4R75A

Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous sedoheptulose-7-phosphate bound)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
318
structure length
318
Chain Sequence
b'KGRLVIYCSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAKVKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYTAIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQGAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTNTTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC-type Fe3+ transport system, periplasmic component
publication title Active Transport of Phosphorylated Carbohydrates Promotes Intestinal Colonization and Transmission of a Bacterial Pathogen.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
total genus 117
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r75A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r75A01
2G29A 2D5WA 1USYE 3H6UA 1I69A 2ZYKA 2PX1A 1MXUA 4WXJA 2R71A 1MPCA 4YKIA 2O51A 1LFIA 4PFYA 5I84A 3JZJA 3RT6B 2GFEA 4JB7A 1IIWA 5CMCA 3OO6A 2F5XA 1ZJLA 1VFEA 1SW2A 4H5FA 3VVFA 4IGTA 4LQ5A 1AL3A 1B5JA 4ZEFA 1B1XA 4YB5A 2ABHA 3MVXA 2QRYA 3S4UA 1II5A 4DCYA 2E0SA 5BWJA 3FJ7A 1OMPA 2XXRA 4PE5B 5F7VA 3N6UA 3FATA 3CI8A 2AL5A 1NNFA 2XHDA 1MPBA 4RPOA 1IZ1A 4FEBA 3Q26A 4OQOA 3TEPA 3T66A 3S9NC 5KDTA 3MW0A 2O6AA 3FJMA 1T0KA 3V89B 1RKMA 1XVXA 3C4MA 5I56A 3JYRA 4KYEA 2I0CA 2H5YA 2H99A 4ELRA 3O6GA 4LVQA 2XX8A 3IR1A 5JTYB 4H8JA 5CRYA 4KI0E 4YU0A 3K1NA 1OVBA 1NNKA 3PPOA 2RCBA 5HBCA 1UTBA 4HW8A 3O2AA 3TTNA 3LSFB 4NF5B 4YKJA 2R9JA 5AA3A 4OVJA 5CMBA 1UQWA 3SEWA 3H6TA 4RJZA 2PMSA 4YZZA 2QL3A 1Y4CA 2PT2A 1SW5A 1MXWA 1PBPA 2ESNA 1B6HA 3MWBA 1Y1MA 3FV1A 4HCYA 1LLSA 5KCJB 1VE4A 3HV1A 3K01A 1LAHE 1UIUA 4Z0IA 4G8MA 1OQHA 1EH3A 1O7TA 2OCUA 2B3BA 1MPDA 4F3BA 1R1NA 2P2AA 3H6WA 2B65A 2NXOA 4NF8B 3G3HA 3MVYA 3TTMA 1B5HA 1PC3A 4RK2A 2I3VA 3B6WA 2I3WA 3MP8A 3SEUA 1SDXA 3EHTA 2ZNSA 1PEBA 1NFTA 1IXCA 2V3TA 4NF6A 3FV2A 3IX1A 3K6VA 3FZVA 1QKAA 4TLMB 5CBSA 1IUDA 3N94A 2RCAA 3M3LA 3LSLA 3KOTA 3FXRA 3LC8A 4OHNA 4RK9A 1PB7A 4F22A 1B0HA 1FW0A 1P99A 2I58A 2F78A 2GHBA 1OLCA 3QUFA 3OOAA 3V8XB 3RPWA 1NNPA 3K00A 5FTIA 5I59B 1N76A 3TQWA 3PUZE 1A40A 3SESA 1ELJA 4Q5TA 2Q9TA 3UK4A 1GGGA 2FNCA 5FHMA 3PV0E 5TP9A 3PPRA 2I6EA 3U72A 2CZLA 3N6TA 1TWYA 2I49A 3G3FA 3TPAA 2QS3A 1MQJA 1XC1A 4R2BA 4GXAA 1M5FA 4YICA 3VXCA 1S7YA 1P1NA 2YPNA 4YB7A 1OIBA 3VV5A 2NOOA 1MXVA 1N7WA 4ZZAA 4FAJA 1B51A 4R74A 2O1MA 4X1BA 5AA2A 1LBCA 2GHAA 1QULA 2DVZA 5H8NA 3HPIA 2RINA 3KGCA 5JK4A 3ZS6A 3BFTA 3SERA 3UA8A 3A3CA 4QRZA 4XKQA 1JEUA 1GV8A 4LUBA 4YKKA 2F7CA 3QAXA 2F8DA 3OXNA 4IO2A 3C35A 4HTGA 1AOVA 3PUWE 4NWCA 2Y84A 2ZYMA 4R6KA 4EDPA 3Q27A 2DWHA 2Z8DA 4C1UA 5ISUA 2V3UA 3Q28A 5H8FB 1P1OA 4N13A 4IY6A 2AIXA 3UORA 1N04A 4R73A 3SKPA 3O6IA 1B0LA 3ZKKA 3TZAA 4MLVA 1UIVA 4KFQA 1FTMA 4EUOA 5DTBA 4R6YA 3G3GA 4GL0A 1VSOA 4GVOA 3CSBA 1AH5A 4G2ZA 3PD8A 4G8NA 2VHAA 3SEVA 4ISUA 2DWJA 2UVGA 1DPEA 1MY3A 2Y7WA 4HCWA 3C9HA 4Q0CA 1VR5A 4OZ9A 4MH5A 2AYSA 3VLWA 3PPQA 1SI0A 3ILUB 3T9UA 4IO6A 3OO7A 1N3WA 3MUQA 4E0WA 2VOZA 4X1DA 4ELOA 5I57B 4PFWA 3OD7A 2HAVA 4F3GA 2QS2A 3VLVA 4F2OA 4TLLB 5K2XA 1MXXA 1Y3PA 5AA1A 1B52A 4X48A 3OSRA 3O29A 5L9MA 4U1ZA 4DCXA 2Q89A 3KFMA 4YB6A 3PPPA 1ZBMA 1Z7ME 2QSXA 2VP1A 2V25A 4BLAA 3I3VA 3R7XA 3TTRA 1LAGE 2PVUA 3FVKA 3IOVA 1B9JA 3TDJA 3AXFA 5KCJA 3MBPA 3N26A 1A8FA 1ZIUA 4G4PA 2F7AA 1IITA 4NF4B 4G8HA 1A54A 2YJPA 1BKAA 2OWTA 3KEIA 2Z22A 4BDQA 2DVCA 4H8IA 1TXFA 2UYFA 5EHSA 4JXIA 5TU0A 3GBAA 1MQDA 3IOWA 5FHNA 3PGFA 4U4XA 2QMXA 4LA9A 4NF8A 3I5OA 3KBRA 4YMBA 1Y9UA 5A5XB 1O64A 4BDRA 1B40A 4YMAA 1JVXA 4JDFA 5EHMA 3FJGA 1QKBA 2O69A 3S9MC 4JWOA 3O6HA 4O3CA 4UACA 1A8EA 2ZYNA 1OQGA 5F1QA 3OENA 4IO3A 4EQ7A 2I4CA 4TQUQ 1FQDA 1LFGA 2G93A 5AA4B 1HSJA 1URGA 3D4CA 4EXKA 4X9TA 1DPPA 1MG1A 3WAFA 4NWDA 3DELB 1IXIA 4GD5A 1B5IA 5CI5A 4YKPA 4WEPA 4QFKA 3EPEA 3UN6A 4AB6A 1I6BA 4NE4A 2DWAA 4R75A 2DXYA 3EHSA 4OENA 4GFRA 4FJPA 4GQOA 1A55A 3TELA 2DXRA 2Q88A 2LAOA 3THIA 1QUJA 4RY1A 2HXWA 4N07A 2UVJA 2X7QA 4YAHX 1SW1A 3V5AA 2F36A 5B7DA 1MM7A 5CC2A 2V93A 4JWXA 1B7UA 1P1WA 2UVHA 1MXZA 1ZTYA 3TAJA 4ZEIA 5I2KB 2XXXA 3KSXA 4OTEA 3UP9A 4BDMA 2NWJA 3U94A 3RQTA 5KZTA 3G3IA 1BIYA 2XXPA 2I0BA 3IOUA 2ANJA 5H8QB 5I58A 1H3DA 4LZ7A 4ONYA 3E4RA 4ESXA 3S9LC 1FQCA 4PFTA 1B3LA 4GIZA 1LAFE 2GH9A 4HS7A 3W9WA 4Q30B 3CG3A 3IJXB 3S2VA 4F1YA 1O63A 3VLUA 3K4UA 1H43A 3O28A 1QVSA 2H98A 3GXAA 3RGYA 1MM6A 2HZLA 1IEJA 4EF1A 4WEDA 4QHQA 3TKDA 4MFIA 5CM6A 5B70A 1PB9A 3UIFA 5CMKA 5AE4A 1SI1A 3T9XB 3KJ7A 2ZYOA 4KHZE 3TUSA 3LUYA 1P1QA 4EQBA 5DVIA 5H8FA 4EQ9A 3C33A 1MY4A 4L17A 5CMMA 4C1TA 1R6ZA 3MPLA 4THIA 2QPQA 4RPNA 4XKRA 3IO4A 2HZKA 2XXQA 2E1SA 5IKBA 1B1HA 1POY1 1N84A 3K2DA 3B6QA 3BFUA 4F31B 3ZKLA 1EZ9A 4UA8A 4I62A 3L6HA 4DXUA 5DEXB 2A5TB 3CSGA 3H3GA 2Y7KA 4OESA 5I57A 2H4IA 1MQGA 3RY3A 4ZE8A 4FIMA 5IAIA 3LSXA 4JSOA 4QSEA 4QFNA 2DWIA 4KCCA 4GWOA 1MQHA 3N5LA 3OELA 4OEVA 3M8UA 3USDA 1JW4A 3DP4A 4R72A 1FQAA 4BDNA 5BUUA 4DZ1A 1RYXA 2ZNUA 3FVOA 3DP8A 3E13X 2QMWA 3DP6A 4G77A 4U22A 4H5GA 2ZMBA 2ZNTA 1MDQA 1GR2A 4ESWA 4H1XA 3FASA 5L8DA 4ZDMA 5DYHA 2QJEA 4NF4A 4R6HA 4K3FA 1LAXA 4QFPA 1LSTA 2PBWA 4DE8A 5I56B 2VD2A 4KPTA 2YLNA 5A5XA 1NL5A 3VVDA 4U21A 4KYDA 1AIVA 3MZ1A 1EU8A 1J1NA 2I4BA 3OSQA 2DE3A 3FVGA 1GTKA 3GBBA 1B05A 4BDOA 4IGRA 4LATA 3HN0A 4DIGA 1EZOA 4XTCQ 4OEUA 3IOTA 2OZZA 3K1PA 5H8HB 4R9GA 1SQYA 2Q2AA 4IO7A 4RYAA 1PDAA 1LBBA 2NUVA 4QF9A 4F1VA 3DM0A 4F19A 3A3UA 3TTLA 5I2NB 3ONMA 3KJTA 3HHGA 1ANFA 4AB5A 2UVIA 1H76A 1XOCA 5EYFA 3MPKA 2F6PA 4DXBA 2B3FA 2D21A 2FA7A 4G68B 1NKXA 4H6DA 3MZBA 2UYEA 3PMVA 3MC2A 4OWDA 3Q25A 1M5EA 4OXVA 3VXBA 2OBGA 2UXAA 3C34A 1FTJA 4RA1A 4ZEDA 2ONSA 1TT1A 2F6GA 4GL8A 3MP1A 1GVCA 1Z7NE 4ZEBA 1PBQA 4XKNA 5JTYA 2XXWA 2Y7RA 4KQPA 5DVJA 5H8SA 3FVNA 3B6TA 1IXGA 4IO4A 2ZXTA 2AL4A 1XT8A 4TOZA 2DOJA 4DDDA 3VVEA 4NF6B 4PQJA 2RC8A 1UTHB 3MJNA 3BKIB 3IK6B 4NF5A 1BLFA 5ICQA 4IB2A 2XXHA 4H65A 3ILTB 3HO7A 2H25A 3O66A 2THIA 1RYOA 3VFJA 1NNTA 4NMYA 2DS9A 3FUZA 4KR5A 1NH7A 1LB8A 1YAEA 3VE1B 4OFJA 4QSCA 1R9LA 2P0SA 4GOTA 3T22A 2Q2CA 2F97A 1B7ZA 3O97A 1OVTA 3K6XA 3B7DA 5FTHA 4U2RA 1SBPA 2XD2A 1YPNA 3U8QA 2XXUA 4JSDA 1B3HA 3C32A 2DE2A 4FE8A 4QFOA 4OYVA 3PMXA 1A7LA 3C31A 2IA4A 3QIMA 3EF7A 1SYIA 2XX7A 3PPNA 3TFLA 4LQ2A 1LGBC 4O3BA 5AA2B 4KD5A 4DXCA 1MY2A 4FEDA 3MVZA 3MVWA 5H8NB 3CVGA 1QUIA 1ZU0A 1VFDA 1URSA 3G3KA 1HSLA 5DEXA 2A5TA 3GLBA 4FATA 1XVYA 5ITOA 2OJTA 3RNNA 1MRPA 2D3IA 4BDLA 4ZS9A 3K02A 2X7PA 1SVXB 3KN7A 3U93A 4M4GA 3FXUA 4GLIA 1FQBA 3QK6A 3OO9A 4KYSA 2HCAA 4KCDA 1BTJA 4FORA 5I59A 2X26A 4XXUA 1NMUA 5K2YA 3W9VA 4FECA 2ONRA 4ELQA 3W15C 3TQLA 4DLDA 3KZGA 3IB0A 4Z7EA 4QFLA 2F35A 4M1VA 1B3GA 3FXQA 1BP5A 1B4ZA 3K6UA 4RXLA 1PB8A 1MH4A 3MZ9A 1ZMGA 1M5BA 4POWA 4ZECA 3KN8A 2H9BA 4NTLA 3M3FA 2Z8EA 2QS4A 1B4HA 4AQ4A 4F3SA 3E9XA 3A09A 1IXHA 1FCKA 1USYH 2REGA 3PD9A 1N3XA 3WAEA 4RNSA 4G68C 3R6UA 2O7IA 2W7YA 5JEIA 3EHUA 1LCFA 3CFZA 5TPAB 3FIRA 1JW5A 5H8HA 3IO6A 4MF3A 1XHYA 3PUYE 2ALUA 1D3KA 1ATGA 5I2NA 1LFHA 1B3FA 3PMWA 3T93B 4E0XA 2KLFA 3RTWB 1DOTA 1M5CA 4OFLA 4G68A 1CB6A 3BBRA 3EQ1A 3QYTA 4ZEKA 3G3JA 4WKMA 1IQ7A 4F39A 3E3KA 3D4GA 1TFDA 4ND9A 1S9TA 1TFAA 4U4SA 3U92A 1FQEA 3TCFA 5DT6A 4OETA 2R6GE 2RC9A 4LZ8A 5LOMA 3CIJA 3G7WA 5AA2D 3IL1B 3OEMA 4ZZEA 2NVUB 5HM4B 3RUMA 3Q29A 1UTHA 1M5DA 1DMBA 3V83A 3KOSA 1WVJA 4C0RA 4NEDA 2GRVA 3PU5A 1DTZA 1JEVA 2DSFA 2O1LA 4JWYA 3QSLA 1MQIA 2WKYA 3U1OA 1DSNA 4PETA 3ODBA 3P7IA 4I1DA 1I6AA 3TCHA 2OLBA 2O7UA 1YCJA 2XD3A 4F3PA 2OWSA 3K6WA 1N7XA 1FTKA 1JW1A 1MH3A 1YTVA 4LZ5A 2HFBA 3IAZA 3LSWA 4F18A 1WODA 4GRKA 3H06B 3HCQA 1Y4TA 4I8CA 1XS5A 1WDNA 1SW4A 2XXYA 5KDTB 1US5A 2HQ0A 4EXLA 1H44A 5ELVA 2A5SA 3HHFA 4F2QA 3FGSA 3L6GA 1EZPA 1D4NA 4ZE9A 3S9EA 1NH8A 4JBZA 1QUKA 3PUXE 2FYIA 3SDFA 5ITPA 1Q35A 3LR1A 2P1SA 4OFOA 3CR9A 2F34A 3ZSFA 1JETA 4XIGQ 2CMOA 3H4ZA 5J1DA 1D9VA 3M3KA 1F9BA 1LB9A 2V84A 3CG1A 5I58B 1B32A 1B2HA 1QW0A 2PT1A 2RKMA 3DLNA 2XXIA 3O9PA 3OMBA 4N6PA 4MBPA 2REJA 3H03A 1US4A 3FD3A 5AA4A 5DVFA 1D9YA 3I6VA 1FTLA 1UTBB 2O84X 4GXSB 3CFLA 4F1UA 1Y20A 2ONKE 3RTFB 1URDA 1Y1ZA 3H7MA 1L5TA 4U1OA 4OERA 1B58A 1MS7A 2OK2A 5FHOA 1MY0A 3LBSA 2DQVA 2XX9A 3T96B 3C36A 4QSDA 3IB1A 1JQFA 4LP2B 3SETA 1P1UA 1A99A 5L9OA 4H0WA 3RLFE 3VDFA 3T9HB 2RF1A 3IORA 4R2FA 1QJMA 2F7BA 1SYHA 4LONB 1HSEA 3MP6A 1OLAA 5CBRA 1R9QA 4XKPA 3UGWA 3IB2A 1B46A 1FTOA 3MAMA 1LCTA 2VGQA 5I2KA 4I9DA 2Y7PA 4ELPA 1ZLQA 1SD3A 1JVYA 1MY1A 5ICTA 3OEKA 4GF8A 4H67A 3TTKA 1Q1KA 5H8QA 4IY5A 4P11A 3QUJA 2HAUA 3SEYA 4ECFA 3GZGA 1JNFA 5M2VA 4O3AA 1B7HA 3JV9A 4EF2A 2IEEA 3RN8A 4POXA 1POTA 3F11A 2RC7A 1CE2A 2PYYA 3RT8A 2DYXA 4IO5A 3IJOB 2VD3A 3EN3A 4P0IA 5TPAA 1I6QA 4R9FA 3TYHA 3OO8A 3TMGA 1H45A 2HEUA 4P0GA 4PP0A 4OMBA 3CRBA 1Y3QA 3T9VA 2Q8JA 3TCGA 1MDP1 2I48A 1MXYA 2Z8FA 2Y7IA 4Q8RA 3QXMA 5L9SA 2XXVA 2XXTA 3MQ9A 2V3QA 1FQFA 3SEXA 4U23A 3PUVE 3K1MA 5TP9B 3HSTA 3H6VA 2DP8A 4PFUA 1S50A 1B3EA 1Y3NA 3CFXA 3KG2A 3TODA 1N0TA 4F29A 2DE4A 3K0VA 2M8CA 3ECRA 1ZKBA 2QS1A 2Z23A 4MLQA 3R26A 1KWHA 5HPQA 2O68A 2BJJX 3KN3A 3KSJA 1DTGA 1AMFA
chains in the Genus database with same CATH superfamily
2G29A 2D5WA 1USYE 3H6UA 1I69A 2ZYKA 2PX1A 1MXUA 4WXJA 2R71A 1MPCA 4YKIA 1NV7A 2O51A 1LFIA 4PFYA 5LTCA 5I84A 3JZJA 3RT6B 2GFEA 4JB7A 1IIWA 4PFRA 5CMCA 3OO6A 2F5XA 1ZJLA 1VFEA 1SW2A 4H5FA 3VVFA 2CZIA 4IGTA 4LQ5A 5EQ8A 1AL3A 1B5JA 4ZEFA 1B1XA 4YB5A 2ABHA 3MVXA 2QRYA 3ROJA 3S4UA 1II5A 1RDZA 4DCYA 4OVRA 2E0SA 5BWJA 4AS5A 3FJ7A 1OMPA 2XXRA 4PE5B 5F7VA 4AS4A 3N6UA 3FATA 3CI8A 2AL5A 1NNFA 3QMFA 2XHDA 1MPBA 4RPOA 1IZ1A 4FEBA 3Q26A 2B4MA 2PCRA 4OQOA 3TEPA 1NI9A 3T66A 3S9NC 5KDTA 3MW0A 2O6AA 3FJMA 1T0KA 5IZ3A 1INPA 1FBGA 3V89B 1RKMA 4O8MA 1XVXA 3C4MA 5IGAA 5I56A 2FHYA 5EYHA 3JYRA 1DCUA 4KYEA 2I0CA 3D1RA 2H5YA 2H99A 4ELRA 3O6GA 4LVQA 2WBBA 2XX8A 1EYKA 3IR1A 5JTYB 4H8JA 5CRYA 4KI0E 4YU0A 3KBZA 3K1NA 3T0JA 1OVBA 1NNKA 3PPOA 2RCBA 5HBCA 1UTBA 4HW8A 3O2AA 3TTNA 3LSFB 4NF5B 1FBCA 4YKJA 4NG7A 2R9JA 5AA3A 4OVJA 1LBYA 5CMBA 1UQWA 3SEWA 3H6TA 4RJZA 2PMSA 4YZZA 2QL3A 1FJ6A 1Y4CA 2PT2A 2QFLA 1SW5A 1MXWA 1PBPA 2ESNA 1B6HA 3MWBA 1Y1MA 3FV1A 4HCYA 1LLSA 5KCJB 2VPNA 1VE4A 3HV1A 3K01A 4I3EA 1LAHE 1UIUA 4Z0IA 4G8MA 1OQHA 2Y5KA 1EH3A 1O7TA 2OCUA 2B3BA 1MPDA 4F3BA 4N8YA 1R1NA 2P2AA 3H6WA 2OWZA 2B65A 2NXOA 4NF8B 1D9QA 3G3HA 3MVYA 3TTMA 1B5HA 1NUXA 1PC3A 4RK2A 2I3VA 3B6WA 2I3WA 3MP8A 3SEUA 1SDXA 3EHTA 2ZNSA 1PEBA 1NFTA 1IXCA 4P9KA 2V3TA 4NF6A 3FV2A 1NV2A 3RYDA 3IX1A 3K6VA 3FZVA 1QKAA 4TLMB 4PFIA 5CBSA 1IUDA 3N94A 2RCAA 4NN3A 4QXDA 3M3LA 3LSLA 3KOTA 3FXRA 3LC8A 4OHNA 2Q8MA 4RK9A 1PB7A 4F22A 1B0HA 1FW0A 1P99A 2I58A 2F78A 4JVDA 4FBPA 1NV4A 2GHBA 4HE2A 1OLCA 3QUFA 3OOAA 1KA0A 3V8XB 3RPWA 3CHGA 1NNPA 3K00A 5FTIA 4OVSA 5I59B 1N76A 3TQWA 3PUZE 1A40A 3SESA 1ELJA 3U65A 4Q5TA 2Q9TA 3UK4A 1GGGA 2FNCA 5FHMA 3PV0E 5TP9A 3E78A 3PPRA 2I6EA 2CZLA 3U72A 3N6TA 4XEQA 1TWYA 2I49A 3G3FA 3TPAA 2QS3A 1MQJA 1XC1A 4GX3A 4R2BA 4GXAA 1M5FA 2ZZVA 4YICA 3VXCA 1S7YA 1P1NA 2YPNA 4YB7A 1OIBA 3VV5A 2NOOA 1MXVA 1LEVA 1N7WA 4ZZAA 4FAJA 1B51A 4R74A 2O1MA 4X1BA 5AA2A 1LBCA 2GHAA 3GYYA 1QULA 2DVZA 5H8NA 3LUZA 3HPIA 4KXPA 2RINA 3KGCA 5JK4A 4P1EA 3ZS6A 3BFTA 3SERA 3UA8A 3A3CA 1FPGA 4QRZA 4XKQA 1JEUA 1GV8A 4LUBA 4YKKA 2F7CA 3QAXA 4MCOA 2F8DA 5ET8A 3OXNA 1AWBA 4IO2A 3C35A 4HTGA 1AOVA 3PUWE 4NWCA 2Y84A 4MMPA 2ZYMA 5ET5A 4R6KA 3IFAA 4EDPA 3Q27A 2DWHA 2Z8DA 4C1UA 5ISUA 3ISPA 2V3UA 3Q28A 5H8FB 1P1OA 4N13A 4IY6A 2AIXA 3UORA 4R73A 1N04A 3SKPA 3O6IA 4N6DA 1B0LA 3ZKKA 3TZAA 4MLVA 1UIVA 4XF5A 4KFQA 1FTMA 4EUOA 4PGNA 5DTBA 4R6YA 3G3GA 4GL0A 1VSOA 4GVOA 3IFCA 3CSBA 1AH5A 4G2ZA 5FBPA 1G0HA 3PD8A 4G8NA 2VHAA 4PCDA 4NGUA 3SEVA 4ISUA 4MX6A 2DWJA 4GWXA 2UVGA 1DPEA 1MY3A 2Y7WA 4HCWA 5J16A 3C9HA 4Q0CA 1VR5A 4OZ9A 4MH5A 2AYSA 3VLWA 3PPQA 1SI0A 3ILUB 3T9UA 4IO6A 3OO7A 1N3WA 3MUQA 4E0WA 2VOZA 4X1DA 4ELOA 5I57B 4PFWA 3OD7A 2HAVA 4F3GA 2QS2A 3VLVA 3E79A 4F2OA 4TLLB 5K2XA 1MXXA 4PFBA 1Y3PA 5AA1A 1B52A 4P47A 4X48A 3OSRA 3O29A 5L9MA 4U1ZA 4DCXA 3RPLA 2Q89A 3KFMA 4YB6A 3PPPA 1ZBMA 1RDXA 1Z7ME 2QSXA 2VP1A 2V25A 4BLAA 3I3VA 1FJ9A 3R7XA 3TTRA 1DK4A 1LAGE 2PVUA 3FVKA 3IOVA 1B9JA 3TDJA 3AXFA 5KCJA 3MBPA 3N26A 1A8FA 1ZIUA 2XWVA 4G4PA 2F7AA 1IITA 4NF4B 4G8HA 1A54A 1DBZA 2YJPA 1BKAA 2OWTA 3KEIA 2Z22A 4BDQA 2DVCA 4X04A 4H8IA 5DW8A 1TXFA 2UYFA 2WX9A 4JXIA 5EHSA 3GBAA 5TU0A 1MQDA 3IOWA 5FHNA 3PGFA 4U4XA 2QMXA 4LA9A 4NF8A 3I5OA 3KBRA 5IZ1A 1Y9UA 4YMBA 5A5XB 5ET7A 1O64A 4BDRA 1B40A 4YMAA 1JVXA 4GX4A 4JDFA 4O94A 5EHMA 3SZPA 4MAGA 4XFEA 3FJGA 4N15A 5A5LA 1QKBA 2O69A 3S9MC 4JWOA 1JP4A 3O6HA 4O3CA 4UACA 1A8EA 2ZYNA 1OQGA 3HFUA 5F1QA 3OENA 4IO3A 4EQ7A 2I4CA 4TQUQ 1FQDA 2PFYA 1LFGA 2G93A 5AA4B 1HSJA 1URGA 3D4CA 4EXKA 4X9TA 1DPPA 1IMEA 1MG1A 3WAFA 4NWDA 3B8BA 3DELB 1IXIA 4GD5A 1B5IA 5CI5A 4YKPA 4WEPA 4QFKA 3EPEA 3UN6A 4AB6A 1I6BA 4NE4A 2DWAA 4N91A 4R75A 2DXYA 3EHSA 4OENA 4GFRA 4FJPA 4GQOA 1A55A 4NHBA 3TELA 2DXRA 4HE1A 4OA4A 2Q88A 2LAOA 2PFZA 3THIA 1QUJA 5EQ7A 4RY1A 2HXWA 4N07A 2UVJA 2X7QA 4YAHX 1SW1A 3V5AA 2F36A 5B7DA 1MM7A 5CC2A 2V93A 4JWXA 1B7UA 1P1WA 2UVHA 1MXZA 1ZTYA 3TAJA 4ZEIA 5I2KB 2XXXA 5EQAA 4OTEA 3KSXA 3UP9A 4BDMA 2NWJA 3U94A 3RQTA 5KZTA 3G3IA 1KZ8A 1BIYA 1FPDA 2XXPA 2I0BA 3IOUA 2ANJA 5H8QB 5IZZA 5I58A 1H3DA 2BJIA 4LZ7A 4ONYA 3E4RA 4ESXA 3S9LC 1FPJA 1FQCA 4PFTA 4GWUA 1B3LA 4GIZA 1LAFE 2GH9A 4HS7A 3W9WA 5LDZA 4Q30B 3CG3A 3IJXB 3S2VA 4F1YA 1O63A 4N8GA 4N6KA 3VLUA 1BK4A 3K4UA 1H43A 4NX1A 3O28A 1QVSA 2H98A 4GBVA 3GXAA 3RGYA 1MM6A 2HZLA 1IEJA 4EF1A 4WEDA 4QHQA 3TKDA 4MFIA 5CM6A 5B70A 4PF8A 1PB9A 3UIFA 2QVVA 5CMKA 5AE4A 1SI1A 3T9XB 5F24A 3KJ7A 2ZYOA 4KHZE 2HPGA 3TUSA 3LUYA 1P1QA 4EQBA 5DVIA 5H8FA 3FBPA 4EQ9A 3C33A 3FXBA 1MY4A 4L17A 1FPFA 5CMMA 2XA5A 5IM2A 4C1TA 1R6ZA 3MPLA 4THIA 2QPQA 4PF6A 4RPNA 4XKRA 3IO4A 2HZKA 2XXQA 1FBFA 2E1SA 5IKBA 1B1HA 1POY1 1FSAA 1N84A 3A29A 3K2DA 3B6QA 2XXKA 3BFUA 4F31B 3ZKLA 2L5VA 1EZ9A 4UA8A 2JJKA 4I62A 1SPIA 3L6HA 4DXUA 5DEXB 2A5TB 3CSGA 3H3GA 2Y7KA 4OESA 5I57A 2H4IA 1MQGA 3RY3A 4ZE8A 4FIMA 5IAIA 3LSXA 4JSOA 2FVZA 2FBPA 4QSEA 4QFNA 2DWIA 4JVCA 4KCCA 4OVQA 4GWOA 1MQHA 3N5LA 3OELA 4OEVA 4OVPA 3M8UA 3USDA 1JW4A 3DP4A 4NF0A 5EYGA 2CEXA 4R72A 1FQAA 4BDNA 5BUUA 4DZ1A 1RYXA 2ZNUA 3FVOA 3DP8A 3E13X 3BIGA 2DDKA 2F3DA 2QMWA 2HHMA 3DP6A 4G77A 4U22A 4H5GA 2ZMBA 2ZNTA 1MDQA 1GR2A 4ESWA 4H1XA 3FASA 5L8DA 4ZDMA 5DYHA 2QJEA 4NF4A 4R6HA 2R8TA 4K3FA 1LAXA 1CNQA 1EYJA 4QFPA 1LSTA 1YXIA 2PBWA 4DE8A 5I56B 2VD2A 4KPTA 1NV5A 2YLNA 5A5XA 2WEFA 1NL5A 3VVDA 4U21A 4KYDA 1AIVA 4I40A 3MZ1A 1EU8A 1J1NA 2I4BA 1NV0A 3OSQA 2DE3A 3FVGA 1GTKA 3GBBA 1B05A 4BDOA 4IGRA 4LATA 3HN0A 4DIGA 1EZOA 4XTCQ 4OEUA 3IOTA 2OZZA 3K1PA 5H8HB 4R9GA 1SQYA 2Q2AA 4IO7A 4RYAA 1PDAA 1LBBA 3B50A 2NUVA 4QF9A 4F1VA 3DM0A 4F19A 3A3UA 3TTLA 5I2NB 3KC0A 3ONMA 3KJTA 4G61A 3HHGA 1ANFA 4AB5A 2UVIA 1H76A 1XOCA 5EYFA 3MPKA 2F6PA 4DXBA 2B3FA 2D21A 4JVIA 2FA7A 3EKIA 4G68B 1NKXA 4H46A 4H6DA 3MZBA 4PBHA 2UYEA 3PMVA 3MC2A 4OWDA 3Q25A 1M5EA 4OXVA 3VXBA 2OBGA 2UXAA 3C34A 1FTJA 4RA1A 4ZEDA 2ONSA 1TT1A 2VT5A 2F6GA 4PGPA 4GL8A 3MP1A 1GVCA 1Z7NE 4ZEBA 1PBQA 4XKNA 5JTYA 2XXWA 2Y7RA 1NUWA 2XWKA 4KQPA 5DVJA 5H8SA 3FVNA 3B6TA 1IXGA 4I3YA 4IO4A 2ZXTA 2MKZA 2AL4A 1FTAA 1XT8A 2QVUA 4TOZA 2DOJA 3VVEA 4DDDA 4NF6B 4MEVA 4PQJA 1NV3A 2RC8A 1LBWA 1UTHB 3MJNA 1FBDA 3BKIB 3IK6B 4NF5A 1BLFA 5ICQA 4IB2A 4O7MA 2XXHA 4H65A 4GWWA 4PAIA 3ILTB 2XWIA 3HO7A 2H25A 3O66A 2THIA 1RYOA 3VFJA 1NNTA 4NMYA 2DS9A 3FUZA 4KR5A 1NH7A 1LB8A 1YAEA 3VE1B 4OFJA 4QSCA 4GX6A 1R9LA 2P0SA 4GOTA 1FPIA 3T22A 2Q2CA 2F97A 1B7ZA 3O97A 1OVTA 3K6XA 3B7DA 5FTHA 4PBQA 4U2RA 2XWOA 4HXVA 1SBPA 2XD2A 1YPNA 4NAPA 3U8QA 2XXUA 4JSDA 1B3HA 3C32A 2DE2A 4FE8A 4QFOA 4OYVA 3PMXA 1A7LA 3C31A 2IA4A 3QIMA 4DI3D 3EF7A 1SYIA 2XX7A 3PPNA 2WBDA 3TFLA 4LQ2A 1LGBC 4O3BA 1FRPA 5ESYA 2KQZA 5AA2B 4KD5A 4DXCA 1MY2A 4FEDA 3MVZA 3MVWA 3LV0A 5H8NB 3CVGA 1QUIA 1ZU0A 1VFDA 1URSA 5I7IA 3G3KA 1HSLA 5DEXA 2A5TA 3GLBA 4FATA 1XVYA 5ITOA 2OJTA 3RNNA 1MRPA 2D3IA 4BDLA 4ZS9A 3K02A 4DI4B 1IMCA 2X7PA 1SVXB 3KN7A 3U93A 4M4GA 3FXUA 4IR8A 4GLIA 1FQBA 3QK6A 4GWSA 4MIJA 3OO9A 4KYSA 2HCAA 4PAKA 4KCDA 1NV6A 1BTJA 4FORA 5I59A 2X26A 4XXUA 1NMUA 3BIHA 4GWYA 2VPOA 5K2YA 3W9VA 4FECA 2ONRA 1VDWA 2OX3A 4ELQA 3W15C 3TQLA 4DLDA 3KZGA 1KA1A 3IB0A 4Z7EA 4QFLA 1IMFA 2F35A 4M1VA 1B3GA 3FXQA 1BP5A 1B4ZA 3K6UA 4RXLA 1PB8A 1MH4A 3MZ9A 1ZMGA 1M5BA 2WYKA 4POWA 4ZECA 3KN8A 2H9BA 4NTLA 1EYIA 2CEYA 3M3FA 4PTKA 2Z8EA 4H45A 1G0IA 2QS4A 1B4HA 4AQ4A 4F3SA 3E9XA 4PDDA 1NV1A 4GWZA 3A09A 1IXHA 1FCKA 3PTYA 1USYH 2REGA 5I5PA 3PD9A 1N3XA 3WAEA 4RNSA 4G68C 3R6UA 2FIEA 2O7IA 2W7YA 5JEIA 3EHUA 1LCFA 3CFZA 5TPAB 3FIRA 1JW5A 5H8HA 3IO6A 4MF3A 1XHYA 3PUYE 2ALUA 1D3KA 1ATGA 5I2NA 1LFHA 1B3FA 3RPLB 3PMWA 3T93B 1K9ZA 4E0XA 1NUZA 2KLFA 3RTWB 1DOTA 1M5CA 4OFLA 4G68A 1CB6A 3BBRA 3EQ1A 3QYTA 4ZEKA 3G3JA 2Q74A 4WKMA 4NQ8A 4N81A 1IQ7A 4F39A 3E3KA 3D4GA 4O7IA 2P3NA 1TFDA 4ND9A 1S9TA 1FBHA 1YZ0A 1TFAA 5ET6A 4U4SA 3U92A 1FQEA 3TCFA 5DT6A 4OETA 4PAFA 2R6GE 2RC9A 2Y5LA 4LZ8A 5LOMA 3CIJA 3G7WA 5AA2D 4UABA 3IL1B 3OEMA 4ZZEA 2NVUB 5HM4B 3RUMA 3Q29A 1UTHA 1M5DA 1DMBA 3V83A 3KOSA 1WVJA 4C0RA 4NEDA 2GRVA 3PU5A 1DTZA 1JEVA 2DSFA 2O1LA 4JWYA 3QSLA 1MQIA 2WKYA 4P8BA 3U1OA 1DSNA 4PETA 3ODBA 3NOHA 3P7IA 1LBXA 4I1DA 1I6AA 3TCHA 2OLBA 2O7UA 1YCJA 2XD3A 4F3PA 2OWSA 3K6WA 1N7XA 1FTKA 1JW1A 1MH3A 1Q9DA 1YTVA 4LZ5A 2HFBA 3IAZA 3LSWA 4F18A 1WODA 4GRKA 3H06B 3HCQA 1Y4TA 4I8CA 1XS5A 1WDNA 1SW4A 2XXYA 5KDTB 1US5A 2HQ0A 4EXLA 1H44A 5ELVA 4GBWA 5IZ3B 2A5SA 3HHFA 4F2QA 3FGSA 3L6GA 1EZPA 1D4NA 4P3LA 4ZE9A 3S9EA 1NH8A 4JBZA 1QUKA 3PUXE 2FYIA 3SDFA 5ITPA 1Q35A 3LR1A 2P1SA 4OFOA 2WYPA 2F34A 3CR9A 3ZSFA 1JETA 4XIGQ 2CMOA 3H4ZA 5J1DA 1D9VA 3M3KA 1F9BA 1LB9A 2V84A 3CG1A 5I58B 1B32A 2ZZWA 1B2HA 1QW0A 2PT1A 4PC9A 2HXRA 4MNIA 2RKMA 3DLNA 2XXIA 3O9PA 3OMBA 4N6PA 4MBPA 5I3SA 2FIXA 1FPEA 2REJA 3H03A 4MHFA 3MSTA 1US4A 4LN5A 3FD3A 5AA4A 5DVFA 1D9YA 3I6VA 1FTLA 1UTBB 2O84X 4GXSB 3CFLA 4F1UA 1Y20A 2ONKE 3RTFB 1URDA 4PE3A 1Y1ZA 3H7MA 1L5TA 4U1OA 4OERA 1LBVA 1B58A 1MS7A 2OK2A 5FHOA 1MY0A 1FBPA 3LBSA 1IMDA 2DQVA 1QGXA 1FBEA 3MYUA 4QBAA 2XX9A 3T96B 3C36A 4QSDA 3IB1A 1JQFA 4LP2B 3SETA 1P1UA 1A99A 5L9OA 4H0WA 3RLFE 2V4CA 3VDFA 1RDYA 2P3VA 3T9HB 2RF1A 3IORA 4OANA 4R2FA 1QJMA 2F7BA 4P56A 1SYHA 4LONB 1HSEA 3MP6A 1OLAA 5CBRA 1R9QA 4XKPA 3UGWA 3IB2A 1B46A 1FTOA 3MAMA 1LCTA 2VGQA 4MJOA 5I2KA 4I9DA 2Y7PA 4ELPA 1ZLQA 1SD3A 5T3JA 1JVYA 1MY1A 5ICTA 3OEKA 4GF8A 4H67A 1XI6A 3TTKA 1Q1KA 5H8QA 4IY5A 4P11A 3QUJA 1FPKA 2HAUA 3SEYA 4ECFA 1FPBA 3GZGA 1JNFA 5M2VA 4OVTA 4O3AA 1B7HA 1K9YA 3JV9A 4EF2A 2IEEA 3RN8A 4POXA 1POTA 2CZKA 3F11A 1FPLA 2RC7A 1CE2A 2PYYA 3RT8A 2DYXA 4IO5A 3IJOB 4MNCA 2VD3A 3EN3A 4MNPA 1IMBA 4P0IA 2CZHA 4HE0A 5TPAA 1I6QA 4R9FA 3TYHA 2F3BA 4X8RA 3OO8A 3TMGA 1H45A 2HEUA 4P0GA 4PP0A 4OMBA 3CRBA 1Y3QA 4N17A 3T9VA 4N4UA 2Q8JA 3TCGA 2KR0A 4P1LA 2ZZXA 1MDP1 2I48A 1NUYA 1LBZA 1MXYA 2Z8FA 2Y7IA 4Q8RA 3QXMA 4PDHA 5L9SA 2XXVA 2B4LA 3KC1A 2XXTA 3MQ9A 1YYZA 2V3QA 1FQFA 4U23A 3SEXA 3PUVE 3K1MA 5TP9B 3HSTA 3H6VA 2DP8A 4PFUA 1S50A 1B3EA 2QVRA 1Y3NA 3CFXA 3KG2A 3TODA 1IMAA 5EQ9A 1N0TA 4F29A 2DE4A 3K0VA 2M8CA 3ECRA 1ZKBA 3T1BA 2QS1A 2Z23A 4MLQA 2GQ1A 3R26A 1KWHA 5HPQA 2O68A 2BJJX 3KN3A 3KSJA 1DTGA 1AMFA
chains in the Genus database with same CATH topology
2G29A 2D5WA 1USYE 3H6UA 1I69A 2ZYKA 2PX1A 1MXUA 4WXJA 2R71A 1MPCA 4YKIA 2O51A 1LFIA 4PFYA 5I84A 3JZJA 3RT6B 2GFEA 4JB7A 1IIWA 5CMCA 3OO6A 2F5XA 1ZJLA 1VFEA 1SW2A 4H5FA 3VVFA 4IGTA 4LQ5A 1AL3A 1B5JA 4ZEFA 1B1XA 4YB5A 2ABHA 3MVXA 2QRYA 3S4UA 1II5A 4DCYA 2E0SA 5BWJA 3FJ7A 1OMPA 2XXRA 4PE5B 5F7VA 3N6UA 3FATA 3CI8A 2AL5A 1NNFA 2XHDA 1MPBA 4RPOA 1IZ1A 4FEBA 3Q26A 4OQOA 3TEPA 3T66A 3S9NC 5KDTA 3MW0A 2O6AA 3FJMA 1T0KA 3V89B 1RKMA 1XVXA 3C4MA 5I56A 3JYRA 4KYEA 2I0CA 2H5YA 2H99A 4ELRA 3O6GA 4LVQA 2XX8A 3IR1A 5JTYB 4H8JA 5CRYA 4KI0E 4YU0A 3K1NA 1OVBA 1NNKA 3PPOA 2RCBA 5HBCA 1UTBA 4HW8A 3O2AA 3TTNA 3LSFB 4NF5B 4YKJA 2R9JA 5AA3A 4OVJA 5CMBA 1UQWA 3SEWA 3H6TA 4RJZA 2PMSA 4YZZA 2QL3A 1Y4CA 2PT2A 1SW5A 1MXWA 1PBPA 2ESNA 1B6HA 3MWBA 1Y1MA 3FV1A 4HCYA 1LLSA 5KCJB 1VE4A 3HV1A 3K01A 1LAHE 1UIUA 4Z0IA 4G8MA 1OQHA 1EH3A 1O7TA 2OCUA 2B3BA 1MPDA 4F3BA 1R1NA 2P2AA 3H6WA 2B65A 2NXOA 4NF8B 3G3HA 3MVYA 3TTMA 1B5HA 1PC3A 4RK2A 2I3VA 3B6WA 2I3WA 3MP8A 3SEUA 1SDXA 3EHTA 2ZNSA 1PEBA 1NFTA 1IXCA 2V3TA 4NF6A 3FV2A 3IX1A 3K6VA 3FZVA 1QKAA 4TLMB 5CBSA 1IUDA 3N94A 2RCAA 3M3LA 3LSLA 3KOTA 3FXRA 3LC8A 4OHNA 4RK9A 1PB7A 4F22A 1B0HA 1FW0A 1P99A 2I58A 2F78A 2GHBA 1OLCA 3QUFA 3OOAA 3V8XB 3RPWA 1NNPA 3K00A 5FTIA 5I59B 1N76A 3TQWA 3PUZE 1A40A 3SESA 1ELJA 4Q5TA 2Q9TA 3UK4A 1GGGA 2FNCA 5FHMA 3PV0E 5TP9A 3PPRA 2I6EA 3U72A 2CZLA 3N6TA 1TWYA 2I49A 3G3FA 3TPAA 2QS3A 1MQJA 1XC1A 4R2BA 4GXAA 1M5FA 4YICA 3VXCA 1S7YA 1P1NA 2YPNA 4YB7A 1OIBA 3VV5A 2NOOA 1MXVA 1N7WA 4ZZAA 4FAJA 1B51A 4R74A 2O1MA 4X1BA 5AA2A 1LBCA 2GHAA 1QULA 2DVZA 5H8NA 3HPIA 2RINA 3KGCA 5JK4A 3ZS6A 3BFTA 3SERA 3UA8A 3A3CA 4QRZA 4XKQA 1JEUA 1GV8A 4LUBA 4YKKA 2F7CA 3QAXA 2F8DA 3OXNA 4IO2A 3C35A 4HTGA 1AOVA 3PUWE 4NWCA 2Y84A 2ZYMA 4R6KA 4EDPA 3Q27A 2DWHA 2Z8DA 4C1UA 5ISUA 2V3UA 3Q28A 5H8FB 1P1OA 4N13A 4IY6A 2AIXA 3UORA 1N04A 4R73A 3SKPA 3O6IA 1B0LA 3ZKKA 3TZAA 4MLVA 1UIVA 4KFQA 1FTMA 4EUOA 5DTBA 4R6YA 3G3GA 4GL0A 1VSOA 4GVOA 3CSBA 1AH5A 4G2ZA 3PD8A 4G8NA 2VHAA 3SEVA 4ISUA 2DWJA 2UVGA 1DPEA 1MY3A 2Y7WA 4HCWA 3C9HA 4Q0CA 1VR5A 4OZ9A 4MH5A 2AYSA 3VLWA 3PPQA 1SI0A 3ILUB 3T9UA 4IO6A 3OO7A 1N3WA 3MUQA 4E0WA 2VOZA 4X1DA 4ELOA 5I57B 4PFWA 3OD7A 2HAVA 4F3GA 2QS2A 3VLVA 4F2OA 4TLLB 5K2XA 1MXXA 1Y3PA 5AA1A 1B52A 4X48A 3OSRA 3O29A 5L9MA 4U1ZA 4DCXA 2Q89A 3KFMA 4YB6A 3PPPA 1ZBMA 1Z7ME 2QSXA 2VP1A 2V25A 4BLAA 3I3VA 3R7XA 3TTRA 1LAGE 2PVUA 3FVKA 3IOVA 1B9JA 3TDJA 3AXFA 5KCJA 3MBPA 3N26A 1A8FA 1ZIUA 4G4PA 2F7AA 1IITA 4NF4B 4G8HA 1A54A 2YJPA 1BKAA 2OWTA 3KEIA 2Z22A 4BDQA 2DVCA 4H8IA 1TXFA 2UYFA 5EHSA 4JXIA 5TU0A 3GBAA 1MQDA 3IOWA 5FHNA 3PGFA 4U4XA 2QMXA 4LA9A 4NF8A 3I5OA 3KBRA 4YMBA 1Y9UA 5A5XB 1O64A 4BDRA 1B40A 4YMAA 1JVXA 4JDFA 5EHMA 3FJGA 1QKBA 2O69A 3S9MC 4JWOA 3O6HA 4O3CA 4UACA 1A8EA 2ZYNA 1OQGA 5F1QA 3OENA 4IO3A 4EQ7A 2I4CA 4TQUQ 1FQDA 1LFGA 2G93A 5AA4B 1HSJA 1URGA 3D4CA 4EXKA 4X9TA 1DPPA 1MG1A 3WAFA 4NWDA 3DELB 1IXIA 4GD5A 1B5IA 5CI5A 4YKPA 4WEPA 4QFKA 3EPEA 3UN6A 4AB6A 1I6BA 4NE4A 2DWAA 4R75A 2DXYA 3EHSA 4OENA 4GFRA 4FJPA 4GQOA 1A55A 3TELA 2DXRA 2Q88A 2LAOA 3THIA 1QUJA 4RY1A 2HXWA 4N07A 2UVJA 2X7QA 4YAHX 1SW1A 3V5AA 2F36A 5B7DA 1MM7A 5CC2A 2V93A 4JWXA 1B7UA 1P1WA 2UVHA 1MXZA 1ZTYA 3TAJA 4ZEIA 5I2KB 2XXXA 3KSXA 4OTEA 3UP9A 4BDMA 2NWJA 3U94A 3RQTA 5KZTA 3G3IA 1BIYA 2XXPA 2I0BA 3IOUA 2ANJA 5H8QB 5I58A 1H3DA 4LZ7A 4ONYA 3E4RA 4ESXA 3S9LC 1FQCA 4PFTA 1B3LA 4GIZA 1LAFE 2GH9A 4HS7A 3W9WA 4Q30B 3CG3A 3IJXB 3S2VA 4F1YA 1O63A 3VLUA 3K4UA 1H43A 3O28A 1QVSA 2H98A 3GXAA 3RGYA 1MM6A 2HZLA 1IEJA 4EF1A 4WEDA 4QHQA 3TKDA 4MFIA 5CM6A 5B70A 1PB9A 3UIFA 5CMKA 5AE4A 1SI1A 3T9XB 3KJ7A 2ZYOA 4KHZE 3TUSA 3LUYA 1P1QA 4EQBA 5DVIA 5H8FA 4EQ9A 3C33A 1MY4A 4L17A 5CMMA 4C1TA 1R6ZA 3MPLA 4THIA 2QPQA 4RPNA 4XKRA 3IO4A 2HZKA 2XXQA 2E1SA 5IKBA 1B1HA 1POY1 1N84A 3K2DA 3B6QA 3BFUA 4F31B 3ZKLA 1EZ9A 4UA8A 4I62A 3L6HA 4DXUA 5DEXB 2A5TB 3CSGA 3H3GA 2Y7KA 4OESA 5I57A 2H4IA 1MQGA 3RY3A 4ZE8A 4FIMA 5IAIA 3LSXA 4JSOA 4QSEA 4QFNA 2DWIA 4KCCA 4GWOA 1MQHA 3N5LA 3OELA 4OEVA 3M8UA 3USDA 1JW4A 3DP4A 4R72A 1FQAA 4BDNA 5BUUA 4DZ1A 1RYXA 2ZNUA 3FVOA 3DP8A 3E13X 2QMWA 3DP6A 4G77A 4U22A 4H5GA 2ZMBA 2ZNTA 1MDQA 1GR2A 4ESWA 4H1XA 3FASA 5L8DA 4ZDMA 5DYHA 2QJEA 4NF4A 4R6HA 4K3FA 1LAXA 4QFPA 1LSTA 2PBWA 4DE8A 5I56B 2VD2A 4KPTA 2YLNA 5A5XA 1NL5A 3VVDA 4U21A 4KYDA 1AIVA 3MZ1A 1EU8A 1J1NA 2I4BA 3OSQA 2DE3A 3FVGA 1GTKA 3GBBA 1B05A 4BDOA 4IGRA 4LATA 3HN0A 4DIGA 1EZOA 4XTCQ 4OEUA 3IOTA 2OZZA 3K1PA 5H8HB 4R9GA 1SQYA 2Q2AA 4IO7A 4RYAA 1PDAA 1LBBA 2NUVA 4QF9A 4F1VA 3DM0A 4F19A 3A3UA 3TTLA 5I2NB 3ONMA 3KJTA 3HHGA 1ANFA 4AB5A 2UVIA 1H76A 1XOCA 5EYFA 3MPKA 2F6PA 4DXBA 2B3FA 2D21A 2FA7A 4G68B 1NKXA 4H6DA 3MZBA 2UYEA 3PMVA 3MC2A 4OWDA 3Q25A 1M5EA 4OXVA 3VXBA 2OBGA 2UXAA 3C34A 1FTJA 4RA1A 4ZEDA 2ONSA 1TT1A 2F6GA 4GL8A 3MP1A 1GVCA 1Z7NE 4ZEBA 1PBQA 4XKNA 5JTYA 2XXWA 2Y7RA 4KQPA 5DVJA 5H8SA 3FVNA 3B6TA 1IXGA 4IO4A 2ZXTA 2AL4A 1XT8A 4TOZA 2DOJA 4DDDA 3VVEA 4NF6B 4PQJA 2RC8A 1UTHB 3MJNA 3BKIB 3IK6B 4NF5A 1BLFA 5ICQA 4IB2A 2XXHA 4H65A 3ILTB 3HO7A 2H25A 3O66A 2THIA 1RYOA 3VFJA 1NNTA 4NMYA 2DS9A 3FUZA 4KR5A 1NH7A 1LB8A 1YAEA 3VE1B 4OFJA 4QSCA 1R9LA 2P0SA 4GOTA 3T22A 2Q2CA 2F97A 1B7ZA 3O97A 1OVTA 3K6XA 3B7DA 5FTHA 4U2RA 1SBPA 2XD2A 1YPNA 3U8QA 2XXUA 4JSDA 1B3HA 3C32A 2DE2A 4FE8A 4QFOA 4OYVA 3PMXA 1A7LA 3C31A 2IA4A 3QIMA 3EF7A 1SYIA 2XX7A 3PPNA 3TFLA 4LQ2A 1LGBC 4O3BA 5AA2B 4KD5A 4DXCA 1MY2A 4FEDA 3MVZA 3MVWA 5H8NB 3CVGA 1QUIA 1ZU0A 1VFDA 1URSA 3G3KA 1HSLA 5DEXA 2A5TA 3GLBA 4FATA 1XVYA 5ITOA 2OJTA 3RNNA 1MRPA 2D3IA 4BDLA 4ZS9A 3K02A 2X7PA 1SVXB 3KN7A 3U93A 4M4GA 3FXUA 4GLIA 1FQBA 3QK6A 3OO9A 4KYSA 2HCAA 4KCDA 1BTJA 4FORA 5I59A 2X26A 4XXUA 1NMUA 5K2YA 3W9VA 4FECA 2ONRA 4ELQA 3W15C 3TQLA 4DLDA 3KZGA 3IB0A 4Z7EA 4QFLA 2F35A 4M1VA 1B3GA 3FXQA 1BP5A 1B4ZA 3K6UA 4RXLA 1PB8A 1MH4A 3MZ9A 1ZMGA 1M5BA 4POWA 4ZECA 3KN8A 2H9BA 4NTLA 3M3FA 2Z8EA 2QS4A 1B4HA 4AQ4A 4F3SA 3E9XA 3A09A 1IXHA 1FCKA 1USYH 2REGA 3PD9A 1N3XA 3WAEA 4RNSA 4G68C 3R6UA 2O7IA 2W7YA 5JEIA 3EHUA 1LCFA 3CFZA 5TPAB 3FIRA 1JW5A 5H8HA 3IO6A 4MF3A 1XHYA 3PUYE 2ALUA 1D3KA 1ATGA 5I2NA 1LFHA 1B3FA 3PMWA 3T93B 4E0XA 2KLFA 3RTWB 1DOTA 1M5CA 4OFLA 4G68A 1CB6A 3BBRA 3EQ1A 3QYTA 4ZEKA 3G3JA 4WKMA 1IQ7A 4F39A 3E3KA 3D4GA 1TFDA 4ND9A 1S9TA 1TFAA 4U4SA 3U92A 1FQEA 3TCFA 5DT6A 4OETA 2R6GE 2RC9A 4LZ8A 5LOMA 3CIJA 3G7WA 5AA2D 3IL1B 3OEMA 4ZZEA 2NVUB 5HM4B 3RUMA 3Q29A 1UTHA 1M5DA 1DMBA 3V83A 3KOSA 1WVJA 4C0RA 4NEDA 2GRVA 3PU5A 1DTZA 1JEVA 2DSFA 2O1LA 4JWYA 3QSLA 1MQIA 2WKYA 3U1OA 1DSNA 4PETA 3ODBA 3P7IA 4I1DA 1I6AA 3TCHA 2OLBA 2O7UA 1YCJA 2XD3A 4F3PA 2OWSA 3K6WA 1N7XA 1FTKA 1JW1A 1MH3A 1YTVA 4LZ5A 2HFBA 3IAZA 3LSWA 4F18A 1WODA 4GRKA 3H06B 3HCQA 1Y4TA 4I8CA 1XS5A 1WDNA 1SW4A 2XXYA 5KDTB 1US5A 2HQ0A 4EXLA 1H44A 5ELVA 2A5SA 3HHFA 4F2QA 3FGSA 3L6GA 1EZPA 1D4NA 4ZE9A 3S9EA 1NH8A 4JBZA 1QUKA 3PUXE 2FYIA 3SDFA 5ITPA 1Q35A 3LR1A 2P1SA 4OFOA 3CR9A 2F34A 3ZSFA 1JETA 4XIGQ 2CMOA 3H4ZA 5J1DA 1D9VA 3M3KA 1F9BA 1LB9A 2V84A 3CG1A 5I58B 1B32A 1B2HA 1QW0A 2PT1A 2RKMA 3DLNA 2XXIA 3O9PA 3OMBA 4N6PA 4MBPA 2REJA 3H03A 1US4A 3FD3A 5AA4A 5DVFA 1D9YA 3I6VA 1FTLA 1UTBB 2O84X 4GXSB 3CFLA 4F1UA 1Y20A 2ONKE 3RTFB 1URDA 1Y1ZA 3H7MA 1L5TA 4U1OA 4OERA 1B58A 1MS7A 2OK2A 5FHOA 1MY0A 3LBSA 2DQVA 2XX9A 3T96B 3C36A 4QSDA 3IB1A 1JQFA 4LP2B 3SETA 1P1UA 1A99A 5L9OA 4H0WA 3RLFE 3VDFA 3T9HB 2RF1A 3IORA 4R2FA 1QJMA 2F7BA 1SYHA 4LONB 1HSEA 3MP6A 1OLAA 5CBRA 1R9QA 4XKPA 3UGWA 3IB2A 1B46A 1FTOA 3MAMA 1LCTA 2VGQA 5I2KA 4I9DA 2Y7PA 4ELPA 1ZLQA 1SD3A 1JVYA 1MY1A 5ICTA 3OEKA 4GF8A 4H67A 3TTKA 1Q1KA 5H8QA 4IY5A 4P11A 3QUJA 2HAUA 3SEYA 4ECFA 3GZGA 1JNFA 5M2VA 4O3AA 1B7HA 3JV9A 4EF2A 2IEEA 3RN8A 4POXA 1POTA 3F11A 2RC7A 1CE2A 2PYYA 3RT8A 2DYXA 4IO5A 3IJOB 2VD3A 3EN3A 4P0IA 5TPAA 1I6QA 4R9FA 3TYHA 3OO8A 3TMGA 1H45A 2HEUA 4P0GA 4PP0A 4OMBA 3CRBA 1Y3QA 3T9VA 2Q8JA 3TCGA 1MDP1 2I48A 1MXYA 2Z8FA 2Y7IA 4Q8RA 3QXMA 5L9SA 2XXVA 2XXTA 3MQ9A 2V3QA 1FQFA 3SEXA 4U23A 3PUVE 3K1MA 5TP9B 3HSTA 3H6VA 2DP8A 4PFUA 1S50A 1B3EA 1Y3NA 3CFXA 3KG2A 3TODA 1N0TA 4F29A 2DE4A 3K0VA 2M8CA 3ECRA 1ZKBA 2QS1A 2Z23A 4MLQA 3R26A 1KWHA 5HPQA 2O68A 2BJJX 3KN3A 3KSJA 1DTGA 1AMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G29 A;  2D5W A;  1USY E;  3H6U A;  1I69 A;  2ZYK A;  2PX1 A;  1MXU A;  4WXJ A;  2R71 A;  1MPC A;  4YKI A;  2O51 A;  1LFI A;  4PFY A;  5I84 A;  3JZJ A;  3RT6 B;  2GFE A;  4JB7 A;  1IIW A;  5CMC A;  3OO6 A;  2F5X A;  1ZJL A;  1VFE A;  1SW2 A;  4H5F A;  3VVF A;  4IGT A;  4LQ5 A;  1AL3 A;  1B5J A;  4ZEF A;  1B1X A;  4YB5 A;  2ABH A;  3MVX A;  2QRY A;  3S4U A;  1II5 A;  4DCY A;  2E0S A;  5BWJ A;  3FJ7 A;  1OMP A;  2XXR A;  4PE5 B;  5F7V A;  3N6U A;  3FAT A;  3CI8 A;  2AL5 A;  1NNF A;  2XHD A;  1MPB A;  4RPO A;  1IZ1 A;  4FEB A;  3Q26 A;  4OQO A;  3TEP A;  3T66 A;  3S9N C;  5KDT A;  3MW0 A;  2O6A A;  3FJM A;  1T0K A;  3V89 B;  1RKM A;  1XVX A;  3C4M A;  5I56 A;  3JYR A;  4KYE A;  2I0C A;  2H5Y A;  2H99 A;  4ELR A;  3O6G A;  4LVQ A;  2XX8 A;  3IR1 A;  5JTY B;  4H8J A;  5CRY A;  4KI0 E;  4YU0 A;  3K1N A;  1OVB A;  1NNK A;  3PPO A;  2RCB A;  5HBC A;  1UTB A;  4HW8 A;  3O2A A;  3TTN A;  3LSF B;  4NF5 B;  4YKJ A;  2R9J A;  5AA3 A;  4OVJ A;  5CMB A;  1UQW A;  3SEW A;  3H6T A;  4RJZ A;  2PMS A;  4YZZ A;  2QL3 A;  1Y4C A;  2PT2 A;  1SW5 A;  1MXW A;  1PBP A;  2ESN A;  1B6H A;  3MWB A;  1Y1M A;  3FV1 A;  4HCY A;  1LLS A;  5KCJ B;  1VE4 A;  3HV1 A;  3K01 A;  1LAH E;  1UIU A;  4Z0I A;  4G8M A;  1OQH A;  1EH3 A;  1O7T A;  2OCU A;  2B3B A;  1MPD A;  4F3B A;  1R1N A;  2P2A A;  3H6W A;  2B65 A;  2NXO A;  4NF8 B;  3G3H A;  3MVY A;  3TTM A;  1B5H A;  1PC3 A;  4RK2 A;  2I3V A;  3B6W A;  2I3W A;  3MP8 A;  3SEU A;  1SDX A;  3EHT A;  2ZNS A;  1PEB A;  1NFT A;  1IXC A;  2V3T A;  4NF6 A;  3FV2 A;  3IX1 A;  3K6V A;  3FZV A;  1QKA A;  4TLM B;  5CBS A;  1IUD A;  3N94 A;  2RCA A;  3M3L A;  3LSL A;  3KOT A;  3FXR A;  3LC8 A;  4OHN A;  4RK9 A;  1PB7 A;  4F22 A;  1B0H A;  1FW0 A;  1P99 A;  2I58 A;  2F78 A;  2GHB A;  1OLC A;  3QUF A;  3OOA A;  3V8X B;  3RPW A;  1NNP A;  3K00 A;  5FTI A;  5I59 B;  1N76 A;  3TQW A;  3PUZ E;  1A40 A;  3SES A;  1ELJ A;  4Q5T A;  2Q9T A;  3UK4 A;  1GGG A;  2FNC A;  5FHM A;  3PV0 E;  5TP9 A;  3PPR A;  2I6E A;  3U72 A;  2CZL A;  3N6T A;  1TWY A;  2I49 A;  3G3F A;  3TPA A;  2QS3 A;  1MQJ A;  1XC1 A;  4R2B A;  4GXA A;  1M5F A;  4YIC A;  3VXC A;  1S7Y A;  1P1N A;  2YPN A;  4YB7 A;  1OIB A;  3VV5 A;  2NOO A;  1MXV A;  1N7W A;  4ZZA A;  4FAJ A;  1B51 A;  4R74 A;  2O1M A;  4X1B A;  5AA2 A;  1LBC A;  2GHA A;  1QUL A;  2DVZ A;  5H8N A;  3HPI A;  2RIN A;  3KGC A;  5JK4 A;  3ZS6 A;  3BFT A;  3SER A;  3UA8 A;  3A3C A;  4QRZ A;  4XKQ A;  1JEU A;  1GV8 A;  4LUB A;  4YKK A;  2F7C A;  3QAX A;  2F8D A;  3OXN A;  4IO2 A;  3C35 A;  4HTG A;  1AOV A;  3PUW E;  4NWC A;  2Y84 A;  2ZYM A;  4R6K A;  4EDP A;  3Q27 A;  2DWH A;  2Z8D A;  4C1U A;  5ISU A;  2V3U A;  3Q28 A;  5H8F B;  1P1O A;  4N13 A;  4IY6 A;  2AIX A;  3UOR A;  1N04 A;  4R73 A;  3SKP A;  3O6I A;  1B0L A;  3ZKK A;  3TZA A;  4MLV A;  1UIV A;  4KFQ A;  1FTM A;  4EUO A;  5DTB A;  4R6Y A;  3G3G A;  4GL0 A;  1VSO A;  4GVO A;  3CSB A;  1AH5 A;  4G2Z A;  3PD8 A;  4G8N A;  2VHA A;  3SEV A;  4ISU A;  2DWJ A;  2UVG A;  1DPE A;  1MY3 A;  2Y7W A;  4HCW A;  3C9H A;  4Q0C A;  1VR5 A;  4OZ9 A;  4MH5 A;  2AYS A;  3VLW A;  3PPQ A;  1SI0 A;  3ILU B;  3T9U A;  4IO6 A;  3OO7 A;  1N3W A;  3MUQ A;  4E0W A;  2VOZ A;  4X1D A;  4ELO A;  5I57 B;  4PFW A;  3OD7 A;  2HAV A;  4F3G A;  2QS2 A;  3VLV A;  4F2O A;  4TLL B;  5K2X A;  1MXX A;  1Y3P A;  5AA1 A;  1B52 A;  4X48 A;  3OSR A;  3O29 A;  5L9M A;  4U1Z A;  4DCX A;  2Q89 A;  3KFM A;  4YB6 A;  3PPP A;  1ZBM A;  1Z7M E;  2QSX A;  2VP1 A;  2V25 A;  4BLA A;  3I3V A;  3R7X A;  3TTR A;  1LAG E;  2PVU A;  3FVK A;  3IOV A;  1B9J A;  3TDJ A;  3AXF A;  5KCJ A;  3MBP A;  3N26 A;  1A8F A;  1ZIU A;  4G4P A;  2F7A A;  1IIT A;  4NF4 B;  4G8H A;  1A54 A;  2YJP A;  1BKA A;  2OWT A;  3KEI A;  2Z22 A;  4BDQ A;  2DVC A;  4H8I A;  1TXF A;  2UYF A;  5EHS A;  4JXI A;  5TU0 A;  3GBA A;  1MQD A;  3IOW A;  5FHN A;  3PGF A;  4U4X A;  2QMX A;  4LA9 A;  4NF8 A;  3I5O A;  3KBR A;  4YMB A;  1Y9U A;  5A5X B;  1O64 A;  4BDR A;  1B40 A;  4YMA A;  1JVX A;  4JDF A;  5EHM A;  3FJG A;  1QKB A;  2O69 A;  3S9M C;  4JWO A;  3O6H A;  4O3C A;  4UAC A;  1A8E A;  2ZYN A;  1OQG A;  5F1Q A;  3OEN A;  4IO3 A;  4EQ7 A;  2I4C A;  4TQU Q;  1FQD A;  1LFG A;  2G93 A;  5AA4 B;  1HSJ A;  1URG A;  3D4C A;  4EXK A;  4X9T A;  1DPP A;  1MG1 A;  3WAF A;  4NWD A;  3DEL B;  1IXI A;  4GD5 A;  1B5I A;  5CI5 A;  4YKP A;  4WEP A;  4QFK A;  3EPE A;  3UN6 A;  4AB6 A;  1I6B A;  4NE4 A;  2DWA A;  4R75 A;  2DXY A;  3EHS A;  4OEN A;  4GFR A;  4FJP A;  4GQO A;  1A55 A;  3TEL A;  2DXR A;  2Q88 A;  2LAO A;  3THI A;  1QUJ A;  4RY1 A;  2HXW A;  4N07 A;  2UVJ A;  2X7Q A;  4YAH X;  1SW1 A;  3V5A A;  2F36 A;  5B7D A;  1MM7 A;  5CC2 A;  2V93 A;  4JWX A;  1B7U A;  1P1W A;  2UVH A;  1MXZ A;  1ZTY A;  3TAJ A;  4ZEI A;  5I2K B;  2XXX A;  3KSX A;  4OTE A;  3UP9 A;  4BDM A;  2NWJ A;  3U94 A;  3RQT A;  5KZT A;  3G3I A;  1BIY A;  2XXP A;  2I0B A;  3IOU A;  2ANJ A;  5H8Q B;  5I58 A;  1H3D A;  4LZ7 A;  4ONY A;  3E4R A;  4ESX A;  3S9L C;  1FQC A;  4PFT A;  1B3L A;  4GIZ A;  1LAF E;  2GH9 A;  4HS7 A;  3W9W A;  4Q30 B;  3CG3 A;  3IJX B;  3S2V A;  4F1Y A;  1O63 A;  3VLU A;  3K4U A;  1H43 A;  3O28 A;  1QVS A;  2H98 A;  3GXA A;  3RGY A;  1MM6 A;  2HZL A;  1IEJ A;  4EF1 A;  4WED A;  4QHQ A;  3TKD A;  4MFI A;  5CM6 A;  5B70 A;  1PB9 A;  3UIF A;  5CMK A;  5AE4 A;  1SI1 A;  3T9X B;  3KJ7 A;  2ZYO A;  4KHZ E;  3TUS A;  3LUY A;  1P1Q A;  4EQB A;  5DVI A;  5H8F A;  4EQ9 A;  3C33 A;  1MY4 A;  4L17 A;  5CMM A;  4C1T A;  1R6Z A;  3MPL A;  4THI A;  2QPQ A;  4RPN A;  4XKR A;  3IO4 A;  2HZK A;  2XXQ A;  2E1S A;  5IKB A;  1B1H A;  1POY 1;  1N84 A;  3K2D A;  3B6Q A;  3BFU A;  4F31 B;  3ZKL A;  1EZ9 A;  4UA8 A;  4I62 A;  3L6H A;  4DXU A;  5DEX B;  2A5T B;  3CSG A;  3H3G A;  2Y7K A;  4OES A;  5I57 A;  2H4I A;  1MQG A;  3RY3 A;  4ZE8 A;  4FIM A;  5IAI A;  3LSX A;  4JSO A;  4QSE A;  4QFN A;  2DWI A;  4KCC A;  4GWO A;  1MQH A;  3N5L A;  3OEL A;  4OEV A;  3M8U A;  3USD A;  1JW4 A;  3DP4 A;  4R72 A;  1FQA A;  4BDN A;  5BUU A;  4DZ1 A;  1RYX A;  2ZNU A;  3FVO A;  3DP8 A;  3E13 X;  2QMW A;  3DP6 A;  4G77 A;  4U22 A;  4H5G A;  2ZMB A;  2ZNT A;  1MDQ A;  1GR2 A;  4ESW A;  4H1X A;  3FAS A;  5L8D A;  4ZDM A;  5DYH A;  2QJE A;  4NF4 A;  4R6H A;  4K3F A;  1LAX A;  4QFP A;  1LST A;  2PBW A;  4DE8 A;  5I56 B;  2VD2 A;  4KPT A;  2YLN A;  5A5X A;  1NL5 A;  3VVD A;  4U21 A;  4KYD A;  1AIV A;  3MZ1 A;  1EU8 A;  1J1N A;  2I4B A;  3OSQ A;  2DE3 A;  3FVG A;  1GTK A;  3GBB A;  1B05 A;  4BDO A;  4IGR A;  4LAT A;  3HN0 A;  4DIG A;  1EZO A;  4XTC Q;  4OEU A;  3IOT A;  2OZZ A;  3K1P A;  5H8H B;  4R9G A;  1SQY A;  2Q2A A;  4IO7 A;  4RYA A;  1PDA A;  1LBB A;  2NUV A;  4QF9 A;  4F1V A;  3DM0 A;  4F19 A;  3A3U A;  3TTL A;  5I2N B;  3ONM A;  3KJT A;  3HHG A;  1ANF A;  4AB5 A;  2UVI A;  1H76 A;  1XOC A;  5EYF A;  3MPK A;  2F6P A;  4DXB A;  2B3F A;  2D21 A;  2FA7 A;  4G68 B;  1NKX A;  4H6D A;  3MZB A;  2UYE A;  3PMV A;  3MC2 A;  4OWD A;  3Q25 A;  1M5E A;  4OXV A;  3VXB A;  2OBG A;  2UXA A;  3C34 A;  1FTJ A;  4RA1 A;  4ZED A;  2ONS A;  1TT1 A;  2F6G A;  4GL8 A;  3MP1 A;  1GVC A;  1Z7N E;  4ZEB A;  1PBQ A;  4XKN A;  5JTY A;  2XXW A;  2Y7R A;  4KQP A;  5DVJ A;  5H8S A;  3FVN A;  3B6T A;  1IXG A;  4IO4 A;  2ZXT A;  2AL4 A;  1XT8 A;  4TOZ A;  2DOJ A;  4DDD A;  3VVE A;  4NF6 B;  4PQJ A;  2RC8 A;  1UTH B;  3MJN A;  3BKI B;  3IK6 B;  4NF5 A;  1BLF A;  5ICQ A;  4IB2 A;  2XXH A;  4H65 A;  3ILT B;  3HO7 A;  2H25 A;  3O66 A;  2THI A;  1RYO A;  3VFJ A;  1NNT A;  4NMY A;  2DS9 A;  3FUZ A;  4KR5 A;  1NH7 A;  1LB8 A;  1YAE A;  3VE1 B;  4OFJ A;  4QSC A;  1R9L A;  2P0S A;  4GOT A;  3T22 A;  2Q2C A;  2F97 A;  1B7Z A;  3O97 A;  1OVT A;  3K6X A;  3B7D A;  5FTH A;  4U2R A;  1SBP A;  2XD2 A;  1YPN A;  3U8Q A;  2XXU A;  4JSD A;  1B3H A;  3C32 A;  2DE2 A;  4FE8 A;  4QFO A;  4OYV A;  3PMX A;  1A7L A;  3C31 A;  2IA4 A;  3QIM A;  3EF7 A;  1SYI A;  2XX7 A;  3PPN A;  3TFL A;  4LQ2 A;  1LGB C;  4O3B A;  5AA2 B;  4KD5 A;  4DXC A;  1MY2 A;  4FED A;  3MVZ A;  3MVW A;  5H8N B;  3CVG A;  1QUI A;  1ZU0 A;  1VFD A;  1URS A;  3G3K A;  1HSL A;  5DEX A;  2A5T A;  3GLB A;  4FAT A;  1XVY A;  5ITO A;  2OJT A;  3RNN A;  1MRP A;  2D3I A;  4BDL A;  4ZS9 A;  3K02 A;  2X7P A;  1SVX B;  3KN7 A;  3U93 A;  4M4G A;  3FXU A;  4GLI A;  1FQB A;  3QK6 A;  3OO9 A;  4KYS A;  2HCA A;  4KCD A;  1BTJ A;  4FOR A;  5I59 A;  2X26 A;  4XXU A;  1NMU A;  5K2Y A;  3W9V A;  4FEC A;  2ONR A;  4ELQ A;  3W15 C;  3TQL A;  4DLD A;  3KZG A;  3IB0 A;  4Z7E A;  4QFL A;  2F35 A;  4M1V A;  1B3G A;  3FXQ A;  1BP5 A;  1B4Z A;  3K6U A;  4RXL A;  1PB8 A;  1MH4 A;  3MZ9 A;  1ZMG A;  1M5B A;  4POW A;  4ZEC A;  3KN8 A;  2H9B A;  4NTL A;  3M3F A;  2Z8E A;  2QS4 A;  1B4H A;  4AQ4 A;  4F3S A;  3E9X A;  3A09 A;  1IXH A;  1FCK A;  1USY H;  2REG A;  3PD9 A;  1N3X A;  3WAE A;  4RNS A;  4G68 C;  3R6U A;  2O7I A;  2W7Y A;  5JEI A;  3EHU A;  1LCF A;  3CFZ A;  5TPA B;  3FIR A;  1JW5 A;  5H8H A;  3IO6 A;  4MF3 A;  1XHY A;  3PUY E;  2ALU A;  1D3K A;  1ATG A;  5I2N A;  1LFH A;  1B3F A;  3PMW A;  3T93 B;  4E0X A;  2KLF A;  3RTW B;  1DOT A;  1M5C A;  4OFL A;  4G68 A;  1CB6 A;  3BBR A;  3EQ1 A;  3QYT A;  4ZEK A;  3G3J A;  4WKM A;  1IQ7 A;  4F39 A;  3E3K A;  3D4G A;  1TFD A;  4ND9 A;  1S9T A;  1TFA A;  4U4S A;  3U92 A;  1FQE A;  3TCF A;  5DT6 A;  4OET A;  2R6G E;  2RC9 A;  4LZ8 A;  5LOM A;  3CIJ A;  3G7W A;  5AA2 D;  3IL1 B;  3OEM A;  4ZZE A;  2NVU B;  5HM4 B;  3RUM A;  3Q29 A;  1UTH A;  1M5D A;  1DMB A;  3V83 A;  3KOS A;  1WVJ A;  4C0R A;  4NED A;  2GRV A;  3PU5 A;  1DTZ A;  1JEV A;  2DSF A;  2O1L A;  4JWY A;  3QSL A;  1MQI A;  2WKY A;  3U1O A;  1DSN A;  4PET A;  3ODB A;  3P7I A;  4I1D A;  1I6A A;  3TCH A;  2OLB A;  2O7U A;  1YCJ A;  2XD3 A;  4F3P A;  2OWS A;  3K6W A;  1N7X A;  1FTK A;  1JW1 A;  1MH3 A;  1YTV A;  4LZ5 A;  2HFB A;  3IAZ A;  3LSW A;  4F18 A;  1WOD A;  4GRK A;  3H06 B;  3HCQ A;  1Y4T A;  4I8C A;  1XS5 A;  1WDN A;  1SW4 A;  2XXY A;  5KDT B;  1US5 A;  2HQ0 A;  4EXL A;  1H44 A;  5ELV A;  2A5S A;  3HHF A;  4F2Q A;  3FGS A;  3L6G A;  1EZP A;  1D4N A;  4ZE9 A;  3S9E A;  1NH8 A;  4JBZ A;  1QUK A;  3PUX E;  2FYI A;  3SDF A;  5ITP A;  1Q35 A;  3LR1 A;  2P1S A;  4OFO A;  3CR9 A;  2F34 A;  3ZSF A;  1JET A;  4XIG Q;  2CMO A;  3H4Z A;  5J1D A;  1D9V A;  3M3K A;  1F9B A;  1LB9 A;  2V84 A;  3CG1 A;  5I58 B;  1B32 A;  1B2H A;  1QW0 A;  2PT1 A;  2RKM A;  3DLN A;  2XXI A;  3O9P A;  3OMB A;  4N6P A;  4MBP A;  2REJ A;  3H03 A;  1US4 A;  3FD3 A;  5AA4 A;  5DVF A;  1D9Y A;  3I6V A;  1FTL A;  1UTB B;  2O84 X;  4GXS B;  3CFL A;  4F1U A;  1Y20 A;  2ONK E;  3RTF B;  1URD A;  1Y1Z A;  3H7M A;  1L5T A;  4U1O A;  4OER A;  1B58 A;  1MS7 A;  2OK2 A;  5FHO A;  1MY0 A;  3LBS A;  2DQV A;  2XX9 A;  3T96 B;  3C36 A;  4QSD A;  3IB1 A;  1JQF A;  4LP2 B;  3SET A;  1P1U A;  1A99 A;  5L9O A;  4H0W A;  3RLF E;  3VDF A;  3T9H B;  2RF1 A;  3IOR A;  4R2F A;  1QJM A;  2F7B A;  1SYH A;  4LON B;  1HSE A;  3MP6 A;  1OLA A;  5CBR A;  1R9Q A;  4XKP A;  3UGW A;  3IB2 A;  1B46 A;  1FTO A;  3MAM A;  1LCT A;  2VGQ A;  5I2K A;  4I9D A;  2Y7P A;  4ELP A;  1ZLQ A;  1SD3 A;  1JVY A;  1MY1 A;  5ICT A;  3OEK A;  4GF8 A;  4H67 A;  3TTK A;  1Q1K A;  5H8Q A;  4IY5 A;  4P11 A;  3QUJ A;  2HAU A;  3SEY A;  4ECF A;  3GZG A;  1JNF A;  5M2V A;  4O3A A;  1B7H A;  3JV9 A;  4EF2 A;  2IEE A;  3RN8 A;  4POX A;  1POT A;  3F11 A;  2RC7 A;  1CE2 A;  2PYY A;  3RT8 A;  2DYX A;  4IO5 A;  3IJO B;  2VD3 A;  3EN3 A;  4P0I A;  5TPA A;  1I6Q A;  4R9F A;  3TYH A;  3OO8 A;  3TMG A;  1H45 A;  2HEU A;  4P0G A;  4PP0 A;  4OMB A;  3CRB A;  1Y3Q A;  3T9V A;  2Q8J A;  3TCG A;  1MDP 1;  2I48 A;  1MXY A;  2Z8F A;  2Y7I A;  4Q8R A;  3QXM A;  5L9S A;  2XXV A;  2XXT A;  3MQ9 A;  2V3Q A;  1FQF A;  3SEX A;  4U23 A;  3PUV E;  3K1M A;  5TP9 B;  3HST A;  3H6V A;  2DP8 A;  4PFU A;  1S50 A;  1B3E A;  1Y3N A;  3CFX A;  3KG2 A;  3TOD A;  1N0T A;  4F29 A;  2DE4 A;  3K0V A;  2M8C A;  3ECR A;  1ZKB A;  2QS1 A;  2Z23 A;  4MLQ A;  3R26 A;  1KWH A;  5HPQ A;  2O68 A;  2BJJ X;  3KN3 A;  3KSJ A;  1DTG A;  1AMF A; 
#chains in the Genus database with same CATH topology
 2G29 A;  2D5W A;  1USY E;  3H6U A;  1I69 A;  2ZYK A;  2PX1 A;  1MXU A;  4WXJ A;  2R71 A;  1MPC A;  4YKI A;  1NV7 A;  2O51 A;  1LFI A;  4PFY A;  5LTC A;  5I84 A;  3JZJ A;  3RT6 B;  2GFE A;  4JB7 A;  1IIW A;  4PFR A;  5CMC A;  3OO6 A;  2F5X A;  1ZJL A;  1VFE A;  1SW2 A;  4H5F A;  3VVF A;  2CZI A;  4IGT A;  4LQ5 A;  5EQ8 A;  1AL3 A;  1B5J A;  4ZEF A;  1B1X A;  4YB5 A;  2ABH A;  3MVX A;  2QRY A;  3ROJ A;  3S4U A;  1II5 A;  1RDZ A;  4DCY A;  4OVR A;  2E0S A;  5BWJ A;  4AS5 A;  3FJ7 A;  1OMP A;  2XXR A;  4PE5 B;  5F7V A;  4AS4 A;  3N6U A;  3FAT A;  3CI8 A;  2AL5 A;  1NNF A;  3QMF A;  2XHD A;  1MPB A;  4RPO A;  1IZ1 A;  4FEB A;  3Q26 A;  2B4M A;  2PCR A;  4OQO A;  3TEP A;  1NI9 A;  3T66 A;  3S9N C;  5KDT A;  3MW0 A;  2O6A A;  3FJM A;  1T0K A;  5IZ3 A;  1INP A;  1FBG A;  3V89 B;  1RKM A;  4O8M A;  1XVX A;  3C4M A;  5IGA A;  5I56 A;  2FHY A;  5EYH A;  3JYR A;  1DCU A;  4KYE A;  2I0C A;  3D1R A;  2H5Y A;  2H99 A;  4ELR A;  3O6G A;  4LVQ A;  2WBB A;  2XX8 A;  1EYK A;  3IR1 A;  5JTY B;  4H8J A;  5CRY A;  4KI0 E;  4YU0 A;  3KBZ A;  3K1N A;  3T0J A;  1OVB A;  1NNK A;  3PPO A;  2RCB A;  5HBC A;  1UTB A;  4HW8 A;  3O2A A;  3TTN A;  3LSF B;  4NF5 B;  1FBC A;  4YKJ A;  4NG7 A;  2R9J A;  5AA3 A;  4OVJ A;  1LBY A;  5CMB A;  1UQW A;  3SEW A;  3H6T A;  4RJZ A;  2PMS A;  4YZZ A;  2QL3 A;  1FJ6 A;  1Y4C A;  2PT2 A;  2QFL A;  1SW5 A;  1MXW A;  1PBP A;  2ESN A;  1B6H A;  3MWB A;  1Y1M A;  3FV1 A;  4HCY A;  1LLS A;  5KCJ B;  2VPN A;  1VE4 A;  3HV1 A;  3K01 A;  4I3E A;  1LAH E;  1UIU A;  4Z0I A;  4G8M A;  1OQH A;  2Y5K A;  1EH3 A;  1O7T A;  2OCU A;  2B3B A;  1MPD A;  4F3B A;  4N8Y A;  1R1N A;  2P2A A;  3H6W A;  2OWZ A;  2B65 A;  2NXO A;  4NF8 B;  1D9Q A;  3G3H A;  3MVY A;  3TTM A;  1B5H A;  1NUX A;  1PC3 A;  4RK2 A;  2I3V A;  3B6W A;  2I3W A;  3MP8 A;  3SEU A;  1SDX A;  3EHT A;  2ZNS A;  1PEB A;  1NFT A;  1IXC A;  4P9K A;  2V3T A;  4NF6 A;  3FV2 A;  1NV2 A;  3RYD A;  3IX1 A;  3K6V A;  3FZV A;  1QKA A;  4TLM B;  4PFI A;  5CBS A;  1IUD A;  3N94 A;  2RCA A;  4NN3 A;  4QXD A;  3M3L A;  3LSL A;  3KOT A;  3FXR A;  3LC8 A;  4OHN A;  2Q8M A;  4RK9 A;  1PB7 A;  4F22 A;  1B0H A;  1FW0 A;  1P99 A;  2I58 A;  2F78 A;  4JVD A;  4FBP A;  1NV4 A;  2GHB A;  4HE2 A;  1OLC A;  3QUF A;  3OOA A;  1KA0 A;  3V8X B;  3RPW A;  3CHG A;  1NNP A;  3K00 A;  5FTI A;  4OVS A;  5I59 B;  1N76 A;  3TQW A;  3PUZ E;  1A40 A;  3SES A;  1ELJ A;  3U65 A;  4Q5T A;  2Q9T A;  3UK4 A;  1GGG A;  2FNC A;  5FHM A;  3PV0 E;  5TP9 A;  3E78 A;  3PPR A;  2I6E A;  2CZL A;  3U72 A;  3N6T A;  4XEQ A;  1TWY A;  2I49 A;  3G3F A;  3TPA A;  2QS3 A;  1MQJ A;  1XC1 A;  4GX3 A;  4R2B A;  4GXA A;  1M5F A;  2ZZV A;  4YIC A;  3VXC A;  1S7Y A;  1P1N A;  2YPN A;  4YB7 A;  1OIB A;  3VV5 A;  2NOO A;  1MXV A;  1LEV A;  1N7W A;  4ZZA A;  4FAJ A;  1B51 A;  4R74 A;  2O1M A;  4X1B A;  5AA2 A;  1LBC A;  2GHA A;  3GYY A;  1QUL A;  2DVZ A;  5H8N A;  3LUZ A;  3HPI A;  4KXP A;  2RIN A;  3KGC A;  5JK4 A;  4P1E A;  3ZS6 A;  3BFT A;  3SER A;  3UA8 A;  3A3C A;  1FPG A;  4QRZ A;  4XKQ A;  1JEU A;  1GV8 A;  4LUB A;  4YKK A;  2F7C A;  3QAX A;  4MCO A;  2F8D A;  5ET8 A;  3OXN A;  1AWB A;  4IO2 A;  3C35 A;  4HTG A;  1AOV A;  3PUW E;  4NWC A;  2Y84 A;  4MMP A;  2ZYM A;  5ET5 A;  4R6K A;  3IFA A;  4EDP A;  3Q27 A;  2DWH A;  2Z8D A;  4C1U A;  5ISU A;  3ISP A;  2V3U A;  3Q28 A;  5H8F B;  1P1O A;  4N13 A;  4IY6 A;  2AIX A;  3UOR A;  4R73 A;  1N04 A;  3SKP A;  3O6I A;  4N6D A;  1B0L A;  3ZKK A;  3TZA A;  4MLV A;  1UIV A;  4XF5 A;  4KFQ A;  1FTM A;  4EUO A;  4PGN A;  5DTB A;  4R6Y A;  3G3G A;  4GL0 A;  1VSO A;  4GVO A;  3IFC A;  3CSB A;  1AH5 A;  4G2Z A;  5FBP A;  1G0H A;  3PD8 A;  4G8N A;  2VHA A;  4PCD A;  4NGU A;  3SEV A;  4ISU A;  4MX6 A;  2DWJ A;  4GWX A;  2UVG A;  1DPE A;  1MY3 A;  2Y7W A;  4HCW A;  5J16 A;  3C9H A;  4Q0C A;  1VR5 A;  4OZ9 A;  4MH5 A;  2AYS A;  3VLW A;  3PPQ A;  1SI0 A;  3ILU B;  3T9U A;  4IO6 A;  3OO7 A;  1N3W A;  3MUQ A;  4E0W A;  2VOZ A;  4X1D A;  4ELO A;  5I57 B;  4PFW A;  3OD7 A;  2HAV A;  4F3G A;  2QS2 A;  3VLV A;  3E79 A;  4F2O A;  4TLL B;  5K2X A;  1MXX A;  4PFB A;  1Y3P A;  5AA1 A;  1B52 A;  4P47 A;  4X48 A;  3OSR A;  3O29 A;  5L9M A;  4U1Z A;  4DCX A;  3RPL A;  2Q89 A;  3KFM A;  4YB6 A;  3PPP A;  1ZBM A;  1RDX A;  1Z7M E;  2QSX A;  2VP1 A;  2V25 A;  4BLA A;  3I3V A;  1FJ9 A;  3R7X A;  3TTR A;  1DK4 A;  1LAG E;  2PVU A;  3FVK A;  3IOV A;  1B9J A;  3TDJ A;  3AXF A;  5KCJ A;  3MBP A;  3N26 A;  1A8F A;  1ZIU A;  2XWV A;  4G4P A;  2F7A A;  1IIT A;  4NF4 B;  4G8H A;  1A54 A;  1DBZ A;  2YJP A;  1BKA A;  2OWT A;  3KEI A;  2Z22 A;  4BDQ A;  2DVC A;  4X04 A;  4H8I A;  5DW8 A;  1TXF A;  2UYF A;  2WX9 A;  4JXI A;  5EHS A;  3GBA A;  5TU0 A;  1MQD A;  3IOW A;  5FHN A;  3PGF A;  4U4X A;  2QMX A;  4LA9 A;  4NF8 A;  3I5O A;  3KBR A;  5IZ1 A;  1Y9U A;  4YMB A;  5A5X B;  5ET7 A;  1O64 A;  4BDR A;  1B40 A;  4YMA A;  1JVX A;  4GX4 A;  4JDF A;  4O94 A;  5EHM A;  3SZP A;  4MAG A;  4XFE A;  3FJG A;  4N15 A;  5A5L A;  1QKB A;  2O69 A;  3S9M C;  4JWO A;  1JP4 A;  3O6H A;  4O3C A;  4UAC A;  1A8E A;  2ZYN A;  1OQG A;  3HFU A;  5F1Q A;  3OEN A;  4IO3 A;  4EQ7 A;  2I4C A;  4TQU Q;  1FQD A;  2PFY A;  1LFG A;  2G93 A;  5AA4 B;  1HSJ A;  1URG A;  3D4C A;  4EXK A;  4X9T A;  1DPP A;  1IME A;  1MG1 A;  3WAF A;  4NWD A;  3B8B A;  3DEL B;  1IXI A;  4GD5 A;  1B5I A;  5CI5 A;  4YKP A;  4WEP A;  4QFK A;  3EPE A;  3UN6 A;  4AB6 A;  1I6B A;  4NE4 A;  2DWA A;  4N91 A;  4R75 A;  2DXY A;  3EHS A;  4OEN A;  4GFR A;  4FJP A;  4GQO A;  1A55 A;  4NHB A;  3TEL A;  2DXR A;  4HE1 A;  4OA4 A;  2Q88 A;  2LAO A;  2PFZ A;  3THI A;  1QUJ A;  5EQ7 A;  4RY1 A;  2HXW A;  4N07 A;  2UVJ A;  2X7Q A;  4YAH X;  1SW1 A;  3V5A A;  2F36 A;  5B7D A;  1MM7 A;  5CC2 A;  2V93 A;  4JWX A;  1B7U A;  1P1W A;  2UVH A;  1MXZ A;  1ZTY A;  3TAJ A;  4ZEI A;  5I2K B;  2XXX A;  5EQA A;  4OTE A;  3KSX A;  3UP9 A;  4BDM A;  2NWJ A;  3U94 A;  3RQT A;  5KZT A;  3G3I A;  1KZ8 A;  1BIY A;  1FPD A;  2XXP A;  2I0B A;  3IOU A;  2ANJ A;  5H8Q B;  5IZZ A;  5I58 A;  1H3D A;  2BJI A;  4LZ7 A;  4ONY A;  3E4R A;  4ESX A;  3S9L C;  1FPJ A;  1FQC A;  4PFT A;  4GWU A;  1B3L A;  4GIZ A;  1LAF E;  2GH9 A;  4HS7 A;  3W9W A;  5LDZ A;  4Q30 B;  3CG3 A;  3IJX B;  3S2V A;  4F1Y A;  1O63 A;  4N8G A;  4N6K A;  3VLU A;  1BK4 A;  3K4U A;  1H43 A;  4NX1 A;  3O28 A;  1QVS A;  2H98 A;  4GBV A;  3GXA A;  3RGY A;  1MM6 A;  2HZL A;  1IEJ A;  4EF1 A;  4WED A;  4QHQ A;  3TKD A;  4MFI A;  5CM6 A;  5B70 A;  4PF8 A;  1PB9 A;  3UIF A;  2QVV A;  5CMK A;  5AE4 A;  1SI1 A;  3T9X B;  5F24 A;  3KJ7 A;  2ZYO A;  4KHZ E;  2HPG A;  3TUS A;  3LUY A;  1P1Q A;  4EQB A;  5DVI A;  5H8F A;  3FBP A;  4EQ9 A;  3C33 A;  3FXB A;  1MY4 A;  4L17 A;  1FPF A;  5CMM A;  2XA5 A;  5IM2 A;  4C1T A;  1R6Z A;  3MPL A;  4THI A;  2QPQ A;  4PF6 A;  4RPN A;  4XKR A;  3IO4 A;  2HZK A;  2XXQ A;  1FBF A;  2E1S A;  5IKB A;  1B1H A;  1POY 1;  1FSA A;  1N84 A;  3A29 A;  3K2D A;  3B6Q A;  2XXK A;  3BFU A;  4F31 B;  3ZKL A;  2L5V A;  1EZ9 A;  4UA8 A;  2JJK A;  4I62 A;  1SPI A;  3L6H A;  4DXU A;  5DEX B;  2A5T B;  3CSG A;  3H3G A;  2Y7K A;  4OES A;  5I57 A;  2H4I A;  1MQG A;  3RY3 A;  4ZE8 A;  4FIM A;  5IAI A;  3LSX A;  4JSO A;  2FVZ A;  2FBP A;  4QSE A;  4QFN A;  2DWI A;  4JVC A;  4KCC A;  4OVQ A;  4GWO A;  1MQH A;  3N5L A;  3OEL A;  4OEV A;  4OVP A;  3M8U A;  3USD A;  1JW4 A;  3DP4 A;  4NF0 A;  5EYG A;  2CEX A;  4R72 A;  1FQA A;  4BDN A;  5BUU A;  4DZ1 A;  1RYX A;  2ZNU A;  3FVO A;  3DP8 A;  3E13 X;  3BIG A;  2DDK A;  2F3D A;  2QMW A;  2HHM A;  3DP6 A;  4G77 A;  4U22 A;  4H5G A;  2ZMB A;  2ZNT A;  1MDQ A;  1GR2 A;  4ESW A;  4H1X A;  3FAS A;  5L8D A;  4ZDM A;  5DYH A;  2QJE A;  4NF4 A;  4R6H A;  2R8T A;  4K3F A;  1LAX A;  1CNQ A;  1EYJ A;  4QFP A;  1LST A;  1YXI A;  2PBW A;  4DE8 A;  5I56 B;  2VD2 A;  4KPT A;  1NV5 A;  2YLN A;  5A5X A;  2WEF A;  1NL5 A;  3VVD A;  4U21 A;  4KYD A;  1AIV A;  4I40 A;  3MZ1 A;  1EU8 A;  1J1N A;  2I4B A;  1NV0 A;  3OSQ A;  2DE3 A;  3FVG A;  1GTK A;  3GBB A;  1B05 A;  4BDO A;  4IGR A;  4LAT A;  3HN0 A;  4DIG A;  1EZO A;  4XTC Q;  4OEU A;  3IOT A;  2OZZ A;  3K1P A;  5H8H B;  4R9G A;  1SQY A;  2Q2A A;  4IO7 A;  4RYA A;  1PDA A;  1LBB A;  3B50 A;  2NUV A;  4QF9 A;  4F1V A;  3DM0 A;  4F19 A;  3A3U A;  3TTL A;  5I2N B;  3KC0 A;  3ONM A;  3KJT A;  4G61 A;  3HHG A;  1ANF A;  4AB5 A;  2UVI A;  1H76 A;  1XOC A;  5EYF A;  3MPK A;  2F6P A;  4DXB A;  2B3F A;  2D21 A;  4JVI A;  2FA7 A;  3EKI A;  4G68 B;  1NKX A;  4H46 A;  4H6D A;  3MZB A;  4PBH A;  2UYE A;  3PMV A;  3MC2 A;  4OWD A;  3Q25 A;  1M5E A;  4OXV A;  3VXB A;  2OBG A;  2UXA A;  3C34 A;  1FTJ A;  4RA1 A;  4ZED A;  2ONS A;  1TT1 A;  2VT5 A;  2F6G A;  4PGP A;  4GL8 A;  3MP1 A;  1GVC A;  1Z7N E;  4ZEB A;  1PBQ A;  4XKN A;  5JTY A;  2XXW A;  2Y7R A;  1NUW A;  2XWK A;  4KQP A;  5DVJ A;  5H8S A;  3FVN A;  3B6T A;  1IXG A;  4I3Y A;  4IO4 A;  2ZXT A;  2MKZ A;  2AL4 A;  1FTA A;  1XT8 A;  2QVU A;  4TOZ A;  2DOJ A;  3VVE A;  4DDD A;  4NF6 B;  4MEV A;  4PQJ A;  1NV3 A;  2RC8 A;  1LBW A;  1UTH B;  3MJN A;  1FBD A;  3BKI B;  3IK6 B;  4NF5 A;  1BLF A;  5ICQ A;  4IB2 A;  4O7M A;  2XXH A;  4H65 A;  4GWW A;  4PAI A;  3ILT B;  2XWI A;  3HO7 A;  2H25 A;  3O66 A;  2THI A;  1RYO A;  3VFJ A;  1NNT A;  4NMY A;  2DS9 A;  3FUZ A;  4KR5 A;  1NH7 A;  1LB8 A;  1YAE A;  3VE1 B;  4OFJ A;  4QSC A;  4GX6 A;  1R9L A;  2P0S A;  4GOT A;  1FPI A;  3T22 A;  2Q2C A;  2F97 A;  1B7Z A;  3O97 A;  1OVT A;  3K6X A;  3B7D A;  5FTH A;  4PBQ A;  4U2R A;  2XWO A;  4HXV A;  1SBP A;  2XD2 A;  1YPN A;  4NAP A;  3U8Q A;  2XXU A;  4JSD A;  1B3H A;  3C32 A;  2DE2 A;  4FE8 A;  4QFO A;  4OYV A;  3PMX A;  1A7L A;  3C31 A;  2IA4 A;  3QIM A;  4DI3 D;  3EF7 A;  1SYI A;  2XX7 A;  3PPN A;  2WBD A;  3TFL A;  4LQ2 A;  1LGB C;  4O3B A;  1FRP A;  5ESY A;  2KQZ A;  5AA2 B;  4KD5 A;  4DXC A;  1MY2 A;  4FED A;  3MVZ A;  3MVW A;  3LV0 A;  5H8N B;  3CVG A;  1QUI A;  1ZU0 A;  1VFD A;  1URS A;  5I7I A;  3G3K A;  1HSL A;  5DEX A;  2A5T A;  3GLB A;  4FAT A;  1XVY A;  5ITO A;  2OJT A;  3RNN A;  1MRP A;  2D3I A;  4BDL A;  4ZS9 A;  3K02 A;  4DI4 B;  1IMC A;  2X7P A;  1SVX B;  3KN7 A;  3U93 A;  4M4G A;  3FXU A;  4IR8 A;  4GLI A;  1FQB A;  3QK6 A;  4GWS A;  4MIJ A;  3OO9 A;  4KYS A;  2HCA A;  4PAK A;  4KCD A;  1NV6 A;  1BTJ A;  4FOR A;  5I59 A;  2X26 A;  4XXU A;  1NMU A;  3BIH A;  4GWY A;  2VPO A;  5K2Y A;  3W9V A;  4FEC A;  2ONR A;  1VDW A;  2OX3 A;  4ELQ A;  3W15 C;  3TQL A;  4DLD A;  3KZG A;  1KA1 A;  3IB0 A;  4Z7E A;  4QFL A;  1IMF A;  2F35 A;  4M1V A;  1B3G A;  3FXQ A;  1BP5 A;  1B4Z A;  3K6U A;  4RXL A;  1PB8 A;  1MH4 A;  3MZ9 A;  1ZMG A;  1M5B A;  2WYK A;  4POW A;  4ZEC A;  3KN8 A;  2H9B A;  4NTL A;  1EYI A;  2CEY A;  3M3F A;  4PTK A;  2Z8E A;  4H45 A;  1G0I A;  2QS4 A;  1B4H A;  4AQ4 A;  4F3S A;  3E9X A;  4PDD A;  1NV1 A;  4GWZ A;  3A09 A;  1IXH A;  1FCK A;  3PTY A;  1USY H;  2REG A;  5I5P A;  3PD9 A;  1N3X A;  3WAE A;  4RNS A;  4G68 C;  3R6U A;  2FIE A;  2O7I A;  2W7Y A;  5JEI A;  3EHU A;  1LCF A;  3CFZ A;  5TPA B;  3FIR A;  1JW5 A;  5H8H A;  3IO6 A;  4MF3 A;  1XHY A;  3PUY E;  2ALU A;  1D3K A;  1ATG A;  5I2N A;  1LFH A;  1B3F A;  3RPL B;  3PMW A;  3T93 B;  1K9Z A;  4E0X A;  1NUZ A;  2KLF A;  3RTW B;  1DOT A;  1M5C A;  4OFL A;  4G68 A;  1CB6 A;  3BBR A;  3EQ1 A;  3QYT A;  4ZEK A;  3G3J A;  2Q74 A;  4WKM A;  4NQ8 A;  4N81 A;  1IQ7 A;  4F39 A;  3E3K A;  3D4G A;  4O7I A;  2P3N A;  1TFD A;  4ND9 A;  1S9T A;  1FBH A;  1YZ0 A;  1TFA A;  5ET6 A;  4U4S A;  3U92 A;  1FQE A;  3TCF A;  5DT6 A;  4OET A;  4PAF A;  2R6G E;  2RC9 A;  2Y5L A;  4LZ8 A;  5LOM A;  3CIJ A;  3G7W A;  5AA2 D;  4UAB A;  3IL1 B;  3OEM A;  4ZZE A;  2NVU B;  5HM4 B;  3RUM A;  3Q29 A;  1UTH A;  1M5D A;  1DMB A;  3V83 A;  3KOS A;  1WVJ A;  4C0R A;  4NED A;  2GRV A;  3PU5 A;  1DTZ A;  1JEV A;  2DSF A;  2O1L A;  4JWY A;  3QSL A;  1MQI A;  2WKY A;  4P8B A;  3U1O A;  1DSN A;  4PET A;  3ODB A;  3NOH A;  3P7I A;  1LBX A;  4I1D A;  1I6A A;  3TCH A;  2OLB A;  2O7U A;  1YCJ A;  2XD3 A;  4F3P A;  2OWS A;  3K6W A;  1N7X A;  1FTK A;  1JW1 A;  1MH3 A;  1Q9D A;  1YTV A;  4LZ5 A;  2HFB A;  3IAZ A;  3LSW A;  4F18 A;  1WOD A;  4GRK A;  3H06 B;  3HCQ A;  1Y4T A;  4I8C A;  1XS5 A;  1WDN A;  1SW4 A;  2XXY A;  5KDT B;  1US5 A;  2HQ0 A;  4EXL A;  1H44 A;  5ELV A;  4GBW A;  5IZ3 B;  2A5S A;  3HHF A;  4F2Q A;  3FGS A;  3L6G A;  1EZP A;  1D4N A;  4P3L A;  4ZE9 A;  3S9E A;  1NH8 A;  4JBZ A;  1QUK A;  3PUX E;  2FYI A;  3SDF A;  5ITP A;  1Q35 A;  3LR1 A;  2P1S A;  4OFO A;  2WYP A;  2F34 A;  3CR9 A;  3ZSF A;  1JET A;  4XIG Q;  2CMO A;  3H4Z A;  5J1D A;  1D9V A;  3M3K A;  1F9B A;  1LB9 A;  2V84 A;  3CG1 A;  5I58 B;  1B32 A;  2ZZW A;  1B2H A;  1QW0 A;  2PT1 A;  4PC9 A;  2HXR A;  4MNI A;  2RKM A;  3DLN A;  2XXI A;  3O9P A;  3OMB A;  4N6P A;  4MBP A;  5I3S A;  2FIX A;  1FPE A;  2REJ A;  3H03 A;  4MHF A;  3MST A;  1US4 A;  4LN5 A;  3FD3 A;  5AA4 A;  5DVF A;  1D9Y A;  3I6V A;  1FTL A;  1UTB B;  2O84 X;  4GXS B;  3CFL A;  4F1U A;  1Y20 A;  2ONK E;  3RTF B;  1URD A;  4PE3 A;  1Y1Z A;  3H7M A;  1L5T A;  4U1O A;  4OER A;  1LBV A;  1B58 A;  1MS7 A;  2OK2 A;  5FHO A;  1MY0 A;  1FBP A;  3LBS A;  1IMD A;  2DQV A;  1QGX A;  1FBE A;  3MYU A;  4QBA A;  2XX9 A;  3T96 B;  3C36 A;  4QSD A;  3IB1 A;  1JQF A;  4LP2 B;  3SET A;  1P1U A;  1A99 A;  5L9O A;  4H0W A;  3RLF E;  2V4C A;  3VDF A;  1RDY A;  2P3V A;  3T9H B;  2RF1 A;  3IOR A;  4OAN A;  4R2F A;  1QJM A;  2F7B A;  4P56 A;  1SYH A;  4LON B;  1HSE A;  3MP6 A;  1OLA A;  5CBR A;  1R9Q A;  4XKP A;  3UGW A;  3IB2 A;  1B46 A;  1FTO A;  3MAM A;  1LCT A;  2VGQ A;  4MJO A;  5I2K A;  4I9D A;  2Y7P A;  4ELP A;  1ZLQ A;  1SD3 A;  5T3J A;  1JVY A;  1MY1 A;  5ICT A;  3OEK A;  4GF8 A;  4H67 A;  1XI6 A;  3TTK A;  1Q1K A;  5H8Q A;  4IY5 A;  4P11 A;  3QUJ A;  1FPK A;  2HAU A;  3SEY A;  4ECF A;  1FPB A;  3GZG A;  1JNF A;  5M2V A;  4OVT A;  4O3A A;  1B7H A;  1K9Y A;  3JV9 A;  4EF2 A;  2IEE A;  3RN8 A;  4POX A;  1POT A;  2CZK A;  3F11 A;  1FPL A;  2RC7 A;  1CE2 A;  2PYY A;  3RT8 A;  2DYX A;  4IO5 A;  3IJO B;  4MNC A;  2VD3 A;  3EN3 A;  4MNP A;  1IMB A;  4P0I A;  2CZH A;  4HE0 A;  5TPA A;  1I6Q A;  4R9F A;  3TYH A;  2F3B A;  4X8R A;  3OO8 A;  3TMG A;  1H45 A;  2HEU A;  4P0G A;  4PP0 A;  4OMB A;  3CRB A;  1Y3Q A;  4N17 A;  3T9V A;  4N4U A;  2Q8J A;  3TCG A;  2KR0 A;  4P1L A;  2ZZX A;  1MDP 1;  2I48 A;  1NUY A;  1LBZ A;  1MXY A;  2Z8F A;  2Y7I A;  4Q8R A;  3QXM A;  4PDH A;  5L9S A;  2XXV A;  2B4L A;  3KC1 A;  2XXT A;  3MQ9 A;  1YYZ A;  2V3Q A;  1FQF A;  4U23 A;  3SEX A;  3PUV E;  3K1M A;  5TP9 B;  3HST A;  3H6V A;  2DP8 A;  4PFU A;  1S50 A;  1B3E A;  2QVR A;  1Y3N A;  3CFX A;  3KG2 A;  3TOD A;  1IMA A;  5EQ9 A;  1N0T A;  4F29 A;  2DE4 A;  3K0V A;  2M8C A;  3ECR A;  1ZKB A;  3T1B A;  2QS1 A;  2Z23 A;  4MLQ A;  2GQ1 A;  3R26 A;  1KWH A;  5HPQ A;  2O68 A;  2BJJ X;  3KN3 A;  3KSJ A;  1DTG A;  1AMF A; 
#chains in the Genus database with same CATH homology
 2G29 A;  2D5W A;  1USY E;  3H6U A;  1I69 A;  2ZYK A;  2PX1 A;  1MXU A;  4WXJ A;  2R71 A;  1MPC A;  4YKI A;  2O51 A;  1LFI A;  4PFY A;  5I84 A;  3JZJ A;  3RT6 B;  2GFE A;  4JB7 A;  1IIW A;  5CMC A;  3OO6 A;  2F5X A;  1ZJL A;  1VFE A;  1SW2 A;  4H5F A;  3VVF A;  4IGT A;  4LQ5 A;  1AL3 A;  1B5J A;  4ZEF A;  1B1X A;  4YB5 A;  2ABH A;  3MVX A;  2QRY A;  3S4U A;  1II5 A;  4DCY A;  2E0S A;  5BWJ A;  3FJ7 A;  1OMP A;  2XXR A;  4PE5 B;  5F7V A;  3N6U A;  3FAT A;  3CI8 A;  2AL5 A;  1NNF A;  2XHD A;  1MPB A;  4RPO A;  1IZ1 A;  4FEB A;  3Q26 A;  4OQO A;  3TEP A;  3T66 A;  3S9N C;  5KDT A;  3MW0 A;  2O6A A;  3FJM A;  1T0K A;  3V89 B;  1RKM A;  1XVX A;  3C4M A;  5I56 A;  3JYR A;  4KYE A;  2I0C A;  2H5Y A;  2H99 A;  4ELR A;  3O6G A;  4LVQ A;  2XX8 A;  3IR1 A;  5JTY B;  4H8J A;  5CRY A;  4KI0 E;  4YU0 A;  3K1N A;  1OVB A;  1NNK A;  3PPO A;  2RCB A;  5HBC A;  1UTB A;  4HW8 A;  3O2A A;  3TTN A;  3LSF B;  4NF5 B;  4YKJ A;  2R9J A;  5AA3 A;  4OVJ A;  5CMB A;  1UQW A;  3SEW A;  3H6T A;  4RJZ A;  2PMS A;  4YZZ A;  2QL3 A;  1Y4C A;  2PT2 A;  1SW5 A;  1MXW A;  1PBP A;  2ESN A;  1B6H A;  3MWB A;  1Y1M A;  3FV1 A;  4HCY A;  1LLS A;  5KCJ B;  1VE4 A;  3HV1 A;  3K01 A;  1LAH E;  1UIU A;  4Z0I A;  4G8M A;  1OQH A;  1EH3 A;  1O7T A;  2OCU A;  2B3B A;  1MPD A;  4F3B A;  1R1N A;  2P2A A;  3H6W A;  2B65 A;  2NXO A;  4NF8 B;  3G3H A;  3MVY A;  3TTM A;  1B5H A;  1PC3 A;  4RK2 A;  2I3V A;  3B6W A;  2I3W A;  3MP8 A;  3SEU A;  1SDX A;  3EHT A;  2ZNS A;  1PEB A;  1NFT A;  1IXC A;  2V3T A;  4NF6 A;  3FV2 A;  3IX1 A;  3K6V A;  3FZV A;  1QKA A;  4TLM B;  5CBS A;  1IUD A;  3N94 A;  2RCA A;  3M3L A;  3LSL A;  3KOT A;  3FXR A;  3LC8 A;  4OHN A;  4RK9 A;  1PB7 A;  4F22 A;  1B0H A;  1FW0 A;  1P99 A;  2I58 A;  2F78 A;  2GHB A;  1OLC A;  3QUF A;  3OOA A;  3V8X B;  3RPW A;  1NNP A;  3K00 A;  5FTI A;  5I59 B;  1N76 A;  3TQW A;  3PUZ E;  1A40 A;  3SES A;  1ELJ A;  4Q5T A;  2Q9T A;  3UK4 A;  1GGG A;  2FNC A;  5FHM A;  3PV0 E;  5TP9 A;  3PPR A;  2I6E A;  3U72 A;  2CZL A;  3N6T A;  1TWY A;  2I49 A;  3G3F A;  3TPA A;  2QS3 A;  1MQJ A;  1XC1 A;  4R2B A;  4GXA A;  1M5F A;  4YIC A;  3VXC A;  1S7Y A;  1P1N A;  2YPN A;  4YB7 A;  1OIB A;  3VV5 A;  2NOO A;  1MXV A;  1N7W A;  4ZZA A;  4FAJ A;  1B51 A;  4R74 A;  2O1M A;  4X1B A;  5AA2 A;  1LBC A;  2GHA A;  1QUL A;  2DVZ A;  5H8N A;  3HPI A;  2RIN A;  3KGC A;  5JK4 A;  3ZS6 A;  3BFT A;  3SER A;  3UA8 A;  3A3C A;  4QRZ A;  4XKQ A;  1JEU A;  1GV8 A;  4LUB A;  4YKK A;  2F7C A;  3QAX A;  2F8D A;  3OXN A;  4IO2 A;  3C35 A;  4HTG A;  1AOV A;  3PUW E;  4NWC A;  2Y84 A;  2ZYM A;  4R6K A;  4EDP A;  3Q27 A;  2DWH A;  2Z8D A;  4C1U A;  5ISU A;  2V3U A;  3Q28 A;  5H8F B;  1P1O A;  4N13 A;  4IY6 A;  2AIX A;  3UOR A;  1N04 A;  4R73 A;  3SKP A;  3O6I A;  1B0L A;  3ZKK A;  3TZA A;  4MLV A;  1UIV A;  4KFQ A;  1FTM A;  4EUO A;  5DTB A;  4R6Y A;  3G3G A;  4GL0 A;  1VSO A;  4GVO A;  3CSB A;  1AH5 A;  4G2Z A;  3PD8 A;  4G8N A;  2VHA A;  3SEV A;  4ISU A;  2DWJ A;  2UVG A;  1DPE A;  1MY3 A;  2Y7W A;  4HCW A;  3C9H A;  4Q0C A;  1VR5 A;  4OZ9 A;  4MH5 A;  2AYS A;  3VLW A;  3PPQ A;  1SI0 A;  3ILU B;  3T9U A;  4IO6 A;  3OO7 A;  1N3W A;  3MUQ A;  4E0W A;  2VOZ A;  4X1D A;  4ELO A;  5I57 B;  4PFW A;  3OD7 A;  2HAV A;  4F3G A;  2QS2 A;  3VLV A;  4F2O A;  4TLL B;  5K2X A;  1MXX A;  1Y3P A;  5AA1 A;  1B52 A;  4X48 A;  3OSR A;  3O29 A;  5L9M A;  4U1Z A;  4DCX A;  2Q89 A;  3KFM A;  4YB6 A;  3PPP A;  1ZBM A;  1Z7M E;  2QSX A;  2VP1 A;  2V25 A;  4BLA A;  3I3V A;  3R7X A;  3TTR A;  1LAG E;  2PVU A;  3FVK A;  3IOV A;  1B9J A;  3TDJ A;  3AXF A;  5KCJ A;  3MBP A;  3N26 A;  1A8F A;  1ZIU A;  4G4P A;  2F7A A;  1IIT A;  4NF4 B;  4G8H A;  1A54 A;  2YJP A;  1BKA A;  2OWT A;  3KEI A;  2Z22 A;  4BDQ A;  2DVC A;  4H8I A;  1TXF A;  2UYF A;  5EHS A;  4JXI A;  5TU0 A;  3GBA A;  1MQD A;  3IOW A;  5FHN A;  3PGF A;  4U4X A;  2QMX A;  4LA9 A;  4NF8 A;  3I5O A;  3KBR A;  4YMB A;  1Y9U A;  5A5X B;  1O64 A;  4BDR A;  1B40 A;  4YMA A;  1JVX A;  4JDF A;  5EHM A;  3FJG A;  1QKB A;  2O69 A;  3S9M C;  4JWO A;  3O6H A;  4O3C A;  4UAC A;  1A8E A;  2ZYN A;  1OQG A;  5F1Q A;  3OEN A;  4IO3 A;  4EQ7 A;  2I4C A;  4TQU Q;  1FQD A;  1LFG A;  2G93 A;  5AA4 B;  1HSJ A;  1URG A;  3D4C A;  4EXK A;  4X9T A;  1DPP A;  1MG1 A;  3WAF A;  4NWD A;  3DEL B;  1IXI A;  4GD5 A;  1B5I A;  5CI5 A;  4YKP A;  4WEP A;  4QFK A;  3EPE A;  3UN6 A;  4AB6 A;  1I6B A;  4NE4 A;  2DWA A;  4R75 A;  2DXY A;  3EHS A;  4OEN A;  4GFR A;  4FJP A;  4GQO A;  1A55 A;  3TEL A;  2DXR A;  2Q88 A;  2LAO A;  3THI A;  1QUJ A;  4RY1 A;  2HXW A;  4N07 A;  2UVJ A;  2X7Q A;  4YAH X;  1SW1 A;  3V5A A;  2F36 A;  5B7D A;  1MM7 A;  5CC2 A;  2V93 A;  4JWX A;  1B7U A;  1P1W A;  2UVH A;  1MXZ A;  1ZTY A;  3TAJ A;  4ZEI A;  5I2K B;  2XXX A;  3KSX A;  4OTE A;  3UP9 A;  4BDM A;  2NWJ A;  3U94 A;  3RQT A;  5KZT A;  3G3I A;  1BIY A;  2XXP A;  2I0B A;  3IOU A;  2ANJ A;  5H8Q B;  5I58 A;  1H3D A;  4LZ7 A;  4ONY A;  3E4R A;  4ESX A;  3S9L C;  1FQC A;  4PFT A;  1B3L A;  4GIZ A;  1LAF E;  2GH9 A;  4HS7 A;  3W9W A;  4Q30 B;  3CG3 A;  3IJX B;  3S2V A;  4F1Y A;  1O63 A;  3VLU A;  3K4U A;  1H43 A;  3O28 A;  1QVS A;  2H98 A;  3GXA A;  3RGY A;  1MM6 A;  2HZL A;  1IEJ A;  4EF1 A;  4WED A;  4QHQ A;  3TKD A;  4MFI A;  5CM6 A;  5B70 A;  1PB9 A;  3UIF A;  5CMK A;  5AE4 A;  1SI1 A;  3T9X B;  3KJ7 A;  2ZYO A;  4KHZ E;  3TUS A;  3LUY A;  1P1Q A;  4EQB A;  5DVI A;  5H8F A;  4EQ9 A;  3C33 A;  1MY4 A;  4L17 A;  5CMM A;  4C1T A;  1R6Z A;  3MPL A;  4THI A;  2QPQ A;  4RPN A;  4XKR A;  3IO4 A;  2HZK A;  2XXQ A;  2E1S A;  5IKB A;  1B1H A;  1POY 1;  1N84 A;  3K2D A;  3B6Q A;  3BFU A;  4F31 B;  3ZKL A;  1EZ9 A;  4UA8 A;  4I62 A;  3L6H A;  4DXU A;  5DEX B;  2A5T B;  3CSG A;  3H3G A;  2Y7K A;  4OES A;  5I57 A;  2H4I A;  1MQG A;  3RY3 A;  4ZE8 A;  4FIM A;  5IAI A;  3LSX A;  4JSO A;  4QSE A;  4QFN A;  2DWI A;  4KCC A;  4GWO A;  1MQH A;  3N5L A;  3OEL A;  4OEV A;  3M8U A;  3USD A;  1JW4 A;  3DP4 A;  4R72 A;  1FQA A;  4BDN A;  5BUU A;  4DZ1 A;  1RYX A;  2ZNU A;  3FVO A;  3DP8 A;  3E13 X;  2QMW A;  3DP6 A;  4G77 A;  4U22 A;  4H5G A;  2ZMB A;  2ZNT A;  1MDQ A;  1GR2 A;  4ESW A;  4H1X A;  3FAS A;  5L8D A;  4ZDM A;  5DYH A;  2QJE A;  4NF4 A;  4R6H A;  4K3F A;  1LAX A;  4QFP A;  1LST A;  2PBW A;  4DE8 A;  5I56 B;  2VD2 A;  4KPT A;  2YLN A;  5A5X A;  1NL5 A;  3VVD A;  4U21 A;  4KYD A;  1AIV A;  3MZ1 A;  1EU8 A;  1J1N A;  2I4B A;  3OSQ A;  2DE3 A;  3FVG A;  1GTK A;  3GBB A;  1B05 A;  4BDO A;  4IGR A;  4LAT A;  3HN0 A;  4DIG A;  1EZO A;  4XTC Q;  4OEU A;  3IOT A;  2OZZ A;  3K1P A;  5H8H B;  4R9G A;  1SQY A;  2Q2A A;  4IO7 A;  4RYA A;  1PDA A;  1LBB A;  2NUV A;  4QF9 A;  4F1V A;  3DM0 A;  4F19 A;  3A3U A;  3TTL A;  5I2N B;  3ONM A;  3KJT A;  3HHG A;  1ANF A;  4AB5 A;  2UVI A;  1H76 A;  1XOC A;  5EYF A;  3MPK A;  2F6P A;  4DXB A;  2B3F A;  2D21 A;  2FA7 A;  4G68 B;  1NKX A;  4H6D A;  3MZB A;  2UYE A;  3PMV A;  3MC2 A;  4OWD A;  3Q25 A;  1M5E A;  4OXV A;  3VXB A;  2OBG A;  2UXA A;  3C34 A;  1FTJ A;  4RA1 A;  4ZED A;  2ONS A;  1TT1 A;  2F6G A;  4GL8 A;  3MP1 A;  1GVC A;  1Z7N E;  4ZEB A;  1PBQ A;  4XKN A;  5JTY A;  2XXW A;  2Y7R A;  4KQP A;  5DVJ A;  5H8S A;  3FVN A;  3B6T A;  1IXG A;  4IO4 A;  2ZXT A;  2AL4 A;  1XT8 A;  4TOZ A;  2DOJ A;  4DDD A;  3VVE A;  4NF6 B;  4PQJ A;  2RC8 A;  1UTH B;  3MJN A;  3BKI B;  3IK6 B;  4NF5 A;  1BLF A;  5ICQ A;  4IB2 A;  2XXH A;  4H65 A;  3ILT B;  3HO7 A;  2H25 A;  3O66 A;  2THI A;  1RYO A;  3VFJ A;  1NNT A;  4NMY A;  2DS9 A;  3FUZ A;  4KR5 A;  1NH7 A;  1LB8 A;  1YAE A;  3VE1 B;  4OFJ A;  4QSC A;  1R9L A;  2P0S A;  4GOT A;  3T22 A;  2Q2C A;  2F97 A;  1B7Z A;  3O97 A;  1OVT A;  3K6X A;  3B7D A;  5FTH A;  4U2R A;  1SBP A;  2XD2 A;  1YPN A;  3U8Q A;  2XXU A;  4JSD A;  1B3H A;  3C32 A;  2DE2 A;  4FE8 A;  4QFO A;  4OYV A;  3PMX A;  1A7L A;  3C31 A;  2IA4 A;  3QIM A;  3EF7 A;  1SYI A;  2XX7 A;  3PPN A;  3TFL A;  4LQ2 A;  1LGB C;  4O3B A;  5AA2 B;  4KD5 A;  4DXC A;  1MY2 A;  4FED A;  3MVZ A;  3MVW A;  5H8N B;  3CVG A;  1QUI A;  1ZU0 A;  1VFD A;  1URS A;  3G3K A;  1HSL A;  5DEX A;  2A5T A;  3GLB A;  4FAT A;  1XVY A;  5ITO A;  2OJT A;  3RNN A;  1MRP A;  2D3I A;  4BDL A;  4ZS9 A;  3K02 A;  2X7P A;  1SVX B;  3KN7 A;  3U93 A;  4M4G A;  3FXU A;  4GLI A;  1FQB A;  3QK6 A;  3OO9 A;  4KYS A;  2HCA A;  4KCD A;  1BTJ A;  4FOR A;  5I59 A;  2X26 A;  4XXU A;  1NMU A;  5K2Y A;  3W9V A;  4FEC A;  2ONR A;  4ELQ A;  3W15 C;  3TQL A;  4DLD A;  3KZG A;  3IB0 A;  4Z7E A;  4QFL A;  2F35 A;  4M1V A;  1B3G A;  3FXQ A;  1BP5 A;  1B4Z A;  3K6U A;  4RXL A;  1PB8 A;  1MH4 A;  3MZ9 A;  1ZMG A;  1M5B A;  4POW A;  4ZEC A;  3KN8 A;  2H9B A;  4NTL A;  3M3F A;  2Z8E A;  2QS4 A;  1B4H A;  4AQ4 A;  4F3S A;  3E9X A;  3A09 A;  1IXH A;  1FCK A;  1USY H;  2REG A;  3PD9 A;  1N3X A;  3WAE A;  4RNS A;  4G68 C;  3R6U A;  2O7I A;  2W7Y A;  5JEI A;  3EHU A;  1LCF A;  3CFZ A;  5TPA B;  3FIR A;  1JW5 A;  5H8H A;  3IO6 A;  4MF3 A;  1XHY A;  3PUY E;  2ALU A;  1D3K A;  1ATG A;  5I2N A;  1LFH A;  1B3F A;  3PMW A;  3T93 B;  4E0X A;  2KLF A;  3RTW B;  1DOT A;  1M5C A;  4OFL A;  4G68 A;  1CB6 A;  3BBR A;  3EQ1 A;  3QYT A;  4ZEK A;  3G3J A;  4WKM A;  1IQ7 A;  4F39 A;  3E3K A;  3D4G A;  1TFD A;  4ND9 A;  1S9T A;  1TFA A;  4U4S A;  3U92 A;  1FQE A;  3TCF A;  5DT6 A;  4OET A;  2R6G E;  2RC9 A;  4LZ8 A;  5LOM A;  3CIJ A;  3G7W A;  5AA2 D;  3IL1 B;  3OEM A;  4ZZE A;  2NVU B;  5HM4 B;  3RUM A;  3Q29 A;  1UTH A;  1M5D A;  1DMB A;  3V83 A;  3KOS A;  1WVJ A;  4C0R A;  4NED A;  2GRV A;  3PU5 A;  1DTZ A;  1JEV A;  2DSF A;  2O1L A;  4JWY A;  3QSL A;  1MQI A;  2WKY A;  3U1O A;  1DSN A;  4PET A;  3ODB A;  3P7I A;  4I1D A;  1I6A A;  3TCH A;  2OLB A;  2O7U A;  1YCJ A;  2XD3 A;  4F3P A;  2OWS A;  3K6W A;  1N7X A;  1FTK A;  1JW1 A;  1MH3 A;  1YTV A;  4LZ5 A;  2HFB A;  3IAZ A;  3LSW A;  4F18 A;  1WOD A;  4GRK A;  3H06 B;  3HCQ A;  1Y4T A;  4I8C A;  1XS5 A;  1WDN A;  1SW4 A;  2XXY A;  5KDT B;  1US5 A;  2HQ0 A;  4EXL A;  1H44 A;  5ELV A;  2A5S A;  3HHF A;  4F2Q A;  3FGS A;  3L6G A;  1EZP A;  1D4N A;  4ZE9 A;  3S9E A;  1NH8 A;  4JBZ A;  1QUK A;  3PUX E;  2FYI A;  3SDF A;  5ITP A;  1Q35 A;  3LR1 A;  2P1S A;  4OFO A;  3CR9 A;  2F34 A;  3ZSF A;  1JET A;  4XIG Q;  2CMO A;  3H4Z A;  5J1D A;  1D9V A;  3M3K A;  1F9B A;  1LB9 A;  2V84 A;  3CG1 A;  5I58 B;  1B32 A;  1B2H A;  1QW0 A;  2PT1 A;  2RKM A;  3DLN A;  2XXI A;  3O9P A;  3OMB A;  4N6P A;  4MBP A;  2REJ A;  3H03 A;  1US4 A;  3FD3 A;  5AA4 A;  5DVF A;  1D9Y A;  3I6V A;  1FTL A;  1UTB B;  2O84 X;  4GXS B;  3CFL A;  4F1U A;  1Y20 A;  2ONK E;  3RTF B;  1URD A;  1Y1Z A;  3H7M A;  1L5T A;  4U1O A;  4OER A;  1B58 A;  1MS7 A;  2OK2 A;  5FHO A;  1MY0 A;  3LBS A;  2DQV A;  2XX9 A;  3T96 B;  3C36 A;  4QSD A;  3IB1 A;  1JQF A;  4LP2 B;  3SET A;  1P1U A;  1A99 A;  5L9O A;  4H0W A;  3RLF E;  3VDF A;  3T9H B;  2RF1 A;  3IOR A;  4R2F A;  1QJM A;  2F7B A;  1SYH A;  4LON B;  1HSE A;  3MP6 A;  1OLA A;  5CBR A;  1R9Q A;  4XKP A;  3UGW A;  3IB2 A;  1B46 A;  1FTO A;  3MAM A;  1LCT A;  2VGQ A;  5I2K A;  4I9D A;  2Y7P A;  4ELP A;  1ZLQ A;  1SD3 A;  1JVY A;  1MY1 A;  5ICT A;  3OEK A;  4GF8 A;  4H67 A;  3TTK A;  1Q1K A;  5H8Q A;  4IY5 A;  4P11 A;  3QUJ A;  2HAU A;  3SEY A;  4ECF A;  3GZG A;  1JNF A;  5M2V A;  4O3A A;  1B7H A;  3JV9 A;  4EF2 A;  2IEE A;  3RN8 A;  4POX A;  1POT A;  3F11 A;  2RC7 A;  1CE2 A;  2PYY A;  3RT8 A;  2DYX A;  4IO5 A;  3IJO B;  2VD3 A;  3EN3 A;  4P0I A;  5TPA A;  1I6Q A;  4R9F A;  3TYH A;  3OO8 A;  3TMG A;  1H45 A;  2HEU A;  4P0G A;  4PP0 A;  4OMB A;  3CRB A;  1Y3Q A;  3T9V A;  2Q8J A;  3TCG A;  1MDP 1;  2I48 A;  1MXY A;  2Z8F A;  2Y7I A;  4Q8R A;  3QXM A;  5L9S A;  2XXV A;  2XXT A;  3MQ9 A;  2V3Q A;  1FQF A;  3SEX A;  4U23 A;  3PUV E;  3K1M A;  5TP9 B;  3HST A;  3H6V A;  2DP8 A;  4PFU A;  1S50 A;  1B3E A;  1Y3N A;  3CFX A;  3KG2 A;  3TOD A;  1N0T A;  4F29 A;  2DE4 A;  3K0V A;  2M8C A;  3ECR A;  1ZKB A;  2QS1 A;  2Z23 A;  4MLQ A;  3R26 A;  1KWH A;  5HPQ A;  2O68 A;  2BJJ X;  3KN3 A;  3KSJ A;  1DTG A;  1AMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...