7A 2UXXA 1PP9H 1NTZH 2DYSB 3HKCB 1YJNV 1HR0O 5DECA 2WLLA 1L0LH 4PDVA 5L3EA 2WLHA 3OM3B 2HHHO 1PNLA 3UM7A 1K7DA 2XHBA 2OCCB 3E2EA 4BR6A 4I0XB 4FFBA 1WP8A 4FLYA 3AG4B 3I5DA 1MSDA 2DWEC 5LOVB 4O4JB 2YXYA 2QA4V 3AG2B 2JS3A 4MVSA 5KLVH 4QNHB 4DV2B 3IFXA 1XI1A 3ABKB 3KCYA 4EFEA 3J81N 5C8YB 5EIBD 3GWOA 4PA6A 4D6TH 5K1PA 5FLXN 5DN6G 4UFZA 3U10A 1E79G 4DR2O 4JI8O 4JAVA 3K0GA 2P4VA 4GCZA 3L72H 4MS2A 1Q82W 1UPGA 1M57C 2YSUB 4H0LB 4B7EA 1XHZA 1NQTA 3E86A 2UU9O 1PM9A 2Y48A 3BVOA 3UQ8A 4CC5A 5CBHA 2YI9A 3W7XA 5DM6V 4P2ZA 3MDSA 1YZBA 2EIKB 2UXDO 5A2QN 3DXRA 3H1LH 1SZTA 1M56B 3LNMB 1Q81W 4D7SA 4DR1B 3ZN0A 4IT5A 4J9ZB 3ZN1A 4MTFA 3D8CA 1J95A 1NR1A 1MNGA 1B6QA 3CHXA 2PZSA 4Z1MG 3FB8C 4OX9O 4H37A 1N0JA 4MVZA 1GN4A 3JASB 4QE9A 5IT9N 2EIKC 3AEIA 4GKJO 3PN1A 3P30A 1VF5B 1HR0B 4OPHA 3JSLA 1TVKB 4CS2A 1N33O 1NZ6A 2PUSA 4UUJC 5LGNA 4B7KA 4JYBA 4FZ1A 4O4LB 4FM1A 5LMNB 1R6NA 3E8HA 4DV5O 4DR5B 2E5LB 3H1IH 3K58A 2BCCH 5FNVB 3W7WA 4DV2O 5KA6A 4RQEA 4IGGA 1RM1C 1PPJH 5LGTA 1K34A 1SQBH 2GV9A 5KHKA 1AI4A 2EZOA 2NR5A 5KUKA 2O57A 2NN4A 2IU0A 2UU9B 4LH7A 3H1JH 5IYCO 3SPJA 4DR1O 4W4KA 3CRMA 2HP8A 3OUSA 1Y74A 5AG2A 1VEWA 3P3NA 1Q7YW 3VQWA 4GYCB 1HNXB 5L3GA 2A9HA 4FMTA 4PA7A 4DR6B 1RFYA 4TV9A 2DQ3A 4JTAB 3WFVA 3ZMVA 1FPOA 1R73A 1YCIA 2DYRC 2R70A 2EULA 2GSMB 2YI8A 4RAIA 1MSWD 1JJ2U 4DW1A 1JOYA 2GUZA 1NH2B 3D36C 3OTOB 1S3JA 4JI1B 4GKJB 4UV8A 3BY6A 4KFMA 4W4LA 3E22A 2UUBO 2E74B 4GLXA 4X20B 3JAMN 1EZVH 2DWDC 3ZRXA 2LFSA 3ABUA 4NR1A 4JI0O 4JI2B 2OCCC 1M9NA 4BIZA 1XMQO 3ZMSA 3LDEA 4LF6O 4JI0B 4B3TO 1Q8IA 2IH3C 3B2EE 1DK1A 4J41A 2PI5A 3ZMZA 4L87A 5CBFA 4FLUA 1OCRC 5D5PA 3RVYA 1K4CC 3STLC 4KP4A 4DYLA 5IE9A 2RQ6A 5L3CA 4MVRA 1SQFA 4WF9V 1NU1H 2UXCO 5ITZA 2EINB 3H1HH 4J7KA 4DW0A 2E5LO 1XDCA 5J2TA 4H44B 2Q67A 4TWKA 3HKEB 4I4TA 1I0HA 2B1GA 2LFRA 2ZM6O 3KKYA 4K0KB 5EZYA 4F6RA 4EB6B 2P7TC 3FAVB 4IYHA 1R6TA 4CBCA 4PDMA 2ZNIA 2IBZH 2EJRA 1IBLO 4C7UA 4H13B 2ADQB 3RVZA 2YXHA 5LA6A 4LWSB 1P4RA 5IDJA 3FB6C 1K9MW 5GTIZ 4K8XA 1M56C 3IC7A 1ENVA 3RT3C 2OYQA 1O9HA 3OW2U 4O4JA 1GN6A 4BWAA 4FLZA 2FL4A 1S5JA 4LC1A 4CH5A 3CRRA 1N4CA 2CDYA 1NI8A 1M93A 2VQFB 1W0KG 3VOUA 1G6UA 3JAWB 3CRQA 3IGAC 5IYDO 5J2TB 2OIGA 1XL6A 3K03A 1GK9A 1V55B 2K9PA 5L3FA 2Q6AA 1AP6A 1E1QG 4U3FH 1NVPD 5EZYB 2BSKB 3WB2A 1PD3A 1JFFA 4O4IA 4DUZO 5CA1B 3AG2C 2AXTZ 3UKMA 4BAYA 2ZE6A 3OFNG 2Z5UA 2ZCEA 3QVNA 1AJPA 2RN9A 3FB5C 4N23A 4B3MB 4ZHQA 3W7UA 2ETNA 2A06H 3L9DA 5D5QA 1N34B 2EIMC 3EHBB 2UXBO 4JI3O 1I5XA 4CZZA 1DTOA 1S5HC 3HKCA 4RQFA 3SR2C 2GTSA 4ZBMA 1WP7A 1MG1A 4MVQA 1OCRB 4P9PA 3ML0A 5E79Z 5LBQA 1DGSA 2YUAA 1I94O 2YICA 1YSCA 1QVGU 3AG3C 5J2UB 3RYHB 3FX7A 3M8AA 1MOFA 1SF9A 3AG1B 5H6RA 1Y76B 5K1XA 4RUEA 3I55V 1WA8A 1Y6XA 1GTOA 3SJCC 3AK1A 2XAFA 4X62B 2M7WA 3K5NA 1BQZA 4I55B 3G67A 1AI7A 1YXBA 3WG7C 4MVMA 1PNKA 2P6JA 4DR4O 3SJAC 2V7QG 4PI0A 2GDSA 4LR3A 5IY5C 3SYOA 2PTMA 4NXNO 5IYZA 4ZIBA 1YJWV 1JPXA 1HNWO 4LF8B 5IJ9B 1G4YB 2B9ZA 2XT9A 1VQKV 4X8AA 3KCXA 4DUZB 4JAUA 1HP8A 4WCEV 1OCZC 1QVFU 3K08A 4J11A 1TVKA 2FKXA 1PL0A 1HDJA 2QTSA 1CEZA 1TUBB 4CH4A 2LQTA 2DW4A 1F4NA 4YY3O 2EINC 3RYIA 4GZRB 1Q90D 2X6CA 1YEWA 1AROP 2VWKA 1YJ9V 4FZ0A 1Q43A 1EZJA 1HW7A 2R9IA 4LF9O 2FMLA 2EILB 5TISZ 2ZINA 2ZR2A 3O65A 1KKCA 2CH7A 1P7BA 4TSFG 2B5UA 3CCQV 3RBZA 3Q4HB 1EBOA 1GMGA 2JEUA 4NTYA 3T2MA 4J42A 3DXRB 3WU2Z 1CP9A 4AQYB 2X6BA 3DC6A 5BR8B 1NH2D 4LF4B 1CPYA 1NBMG 1FKAO 1GAXA 4F4LA 2H94A 1G1XB 2WA3A 2HVJC 2IJKA 1QU7A 2ZQMA 3CX5F 4J7JA 3APOA 1KB9F 1W59A 2ZNJA 4BW9A 4JYAB 4X1YB 3RWRD 2HR3A 2X7RB 3JD2A 1HNZO 1S77D 1ZSPA 1R3KC 2GUZB 2F4VO 2QWOB 5F2VO 1TA8A 3CC2V 2OCHA 4UVCA 1YVWA 2IH1C 1FS0G 5H5NA 2JEXA 2IW5A 2W0FC 1AB3A 3ZHTA 5LHHA 3CRCA 1AVMA 2Q9LA 2N74A 2AZ2A 3AK2A 1VQ5V 4LF4O 2HLDG 3E8FA 2XUMA 3ETEA 1QR8A 2R9RB 3RYHA 1RP3B 2QJ1A 4JI6O 1JVMA 3OEEG 4B3MO 5KX5A 3SPIA 3B09A 2X0LA 1FXKA 2L6LA 3LSQA 5JH7B 5LL6Y 4FK5C 1BE3H 3TXSA 4DK0A 1N36B 2YIDA 1H2NA 2YDEA 2ZE5A 3JSNA 1XOUA 1U96A 3LSUA 3O9OA 3U11A 1RPOA 2CTQA 3QTCA 3TCUA 4LBEC 3SJQC 3Q4HA 1BT8A 2F4VB 1I94B 1AI6A 2WLLB 2LGWA 4R50A 4AHCA 1VQ4V 2N05A 3ZMUA 3BAAA 1HNXO 1OCOB 3KZIZ 3T4ZA 1IBMB 1H2MA 3I56V 2HJDA 3GVMA 1M1KW 4UCTA 5IJ0A 3G4SV 4JGSA 3CCEV 4X89A 1AR1B
chains in the Genus database with same CATH topology
1ORQC 4ZKIA 4JTAB 3ABTA 3WFVA 3ZMVA 4MW3A 5B1BB 1VQ7V 3E8GA 5C93A 4XDJA 1R73A 2EBOA 2W6JG 2DYRC 4DXWA 3B8NA 2ITCC 4U7NA 4QPJA 1QCEA 3P32A 2GSMB 4RAIA 2Q68A 3FB7C 5CMUA 1YTFB 2K1EA 1MSWD 1JJ2U 1VQ6V 1YIJV 1JOYA 3GB7C 1NH2B 4ASUG 1K5SA 1S3JA 1W0JG 3BY6A 3K79A 4UV8A 4XBFA 4KFMA 4MTGA 2WPDG 3W7TA 1F51A 1Q86W 1KP2A 3JYCA 3CCRV 3ZRSA 3OMIB 1H8EG 5B1AB 5IY5B 3SPHA 4JYCA 2DWDC 1BMFG 3OR7C 3ZRXA 2LFSA 3ABUA 4I5SA 1QR9A 2OTLV 3ABLC 2DYRB 3HB3B 3ASOC 2OCCC 1M9NA 4BIZA 3ZMSA 3LDEA 1DLBA 3CXCU 3DGEA 2IH3C 4GX1A 3JD3A 4X88A 4HZ3A 1GKFA 3OUFA 3LDCA 2PI5A 1BL8A 2ZDIA 5CN0A 1YHQV 1NJIW 5LHIA 2B1IA 3ZMZA 1K97A 4L87A 3OAAG 4PA9A 3STZC 5CBFA 2IJJA 3TETA 1OCRC 2WLIA 3RVYA 3SYPA 1NVPB 1K4CC 3ASNB 3STLC 3CC7V 1OCZB 4QIWF 4KP4A 4P30A 1VQPV 5L3CA 2WWWA 4MVRA 4WF9V 1KKDA 4GX0A 2Z3YA 3AG1C 2EINB 4LCUC 4JTDB 4OXSA 4MTXA 1OCCC 2NNUA 2JDIG 4PDLA 2H8PC 1KP3A 2Q67A 4XDLA 1K8AW 4TWKA 4PA3A 4BIUA 2B1GA 2PI4A 2LFRA 2XAHA 1KQSU 1L1FA 1QLEC 2P7TC 4GX5A 2QM7A 2HG5C 5B1OA 4FPPA 3X2QB 5CA3A 4CBCA 4PDMA 2EJRA 4HYOA 4MW8A 4QPKA 2GHYA 1RM1B 3RVZA 2XAJA 1NKDA 2EZPA 3SYCA 1P4RA 1RPRA 5IDJA 3FB6C 4UVBA 1K9MW 3QO8A 1V55C 4HAMA 4R8CA 1M56C 2A79B 1Y4MA 3E35A 3IC7A 1ENVA 3B77A 4FJCC 2XAQA 4WFGA 3OW2U 1VQMV 1JCHA 4H33A 2DYSC 1K33A 5EBWC 1F23A 1XL4A 2EIJC 1PNMA 3ETDA 4UXNA 4LC1A 3ZJZA 1AI5A 2UXNA 4U7OA 2JIZG 1VQOV 3ASNC 4LP8A 3ZRVA 1W0KG 3VOUA 1N8RW 3CCLV 4PA4A 2QE7G 5B3SC 4FIPC 1KC8W 3IGAC 5BZBA 5EBLC 5IYDO 3FYIB 1XL6A 3K03A 2P90A 1GK9A 1SETA 2DQ0A 2MK3A 1V55B 5L3FA 2Q6AA 2EIMB 2JJ1G 2ZXWB 1E1QG 3VBBA 1NVPD 4XDKA 3OR6C 2WLNA 4Q20A 1PD3A 4RUFA 3SPCA 2WLIB 1FXKC 3K0DA 1QLNA 3K04A 1FXVA 3AG2C 2HJFC 5J9PC 2V1DA 3CCSV 3UKMA 4BAYA 3WG7B 1QLEB 3OFNG 4G27B 2Z5UA 1VQ9V 3CD6V 2LP7A 1AJPA 3FB5C 4N23A 3W7SA 1GM9A 4QJFB 5B3SB 2OTJV 3CCUV 3CC4V 4PDRA 1OHHG 3AG3B 3QO7A 3W7UA 1THZA 2EIMC 3EHBB 2IJHA 5H6QA 1I5XA 3D3IA 4EKWA 4CZZA 1DTOA 1BHBA 2AHYA 1S5HC 4RQFA 1Y66A 2ITDC 4MTOA 2XNDG 2QM8A 4ZBMA 3CCVV 1VQLV 1M57B 1GM8A 1MG1A 4MVQA 1OCRB 2EIJB 4P9PA 3ML0A 1K92A 1V54C 5LBQA 3OE7G 2NLJC 3JD4A 1FFTB 4WFEA 2XOKG 1YSCA 1QVGU 1FXHA 1ZWIC 3AG3C 4P9OA 1YITV 2KB1A 1QBZA 2YEVA 1MOFA 3AG1B 4GX2A 4DO2A 3DTUB 5H6RA 4PELA 1OCCB 4RUEA 1LNQA 3MHSC 4E2LA 3I55V 3RW0A 4GT1A 1OCOC 2ZD9A 2WAMA 1GTOA 2WLKA 3LDDA 2XAFA 2OT5A 2M7WA 1H2GA 3A0RA 1OZ0A 2HVKC 2QTOA 4KUMA 5B1NA 1G8MA 3K3WA 3CCJV 1AI7A 3WG7C 4MVUA 4MVMA 1SESA 1KECA 1PNKA 2P6JA 3NXSA 4TT3G 1H8HG 5EBMC 1SRYA 2V7QG 5HFMA 1JX9A 3ABKC 3CP1A 1WLEA 5B1AC 5IY5C 3PJSK 5LGUA 3SYOA 2CK3G 3LUTB 3R65A 1KD1W 3F5WC 3KG2A 1AJQA 3QNEA 2D3OW 2W6IG 3ZCCA 1S76D 3T1CA 1EFRG 2WLJA 4WFBV 1YJWV 3ASOB 1VQ8V 1JPXA 1NR7A 3AG4C 2UXXA 1G4YB 2AHZA 2DYSB 1VQKV 2JJ2G 3JCZA 1YJNV 2A0LA 1WPXA 4X8AA 2WLLA 3ZRWB 3MD0A 4JAUA 3ZIAG 4PDVA 5EK0A 1SERA 5L3EA 1K73W 4R6ZA 2WLHA 1VQNV 4JGSA 4WFAV 3OM3B 1PNLA 4WCEV 3UM7A 1K7DA 1OCZC 1QVFU 3K08A 2OCCB 5L3DA 5L3BA 2ZXWC 3BEHA 2P67A 1PL0A 3CMEV 3F7YC 3E2EA 1CEZA 4JTCB 2IU3A 2DW4A 1F4NA 3F7VC 2EINC 3AG4B 4QE7A 2DWEC 1M90W 2X6CA 4YXWG 2ZDIC 4J9YB 2QA4V 3AG2B 4MVSA 1AROP 1YJ9V 5HFLA 5IYBO 1EZJA 4QNHB 2R9IA 1W2BU 3T4DA 2EILB 2QEXV 3IFXA 4MSWC 2ZR2A 1K4DC 3ABKB 1YI2V 4R7CA 1P7BA 4WFFA 4TSFG 2B5UA 1DF4A 3GWOA 3E83A 4PA6A 3EFFK 3RBZA 3CCQV 5EC2C 4JASA 5DN6G 1UJWB 1EBOA 1GMGA 1F4MA 2JEUA 1E79G 3LSSA 3T2MA 2Q69A 1CP9A 5LHGA 4JAVA 2WLMA 3K0GA 3JD1A 4GCZA 2X6BA 4MS2A 1H38A 1Q82W 3G71V 1NH2D 1M57C 4MT8A 2YSUB 1CPYA 1NBMG 4F4LA 2H94A 1NQTA 2HFEC 1BHAA 1R6KA 3E86A 2Y48A 2HVJC 1K5QA 2IJKA 3X2QC 2ZQMA 5CBHA 3W7XA 2HKOA 3D36A 3K06A 5DM6V 4P2ZA 2EIKB 3SPGA 1SZTA 1M56B 3LNMB 3CMAV 2FTKA 2HR3A 2YEVB 1Q81W 2X7RB 3JD2A 3ABLB 3ZN0A 1S77D 3ZN1A 3FKSG 4J9ZB 1R3KC 3OMAB 4MTFA 1J95A 1NR1A 1JQ0A 2ATKC 4UVAA 3QO5A 1B6QA 4JPRA 4Z1MG 3FB8C 3CC2V 1ROPA 3E8BA 3SYQA 3JD0A 1S72V 4H37A 4UVCA 4MVZA 2IH1C 1FS0G 2EILC 2ZR3A 2Y69B 1YTFD 2JEXA 1E1RG 2IW5A 4QE9A 3HPLC 2W0FC 2JK5C 1HWYA 1MABG 5LHHA 2EIKC 4I9WA 3AEIA 5EC1C 3P30A 5B1BC 1VQ5V 2HLDG 3E8FA 3ETEA 3ZMTA 1QR8A 3CPWU 4N21A 3CCMV 2R9RB 4BW5A 1JVMA 3OEEG 2BOCC 2C2AA 1FXKB 2X6AA 3SPIA 3LSQA 2X0LA 1FXKA 2QKSA 3OGCC 1R3IC 4UUJC 5LGNA 3MHHC 4FK5C 1TUEB 4JYBA 1I5YA 1R6NA 2XASA 3E89A 3ABMB 3E8HA 3OMNB 3G6EV 1R3LC 3M99B 1AJNA 3ZRWA 5KUMA 3W7WA 4RO2A 5KA6A 5FL7G 4RQEA 1RM1C 5CBGA 5LGTA 1K34A 4G2KA 1RPOA 1PKXA 4LBEC 1AI4A 2EZOA 3SJQC 3TCUA 3K9AA 2F43G 3CYOA 5E1AC 2XAGA 3H01A 5KUKA 3B8MA 1GO3F 1AI6A 3ETGA 2WLLB 4UV9A 2IU0A 4R50A 1VQ4V 3SYAA 4G28B 5IYCO 1IXMA 1DF5A 3FYEB 3SPJA 5GW7A 3ZMUA 1GM7A 4MVOA 1K3EA 1OCOB 2IJIA 5KA5A 3OUSA 3T4ZA 3TK1A 1V54B 3ABMC 5H9CA 1Q7YW 1R3JC 1COWG 4JF3A 3I56V 2BOBC 5L3GA 2A9HA 3OEHG 2Y69C 4FMTA 1M1KW 1S0VA 2WSSG 4PA7A 4WFHA 3G4SV 2DQ3A 3CCEV 4X89A 1AR1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORQ C;  2WLK A;  1V55 C;  3E86 A;  2HVJ C;  3LDD A;  1M56 C;  4JTA B;  4R8C A;  4MW3 A;  2A79 B;  3X2Q C;  3E8G A;  2HVK C;  4XDJ A;  5CBH A;  2QTO A;  3K06 A;  3WG7 C;  4MVU A;  4P2Z A;  2DYR C;  4DXW A;  4MVM A;  2ITC C;  4WFG A;  5EBM C;  3SPG A;  4H33 A;  4RAI A;  2DYS C;  5EBW C;  2Q68 A;  3FB7 C;  1XL4 A;  3ABK C;  2K1E A;  3LNM B;  2EIJ C;  3GB7 C;  3ZJZ A;  4J9Z B;  5B1A C;  5IY5 C;  3ASN C;  1R3K C;  3SYO A;  4MTF A;  1J95 A;  3LUT B;  4LP8 A;  2ATK C;  3R65 A;  3F5W C;  3VOU A;  3KG2 A;  4KFM A;  4MTG A;  4PA4 A;  5B3S C;  3JYC A;  3IGA C;  5BZB A;  3T1C A;  3ZRS A;  5EBL C;  3FB8 C;  2WLJ A;  3E8B A;  3SYQ A;  1XL6 A;  3K03 A;  3AG4 C;  3SPH A;  4H37 A;  2Q6A A;  2DWD C;  4MVZ A;  1G4Y B;  3OR7 C;  2AHZ A;  2IH1 C;  2EIL C;  4XDK A;  3OR6 C;  4QE9 A;  2WLN A;  2W0F C;  2A0L A;  2JK5 C;  3ABL C;  3HPL C;  2EIK C;  4I9W A;  2WLL A;  4RUF A;  4X8A A;  3SPC A;  3ASO C;  2OCC C;  2WLI B;  3K0D A;  5EC1 C;  4PDV A;  3K04 A;  5EK0 A;  5B1B C;  4R6Z A;  2WLH A;  3AG2 C;  2HJF C;  3E8F A;  5J9P C;  3LDE A;  3UKM A;  4GX1 A;  2IH3 C;  2R9R B;  4G27 B;  4X88 A;  4HZ3 A;  3UM7 A;  3OUF A;  4BW5 A;  1JVM A;  1OCZ C;  3LDC A;  1BL8 A;  2BOC C;  3K08 A;  3FB5 C;  2X6A A;  3SPI A;  3TET A;  2ZXW C;  4PA9 A;  2QKS A;  3BEH A;  3STZ C;  5CBF A;  3OGC C;  1R3I C;  4UUJ C;  3F7Y C;  1OCR C;  4JTC B;  2WLI A;  4PDR A;  3RVY A;  3SYP A;  1K4C C;  3F7V C;  3STL C;  2EIN C;  4QE7 A;  2DWE C;  3E89 A;  3E8H A;  2EIM C;  2X6C A;  1R3L C;  4J9Y B;  4P30 A;  4MVS A;  4EKW A;  5KUM A;  4MVR A;  2AHY A;  1S5H C;  1KKD A;  4GX0 A;  4RO2 A;  4QNH B;  2ITD C;  3AG1 C;  4MTO A;  4LCU C;  5CBG A;  4JTD B;  4OXS A;  3T4D A;  4ZBM A;  1OCC C;  3IFX A;  4MSW C;  1K4D C;  4LBE C;  3TCU A;  4PDL A;  4MVQ A;  2H8P C;  3SJQ C;  2Q67 A;  4P9P A;  4XDL A;  5E1A C;  5KUK A;  4TWK A;  4R7C A;  1P7B A;  4WFF A;  1V54 C;  4PA3 A;  4PA6 A;  2NLJ C;  2WLL B;  3E83 A;  3EFF K;  3RBZ A;  5EC2 C;  4R50 A;  4WFE A;  3SYA A;  4G28 B;  1QLE C;  3SPJ A;  4MVO A;  3T2M A;  2P7T C;  2Q69 A;  1ZWI C;  3AG3 C;  4GX5 A;  3OUS A;  2KB1 A;  2YEV A;  2HG5 C;  4P9O A;  3T4Z A;  2WLM A;  3K0G A;  4GX2 A;  3ABM C;  2X6B A;  4MS2 A;  4CBC A;  4PDM A;  1R3J C;  4HYO A;  2BOB C;  4RUE A;  2A9H A;  1M57 C;  4MW8 A;  2Y69 C;  1LNQ A;  3RVZ A;  4PA7 A;  3RW0 A;  4WFH A;  1OCO C;  3SYC A;  4F4L A;  2ZD9 A;  3PJS K;  3FB6 C;  4X89 A;  2HFE C; 
#chains in the Genus database with same CATH topology
 1ORQ C;  4ZKI A;  1O9G A;  3ABT A;  4MW3 A;  5C93 A;  4XDJ A;  4FLX A;  3OTF A;  2EBO A;  5CA0 B;  2W6J G;  4U7N A;  5DED A;  1Q5O A;  5GTH Z;  1KBH A;  3IJ4 A;  2VQE B;  2F1M A;  3RYC B;  1RSO A;  2Q68 A;  1YTF B;  1YIJ V;  3E22 B;  4ASU G;  3RYI B;  2FYU H;  2CTR A;  1K5S A;  2PGG A;  3ZX6 A;  1W0J G;  4YJ3 A;  3W7T A;  3JYC A;  5JJJ B;  4K8Z A;  4DRX B;  5IY5 B;  3SPH A;  4IYI A;  2JVD A;  3JAW A;  4B3R O;  1J5E B;  2PF4 E;  4I5S A;  1QR9 A;  2YC0 A;  3ABL C;  1I7F A;  3CEI A;  3K5L A;  2VQF O;  4YJ2 A;  5JH7 A;  5LA6 B;  2LW1 A;  4X88 A;  5BXZ A;  1GKF A;  3LDC A;  3RYF B;  1BL8 A;  3L75 H;  5LHI A;  2B1I A;  3OAA G;  3STZ C;  3T1Y B;  2IJJ A;  1XNQ O;  1LUW A;  3BFR A;  1NVP B;  1HNZ B;  3L70 H;  4QIW F;  1VQP V;  2WWW A;  1FFX B;  5ITZ B;  1KKD A;  4GX0 A;  4UB6 Z;  4LCU C;  2JRI A;  1S5L Z;  2NNU A;  2JDI G;  4PDL A;  2H8P C;  1KP3 A;  4XDL A;  4CS3 A;  1VF6 A;  4BIU A;  2XAH A;  1KQS U;  1X4T A;  1L1F A;  3TJT A;  4O4L A;  1D5A A;  3RFR A;  2VWJ A;  1XNR O;  5KAF Z;  5B1O A;  2A7W A;  3NR7 A;  1LR1 A;  3X2Q B;  4UCR A;  5BY1 A;  4HBN A;  4HYO A;  4JV5 B;  4ICG A;  3DC5 A;  2XAJ A;  2ZM6 B;  1WPB A;  4EEQ A;  2Q4P A;  2WA4 A;  3VQX A;  2ILM A;  4X62 O;  3QO8 A;  4HAM A;  2UUA O;  1P84 F;  4DK1 A;  4IIJ B;  1YDX A;  2MW2 B;  4I0X A;  3B77 A;  2AZ0 A;  3ZS8 C;  1SA0 B;  2YIB D;  1P7G A;  3C3S A;  2QM4 A;  4LFB B;  4X20 A;  4H33 A;  1K33 A;  4IIJ A;  5EBW C;  1XL4 A;  2UXN A;  4U7O A;  1IDS A;  3FFQ A;  1Q6I A;  5EIB C;  4DV3 B;  1N8R W;  4X9Q A;  3VQV A;  4OX9 B;  4E4E A;  5JWP A;  3JAR B;  1SQV H;  4I9Q A;  2QSA A;  1XMO O;  2XTA A;  4Q20 A;  1IUR A;  2WLI B;  1FXK C;  2L35 A;  3K04 A;  5J9P C;  2V1D A;  3CCS V;  4LF8 O;  4Q6G A;  2EJ7 A;  3RYF A;  4ZHQ B;  4OPA A;  1XHX A;  1ZL8 B;  4CH3 A;  3TXQ A;  4LFC O;  3CCU V;  3ZHU A;  1M4U A;  1QNM A;  2IJH A;  1KYO F;  3D3I A;  4EKW A;  1BHB A;  1VF7 A;  1Y66 A;  4L8J A;  2QM8 A;  1FJG B;  2ZKO A;  1VQL V;  2ARH A;  1M57 B;  4FFB B;  2VRZ A;  1V54 C;  3OE7 G;  1QQC A;  1B3Q A;  4UB8 Z;  1FFT B;  2E76 B;  1YIT V;  1QBZ A;  2YEV A;  5EYP B;  1WB8 A;  5CA0 A;  4DO2 A;  5BR8 O;  3DTU B;  4PEL A;  4DV4 B;  2H3O A;  3HKB B;  4DUY B;  1MMM A;  2Q0O C;  4E2L A;  5IWA B;  2WAM A;  4CH6 A;  5LMN O;  4NXM O;  1H2G A;  3A0R A;  1BCC H;  5B1N A;  1G8M A;  2CGO A;  4MVU A;  3L71 H;  1SES A;  1KEC A;  3THO A;  1JX9 A;  2CGN A;  3CP1 A;  4O4I B;  5BMV A;  3CXH F;  4X1K A;  4ZOL B;  2QKA A;  1KD1 W;  4TQF A;  5IJ0 B;  3KG2 A;  1AJQ A;  1X59 A;  5BMV B;  3T1C A;  4B3S O;  1EFR G;  1VQ8 V;  1EN6 A;  2V4D A;  5LMU O;  4DV6 B;  4NTW A;  2UUC O;  2AHZ A;  3A8T A;  3JCZ A;  2A0L A;  4AIL C;  1WPX A;  3ZRW B;  4LF6 B;  1XUQ A;  3N27 A;  3UT5 B;  1K73 W;  4R6Z A;  1VQN V;  4WFA V;  3B4S A;  1BSM A;  2LJ2 A;  2BE3 A;  2Z0A A;  2Y4U A;  1MA1 A;  4UCV A;  3IAY A;  5L3D A;  5L3B A;  3JAL A;  2ZXW C;  3BEH A;  2CTP A;  2G38 A;  2P67 A;  4NXM B;  3CME V;  4JTC B;  5JVD A;  3F7V C;  4J7Z A;  4QE7 A;  3SGI A;  4UCU A;  2BSK A;  2ZDI C;  4J9Y B;  1ZTE A;  4I7Z B;  4YIO A;  1L8D A;  1VF6 C;  3ZHQ A;  3P3P A;  3A0B Z;  4PI2 A;  2E3C A;  5HFL A;  5IYB O;  2GTA A;  3BHP A;  1K4D C;  4B3S B;  4K0K O;  4I50 A;  1DF4 A;  4NTX A;  1A32 A;  3EFF K;  4JAS A;  1FJG O;  4QGP A;  1EN4 A;  1LUV A;  3LSS A;  2Q69 A;  1JA8 A;  5KHI A;  5LHG A;  3RGB A;  4Z2W A;  2Y4T A;  4EFB A;  2WLM A;  4F6E A;  3G71 V;  5B66 Z;  3UT5 A;  2PY5 A;  4MT8 A;  4AI8 A;  1BHA A;  2HFE C;  3RN4 A;  1K5Q A;  3X2Q C;  2P5O A;  2HKO A;  5IWA O;  3D36 A;  4LFA O;  4K35 A;  3J7A U;  1YF2 A;  5H2F Z;  1F7Y A;  2KQX A;  2UXC B;  4YHH O;  4F6R B;  3OGI B;  5J2U A;  3ABL B;  4ZOL A;  3UO3 A;  3FKS G;  3ZED A;  5KMG A;  3OMA B;  4DV5 B;  4DR5 O;  4UVA A;  1WA8 B;  4JPR A;  4TUY A;  1H2S B;  3E8B A;  3SYQ A;  1S72 V;  4JI7 B;  5B5E Z;  1E1R G;  1JMK C;  3HPL C;  1HWY A;  3CS5 A;  4I9W A;  2ZIO A;  2PYL A;  5EC1 C;  5B1B C;  2F23 A;  4LFB O;  3CPW U;  4N21 A;  4FVM A;  3N2G B;  4B3R B;  1H2L A;  2E75 B;  4BW5 A;  2C2A A;  2X6A A;  2YS8 A;  2QKS A;  3OGC C;  3MHH C;  1TUE B;  2OWO A;  1I5Y A;  2XAS A;  4LH6 A;  3E89 A;  1FD9 A;  3ABM B;  3OMN B;  1R3L C;  2ZIM A;  5KUM A;  1BZK A;  2M6Y A;  4ZI7 B;  4G2K A;  4LF7 O;  1PKX A;  4TV9 B;  3SDL A;  4TUY B;  3B8M A;  1GO3 F;  3ETG A;  4UV9 A;  5JCO C;  4MVO A;  1K3E A;  5LP6 C;  4DV4 O;  1IX9 A;  3TK1 A;  1IBL B;  2HHH B;  3ABM C;  5H9C A;  1COW G;  1Q6H A;  2BOB C;  2UXD B;  3OEH G;  1S0V A;  1SQX H;  4WFH A;  4FM0 A;  2YIA A;  2OIE A;  5B1B B;  1VQ7 V;  1XIL A;  4DRX A;  2RJZ A;  3HKD A;  2Y0P A;  4LFC B;  1N33 B;  1WN7 A;  4PJ0 Z;  2ITC C;  3K59 A;  1QCE A;  3T1H O;  1B06 A;  5KAI Z;  5GON B;  1MZE A;  3CE2 A;  4WBN A;  3FB7 C;  5CMU A;  1NS1 A;  2Q73 A;  3OTO O;  3GB7 C;  4TQD A;  2CH7 B;  3K79 A;  2WPD G;  4JI5 B;  1Q86 W;  1Y76 A;  3CCR V;  4NKG B;  3ZRS A;  4X1I B;  3OMI B;  1H8E G;  5JQG B;  5B1A B;  4JZ2 A;  4JYC A;  1BMF G;  1VIB A;  2QWP B;  1V9P A;  2OTL V;  3JAR A;  3HB3 B;  3ASO C;  2FB5 A;  3BCC H;  2P06 A;  4JI2 O;  1DLB A;  5KHH A;  3CXC U;  3AG7 A;  3JD3 A;  4HZ3 A;  4J80 A;  3OUF A;  2ZDI A;  1YHQ V;  3H1K H;  4YHH B;  3TGU H;  2KKW A;  3WB0 A;  4KHP O;  1JFF B;  3CWB H;  1OCZ B;  3J80 N;  2W0X A;  4JI1 O;  4IHJ B;  2Q0A A;  2Q7H A;  3G6B A;  2Z3Y A;  4LFA B;  4OXS A;  2LGQ A;  3JAT A;  4MTX A;  1ZLZ A;  2F93 B;  1OCC C;  4KL1 A;  3A0H Z;  1K8A W;  4O4H A;  2Q7E A;  4FLT A;  4NVP A;  1VP7 A;  2PI4 A;  4KXR A;  1SC5 B;  5JJN B;  1ZL8 A;  2Q7G A;  3K5O A;  1QLE C;  1AIL A;  4GX5 A;  4AQY O;  2QM7 A;  2HG5 C;  1BGY H;  5CA3 A;  4X64 B;  1BS3 A;  1XNR B;  1RM1 B;  5JCO A;  4O2A A;  1RPR A;  5LP6 A;  4LWS A;  4UVB A;  1TAE A;  1CXZ B;  1V55 C;  2AW9 A;  2YIB A;  1Y4M A;  4CS4 A;  4WBN B;  4FJC C;  4WFG A;  1GN3 A;  1JCH A;  3HR0 A;  1F23 A;  4DV3 O;  1Y74 B;  3ETD A;  4UXN A;  4JYY A;  4FLV A;  2JIZ G;  2GBO A;  4LP8 A;  1IBK B;  2QE7 G;  5B3S C;  2BTQ A;  5BZB A;  4ZI7 A;  1KMI Z;  1GRJ A;  2UUC B;  2P90 A;  4TV8 B;  2DQ0 A;  2JJ1 G;  3VBB A;  1QHT A;  4JI5 O;  5LOV A;  3OR6 C;  1WJZ A;  1KU9 A;  1XRE A;  4DV1 B;  3K0D A;  1P49 A;  4A5U B;  1GH6 A;  4DV7 B;  3QF7 A;  1J5E O;  2HJF C;  2HEP A;  4X1Y A;  5LMU B;  1QLE B;  4DV6 O;  4G27 B;  3CD6 V;  2LP7 A;  3UCS C;  1GM9 A;  2EX3 A;  4QJF B;  4DR7 O;  4DR3 O;  3B40 A;  3CC4 V;  1OHH G;  3AG3 B;  4DV0 B;  1D2D A;  4GUN A;  3BRC A;  3UO2 A;  5H6Q A;  2P22 C;  4LNU B;  3A2F A;  2VQE O;  4MTO A;  2XND G;  3CJH B;  2QKC A;  1Q3E A;  1IXB A;  3LNN A;  5JJE B;  2NLJ C;  2CUG A;  2XOK G;  3MAQ A;  2LW7 A;  4P9O A;  2CTW A;  2KB1 A;  3HKD B;  4GX2 A;  4CC6 A;  3BA9 A;  1OV9 A;  2ZT9 B;  1NT2 B;  1OCC B;  1LNQ A;  3MHS C;  3ZHS A;  3RW0 A;  1US6 A;  5LP6 B;  2A3Q A;  2WLK A;  3LDD A;  5C8Y A;  2OT5 A;  4KUM A;  3K3W A;  4J10 A;  3NXS A;  1FAF A;  1SRY A;  1GN2 A;  3ABK C;  1N36 O;  3APQ A;  1WLE A;  2KG7 B;  5LGU A;  2CK3 G;  3LUT B;  4X65 B;  3F5W C;  2D3O W;  3ZCC A;  2DMX A;  1S76 D;  2WLJ A;  3ASO B;  2KSD A;  4I55 A;  2CAZ C;  2QR4 A;  3CB2 A;  1WAZ A;  3AG4 C;  4D7T A;  1PL4 A;  2JJ2 G;  1JR9 A;  3MD0 A;  4O2A B;  2Q8V A;  3ZIA G;  1XMO B;  4DV1 O;  5EK0 A;  4DUY O;  1SER A;  3JAL B;  1N32 B;  5CB4 A;  4GKK B;  1ZX3 A;  3L74 H;  4BIO A;  2D2C B;  2JGD B;  4JAA A;  4U3J A;  1EN5 A;  3F7Y C;  2IU3 A;  2ZE7 A;  1N0N A;  1WNS A;  4FFK A;  4O4H B;  4YXW G;  1M90 W;  2ADP A;  3CJH A;  4JYA O;  4IL6 Z;  4Z1V A;  1W2B U;  3T4D A;  4DR2 B;  3K9S A;  2QEX V;  4JI4 O;  4MSW C;  1YI2 V;  2QWN B;  3C90 A;  4R7C A;  5KHG A;  4WFF A;  1M5I A;  1KUQ A;  3E83 A;  2QWQ B;  1AR5 A;  1Q6U A;  3BPZ A;  5EC2 C;  2QGN A;  1URF A;  1UJW B;  3D3Q A;  1H2K A;  1IVS A;  1F4M A;  1VMG A;  3JD1 A;  1H38 A;  4X66 O;  5CB4 B;  3R66 A;  1R6K A;  3C3T A;  4X1K B;  4YY3 B;  4U3J B;  3K06 A;  3EXA A;  3T1Y O;  1XNQ B;  5IYZ B;  3CRA A;  3SPG A;  1Z5W A;  2DOS A;  3CMA V;  1XBL A;  2FTK A;  1FFX A;  1XEQ A;  2YEV B;  2KG7 A;  2RCV A;  1JQ0 A;  2ATK C;  3QO5 A;  1AP5 A;  1I08 A;  1ROP A;  2DJV A;  5KX5 B;  3JD0 A;  5EYP A;  2EIL C;  2ZR3 A;  2Y69 B;  1YTF D;  5FPO A;  4X1I A;  2JK5 C;  1Y67 A;  1MAB G;  4I4T B;  2PYJ A;  1WB7 A;  3ZMT A;  2CE4 A;  3RYC A;  2QWR B;  3CCM V;  1Z2G A;  2BOC C;  1FXK B;  4HNA B;  4JI6 B;  1R3I C;  4LF5 B;  2Q5Z A;  1SQQ H;  3JAK B;  3G6E V;  3M99 B;  1AJN A;  2QDO A;  3ZRW A;  3WB1 A;  1UFI A;  3G80 A;  3IC9 A;  4RO2 A;  5FNV A;  5FL7 G;  1SZX A;  1JJO A;  1SS3 A;  5CBG A;  1U97 A;  3K9A A;  2F43 G;  3CYO A;  5E1A C;  2XAG A;  3H01 A;  2JGU A;  1FYJ A;  3SYA A;  4G28 B;  1IXM A;  1DF5 A;  3FYE B;  5JVD B;  5GW7 A;  3JAS A;  1GM7 A;  2IJI A;  5KA5 A;  4JV5 O;  1V54 B;  3AK3 A;  4X66 B;  1N32 O;  2R9A A;  1R3J C;  1D5N A;  4JF3 A;  2Y69 C;  1B04 A;  2WSS G;  1ZUQ A;  3PJS K;  2JS5 A;  3E8G A;  4HNA A;  4LF5 O;  5GON A;  5LYJ B;  4DXW A;  3B8N A;  4QPJ A;  4JI4 B;  3P32 A;  1TGO A;  2K1E A;  4LNU A;  4X65 O;  5CA1 A;  3ZHR A;  1VQ6 V;  1N34 O;  3ICX A;  4DV0 O;  4I50 B;  3GWK C;  4XBF A;  1TUB A;  4MTG A;  1F51 A;  1KP2 A;  1OJH A;  4O2B B;  2ZE8 A;  4LF9 B;  1ZAU A;  2BTQ B;  3OR7 C;  4DV7 O;  1AR4 A;  2DYR B;  1IBK O;  3CSX A;  1IZ3 A;  4GKK O;  2RMK B;  4YJ2 B;  4OGQ B;  4K3A A;  5KMG B;  3DGE A;  4GX1 A;  4FM2 A;  1IBM O;  5LXT B;  5CN0 A;  1XQ8 A;  2AGA A;  1NJI W;  1K97 A;  3S3X A;  4PA9 A;  3TET A;  5LXT A;  2UUA B;  2WLI A;  3SYP A;  3ASN B;  3CC7 V;  2RNB A;  1L0N H;  4P30 A;  3JAT B;  3ZBH A;  5A9G A;  1PV0 A;  3AG1 C;  4NYK A;  4UCO A;  4JTD B;  1HNW B;  3VQY A;  3EVK A;  2UUB B;  3BAB A;  4NXN B;  4PA3 A;  4LF7 B;  4X64 O;  3HKE A;  1SA0 A;  3QG5 A;  4B08 A;  1BQ0 A;  2R72 A;  3N2G A;  4FPP A;  3FAV A;  4JI8 B;  2UXB B;  3SJB C;  1R1B A;  2LO1 A;  4EB6 A;  4MW8 A;  4QPK A;  2GHY A;  1NKD A;  2EZP A;  3SYC A;  1Z5V A;  2ODM A;  2P4K A;  3K57 A;  4R8C A;  1NTM H;  2A79 B;  1SQG A;  3E35 A;  4DR6 O;  2XAQ A;  1VQM V;  5JQG A;  2DYS C;  3L73 H;  2EIJ C;  1PNM A;  3F5T A;  2RDC A;  3ZJZ A;  5FPR A;  1AI5 A;  1VQO V;  3ASN C;  1MZF A;  2N04 A;  3ZRV A;  3N2K A;  3CCL V;  4PA4 A;  4FIP C;  1KC8 W;  5EBL C;  4TV8 A;  3FYI B;  1SET A;  2F95 B;  2MK3 A;  4B3T B;  2EIM B;  2ZXW B;  4XDK A;  1VAR A;  2WLN A;  4RUF A;  3SPC A;  1QLN A;  3U0Z A;  3JCU Z;  1FXV A;  3JAK A;  1SKV A;  3WG7 B;  4DR3 B;  5IJ9 A;  3ETQ A;  1VQ9 V;  4YJ3 B;  3T1H B;  4ABM A;  3W7S A;  5B3S B;  2OTJ V;  3H9V A;  4PDR A;  3QO7 A;  1SQP H;  1THZ A;  3OT7 A;  4NB5 A;  2DE0 X;  4YIP A;  4TOI A;  3M7M X;  4PV1 B;  2AHY A;  4DR4 B;  2ITD C;  2Y0I A;  3HKB A;  4JI7 O;  3N2K B;  3CCV V;  1GM8 A;  2EIJ B;  1K92 A;  1T5E A;  3JD4 A;  4JZG A;  4WFE A;  5KHJ A;  4PHZ A;  1FXH A;  1ZWI C;  2BTO A;  4O2B A;  5LYJ A;  4IHJ A;  2F66 C;  4GT1 A;  1OCO C;  4KHP B;  2ZD9 A;  3DSQ A;  3BA8 A;  4UCS A;  1OZ0 A;  2HVK C;  2QTO A;  3CCJ V;  2IM9 A;  2DN9 A;  2YXL A;  5EBM C;  4TT3 G;  1H8H G;  1XMQ B;  4PD4 F;  5HFM A;  4JI3 B;  3FD9 A;  5B1A C;  3K5M A;  3ZHV A;  3S3W A;  3R65 A;  4DR7 B;  4RWU A;  2VS0 A;  3QNE A;  2W6I G;  3OD4 A;  1EM1 A;  4WFB V;  2JGD A;  4FLW A;  1NTK H;  1RSO B;  1NR7 A;  2UXX A;  1PP9 H;  1NTZ H;  2DYS B;  3HKC B;  1YJN V;  1HR0 O;  5DEC A;  2WLL A;  1L0L H;  4PDV A;  5L3E A;  2WLH A;  3OM3 B;  2HHH O;  1PNL A;  3UM7 A;  1K7D A;  2XHB A;  2OCC B;  3E2E A;  4BR6 A;  4I0X B;  4FFB A;  1WP8 A;  4FLY A;  3AG4 B;  3I5D A;  1MSD A;  2DWE C;  5LOV B;  4O4J B;  2YXY A;  2QA4 V;  3AG2 B;  2JS3 A;  4MVS A;  5KLV H;  4QNH B;  4DV2 B;  3IFX A;  1XI1 A;  3ABK B;  3KCY A;  4EFE A;  3J81 N;  5C8Y B;  5EIB D;  3GWO A;  4PA6 A;  4D6T H;  5K1P A;  5FLX N;  5DN6 G;  4UFZ A;  3U10 A;  1E79 G;  4DR2 O;  4JI8 O;  4JAV A;  3K0G A;  2P4V A;  4GCZ A;  3L72 H;  4MS2 A;  1Q82 W;  1UPG A;  1M57 C;  2YSU B;  4H0L B;  4B7E A;  1XHZ A;  1NQT A;  3E86 A;  2UU9 O;  1PM9 A;  2Y48 A;  3BVO A;  3UQ8 A;  4CC5 A;  5CBH A;  2YI9 A;  3W7X A;  5DM6 V;  4P2Z A;  3MDS A;  1YZB A;  2EIK B;  2UXD O;  5A2Q N;  3DXR A;  3H1L H;  1SZT A;  1M56 B;  3LNM B;  1Q81 W;  4D7S A;  4DR1 B;  3ZN0 A;  4IT5 A;  4J9Z B;  3ZN1 A;  4MTF A;  3D8C A;  1J95 A;  1NR1 A;  1MNG A;  1B6Q A;  3CHX A;  2PZS A;  4Z1M G;  3FB8 C;  4OX9 O;  4H37 A;  1N0J A;  4MVZ A;  1GN4 A;  3JAS B;  4QE9 A;  5IT9 N;  2EIK C;  3AEI A;  4GKJ O;  3PN1 A;  3P30 A;  1VF5 B;  1HR0 B;  4OPH A;  3JSL A;  1TVK B;  4CS2 A;  1N33 O;  1NZ6 A;  2PUS A;  4UUJ C;  5LGN A;  4B7K A;  4JYB A;  4FZ1 A;  4O4L B;  4FM1 A;  5LMN B;  1R6N A;  3E8H A;  4DV5 O;  4DR5 B;  2E5L B;  3H1I H;  3K58 A;  2BCC H;  5FNV B;  3W7W A;  4DV2 O;  5KA6 A;  4RQE A;  4IGG A;  1RM1 C;  1PPJ H;  5LGT A;  1K34 A;  1SQB H;  2GV9 A;  5KHK A;  1AI4 A;  2EZO A;  2NR5 A;  5KUK A;  2O57 A;  2NN4 A;  2IU0 A;  2UU9 B;  4LH7 A;  3H1J H;  5IYC O;  3SPJ A;  4DR1 O;  4W4K A;  3CRM A;  2HP8 A;  3OUS A;  1Y74 A;  5AG2 A;  1VEW A;  3P3N A;  1Q7Y W;  3VQW A;  4GYC B;  1HNX B;  5L3G A;  2A9H A;  4FMT A;  4PA7 A;  4DR6 B;  1RFY A;  4TV9 A;  2DQ3 A;  4JTA B;  3WFV A;  3ZMV A;  1FPO A;  1R73 A;  1YCI A;  2DYR C;  2R70 A;  2EUL A;  2GSM B;  2YI8 A;  4RAI A;  1MSW D;  1JJ2 U;  4DW1 A;  1JOY A;  2GUZ A;  1NH2 B;  3D36 C;  3OTO B;  1S3J A;  4JI1 B;  4GKJ B;  4UV8 A;  3BY6 A;  4KFM A;  4W4L A;  3E22 A;  2UUB O;  2E74 B;  4GLX A;  4X20 B;  3JAM N;  1EZV H;  2DWD C;  3ZRX A;  2LFS A;  3ABU A;  4NR1 A;  4JI0 O;  4JI2 B;  2OCC C;  1M9N A;  4BIZ A;  1XMQ O;  3ZMS A;  3LDE A;  4LF6 O;  4JI0 B;  4B3T O;  1Q8I A;  2IH3 C;  3B2E E;  1DK1 A;  4J41 A;  2PI5 A;  3ZMZ A;  4L87 A;  5CBF A;  4FLU A;  1OCR C;  5D5P A;  3RVY A;  1K4C C;  3STL C;  4KP4 A;  4DYL A;  5IE9 A;  2RQ6 A;  5L3C A;  4MVR A;  1SQF A;  4WF9 V;  1NU1 H;  2UXC O;  5ITZ A;  2EIN B;  3H1H H;  4J7K A;  4DW0 A;  2E5L O;  1XDC A;  5J2T A;  4H44 B;  2Q67 A;  4TWK A;  3HKE B;  4I4T A;  1I0H A;  2B1G A;  2LFR A;  2ZM6 O;  3KKY A;  4K0K B;  5EZY A;  4F6R A;  4EB6 B;  2P7T C;  3FAV B;  4IYH A;  1R6T A;  4CBC A;  4PDM A;  2ZNI A;  2IBZ H;  2EJR A;  1IBL O;  4C7U A;  4H13 B;  2ADQ B;  3RVZ A;  2YXH A;  5LA6 A;  4LWS B;  1P4R A;  5IDJ A;  3FB6 C;  1K9M W;  5GTI Z;  4K8X A;  1M56 C;  3IC7 A;  1ENV A;  3RT3 C;  2OYQ A;  1O9H A;  3OW2 U;  4O4J A;  1GN6 A;  4BWA A;  4FLZ A;  2FL4 A;  1S5J A;  4LC1 A;  4CH5 A;  3CRR A;  1N4C A;  2CDY A;  1NI8 A;  1M93 A;  2VQF B;  1W0K G;  3VOU A;  1G6U A;  3JAW B;  3CRQ A;  3IGA C;  5IYD O;  5J2T B;  2OIG A;  1XL6 A;  3K03 A;  1GK9 A;  1V55 B;  2K9P A;  5L3F A;  2Q6A A;  1AP6 A;  1E1Q G;  4U3F H;  1NVP D;  5EZY B;  2BSK B;  3WB2 A;  1PD3 A;  1JFF A;  4O4I A;  4DUZ O;  5CA1 B;  3AG2 C;  2AXT Z;  3UKM A;  4BAY A;  2ZE6 A;  3OFN G;  2Z5U A;  2ZCE A;  3QVN A;  1AJP A;  2RN9 A;  3FB5 C;  4N23 A;  4B3M B;  4ZHQ A;  3W7U A;  2ETN A;  2A06 H;  3L9D A;  5D5Q A;  1N34 B;  2EIM C;  3EHB B;  2UXB O;  4JI3 O;  1I5X A;  4CZZ A;  1DTO A;  1S5H C;  3HKC A;  4RQF A;  3SR2 C;  2GTS A;  4ZBM A;  1WP7 A;  1MG1 A;  4MVQ A;  1OCR B;  4P9P A;  3ML0 A;  5E79 Z;  5LBQ A;  1DGS A;  2YUA A;  1I94 O;  2YIC A;  1YSC A;  1QVG U;  3AG3 C;  5J2U B;  3RYH B;  3FX7 A;  3M8A A;  1MOF A;  1SF9 A;  3AG1 B;  5H6R A;  1Y76 B;  5K1X A;  4RUE A;  3I55 V;  1WA8 A;  1Y6X A;  1GTO A;  3SJC C;  3AK1 A;  2XAF A;  4X62 B;  2M7W A;  3K5N A;  1BQZ A;  4I55 B;  3G67 A;  1AI7 A;  1YXB A;  3WG7 C;  4MVM A;  1PNK A;  2P6J A;  4DR4 O;  3SJA C;  2V7Q G;  4PI0 A;  2GDS A;  4LR3 A;  5IY5 C;  3SYO A;  2PTM A;  4NXN O;  5IYZ A;  4ZIB A;  1YJW V;  1JPX A;  1HNW O;  4LF8 B;  5IJ9 B;  1G4Y B;  2B9Z A;  2XT9 A;  1VQK V;  4X8A A;  3KCX A;  4DUZ B;  4JAU A;  1HP8 A;  4WCE V;  1OCZ C;  1QVF U;  3K08 A;  4J11 A;  1TVK A;  2FKX A;  1PL0 A;  1HDJ A;  2QTS A;  1CEZ A;  1TUB B;  4CH4 A;  2LQT A;  2DW4 A;  1F4N A;  4YY3 O;  2EIN C;  3RYI A;  4GZR B;  1Q90 D;  2X6C A;  1YEW A;  1ARO P;  2VWK A;  1YJ9 V;  4FZ0 A;  1Q43 A;  1EZJ A;  1HW7 A;  2R9I A;  4LF9 O;  2FML A;  2EIL B;  5TIS Z;  2ZIN A;  2ZR2 A;  3O65 A;  1KKC A;  2CH7 A;  1P7B A;  4TSF G;  2B5U A;  3CCQ V;  3RBZ A;  3Q4H B;  1EBO A;  1GMG A;  2JEU A;  4NTY A;  3T2M A;  4J42 A;  3DXR B;  3WU2 Z;  1CP9 A;  4AQY B;  2X6B A;  3DC6 A;  5BR8 B;  1NH2 D;  4LF4 B;  1CPY A;  1NBM G;  1FKA O;  1GAX A;  4F4L A;  2H94 A;  1G1X B;  2WA3 A;  2HVJ C;  2IJK A;  1QU7 A;  2ZQM A;  3CX5 F;  4J7J A;  3APO A;  1KB9 F;  1W59 A;  2ZNJ A;  4BW9 A;  4JYA B;  4X1Y B;  3RWR D;  2HR3 A;  2X7R B;  3JD2 A;  1HNZ O;  1S77 D;  1ZSP A;  1R3K C;  2GUZ B;  2F4V O;  2QWO B;  5F2V O;  1TA8 A;  3CC2 V;  2OCH A;  4UVC A;  1YVW A;  2IH1 C;  1FS0 G;  5H5N A;  2JEX A;  2IW5 A;  2W0F C;  1AB3 A;  3ZHT A;  5LHH A;  3CRC A;  1AVM A;  2Q9L A;  2N74 A;  2AZ2 A;  3AK2 A;  1VQ5 V;  4LF4 O;  2HLD G;  3E8F A;  2XUM A;  3ETE A;  1QR8 A;  2R9R B;  3RYH A;  1RP3 B;  2QJ1 A;  4JI6 O;  1JVM A;  3OEE G;  4B3M O;  5KX5 A;  3SPI A;  3B09 A;  2X0L A;  1FXK A;  2L6L A;  3LSQ A;  5JH7 B;  5LL6 Y;  4FK5 C;  1BE3 H;  3TXS A;  4DK0 A;  1N36 B;  2YID A;  1H2N A;  2YDE A;  2ZE5 A;  3JSN A;  1XOU A;  1U96 A;  3LSU A;  3O9O A;  3U11 A;  1RPO A;  2CTQ A;  3QTC A;  3TCU A;  4LBE C;  3SJQ C;  3Q4H A;  1BT8 A;  2F4V B;  1I94 B;  1AI6 A;  2WLL B;  2LGW A;  4R50 A;  4AHC A;  1VQ4 V;  2N05 A;  3ZMU A;  3BAA A;  1HNX O;  1OCO B;  3KZI Z;  3T4Z A;  1IBM B;  1H2M A;  3I56 V;  2HJD A;  3GVM A;  1M1K W;  4UCT A;  5IJ0 A;  3G4S V;  4JGS A;  3CCE V;  4X89 A;  1AR1 B; 
#chains in the Genus database with same CATH homology
 1ORQ C;  4ZKI A;  4JTA B;  3ABT A;  3WFV A;  3ZMV A;  4MW3 A;  5B1B B;  1VQ7 V;  3E8G A;  5C93 A;  4XDJ A;  1R73 A;  2EBO A;  2W6J G;  2DYR C;  4DXW A;  3B8N A;  2ITC C;  4U7N A;  4QPJ A;  1QCE A;  3P32 A;  2GSM B;  4RAI A;  2Q68 A;  3FB7 C;  5CMU A;  1YTF B;  2K1E A;  1MSW D;  1JJ2 U;  1VQ6 V;  1YIJ V;  1JOY A;  3GB7 C;  1NH2 B;  4ASU G;  1K5S A;  1S3J A;  1W0J G;  3BY6 A;  3K79 A;  4UV8 A;  4XBF A;  4KFM A;  4MTG A;  2WPD G;  3W7T A;  1F51 A;  1Q86 W;  1KP2 A;  3JYC A;  3CCR V;  3ZRS A;  3OMI B;  1H8E G;  5B1A B;  5IY5 B;  3SPH A;  4JYC A;  2DWD C;  1BMF G;  3OR7 C;  3ZRX A;  2LFS A;  3ABU A;  4I5S A;  1QR9 A;  2OTL V;  3ABL C;  2DYR B;  3HB3 B;  3ASO C;  2OCC C;  1M9N A;  4BIZ A;  3ZMS A;  3LDE A;  1DLB A;  3CXC U;  3DGE A;  2IH3 C;  4GX1 A;  3JD3 A;  4X88 A;  4HZ3 A;  1GKF A;  3OUF A;  3LDC A;  2PI5 A;  1BL8 A;  2ZDI A;  5CN0 A;  1YHQ V;  1NJI W;  5LHI A;  2B1I A;  3ZMZ A;  1K97 A;  4L87 A;  3OAA G;  4PA9 A;  3STZ C;  5CBF A;  2IJJ A;  3TET A;  1OCR C;  2WLI A;  3RVY A;  3SYP A;  1NVP B;  1K4C C;  3ASN B;  3STL C;  3CC7 V;  1OCZ B;  4QIW F;  4KP4 A;  4P30 A;  1VQP V;  5L3C A;  2WWW A;  4MVR A;  4WF9 V;  1KKD A;  4GX0 A;  2Z3Y A;  3AG1 C;  2EIN B;  4LCU C;  4JTD B;  4OXS A;  4MTX A;  1OCC C;  2NNU A;  2JDI G;  4PDL A;  2H8P C;  1KP3 A;  2Q67 A;  4XDL A;  1K8A W;  4TWK A;  4PA3 A;  4BIU A;  2B1G A;  2PI4 A;  2LFR A;  2XAH A;  1KQS U;  1L1F A;  1QLE C;  2P7T C;  4GX5 A;  2QM7 A;  2HG5 C;  5B1O A;  4FPP A;  3X2Q B;  5CA3 A;  4CBC A;  4PDM A;  2EJR A;  4HYO A;  4MW8 A;  4QPK A;  2GHY A;  1RM1 B;  3RVZ A;  2XAJ A;  1NKD A;  2EZP A;  3SYC A;  1P4R A;  1RPR A;  5IDJ A;  3FB6 C;  4UVB A;  1K9M W;  3QO8 A;  1V55 C;  4HAM A;  4R8C A;  1M56 C;  2A79 B;  1Y4M A;  3E35 A;  3IC7 A;  1ENV A;  3B77 A;  4FJC C;  2XAQ A;  4WFG A;  3OW2 U;  1VQM V;  1JCH A;  4H33 A;  2DYS C;  1K33 A;  5EBW C;  1F23 A;  1XL4 A;  2EIJ C;  1PNM A;  3ETD A;  4UXN A;  4LC1 A;  3ZJZ A;  1AI5 A;  2UXN A;  4U7O A;  2JIZ G;  1VQO V;  3ASN C;  4LP8 A;  3ZRV A;  1W0K G;  3VOU A;  1N8R W;  3CCL V;  4PA4 A;  2QE7 G;  5B3S C;  4FIP C;  1KC8 W;  3IGA C;  5BZB A;  5EBL C;  5IYD O;  3FYI B;  1XL6 A;  3K03 A;  2P90 A;  1GK9 A;  1SET A;  2DQ0 A;  2MK3 A;  1V55 B;  5L3F A;  2Q6A A;  2EIM B;  2JJ1 G;  2ZXW B;  1E1Q G;  3VBB A;  1NVP D;  4XDK A;  3OR6 C;  2WLN A;  4Q20 A;  1PD3 A;  4RUF A;  3SPC A;  2WLI B;  1FXK C;  3K0D A;  1QLN A;  3K04 A;  1FXV A;  3AG2 C;  2HJF C;  5J9P C;  2V1D A;  3CCS V;  3UKM A;  4BAY A;  3WG7 B;  1QLE B;  3OFN G;  4G27 B;  2Z5U A;  1VQ9 V;  3CD6 V;  2LP7 A;  1AJP A;  3FB5 C;  4N23 A;  3W7S A;  1GM9 A;  4QJF B;  5B3S B;  2OTJ V;  3CCU V;  3CC4 V;  4PDR A;  1OHH G;  3AG3 B;  3QO7 A;  3W7U A;  1THZ A;  2EIM C;  3EHB B;  2IJH A;  5H6Q A;  1I5X A;  3D3I A;  4EKW A;  4CZZ A;  1DTO A;  1BHB A;  2AHY A;  1S5H C;  4RQF A;  1Y66 A;  2ITD C;  4MTO A;  2XND G;  2QM8 A;  4ZBM A;  3CCV V;  1VQL V;  1M57 B;  1GM8 A;  1MG1 A;  4MVQ A;  1OCR B;  2EIJ B;  4P9P A;  3ML0 A;  1K92 A;  1V54 C;  5LBQ A;  3OE7 G;  2NLJ C;  3JD4 A;  1FFT B;  4WFE A;  2XOK G;  1YSC A;  1QVG U;  1FXH A;  1ZWI C;  3AG3 C;  4P9O A;  1YIT V;  2KB1 A;  1QBZ A;  2YEV A;  1MOF A;  3AG1 B;  4GX2 A;  4DO2 A;  3DTU B;  5H6R A;  4PEL A;  1OCC B;  4RUE A;  1LNQ A;  3MHS C;  4E2L A;  3I55 V;  3RW0 A;  4GT1 A;  1OCO C;  2ZD9 A;  2WAM A;  1GTO A;  2WLK A;  3LDD A;  2XAF A;  2OT5 A;  2M7W A;  1H2G A;  3A0R A;  1OZ0 A;  2HVK C;  2QTO A;  4KUM A;  5B1N A;  1G8M A;  3K3W A;  3CCJ V;  1AI7 A;  3WG7 C;  4MVU A;  4MVM A;  1SES A;  1KEC A;  1PNK A;  2P6J A;  3NXS A;  4TT3 G;  1H8H G;  5EBM C;  1SRY A;  2V7Q G;  5HFM A;  1JX9 A;  3ABK C;  3CP1 A;  1WLE A;  5B1A C;  5IY5 C;  3PJS K;  5LGU A;  3SYO A;  2CK3 G;  3LUT B;  3R65 A;  1KD1 W;  3F5W C;  3KG2 A;  1AJQ A;  3QNE A;  2D3O W;  2W6I G;  3ZCC A;  1S76 D;  3T1C A;  1EFR G;  2WLJ A;  4WFB V;  1YJW V;  3ASO B;  1VQ8 V;  1JPX A;  1NR7 A;  3AG4 C;  2UXX A;  1G4Y B;  2AHZ A;  2DYS B;  1VQK V;  2JJ2 G;  3JCZ A;  1YJN V;  2A0L A;  1WPX A;  4X8A A;  2WLL A;  3ZRW B;  3MD0 A;  4JAU A;  3ZIA G;  4PDV A;  5EK0 A;  1SER A;  5L3E A;  1K73 W;  4R6Z A;  2WLH A;  1VQN V;  4JGS A;  4WFA V;  3OM3 B;  1PNL A;  4WCE V;  3UM7 A;  1K7D A;  1OCZ C;  1QVF U;  3K08 A;  2OCC B;  5L3D A;  5L3B A;  2ZXW C;  3BEH A;  2P67 A;  1PL0 A;  3CME V;  3F7Y C;  3E2E A;  1CEZ A;  4JTC B;  2IU3 A;  2DW4 A;  1F4N A;  3F7V C;  2EIN C;  3AG4 B;  4QE7 A;  2DWE C;  1M90 W;  2X6C A;  4YXW G;  2ZDI C;  4J9Y B;  2QA4 V;  3AG2 B;  4MVS A;  1ARO P;  1YJ9 V;  5HFL A;  5IYB O;  1EZJ A;  4QNH B;  2R9I A;  1W2B U;  3T4D A;  2EIL B;  2QEX V;  3IFX A;  4MSW C;  2ZR2 A;  1K4D C;  3ABK B;  1YI2 V;  4R7C A;  1P7B A;  4WFF A;  4TSF G;  2B5U A;  1DF4 A;  3GWO A;  3E83 A;  4PA6 A;  3EFF K;  3RBZ A;  3CCQ V;  5EC2 C;  4JAS A;  5DN6 G;  1UJW B;  1EBO A;  1GMG A;  1F4M A;  2JEU A;  1E79 G;  3LSS A;  3T2M A;  2Q69 A;  1CP9 A;  5LHG A;  4JAV A;  2WLM A;  3K0G A;  3JD1 A;  4GCZ A;  2X6B A;  4MS2 A;  1H38 A;  1Q82 W;  3G71 V;  1NH2 D;  1M57 C;  4MT8 A;  2YSU B;  1CPY A;  1NBM G;  4F4L A;  2H94 A;  1NQT A;  2HFE C;  1BHA A;  1R6K A;  3E86 A;  2Y48 A;  2HVJ C;  1K5Q A;  2IJK A;  3X2Q C;  2ZQM A;  5CBH A;  3W7X A;  2HKO A;  3D36 A;  3K06 A;  5DM6 V;  4P2Z A;  2EIK B;  3SPG A;  1SZT A;  1M56 B;  3LNM B;  3CMA V;  2FTK A;  2HR3 A;  2YEV B;  1Q81 W;  2X7R B;  3JD2 A;  3ABL B;  3ZN0 A;  1S77 D;  3ZN1 A;  3FKS G;  4J9Z B;  1R3K C;  3OMA B;  4MTF A;  1J95 A;  1NR1 A;  1JQ0 A;  2ATK C;  4UVA A;  3QO5 A;  1B6Q A;  4JPR A;  4Z1M G;  3FB8 C;  3CC2 V;  1ROP A;  3E8B A;  3SYQ A;  3JD0 A;  1S72 V;  4H37 A;  4UVC A;  4MVZ A;  2IH1 C;  1FS0 G;  2EIL C;  2ZR3 A;  2Y69 B;  1YTF D;  2JEX A;  1E1R G;  2IW5 A;  4QE9 A;  3HPL C;  2W0F C;  2JK5 C;  1HWY A;  1MAB G;  5LHH A;  2EIK C;  4I9W A;  3AEI A;  5EC1 C;  3P30 A;  5B1B C;  1VQ5 V;  2HLD G;  3E8F A;  3ETE A;  3ZMT A;  1QR8 A;  3CPW U;  4N21 A;  3CCM V;  2R9R B;  4BW5 A;  1JVM A;  3OEE G;  2BOC C;  2C2A A;  1FXK B;  2X6A A;  3SPI A;  3LSQ A;  2X0L A;  1FXK A;  2QKS A;  3OGC C;  1R3I C;  4UUJ C;  5LGN A;  3MHH C;  4FK5 C;  1TUE B;  4JYB A;  1I5Y A;  1R6N A;  2XAS A;  3E89 A;  3ABM B;  3E8H A;  3OMN B;  3G6E V;  1R3L C;  3M99 B;  1AJN A;  3ZRW A;  5KUM A;  3W7W A;  4RO2 A;  5KA6 A;  5FL7 G;  4RQE A;  1RM1 C;  5CBG A;  5LGT A;  1K34 A;  4G2K A;  1RPO A;  1PKX A;  4LBE C;  1AI4 A;  2EZO A;  3SJQ C;  3TCU A;  3K9A A;  2F43 G;  3CYO A;  5E1A C;  2XAG A;  3H01 A;  5KUK A;  3B8M A;  1GO3 F;  1AI6 A;  3ETG A;  2WLL B;  4UV9 A;  2IU0 A;  4R50 A;  1VQ4 V;  3SYA A;  4G28 B;  5IYC O;  1IXM A;  1DF5 A;  3FYE B;  3SPJ A;  5GW7 A;  3ZMU A;  1GM7 A;  4MVO A;  1K3E A;  1OCO B;  2IJI A;  5KA5 A;  3OUS A;  3T4Z A;  3TK1 A;  1V54 B;  3ABM C;  5H9C A;  1Q7Y W;  1R3J C;  1COW G;  4JF3 A;  3I56 V;  2BOB C;  5L3G A;  2A9H A;  3OEH G;  2Y69 C;  4FMT A;  1M1K W;  1S0V A;  2WSS G;  4PA7 A;  4WFH A;  3G4S V;  2DQ3 A;  3CCE V;  4X89 A;  1AR1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...