4R75A

Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous sedoheptulose-7-phosphate bound)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
318
structure length
318
Chain Sequence
KGRLVIYCSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAKVKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYTAIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQGAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTNTTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC-type Fe3+ transport system, periplasmic component
publication title Active Transport of Phosphorylated Carbohydrates Promotes Intestinal Colonization and Transmission of a Bacterial Pathogen.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
total genus 117
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r75A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r75A01
3VLWA 3HO7A 3PU5A 1DSNA 1B52A 2HAVA 4RJZA 3C9HA 5AE4A 1JNFA 1N7XA 3TFLA 4YKKA 3MJNA 1RKMA 2H99A 3TTRA 3IOWA 3IR1A 2NWJA 2VD3A 2P1SA 3S9MC 1LAHE 3ZSFA 3SEWA 1MH4A 1D4NA 4LZ8A 4FJPA 2DE4A 1JETA 4ISUA 4HCWA 5KDTA 3EN3A 5F7VA 3FGSA 4OMBA 2ZXTA 4X48A 3PD9A 1M5FA 3IX1A 3T9XB 2DXYA 5I59B 5I2NB 3LBSA 3ZS6A 4OVJA 4KHZE 4F2QA 1O7TA 5CC2A 3IJXB 2O69A 4Q30B 4OTEA 4QFPA 1VE4A 4DCXA 2I58A 3PMVA 4ZZEA 4IY6A 4F3PA 3KBRA 4KCDA 4ELRA 1FTLA 4POXA 1H44A 1LCFA 2PYYA 4EQBA 1POTA 3OEMA 3TELA 4XKPA 3T96B 2Q2CA 4K3FA 4QRZA 3K6VA 4IO5A 4KQPA 4HS7A 1PB8A 5ITOA 4YAHX 4HTGA 4FORA 2H9BA 1AOVA 1A7LA 5H8FA 2F7AA 1FTOA 1MQDA 2XXUA 4U23A 3IO6A 3SETA 1JW1A 2F8DA 5L9MA 1URDA 3VLUA 2ZMBA 3C31A 2QS4A 3UN6A 1OLCA 4ELOA 1MQGA 3RTWB 3O6GA 3CFXA 4Z7EA 3QSLA 1XOCA 2H4IA 1SDXA 4WKMA 1SW1A 1Y4TA 1MQHA 2UVIA 5L9SA 3CSBA 2F78A 2FYIA 2H25A 4H0WA 3TDJA 1LAXA 2Z8EA 3LSLA 5A5XA 4F1VA 3HN0A 4Q0CA 4YKIA 3QIMA 1IXGA 2V3QA 3FATA 4H5GA 4BLAA 1R9LA 5DT6A 3MP8A 3FJGA 4LZ5A 5DEXA 1D9YA 3PUZE 1MM6A 1MY1A 4PFTA 2V93A 3B7DA 1B05A 3VVEA 2ZYNA 3VV5A 1SD3A 1F9BA 4R2FA 4IGTA 1NMUA 3VLVA 3G3IA 4FECA 3O66A 1B7ZA 1II5A 3G3FA 1ZBMA 3U1OA 2ZNTA 3BFUA 1ZJLA 3E13X 3FJ7A 3QUFA 2NXOA 1D9VA 5KCJA 4G4PA 5ITPA 3D4CA 2D3IA 5AA4A 4WEPA 2O7UA 5B7DA 2O6AA 3MAMA 1LAGE 2P2AA 2Q9TA 4NF5B 3K1MA 4RK9A 1SVXB 1M5CA 3TYHA 2QMXA 4O3AA 5TPAB 5HBCA 2QPQA 4FE8A 3FVOA 4KCCA 3U8QA 2Z23A 1PC3A 3BFTA 4AB6A 5CMBA 1SW4A 3OO7A 1QUJA 1FCKA 5IKBA 4LP2B 5JTYB 4DXCA 3UK4A 1IXCA 4OYVA 1OMPA 3FXRA 3E9XA 3TAJA 2GHBA 3RPWA 1FQDA 5TP9A 4NF8A 4IO3A 2DWHA 3B6QA 5FTHA 5ICTA 2Q89A 3EF7A 2DP8A 2B3BA 1USYH 4OZ9A 3OO6A 2QL3A 4G2ZA 1NH7A 4NWDA 3H7MA 3O29A 3S4UA 2XXRA 2V3UA 3VVDA 5J1DA 4QFNA 1QW0A 4X1DA 3DELB 3R6UA 3MQ9A 4ZS9A 5K2XA 3DLNA 4FEDA 1UQWA 1LB8A 5I57B 3V8XB 2OK2A 1VR5A 3OO8A 1LSTA 2DVZA 3MZBA 1CE2A 2Y7KA 4POWA 1LLSA 4OXVA 1PEBA 2F6PA 3LSFB 4YICA 5I56A 2UVHA 2QS3A 5EYFA 3I6VA 4YB6A 3IL1B 2OBGA 3K1PA 1R6ZA 3CG1A 3MVYA 1EZ9A 3TKDA 3CI8A 2HZLA 2Y7RA 3HHFA 3C35A 1SQYA 1QJMA 1I6QA 3IO4A 1P1WA 4EUOA 3FUZA 3LC8A 5DVJA 4R72A 3OSRA 3PD8A 5BUUA 3H6TA 2YJPA 2XXPA 1B9JA 1H76A 4GQOA 4U21A 5I59A 5I2NA 1EH3A 1H43A 5I58B 1TXFA 4DLDA 5I84A 4I9DA 1PBPA 3HHGA 4LVQA 1B40A 1TWYA 3QXMA 3U93A 1A54A 5DYHA 3HV1A 2RCBA 1MXYA 2AL4A 4EDPA 4KPTA 4Z0IA 4ESXA 1SBPA 1B3GA 4X1BA 2O1MA 3HCQA 4GXAA 4R6KA 4U1ZA 2WKYA 5H8QB 3THIA 3UA8A 2QS1A 1OIBA 4QFKA 1WDNA 3K6WA 1N84A 1VFDA 3IB0A 5TU0A 4NF4B 2UVGA 1TFDA 3LR1A 4F1UA 2DS9A 3K6UA 1ZU0A 4F19A 1Y1MA 5K2YA 4NE4A 3VDFA 4NMYA 1UIUA 2OLBA 2ZNSA 1SW2A 2UVJA 3RTFB 1B3LA 2X7PA 3MWBA 4RPOA 2QS2A 3UP9A 1IXHA 3C33A 4G68C 2F7BA 3KN8A 2Q88A 3T93B 1LCTA 1GV8A 1PDAA 4GL8A 4GXSB 3SEUA 2M8CA 4ZE9A 4I1DA 1IEJA 3K4UA 3SEVA 4OWDA 1LFIA 4U2RA 4GIZA 3IB1A 3FD3A 5F1QA 1CB6A 4PFUA 4YZZA 5CM6A 3KJTA 4XTCQ 1XVYA 2G29A 4UACA 1XVXA 2PT2A 1T0KA 1B58A 4R6HA 1FW0A 4ONYA 4JWXA 1B0HA 3ILUB 1MY4A 1R1NA 1LBBA 4F39A 4N13A 3PGFA 2F97A 3MVZA 4TLMB 2F35A 1B5JA 1MXZA 2ZYOA 2DVCA 2OWTA 4GOTA 4F1YA 1JEVA 4P0GA 3TPAA 2CZLA 1B3FA 5M2VA 1Y1ZA 1N04A 2H98A 4F18A 1MY3A 1OVBA 3U94A 5LOMA 3AXFA 3EHUA 3C36A 3KZGA 4U4SA 3FASA 1FTKA 3C32A 4NF5A 1URSA 1M5BA 1RYXA 5TPAA 4QFOA 4U22A 4XKRA 3WAEA 4G68A 4P0IA 4G8HA 4GLIA 3OD7A 3C4MA 3OXNA 1P1QA 2GFEA 3S9EA 1MPDA 1MXWA 2AYSA 3MZ1A 3U72A 1NNFA 1BTJA 1TFAA 3FVNA 1B3HA 2Q2AA 2VHAA 4JWYA 1H3DA 3VVFA 2A5TB 1ZLQA 3RUMA 1SYIA 3TCGA 1EZOA 3W15C 4H8IA 3O6IA 4GL0A 2RF1A 4X9TA 2KLFA 3MZ9A 3V89B 3MBPA 3WAFA 3MP6A 1KWHA 4NWCA 1A55A 1AL3A 3DP8A 1BIYA 1BKAA 2PBWA 4EXKA 2VOZA 4U4XA 5I57A 3PMXA 2UXAA 1GGGA 1MG1A 4P11A 4PFYA 1Q1KA 4LONB 3G3JA 2I3VA 3TTLA 3H6UA 1UIVA 2RINA 2Z8FA 1VSOA 3VE1B 5H8NB 1RYOA 2RC7A 2I0BA 1MDP1 4F22A 4ELPA 4IGRA 3RY3A 3IOUA 4FEBA 3FVGA 4JSOA 3CVGA 4LZ7A 3S9LC 2OJTA 4QSDA 3ECRA 1UTHB 4IO6A 4JWOA 3PUWE 3CR9A 4R9GA 4R74A 5AA3A 2F5XA 2X7QA 1ZIUA 1URGA 1DPEA 4MH5A 3RNNA 3W9WA 2HCAA 2REGA 3N5LA 1DOTA 1D3KA 5I58A 4YKPA 5FTIA 3IORA 3V5AA 4YB7A 3P7IA 4AQ4A 1MPBA 3KOTA 1US4A 4ZEFA 1MM7A 4RK2A 4ZEIA 1MS7A 3KGCA 3K2DA 2OCUA 5JEIA 4OEUA 4QHQA 4OHNA 2ONSA 1MY0A 3BBRA 3IJOB 3LSWA 5H8QA 4EF1A 2VP1A 1O63A 3KSXA 4O3BA 3GLBA 3IOTA 4NEDA 3M3LA 4FIMA 2DWAA 1B4ZA 1AMFA 4YMAA 5HPQA 2UYEA 3D4GA 1XT8A 4JXIA 1WODA 2FA7A 2I4BA 3PPOA 2VGQA 3EHSA 5DVIA 4RXLA 3TZAA 1IQ7A 3Q29A 2BJJX 1Y20A 4M1VA 3EPEA 2XHDA 4PQJA 5H8HB 1JEUA 3SKPA 4XXUA 3KJ7A 3EQ1A 4JB7A 3GBAA 3TCFA 3CSGA 4RPNA 4F3GA 4WXJA 2I4CA 3OOAA 3VXBA 4U1OA 3FXQA 3OMBA 3T66A 5IAIA 2F36A 4HCYA 3KN7A 2ALUA 3DP6A 1PBQA 2OWSA 1ZTYA 1YAEA 2XD3A 1VFEA 4DDDA 2O7IA 1JVXA 1IIWA 4H6DA 1MQJA 3KSJA 5ELVA 3TTNA 5CRYA 3KOSA 3SEXA 2I6EA 2Y7WA 1POY1 3I3VA 4TLLB 4WEDA 1Z7ME 3VXCA 1HSLA 4LATA 4QFLA 2PMSA 2X26A 3FV2A 2GH9A 1NKXA 4GVOA 4FAJA 3MPLA 2HZKA 3QK6A 4IO2A 3T22A 1P1UA 2GRVA 4GFRA 3GZGA 2XXTA 1DMBA 3GBBA 1B4HA 1WVJA 3O6HA 4GF8A 4M4GA 1BP5A 1Y4CA 3L6HA 4GWOA 2O1LA 2I48A 2ZYKA 1BLFA 1B2HA 3FV1A 4C0RA 1Y3QA 4LUBA 3RN8A 3A09A 4Q8RA 2O51A 2Y84A 2QJEA 2RCAA 2DXRA 3I5OA 4MLVA 5CBSA 2F6GA 3V83A 4IY5A 3TQLA 4OFOA 2A5TA 4E0WA 3OENA 2QSXA 2IEEA 5ICQA 4KD5A 2ESNA 1LB9A 1FQEA 2D21A 2XXHA 4PFWA 4ZEBA 1JVYA 3H03A 3ONMA 4F29A 3PV0E 1XC1A 1AH5A 4ZZAA 1N3WA 2DE3A 5AA2D 4NF6B 5CBRA 2B65A 1YPNA 1IITA 3PPPA 4KR5A 2E1SA 3H6WA 3LUYA 1N0TA 2XXIA 3IB2A 3C34A 2V84A 1QULA 1Z7NE 5CMMA 1N3XA 2AL5A 2R9JA 1Q35A 4BDLA 3TTMA 2RC9A 4N6PA 2QRYA 1B46A 3RQTA 3Q27A 1SI0A 1FTJA 3LSXA 4R9FA 2DYXA 5H8NA 1GR2A 4MFIA 4O3CA 1LAFE 2DOJA 2V3TA 3Q28A 1B5IA 1FQFA 2G93A 2FNCA 1US5A 4Q5TA 4OFJA 3QYTA 5ISUA 4IB2A 5EHMA 1MQIA 4DZ1A 3FJMA 1DTZA 4H8JA 1UTHA 1Y9UA 3H3GA 5JK4A 2O84X 3UGWA 3E4RA 1USYE 2PVUA 2HQ0A 2REJA 1QUIA 4PP0A 1HSEA 2H5YA 4PE5B 2DQVA 4XKNA 2RC8A 3N26A 1B1HA 4YKJA 3TMGA 3L6GA 3IAZA 4H1XA 2XXXA 3N6UA 2P0SA 2LAOA 3GXAA 2Z22A 3QUJA 3TUSA 2YPNA 5AA2B 4EQ7A 4FATA 1OLAA 4OEVA 3T9UA 2DWJA 1ATGA 1SI1A 3KFMA 3G3KA 4OETA 3KN3A 5FHMA 5EHSA 1I6AA 3CFLA 1N76A 3UIFA 1Y3PA 1GTKA 1J1NA 3HSTA 4DE8A 3F11A 3K6XA 4THIA 2I3WA 4EF2A 5JTYA 1I6BA 2XXYA 4F31B 3O28A 5I2KB 3G3GA 1LFGA 4F3BA 3K02A 1SW5A 5AA1A 4ELQA 1QKAA 3FVKA 1MPCA 1DTGA 4OERA 3T9VA 4OESA 3T9HB 1B32A 3MP1A 4ZEDA 4G8NA 4KYSA 1MY2A 5H8HA 1JW4A 4DXBA 1DPPA 2R71A 3BKIB 2NUVA 3PPRA 2V25A 2GHAA 1MDQA 3TEPA 2HXWA 2W7YA 3OSQA 3CG3A 1P99A 2DE2A 4F2OA 1FQBA 4KYEA 3ZKKA 4AB5A 1Y3NA 1IXIA 2AIXA 2F34A 3W9VA 4MF3A 4H65A 4PETA 1B5HA 5BWJA 4R2BA 3K01A 1FQAA 1B51A 1P1NA 4ZDMA 2XXVA 4G77A 4N07A 4IO4A 5CMCA 4YB5A 3RLFE 1S50A 4OENA 1NFTA 2ZYMA 3MVWA 2HEUA 3O9PA 3O2AA 4C1UA 4LQ2A 5FHOA 4TQUQ 1UTBB 2CMOA 1N7WA 3MW0A 1A8EA 3A3CA 1ANFA 3B6WA 3KEIA 2DSFA 4R73A 1PB7A 1NH8A 3OO9A 2XXQA 3RT8A 5CI5A 4NTLA 3RT6B 4YMBA 1JQFA 3JYRA 3EHTA 3Q25A 3SDFA 4MLQA 2R6GE 2ANJA 2THIA 4QF9A 4RY1A 5KDTB 3ILTB 3PMWA 1NNTA 3U92A 1MXVA 3QAXA 1NNKA 3M3FA 5B70A 3SESA 1IUDA 4LA9A 3H6VA 5KZTA 4NF4A 4MBPA 1QUKA 4I8CA 2RKMA 3CFZA 3SEYA 1S9TA 3IOVA 4C1TA 4G68B 4JDFA 2XXWA 4NF6A 4KI0E 3M3KA 2E0SA 3R7XA 4ZE8A 1NNPA 2DWIA 1MXXA 1IZ1A 2NVUB 3OELA 3PUYE 4TOZA 4BDNA 1A99A 2XX8A 4ECFA 1MRPA 2UYFA 4BDMA 2OZZA 3CIJA 3M8UA 2XD2A 5H8FB 5H8SA 3A3UA 1I69A 4IO7A 3MUQA 3B6TA 3FZVA 1LFHA 3DP4A 4XKQA 1ZMGA 3HPIA 4F3SA 3VFJA 4E0XA 2Y7PA 4BDOA 3K1NA 4DIGA 3Q26A 3PUVE 4OFLA 2B3FA 2NOOA 4ZECA 3OEKA 4H67A 3IK6B 1ELJA 1OQHA 1EU8A 5DTBA 4KFQA 5FHNA 3ODBA 4LQ5A 1HSJA 1R9QA 4EXLA 4ESWA 2A5SA 3N94A 3TTKA 1EZPA 5A5XB 2HAUA 2I49A 2I0CA 1AIVA 3E3KA 2VD2A 4ZEKA 1QKBA 1QVSA 4I62A 3ZKLA 1YCJA 3TCHA 4JSDA 4ND9A 2ABHA 2YLNA 2QMWA 5DVFA 1ZKBA 3G7WA 1B7HA 5DEXB 3MVXA 2XX7A 3PPQA 4BDRA 3USDA 4YU0A 2D5WA 5AA2A 1SYHA 1P1OA 3G3HA 1PB9A 1LGBC 1B7UA 5L8DA 4DXUA 2IA4A 4KYDA 4H5FA 1XS5A 1OQGA 4QSEA 1L5TA 4R6YA 3R26A 2PX1A 3JV9A 4OQOA 5I2KA 5KCJB 1MH3A 4JBZA 4DCYA 3PPNA 4L17A 2ONKE 5AA4B 4HW8A 4R75A 1O64A 1LBCA 3MPKA 3H06B 1YTVA 2PT1A 3S9NC 1B6HA 1B1XA 2XX9A 1TT1A 5HM4B 2Y7IA 3RGYA 2O68A 2ZNUA 1JW5A 1A8FA 1OVTA 3JZJA 1S7YA 5CMKA 4RNSA 2HFBA 5TP9B 2ONRA 1NL5A 4NF8B 1H45A 3SERA 3MC2A 3O97A 4BDQA 3DM0A 4EQ9A 4GD5A 1GVCA 2Z8DA 3PUXE 4G8MA 3UORA 2F7CA 3KG2A 1FQCA 3K00A 1M5EA 1MXUA 1M5DA 1FTMA 1B3EA 3K0VA 5L9OA 3TQWA 3TODA 3FXUA 3FIRA 4UA8A 4QSCA 4GRKA 1XHYA 1A40A 4RA1A 3H4ZA 4RYAA 4XIGQ 1UTBA 2Q8JA 3N6TA 3CRBA 5I56B 3S2VA 1B0LA
chains in the Genus database with same CATH superfamily
3VLWA 3HO7A 3PU5A 1DSNA 4NN3A 1B52A 2HAVA 4RJZA 5T3JA 1FPDA 3C9HA 5AE4A 3BIHA 3EKIA 1JNFA 1N7XA 3TFLA 4YKKA 1FPIA 1RKMA 3MJNA 2H99A 3TTRA 4O7IA 3IOWA 3IR1A 2NWJA 1AWBA 2VD3A 2P1SA 3S9MC 5IZ1A 5EQ8A 1LAHE 3ZSFA 3SEWA 1MH4A 4N81A 1D4NA 4LZ8A 4FJPA 2DE4A 1JETA 4ISUA 4HCWA 5KDTA 3EN3A 5F7VA 3FGSA 4OMBA 2ZXTA 4X48A 3PD9A 1M5FA 3IX1A 3T9XB 2DXYA 5I59B 5I2NB 3LBSA 3ZS6A 4OVJA 4KHZE 4F2QA 1O7TA 1FBPA 5CC2A 3IJXB 2O69A 4Q30B 1LBVA 1NUWA 4OTEA 4QFPA 1VE4A 4DCXA 2I58A 3PMVA 1CNQA 4DI4B 4ZZEA 4IY6A 4F3PA 3KBRA 4KCDA 4ELRA 4OVTA 1FTLA 4POXA 1H44A 1LCFA 2Q8MA 1D9QA 2PYYA 4EQBA 1POTA 3OEMA 3TELA 4XKPA 3T96B 2Q2CA 4K3FA 4QRZA 3K6VA 4IO5A 4KQPA 4HS7A 1PB8A 2CEXA 5ITOA 4YAHX 4HTGA 2XWOA 4FORA 2H9BA 1AOVA 1A7LA 5H8FA 2F7AA 1FTOA 1MQDA 2XXUA 4U23A 3IO6A 3SETA 1EYIA 1JW1A 2F8DA 5L9MA 3SZPA 4MAGA 1URDA 3VLUA 2ZMBA 3C31A 1NUZA 2QS4A 4H46A 3U65A 3UN6A 1OLCA 4ELOA 3NOHA 1MQGA 3RTWB 3O6GA 3CFXA 1G0IA 4Z7EA 4P1LA 3QSLA 1XOCA 2H4IA 1SDXA 1YXIA 4WKMA 1SW1A 1Y4TA 1MQHA 1VDWA 2UVIA 5L9SA 2GQ1A 3CSBA 5IZ3A 2KQZA 2F78A 2FYIA 2H25A 4H0WA 3TDJA 1LAXA 2Z8EA 3LSLA 4PTKA 4MCOA 5A5XA 2MKZA 4F1VA 3HN0A 4GBWA 4Q0CA 4YKIA 3QIMA 2VPOA 1IXGA 4G61A 1FPLA 2V3QA 3FATA 4H5GA 4HE0A 4BLAA 1R9LA 5DT6A 3MP8A 3FJGA 4LZ5A 1IMAA 5DEXA 1D9YA 2XXKA 3PUZE 1K9YA 1MM6A 3E78A 1MY1A 4PFTA 2V93A 3B7DA 4NGUA 1B05A 1K9ZA 2ZYNA 3VV5A 3VVEA 1SD3A 4PFRA 1F9BA 4R2FA 4X04A 4IGTA 1NMUA 3VLVA 3G3IA 4FECA 3O66A 1B7ZA 2PCRA 1II5A 3G3FA 1ZBMA 3U1OA 2ZNTA 1IMCA 3BFUA 1ZJLA 3E13X 1JP4A 3FJ7A 3QUFA 2NXOA 1D9VA 5KCJA 4PFBA 1KA0A 4G4PA 5ITPA 5FBPA 4I3YA 3D4CA 2D3IA 5AA4A 4WEPA 2O7UA 5B7DA 2O6AA 3MAMA 1LAGE 2P2AA 2Q9TA 4NF5B 3K1MA 4RK9A 1SVXB 1M5CA 5J16A 3TYHA 2QMXA 4O3AA 4NAPA 5TPAB 5HBCA 2QPQA 3A29A 4FE8A 3FVOA 4KCCA 3U8QA 4LN5A 2Z23A 1PC3A 3BFTA 4AB6A 5CMBA 1SW4A 3OO7A 1QUJA 1FCKA 5IKBA 4LP2B 5JTYB 4DXCA 3UK4A 1IXCA 4OYVA 1OMPA 4OVQA 3FXRA 3E9XA 3TAJA 2GHBA 3RPWA 1FQDA 5TP9A 4NF8A 4IO3A 4N15A 2DWHA 3B6QA 2JJKA 5FTHA 5ICTA 2Q89A 3EF7A 2DP8A 2B3BA 1USYH 4OZ9A 3OO6A 2QL3A 4G2ZA 1NH7A 4NWDA 1FPEA 1RDYA 3H7MA 3O29A 3S4UA 2XXRA 2V3UA 3VVDA 5J1DA 2CZKA 4QFNA 5ET7A 1QW0A 4QXDA 4X1DA 3DELB 3R6UA 3MQ9A 4ZS9A 5K2XA 4JVDA 3DLNA 4FEDA 1UQWA 1LB8A 5I57B 3V8XB 2OK2A 1VR5A 3OO8A 1LSTA 2DVZA 3MZBA 1CE2A 2Y7KA 4POWA 1LLSA 4PGPA 3KC1A 4OXVA 5I3SA 1PEBA 2F6PA 3LSFB 4YICA 5I56A 2UVHA 2QS3A 5EYFA 3I6VA 4N8YA 4YB6A 4P56A 1IMFA 3IL1B 2OBGA 3K1PA 1R6ZA 3CG1A 3MVYA 1EZ9A 3TKDA 3CI8A 2HZLA 2Y7RA 3HHFA 3C35A 1SQYA 1QJMA 1I6QA 3IO4A 1P1WA 4EUOA 3FUZA 3LC8A 5DVJA 1FJ6A 3PTYA 4R72A 3OSRA 3PD8A 5BUUA 3H6TA 2YJPA 2XXPA 1B9JA 1H76A 4GQOA 4U21A 5I59A 4PDDA 5I2NA 1EH3A 1H43A 5I58B 1TXFA 4DLDA 5I84A 4I9DA 1PBPA 3HHGA 4DI3D 4LVQA 1B40A 1TWYA 5LTCA 3QXMA 3U93A 1A54A 5DYHA 3HV1A 2RCBA 1MXYA 2AL4A 4EDPA 4KPTA 4Z0IA 4ESXA 1SBPA 1B3GA 4X1BA 2O1MA 2Y5LA 3HCQA 4GXAA 4R6KA 2F3BA 4U1ZA 2WKYA 4P1EA 5H8QB 3THIA 2VT5A 3UA8A 2QS1A 1OIBA 4QFKA 1WDNA 3K6WA 1N84A 1VFDA 3IB0A 5TU0A 2ZZXA 4NF4B 4GX4A 4MNCA 2UVGA 1TFDA 3B8BA 3LR1A 4PAIA 4F1UA 1NV3A 3GYYA 2DS9A 3K6UA 1ZU0A 1EYKA 4F19A 1Y1MA 5K2YA 4NE4A 3VDFA 2CZIA 4NMYA 1UIUA 2OLBA 2ZNSA 1SW2A 2UVJA 3RTFB 1B3LA 2X7PA 3MWBA 4RPOA 4PDHA 2QS2A 3BIGA 3UP9A 1IXHA 3C33A 4G68C 2F7BA 3KN8A 2Q88A 3T93B 1LCTA 1GV8A 1PDAA 4GL8A 4GXSB 4HE1A 2M8CA 3SEUA 4ZE9A 4I1DA 2FBPA 4X8RA 1IEJA 3K4UA 3SEVA 4OWDA 1LFIA 4U2RA 4GIZA 3IB1A 3FD3A 5F1QA 1CB6A 4PFUA 2XA5A 4YZZA 4OA4A 5CM6A 3KJTA 1NV1A 4XTCQ 1XVYA 2G29A 3LV0A 4UACA 1XVXA 2PT2A 1T0KA 2QVUA 1B58A 4R6HA 1FW0A 3D1RA 4MX6A 4ONYA 4JWXA 1B0HA 2HHMA 3ILUB 1MY4A 1R1NA 1LBBA 4F39A 4N13A 4JVCA 3PGFA 2F97A 3MVZA 4TLMB 1SPIA 2F35A 1B5JA 1MXZA 2ZYOA 2DVCA 2OWTA 4GOTA 4F1YA 1JEVA 4P0GA 3TPAA 2CZLA 1B3FA 5M2VA 1Y1ZA 1N04A 2H98A 4F18A 1MY3A 1OVBA 3U94A 5LOMA 3AXFA 3EHUA 3C36A 3KZGA 4U4SA 3FASA 1FTKA 4O7MA 3C32A 4NF5A 1URSA 1M5BA 1RYXA 5TPAA 1DCUA 4QFOA 4U22A 4XKRA 3WAEA 4G68A 4P0IA 4G8HA 4GLIA 2PFYA 3OD7A 3C4MA 3OXNA 1P1QA 2GFEA 3S9EA 1MPDA 1MXWA 2AYSA 3MZ1A 3U72A 1NNFA 1BTJA 1FPKA 1TFAA 3FVNA 1B3HA 2Q2AA 2VHAA 4JWYA 1H3DA 3VVFA 2A5TB 1ZLQA 3RUMA 1SYIA 3TCGA 1EZOA 4I40A 3W15C 4H8IA 3O6IA 4GL0A 4GWWA 3ROJA 2RF1A 4X9TA 2KLFA 3MZ9A 3V89B 3MBPA 3WAFA 3MP6A 1KWHA 4N91A 4NWCA 2HPGA 1A55A 1AL3A 3DP8A 1BIYA 1BKAA 2PBWA 4EXKA 3E79A 4PAKA 2VOZA 4U4XA 5I57A 3PMXA 4PC9A 2UXAA 1YZ0A 1GGGA 1MG1A 4P11A 4PFYA 3MYUA 1Q1KA 3T1BA 4LONB 3G3JA 2I3VA 3TTLA 3H6UA 1UIVA 1LBYA 2RINA 1INPA 2Z8FA 1VSOA 4UABA 3VE1B 5H8NB 1RYOA 2RC7A 2I0BA 1MDP1 4O94A 4F22A 4ELPA 4IGRA 3RY3A 3IOUA 4FEBA 3FVGA 1LBWA 4JSOA 1FBEA 3CVGA 4LZ7A 3S9LC 2OJTA 4QSDA 3ECRA 3FXBA 1UTHB 4IO6A 4JWOA 3PUWE 3CR9A 4R9GA 4R74A 5AA3A 2F5XA 2X7QA 1ZIUA 1URGA 1DPEA 4MH5A 3RNNA 1FPJA 3W9WA 2HCAA 2REGA 3N5LA 1DOTA 1D3KA 5I58A 4YKPA 5FTIA 4QBAA 3IORA 3V5AA 4YB7A 3P7IA 4AQ4A 2Q74A 1MPBA 3KOTA 1US4A 4ZEFA 1MM7A 4RK2A 2ZZVA 4ZEIA 4NQ8A 5ESYA 1MS7A 3KGCA 3K2DA 2OCUA 5JEIA 4OEUA 4QHQA 4OHNA 2ONSA 1MY0A 3BBRA 3IJOB 3LSWA 5H8QA 5EQAA 4EF1A 2VP1A 1O63A 4NG7A 3KSXA 4O3BA 3GLBA 2FHYA 3IOTA 4NEDA 3M3LA 4PBQA 4FIMA 2DWAA 1B4ZA 1AMFA 2DDKA 4YMAA 5HPQA 2UYEA 3D4GA 1XT8A 4JXIA 1WODA 2FA7A 2I4BA 3PPOA 2VGQA 3EHSA 4JVIA 5DVIA 4RXLA 2WYKA 4OVRA 3TZAA 1IQ7A 3Q29A 4GWZA 2BJJX 1Y20A 4M1VA 3EPEA 1NUYA 2XHDA 4PQJA 5H8HB 1JEUA 3SKPA 4XXUA 1LBXA 3KJ7A 4AS5A 3EQ1A 4JB7A 3GBAA 3TCFA 3CSGA 4RPNA 4GX6A 4OVSA 4F3GA 4WXJA 2I4CA 3OOAA 3VXBA 4U1OA 3FXQA 3OMBA 1XI6A 3T66A 5IAIA 2F36A 4HCYA 3KN7A 2ALUA 3DP6A 1PBQA 2OWSA 1ZTYA 5ET5A 1YAEA 2XD3A 1VFEA 4DDDA 1NV4A 2O7IA 1JVXA 1IIWA 4I3EA 4H6DA 2P3NA 1MQJA 5IZ3B 3KSJA 5ELVA 3TTNA 5CRYA 3KOSA 4OVPA 1EYJA 3SEXA 5F24A 2I6EA 2Y7WA 1POY1 3I3VA 4TLLB 4WEDA 4FBPA 1Z7ME 3VXCA 1HSLA 4LATA 4QFLA 2PMSA 4PF8A 2X26A 3FV2A 2GH9A 2QVVA 1NKXA 4GVOA 4FAJA 3MPLA 2HZKA 3QK6A 4IO2A 3T22A 1P1UA 2GRVA 4PGNA 4GFRA 3GZGA 2XXTA 1DMBA 3GBBA 1B4HA 1WVJA 3O6HA 4GF8A 3QMFA 4M4GA 1BP5A 1Y4CA 3L6HA 4GWOA 4N6DA 2O1LA 2I48A 3CHGA 5I7IA 2ZYKA 1BLFA 1B2HA 1NV0A 3FV1A 4P8BA 4C0RA 4GWUA 1Y3QA 1FRPA 4LUBA 3RN8A 3A09A 4Q8RA 2O51A 2Y84A 1FPGA 2QJEA 2RCAA 2DXRA 3I5OA 4MLVA 5CBSA 2F6GA 3V83A 4IY5A 3TQLA 4OFOA 2A5TA 4E0WA 3OENA 2QSXA 1LEVA 2IEEA 5ICQA 4KD5A 2ESNA 1LB9A 1FQEA 2D21A 2BJIA 2XWVA 2XXHA 4PFWA 4ZEBA 1JVYA 3H03A 3ONMA 3RPLB 4F29A 3PV0E 1XC1A 1AH5A 4ZZAA 1N3WA 2DE3A 5AA2D 4NF6B 5CBRA 2B65A 1YPNA 1IITA 3PPPA 4KR5A 2E1SA 3H6WA 3LUYA 1N0TA 2XXIA 4P9KA 3IB2A 3C34A 2V84A 1QULA 1Z7NE 5CMMA 1N3XA 2AL5A 2R9JA 1Q35A 4BDLA 3TTMA 2RC9A 4N6PA 2QRYA 2L5VA 1B46A 3RQTA 3Q27A 1SI0A 1BK4A 1FTJA 3LSXA 4R9FA 2DYXA 5H8NA 1GR2A 4MFIA 4O3CA 1LAFE 2DOJA 2V3TA 3Q28A 1B5IA 1FQFA 2G93A 4N8GA 2KR0A 2FNCA 1US5A 4Q5TA 4OFJA 2FVZA 3QYTA 4IB2A 5ISUA 5EHMA 1MQIA 2B4LA 4DZ1A 3FJMA 1DTZA 4H8JA 1UTHA 1Y9UA 3H3GA 5JK4A 2O84X 3UGWA 4GWSA 4PCDA 5EQ9A 3E4RA 1USYE 4O8MA 2PVUA 2HQ0A 2REJA 1QUIA 4PP0A 1HSEA 2H5YA 4PE5B 2DQVA 4XKNA 2RC8A 3N26A 1B1HA 3MSTA 4YKJA 3TMGA 3L6GA 3IAZA 4H1XA 2XXXA 5IGAA 4PE3A 3N6UA 2P0SA 1IMBA 4NX1A 2LAOA 3GXAA 2Z22A 3QUJA 3TUSA 2WX9A 2YPNA 5AA2B 1QGXA 4EQ7A 1FTAA 1OLAA 4OEVA 2DWJA 3T9UA 1ATGA 1SI1A 4FATA 3KFMA 3G3KA 4OETA 3KN3A 5FHMA 5EHSA 1I6AA 4GBVA 3CFLA 2Y5KA 1N76A 1Q9DA 3UIFA 1Y3PA 1GTKA 2WBBA 1J1NA 3HSTA 4DE8A 3F11A 3K6XA 4THIA 2I3WA 4EF2A 1FJ9A 5JTYA 1I6BA 2XXYA 3IFAA 4IR8A 4N6KA 3O28A 4NHBA 5I2KB 4F31B 4PAFA 3G3GA 1LFGA 4F3BA 4KXPA 1DBZA 3K02A 5A5LA 1SW5A 5AA1A 4ELQA 1QKAA 4PBHA 3FVKA 4P3LA 1MPCA 1DTGA 4P47A 4OERA 3KC0A 3T9VA 4OESA 3T9HB 1B32A 3MP1A 4ZEDA 4G8NA 4KYSA 1MY2A 1FBGA 5H8HA 1JW4A 2P3VA 4DXBA 1NV2A 1DPPA 2R71A 3BKIB 2NUVA 3PPRA 2V25A 4MNPA 2GHAA 1MDQA 3TEPA 2HXWA 2W7YA 2XWIA 1KZ8A 3OSQA 3CG3A 1NI9A 1P99A 2DE2A 4F2OA 1FQBA 4KYEA 4MNIA 3ZKKA 4AB5A 1Y3NA 4MHFA 1IXIA 2AIXA 2F34A 3W9VA 4MF3A 4H65A 4PETA 1B5HA 5ET8A 5BWJA 4R2BA 3K01A 1FQAA 1B51A 1FBFA 1P1NA 4ZDMA 2XXVA 4G77A 4N07A 1FBCA 4IO4A 5CMCA 4YB5A 3RLFE 1S50A 4OENA 2R8TA 1NFTA 2ZYMA 3MVWA 2HEUA 3O9PA 3O2AA 4C1UA 4LQ2A 5FHOA 4TQUQ 1UTBB 5DW8A 2B4MA 2CMOA 1N7WA 3MW0A 1A8EA 3A3CA 1ANFA 3B6WA 3KEIA 2DSFA 4R73A 1PB7A 4N17A 1NH8A 3OO9A 2XXQA 3RT8A 4NF0A 5CI5A 4NTLA 3RT6B 4YMBA 1JQFA 5ET6A 3JYRA 3EHTA 3Q25A 3SDFA 4MLQA 2R6GE 2ANJA 2VPNA 3ISPA 4MMPA 2THIA 4QF9A 4RY1A 1RDZA 2CEYA 3B50A 5KDTB 3ILTB 3PMWA 1NNTA 2HXRA 1FBHA 3U92A 1MXVA 3QAXA 5EYHA 1DK4A 1NNKA 3M3FA 5B70A 3SESA 1IUDA 4LA9A 3H6VA 5KZTA 4NF4A 4MBPA 1NUXA 1QUKA 4I8CA 2RKMA 3CFZA 3SEYA 1S9TA 3IOVA 4C1TA 3RPLA 4G68B 4JDFA 2XXWA 4NF6A 4KI0E 3M3KA 2E0SA 3R7XA 4OANA 4ZE8A 4N4UA 1NNPA 2DWIA 1MXXA 1NV6A 1IMEA 1IZ1A 2NVUB 3IFCA 3OELA 1FBDA 2WEFA 3PUYE 4TOZA 4BDNA 1A99A 2XX8A 4AS4A 4ECFA 1MRPA 2UYFA 4BDMA 2OZZA 3CIJA 3FBPA 5LDZA 3M8UA 2XD2A 3HFUA 5H8FB 5H8SA 3A3UA 1I69A 4IO7A 3MUQA 2QFLA 3B6TA 3FZVA 1LFHA 5IZZA 2XWKA 3DP4A 4XKQA 1FPFA 1ZMGA 4HE2A 3HPIA 2WBDA 3LUZA 1LBZA 4F3SA 3VFJA 4E0XA 2ZZWA 2Y7PA 4BDOA 3K1NA 4DIGA 3Q26A 3PUVE 4OFLA 2B3FA 2NOOA 4ZECA 3OEKA 4H67A 3IK6B 2OWZA 1ELJA 1OQHA 1EU8A 4PFIA 5DTBA 4KFQA 5FHNA 3ODBA 4LQ5A 4GWXA 1HSJA 1R9QA 4EXLA 3KBZA 4ESWA 2A5SA 1G0HA 3N94A 3TTKA 1EZPA 2QVRA 5I5PA 5A5XB 2HAUA 2I49A 2I0CA 1AIVA 3E3KA 2VD2A 4ZEKA 1QKBA 5EYGA 3RYDA 1QVSA 4I62A 3ZKLA 1YCJA 3TCHA 4JSDA 4ND9A 2ABHA 2YLNA 2QMWA 5DVFA 1NV7A 1ZKBA 3G7WA 1B7HA 5DEXB 3MVXA 2XX7A 3PPQA 4BDRA 3USDA 4YU0A 2D5WA 2OX3A 5AA2A 1SYHA 1P1OA 3G3HA 1PB9A 1LGBC 1B7UA 5L8DA 4DXUA 5EQ7A 2IA4A 4KYDA 4H5FA 4PF6A 1XS5A 1OQGA 4QSEA 2F3DA 1L5TA 4R6YA 2WYPA 3T0JA 3R26A 2PX1A 3JV9A 4OQOA 5I2KA 5KCJB 1MH3A 4JBZA 4DCYA 3PPNA 4L17A 2ONKE 4GX3A 5AA4B 4HW8A 2CZHA 4R75A 1O64A 1FSAA 1LBCA 3MPKA 3H06B 1YTVA 2PT1A 3S9NC 1B6HA 1YYZA 1B1XA 2XX9A 4HXVA 1TT1A 5HM4B 2Y7IA 2V4CA 3RGYA 2O68A 4XFEA 2ZNUA 1JW5A 1A8FA 1OVTA 3JZJA 1S7YA 4MJOA 5CMKA 4RNSA 2FIXA 2HFBA 1RDXA 5TP9B 4XF5A 2ONRA 1NL5A 4NF8B 1H45A 3SERA 2FIEA 3MC2A 4MEVA 3O97A 4BDQA 3DM0A 4EQ9A 4XEQA 4GD5A 1GVCA 2Z8DA 3PUXE 1NV5A 4G8MA 3UORA 2F7CA 3KG2A 1FQCA 3K00A 4H45A 1M5EA 1MXUA 1M5DA 5IM2A 2PFZA 1FTMA 1KA1A 1B3EA 3K0VA 5L9OA 3TQWA 3TODA 3FXUA 4MIJA 3FIRA 4UA8A 4QSCA 4GRKA 1IMDA 1XHYA 1A40A 4RA1A 4GWYA 3H4ZA 4RYAA 1FPBA 4XIGQ 1UTBA 2Q8JA 3N6TA 3CRBA 5I56B 3S2VA 1B0LA
chains in the Genus database with same CATH topology
3VLWA 3HO7A 3PU5A 1DSNA 1B52A 2HAVA 4RJZA 3C9HA 5AE4A 1JNFA 1N7XA 3TFLA 4YKKA 3MJNA 1RKMA 2H99A 3TTRA 3IOWA 3IR1A 2NWJA 2VD3A 2P1SA 3S9MC 1LAHE 3ZSFA 3SEWA 1MH4A 1D4NA 4LZ8A 4FJPA 2DE4A 1JETA 4ISUA 4HCWA 5KDTA 3EN3A 5F7VA 3FGSA 4OMBA 2ZXTA 4X48A 3PD9A 1M5FA 3IX1A 3T9XB 2DXYA 5I59B 5I2NB 3LBSA 3ZS6A 4OVJA 4KHZE 4F2QA 1O7TA 5CC2A 3IJXB 2O69A 4Q30B 4OTEA 4QFPA 1VE4A 4DCXA 2I58A 3PMVA 4ZZEA 4IY6A 4F3PA 3KBRA 4KCDA 4ELRA 1FTLA 4POXA 1H44A 1LCFA 2PYYA 4EQBA 1POTA 3OEMA 3TELA 4XKPA 3T96B 2Q2CA 4K3FA 4QRZA 3K6VA 4IO5A 4KQPA 4HS7A 1PB8A 5ITOA 4YAHX 4HTGA 4FORA 2H9BA 1AOVA 1A7LA 5H8FA 2F7AA 1FTOA 1MQDA 2XXUA 4U23A 3IO6A 3SETA 1JW1A 2F8DA 5L9MA 1URDA 3VLUA 2ZMBA 3C31A 2QS4A 3UN6A 1OLCA 4ELOA 1MQGA 3RTWB 3O6GA 3CFXA 4Z7EA 3QSLA 1XOCA 2H4IA 1SDXA 4WKMA 1SW1A 1Y4TA 1MQHA 2UVIA 5L9SA 3CSBA 2F78A 2FYIA 2H25A 4H0WA 3TDJA 1LAXA 2Z8EA 3LSLA 5A5XA 4F1VA 3HN0A 4Q0CA 4YKIA 3QIMA 1IXGA 2V3QA 3FATA 4H5GA 4BLAA 1R9LA 5DT6A 3MP8A 3FJGA 4LZ5A 5DEXA 1D9YA 3PUZE 1MM6A 1MY1A 4PFTA 2V93A 3B7DA 1B05A 3VVEA 2ZYNA 3VV5A 1SD3A 1F9BA 4R2FA 4IGTA 1NMUA 3VLVA 3G3IA 4FECA 3O66A 1B7ZA 1II5A 3G3FA 1ZBMA 3U1OA 2ZNTA 3BFUA 1ZJLA 3E13X 3FJ7A 3QUFA 2NXOA 1D9VA 5KCJA 4G4PA 5ITPA 3D4CA 2D3IA 5AA4A 4WEPA 2O7UA 5B7DA 2O6AA 3MAMA 1LAGE 2P2AA 2Q9TA 4NF5B 3K1MA 4RK9A 1SVXB 1M5CA 3TYHA 2QMXA 4O3AA 5TPAB 5HBCA 2QPQA 4FE8A 3FVOA 4KCCA 3U8QA 2Z23A 1PC3A 3BFTA 4AB6A 5CMBA 1SW4A 3OO7A 1QUJA 1FCKA 5IKBA 4LP2B 5JTYB 4DXCA 3UK4A 1IXCA 4OYVA 1OMPA 3FXRA 3E9XA 3TAJA 2GHBA 3RPWA 1FQDA 5TP9A 4NF8A 4IO3A 2DWHA 3B6QA 5FTHA 5ICTA 2Q89A 3EF7A 2DP8A 2B3BA 1USYH 4OZ9A 3OO6A 2QL3A 4G2ZA 1NH7A 4NWDA 3H7MA 3O29A 3S4UA 2XXRA 2V3UA 3VVDA 5J1DA 4QFNA 1QW0A 4X1DA 3DELB 3R6UA 3MQ9A 4ZS9A 5K2XA 3DLNA 4FEDA 1UQWA 1LB8A 5I57B 3V8XB 2OK2A 1VR5A 3OO8A 1LSTA 2DVZA 3MZBA 1CE2A 2Y7KA 4POWA 1LLSA 4OXVA 1PEBA 2F6PA 3LSFB 4YICA 5I56A 2UVHA 2QS3A 5EYFA 3I6VA 4YB6A 3IL1B 2OBGA 3K1PA 1R6ZA 3CG1A 3MVYA 1EZ9A 3TKDA 3CI8A 2HZLA 2Y7RA 3HHFA 3C35A 1SQYA 1QJMA 1I6QA 3IO4A 1P1WA 4EUOA 3FUZA 3LC8A 5DVJA 4R72A 3OSRA 3PD8A 5BUUA 3H6TA 2YJPA 2XXPA 1B9JA 1H76A 4GQOA 4U21A 5I59A 5I2NA 1EH3A 1H43A 5I58B 1TXFA 4DLDA 5I84A 4I9DA 1PBPA 3HHGA 4LVQA 1B40A 1TWYA 3QXMA 3U93A 1A54A 5DYHA 3HV1A 2RCBA 1MXYA 2AL4A 4EDPA 4KPTA 4Z0IA 4ESXA 1SBPA 1B3GA 4X1BA 2O1MA 3HCQA 4GXAA 4R6KA 4U1ZA 2WKYA 5H8QB 3THIA 3UA8A 2QS1A 1OIBA 4QFKA 1WDNA 3K6WA 1N84A 1VFDA 3IB0A 5TU0A 4NF4B 2UVGA 1TFDA 3LR1A 4F1UA 2DS9A 3K6UA 1ZU0A 4F19A 1Y1MA 5K2YA 4NE4A 3VDFA 4NMYA 1UIUA 2OLBA 2ZNSA 1SW2A 2UVJA 3RTFB 1B3LA 2X7PA 3MWBA 4RPOA 2QS2A 3UP9A 1IXHA 3C33A 4G68C 2F7BA 3KN8A 2Q88A 3T93B 1LCTA 1GV8A 1PDAA 4GL8A 4GXSB 3SEUA 2M8CA 4ZE9A 4I1DA 1IEJA 3K4UA 3SEVA 4OWDA 1LFIA 4U2RA 4GIZA 3IB1A 3FD3A 5F1QA 1CB6A 4PFUA 4YZZA 5CM6A 3KJTA 4XTCQ 1XVYA 2G29A 4UACA 1XVXA 2PT2A 1T0KA 1B58A 4R6HA 1FW0A 4ONYA 4JWXA 1B0HA 3ILUB 1MY4A 1R1NA 1LBBA 4F39A 4N13A 3PGFA 2F97A 3MVZA 4TLMB 2F35A 1B5JA 1MXZA 2ZYOA 2DVCA 2OWTA 4GOTA 4F1YA 1JEVA 4P0GA 3TPAA 2CZLA 1B3FA 5M2VA 1Y1ZA 1N04A 2H98A 4F18A 1MY3A 1OVBA 3U94A 5LOMA 3AXFA 3EHUA 3C36A 3KZGA 4U4SA 3FASA 1FTKA 3C32A 4NF5A 1URSA 1M5BA 1RYXA 5TPAA 4QFOA 4U22A 4XKRA 3WAEA 4G68A 4P0IA 4G8HA 4GLIA 3OD7A 3C4MA 3OXNA 1P1QA 2GFEA 3S9EA 1MPDA 1MXWA 2AYSA 3MZ1A 3U72A 1NNFA 1BTJA 1TFAA 3FVNA 1B3HA 2Q2AA 2VHAA 4JWYA 1H3DA 3VVFA 2A5TB 1ZLQA 3RUMA 1SYIA 3TCGA 1EZOA 3W15C 4H8IA 3O6IA 4GL0A 2RF1A 4X9TA 2KLFA 3MZ9A 3V89B 3MBPA 3WAFA 3MP6A 1KWHA 4NWCA 1A55A 1AL3A 3DP8A 1BIYA 1BKAA 2PBWA 4EXKA 2VOZA 4U4XA 5I57A 3PMXA 2UXAA 1GGGA 1MG1A 4P11A 4PFYA 1Q1KA 4LONB 3G3JA 2I3VA 3TTLA 3H6UA 1UIVA 2RINA 2Z8FA 1VSOA 3VE1B 5H8NB 1RYOA 2RC7A 2I0BA 1MDP1 4F22A 4ELPA 4IGRA 3RY3A 3IOUA 4FEBA 3FVGA 4JSOA 3CVGA 4LZ7A 3S9LC 2OJTA 4QSDA 3ECRA 1UTHB 4IO6A 4JWOA 3PUWE 3CR9A 4R9GA 4R74A 5AA3A 2F5XA 2X7QA 1ZIUA 1URGA 1DPEA 4MH5A 3RNNA 3W9WA 2HCAA 2REGA 3N5LA 1DOTA 1D3KA 5I58A 4YKPA 5FTIA 3IORA 3V5AA 4YB7A 3P7IA 4AQ4A 1MPBA 3KOTA 1US4A 4ZEFA 1MM7A 4RK2A 4ZEIA 1MS7A 3KGCA 3K2DA 2OCUA 5JEIA 4OEUA 4QHQA 4OHNA 2ONSA 1MY0A 3BBRA 3IJOB 3LSWA 5H8QA 4EF1A 2VP1A 1O63A 3KSXA 4O3BA 3GLBA 3IOTA 4NEDA 3M3LA 4FIMA 2DWAA 1B4ZA 1AMFA 4YMAA 5HPQA 2UYEA 3D4GA 1XT8A 4JXIA 1WODA 2FA7A 2I4BA 3PPOA 2VGQA 3EHSA 5DVIA 4RXLA 3TZAA 1IQ7A 3Q29A 2BJJX 1Y20A 4M1VA 3EPEA 2XHDA 4PQJA 5H8HB 1JEUA 3SKPA 4XXUA 3KJ7A 3EQ1A 4JB7A 3GBAA 3TCFA 3CSGA 4RPNA 4F3GA 4WXJA 2I4CA 3OOAA 3VXBA 4U1OA 3FXQA 3OMBA 3T66A 5IAIA 2F36A 4HCYA 3KN7A 2ALUA 3DP6A 1PBQA 2OWSA 1ZTYA 1YAEA 2XD3A 1VFEA 4DDDA 2O7IA 1JVXA 1IIWA 4H6DA 1MQJA 3KSJA 5ELVA 3TTNA 5CRYA 3KOSA 3SEXA 2I6EA 2Y7WA 1POY1 3I3VA 4TLLB 4WEDA 1Z7ME 3VXCA 1HSLA 4LATA 4QFLA 2PMSA 2X26A 3FV2A 2GH9A 1NKXA 4GVOA 4FAJA 3MPLA 2HZKA 3QK6A 4IO2A 3T22A 1P1UA 2GRVA 4GFRA 3GZGA 2XXTA 1DMBA 3GBBA 1B4HA 1WVJA 3O6HA 4GF8A 4M4GA 1BP5A 1Y4CA 3L6HA 4GWOA 2O1LA 2I48A 2ZYKA 1BLFA 1B2HA 3FV1A 4C0RA 1Y3QA 4LUBA 3RN8A 3A09A 4Q8RA 2O51A 2Y84A 2QJEA 2RCAA 2DXRA 3I5OA 4MLVA 5CBSA 2F6GA 3V83A 4IY5A 3TQLA 4OFOA 2A5TA 4E0WA 3OENA 2QSXA 2IEEA 5ICQA 4KD5A 2ESNA 1LB9A 1FQEA 2D21A 2XXHA 4PFWA 4ZEBA 1JVYA 3H03A 3ONMA 4F29A 3PV0E 1XC1A 1AH5A 4ZZAA 1N3WA 2DE3A 5AA2D 4NF6B 5CBRA 2B65A 1YPNA 1IITA 3PPPA 4KR5A 2E1SA 3H6WA 3LUYA 1N0TA 2XXIA 3IB2A 3C34A 2V84A 1QULA 1Z7NE 5CMMA 1N3XA 2AL5A 2R9JA 1Q35A 4BDLA 3TTMA 2RC9A 4N6PA 2QRYA 1B46A 3RQTA 3Q27A 1SI0A 1FTJA 3LSXA 4R9FA 2DYXA 5H8NA 1GR2A 4MFIA 4O3CA 1LAFE 2DOJA 2V3TA 3Q28A 1B5IA 1FQFA 2G93A 2FNCA 1US5A 4Q5TA 4OFJA 3QYTA 5ISUA 4IB2A 5EHMA 1MQIA 4DZ1A 3FJMA 1DTZA 4H8JA 1UTHA 1Y9UA 3H3GA 5JK4A 2O84X 3UGWA 3E4RA 1USYE 2PVUA 2HQ0A 2REJA 1QUIA 4PP0A 1HSEA 2H5YA 4PE5B 2DQVA 4XKNA 2RC8A 3N26A 1B1HA 4YKJA 3TMGA 3L6GA 3IAZA 4H1XA 2XXXA 3N6UA 2P0SA 2LAOA 3GXAA 2Z22A 3QUJA 3TUSA 2YPNA 5AA2B 4EQ7A 4FATA 1OLAA 4OEVA 3T9UA 2DWJA 1ATGA 1SI1A 3KFMA 3G3KA 4OETA 3KN3A 5FHMA 5EHSA 1I6AA 3CFLA 1N76A 3UIFA 1Y3PA 1GTKA 1J1NA 3HSTA 4DE8A 3F11A 3K6XA 4THIA 2I3WA 4EF2A 5JTYA 1I6BA 2XXYA 4F31B 3O28A 5I2KB 3G3GA 1LFGA 4F3BA 3K02A 1SW5A 5AA1A 4ELQA 1QKAA 3FVKA 1MPCA 1DTGA 4OERA 3T9VA 4OESA 3T9HB 1B32A 3MP1A 4ZEDA 4G8NA 4KYSA 1MY2A 5H8HA 1JW4A 4DXBA 1DPPA 2R71A 3BKIB 2NUVA 3PPRA 2V25A 2GHAA 1MDQA 3TEPA 2HXWA 2W7YA 3OSQA 3CG3A 1P99A 2DE2A 4F2OA 1FQBA 4KYEA 3ZKKA 4AB5A 1Y3NA 1IXIA 2AIXA 2F34A 3W9VA 4MF3A 4H65A 4PETA 1B5HA 5BWJA 4R2BA 3K01A 1FQAA 1B51A 1P1NA 4ZDMA 2XXVA 4G77A 4N07A 4IO4A 5CMCA 4YB5A 3RLFE 1S50A 4OENA 1NFTA 2ZYMA 3MVWA 2HEUA 3O9PA 3O2AA 4C1UA 4LQ2A 5FHOA 4TQUQ 1UTBB 2CMOA 1N7WA 3MW0A 1A8EA 3A3CA 1ANFA 3B6WA 3KEIA 2DSFA 4R73A 1PB7A 1NH8A 3OO9A 2XXQA 3RT8A 5CI5A 4NTLA 3RT6B 4YMBA 1JQFA 3JYRA 3EHTA 3Q25A 3SDFA 4MLQA 2R6GE 2ANJA 2THIA 4QF9A 4RY1A 5KDTB 3ILTB 3PMWA 1NNTA 3U92A 1MXVA 3QAXA 1NNKA 3M3FA 5B70A 3SESA 1IUDA 4LA9A 3H6VA 5KZTA 4NF4A 4MBPA 1QUKA 4I8CA 2RKMA 3CFZA 3SEYA 1S9TA 3IOVA 4C1TA 4G68B 4JDFA 2XXWA 4NF6A 4KI0E 3M3KA 2E0SA 3R7XA 4ZE8A 1NNPA 2DWIA 1MXXA 1IZ1A 2NVUB 3OELA 3PUYE 4TOZA 4BDNA 1A99A 2XX8A 4ECFA 1MRPA 2UYFA 4BDMA 2OZZA 3CIJA 3M8UA 2XD2A 5H8FB 5H8SA 3A3UA 1I69A 4IO7A 3MUQA 3B6TA 3FZVA 1LFHA 3DP4A 4XKQA 1ZMGA 3HPIA 4F3SA 3VFJA 4E0XA 2Y7PA 4BDOA 3K1NA 4DIGA 3Q26A 3PUVE 4OFLA 2B3FA 2NOOA 4ZECA 3OEKA 4H67A 3IK6B 1ELJA 1OQHA 1EU8A 5DTBA 4KFQA 5FHNA 3ODBA 4LQ5A 1HSJA 1R9QA 4EXLA 4ESWA 2A5SA 3N94A 3TTKA 1EZPA 5A5XB 2HAUA 2I49A 2I0CA 1AIVA 3E3KA 2VD2A 4ZEKA 1QKBA 1QVSA 4I62A 3ZKLA 1YCJA 3TCHA 4JSDA 4ND9A 2ABHA 2YLNA 2QMWA 5DVFA 1ZKBA 3G7WA 1B7HA 5DEXB 3MVXA 2XX7A 3PPQA 4BDRA 3USDA 4YU0A 2D5WA 5AA2A 1SYHA 1P1OA 3G3HA 1PB9A 1LGBC 1B7UA 5L8DA 4DXUA 2IA4A 4KYDA 4H5FA 1XS5A 1OQGA 4QSEA 1L5TA 4R6YA 3R26A 2PX1A 3JV9A 4OQOA 5I2KA 5KCJB 1MH3A 4JBZA 4DCYA 3PPNA 4L17A 2ONKE 5AA4B 4HW8A 4R75A 1O64A 1LBCA 3MPKA 3H06B 1YTVA 2PT1A 3S9NC 1B6HA 1B1XA 2XX9A 1TT1A 5HM4B 2Y7IA 3RGYA 2O68A 2ZNUA 1JW5A 1A8FA 1OVTA 3JZJA 1S7YA 5CMKA 4RNSA 2HFBA 5TP9B 2ONRA 1NL5A 4NF8B 1H45A 3SERA 3MC2A 3O97A 4BDQA 3DM0A 4EQ9A 4GD5A 1GVCA 2Z8DA 3PUXE 4G8MA 3UORA 2F7CA 3KG2A 1FQCA 3K00A 1M5EA 1MXUA 1M5DA 1FTMA 1B3EA 3K0VA 5L9OA 3TQWA 3TODA 3FXUA 3FIRA 4UA8A 4QSCA 4GRKA 1XHYA 1A40A 4RA1A 3H4ZA 4RYAA 4XIGQ 1UTBA 2Q8JA 3N6TA 3CRBA 5I56B 3S2VA 1B0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLW A;  3HO7 A;  3PU5 A;  1DSN A;  1B52 A;  2HAV A;  4RJZ A;  3C9H A;  5AE4 A;  1JNF A;  1N7X A;  3TFL A;  4YKK A;  3MJN A;  1RKM A;  2H99 A;  3TTR A;  3IOW A;  3IR1 A;  2NWJ A;  2VD3 A;  2P1S A;  3S9M C;  1LAH E;  3ZSF A;  3SEW A;  1MH4 A;  1D4N A;  4LZ8 A;  4FJP A;  2DE4 A;  1JET A;  4ISU A;  4HCW A;  5KDT A;  3EN3 A;  5F7V A;  3FGS A;  4OMB A;  2ZXT A;  4X48 A;  3PD9 A;  1M5F A;  3IX1 A;  3T9X B;  2DXY A;  5I59 B;  5I2N B;  3LBS A;  3ZS6 A;  4OVJ A;  4KHZ E;  4F2Q A;  1O7T A;  5CC2 A;  3IJX B;  2O69 A;  4Q30 B;  4OTE A;  4QFP A;  1VE4 A;  4DCX A;  2I58 A;  3PMV A;  4ZZE A;  4IY6 A;  4F3P A;  3KBR A;  4KCD A;  4ELR A;  1FTL A;  4POX A;  1H44 A;  1LCF A;  2PYY A;  4EQB A;  1POT A;  3OEM A;  3TEL A;  4XKP A;  3T96 B;  2Q2C A;  4K3F A;  4QRZ A;  3K6V A;  4IO5 A;  4KQP A;  4HS7 A;  1PB8 A;  5ITO A;  4YAH X;  4HTG A;  4FOR A;  2H9B A;  1AOV A;  1A7L A;  5H8F A;  2F7A A;  1FTO A;  1MQD A;  2XXU A;  4U23 A;  3IO6 A;  3SET A;  1JW1 A;  2F8D A;  5L9M A;  1URD A;  3VLU A;  2ZMB A;  3C31 A;  2QS4 A;  3UN6 A;  1OLC A;  4ELO A;  1MQG A;  3RTW B;  3O6G A;  3CFX A;  4Z7E A;  3QSL A;  1XOC A;  2H4I A;  1SDX A;  4WKM A;  1SW1 A;  1Y4T A;  1MQH A;  2UVI A;  5L9S A;  3CSB A;  2F78 A;  2FYI A;  2H25 A;  4H0W A;  3TDJ A;  1LAX A;  2Z8E A;  3LSL A;  5A5X A;  4F1V A;  3HN0 A;  4Q0C A;  4YKI A;  3QIM A;  1IXG A;  2V3Q A;  3FAT A;  4H5G A;  4BLA A;  1R9L A;  5DT6 A;  3MP8 A;  3FJG A;  4LZ5 A;  5DEX A;  1D9Y A;  3PUZ E;  1MM6 A;  1MY1 A;  4PFT A;  2V93 A;  3B7D A;  1B05 A;  3VVE A;  2ZYN A;  3VV5 A;  1SD3 A;  1F9B A;  4R2F A;  4IGT A;  1NMU A;  3VLV A;  3G3I A;  4FEC A;  3O66 A;  1B7Z A;  1II5 A;  3G3F A;  1ZBM A;  3U1O A;  2ZNT A;  3BFU A;  1ZJL A;  3E13 X;  3FJ7 A;  3QUF A;  2NXO A;  1D9V A;  5KCJ A;  4G4P A;  5ITP A;  3D4C A;  2D3I A;  5AA4 A;  4WEP A;  2O7U A;  5B7D A;  2O6A A;  3MAM A;  1LAG E;  2P2A A;  2Q9T A;  4NF5 B;  3K1M A;  4RK9 A;  1SVX B;  1M5C A;  3TYH A;  2QMX A;  4O3A A;  5TPA B;  5HBC A;  2QPQ A;  4FE8 A;  3FVO A;  4KCC A;  3U8Q A;  2Z23 A;  1PC3 A;  3BFT A;  4AB6 A;  5CMB A;  1SW4 A;  3OO7 A;  1QUJ A;  1FCK A;  5IKB A;  4LP2 B;  5JTY B;  4DXC A;  3UK4 A;  1IXC A;  4OYV A;  1OMP A;  3FXR A;  3E9X A;  3TAJ A;  2GHB A;  3RPW A;  1FQD A;  5TP9 A;  4NF8 A;  4IO3 A;  2DWH A;  3B6Q A;  5FTH A;  5ICT A;  2Q89 A;  3EF7 A;  2DP8 A;  2B3B A;  1USY H;  4OZ9 A;  3OO6 A;  2QL3 A;  4G2Z A;  1NH7 A;  4NWD A;  3H7M A;  3O29 A;  3S4U A;  2XXR A;  2V3U A;  3VVD A;  5J1D A;  4QFN A;  1QW0 A;  4X1D A;  3DEL B;  3R6U A;  3MQ9 A;  4ZS9 A;  5K2X A;  3DLN A;  4FED A;  1UQW A;  1LB8 A;  5I57 B;  3V8X B;  2OK2 A;  1VR5 A;  3OO8 A;  1LST A;  2DVZ A;  3MZB A;  1CE2 A;  2Y7K A;  4POW A;  1LLS A;  4OXV A;  1PEB A;  2F6P A;  3LSF B;  4YIC A;  5I56 A;  2UVH A;  2QS3 A;  5EYF A;  3I6V A;  4YB6 A;  3IL1 B;  2OBG A;  3K1P A;  1R6Z A;  3CG1 A;  3MVY A;  1EZ9 A;  3TKD A;  3CI8 A;  2HZL A;  2Y7R A;  3HHF A;  3C35 A;  1SQY A;  1QJM A;  1I6Q A;  3IO4 A;  1P1W A;  4EUO A;  3FUZ A;  3LC8 A;  5DVJ A;  4R72 A;  3OSR A;  3PD8 A;  5BUU A;  3H6T A;  2YJP A;  2XXP A;  1B9J A;  1H76 A;  4GQO A;  4U21 A;  5I59 A;  5I2N A;  1EH3 A;  1H43 A;  5I58 B;  1TXF A;  4DLD A;  5I84 A;  4I9D A;  1PBP A;  3HHG A;  4LVQ A;  1B40 A;  1TWY A;  3QXM A;  3U93 A;  1A54 A;  5DYH A;  3HV1 A;  2RCB A;  1MXY A;  2AL4 A;  4EDP A;  4KPT A;  4Z0I A;  4ESX A;  1SBP A;  1B3G A;  4X1B A;  2O1M A;  3HCQ A;  4GXA A;  4R6K A;  4U1Z A;  2WKY A;  5H8Q B;  3THI A;  3UA8 A;  2QS1 A;  1OIB A;  4QFK A;  1WDN A;  3K6W A;  1N84 A;  1VFD A;  3IB0 A;  5TU0 A;  4NF4 B;  2UVG A;  1TFD A;  3LR1 A;  4F1U A;  2DS9 A;  3K6U A;  1ZU0 A;  4F19 A;  1Y1M A;  5K2Y A;  4NE4 A;  3VDF A;  4NMY A;  1UIU A;  2OLB A;  2ZNS A;  1SW2 A;  2UVJ A;  3RTF B;  1B3L A;  2X7P A;  3MWB A;  4RPO A;  2QS2 A;  3UP9 A;  1IXH A;  3C33 A;  4G68 C;  2F7B A;  3KN8 A;  2Q88 A;  3T93 B;  1LCT A;  1GV8 A;  1PDA A;  4GL8 A;  4GXS B;  3SEU A;  2M8C A;  4ZE9 A;  4I1D A;  1IEJ A;  3K4U A;  3SEV A;  4OWD A;  1LFI A;  4U2R A;  4GIZ A;  3IB1 A;  3FD3 A;  5F1Q A;  1CB6 A;  4PFU A;  4YZZ A;  5CM6 A;  3KJT A;  4XTC Q;  1XVY A;  2G29 A;  4UAC A;  1XVX A;  2PT2 A;  1T0K A;  1B58 A;  4R6H A;  1FW0 A;  4ONY A;  4JWX A;  1B0H A;  3ILU B;  1MY4 A;  1R1N A;  1LBB A;  4F39 A;  4N13 A;  3PGF A;  2F97 A;  3MVZ A;  4TLM B;  2F35 A;  1B5J A;  1MXZ A;  2ZYO A;  2DVC A;  2OWT A;  4GOT A;  4F1Y A;  1JEV A;  4P0G A;  3TPA A;  2CZL A;  1B3F A;  5M2V A;  1Y1Z A;  1N04 A;  2H98 A;  4F18 A;  1MY3 A;  1OVB A;  3U94 A;  5LOM A;  3AXF A;  3EHU A;  3C36 A;  3KZG A;  4U4S A;  3FAS A;  1FTK A;  3C32 A;  4NF5 A;  1URS A;  1M5B A;  1RYX A;  5TPA A;  4QFO A;  4U22 A;  4XKR A;  3WAE A;  4G68 A;  4P0I A;  4G8H A;  4GLI A;  3OD7 A;  3C4M A;  3OXN A;  1P1Q A;  2GFE A;  3S9E A;  1MPD A;  1MXW A;  2AYS A;  3MZ1 A;  3U72 A;  1NNF A;  1BTJ A;  1TFA A;  3FVN A;  1B3H A;  2Q2A A;  2VHA A;  4JWY A;  1H3D A;  3VVF A;  2A5T B;  1ZLQ A;  3RUM A;  1SYI A;  3TCG A;  1EZO A;  3W15 C;  4H8I A;  3O6I A;  4GL0 A;  2RF1 A;  4X9T A;  2KLF A;  3MZ9 A;  3V89 B;  3MBP A;  3WAF A;  3MP6 A;  1KWH A;  4NWC A;  1A55 A;  1AL3 A;  3DP8 A;  1BIY A;  1BKA A;  2PBW A;  4EXK A;  2VOZ A;  4U4X A;  5I57 A;  3PMX A;  2UXA A;  1GGG A;  1MG1 A;  4P11 A;  4PFY A;  1Q1K A;  4LON B;  3G3J A;  2I3V A;  3TTL A;  3H6U A;  1UIV A;  2RIN A;  2Z8F A;  1VSO A;  3VE1 B;  5H8N B;  1RYO A;  2RC7 A;  2I0B A;  1MDP 1;  4F22 A;  4ELP A;  4IGR A;  3RY3 A;  3IOU A;  4FEB A;  3FVG A;  4JSO A;  3CVG A;  4LZ7 A;  3S9L C;  2OJT A;  4QSD A;  3ECR A;  1UTH B;  4IO6 A;  4JWO A;  3PUW E;  3CR9 A;  4R9G A;  4R74 A;  5AA3 A;  2F5X A;  2X7Q A;  1ZIU A;  1URG A;  1DPE A;  4MH5 A;  3RNN A;  3W9W A;  2HCA A;  2REG A;  3N5L A;  1DOT A;  1D3K A;  5I58 A;  4YKP A;  5FTI A;  3IOR A;  3V5A A;  4YB7 A;  3P7I A;  4AQ4 A;  1MPB A;  3KOT A;  1US4 A;  4ZEF A;  1MM7 A;  4RK2 A;  4ZEI A;  1MS7 A;  3KGC A;  3K2D A;  2OCU A;  5JEI A;  4OEU A;  4QHQ A;  4OHN A;  2ONS A;  1MY0 A;  3BBR A;  3IJO B;  3LSW A;  5H8Q A;  4EF1 A;  2VP1 A;  1O63 A;  3KSX A;  4O3B A;  3GLB A;  3IOT A;  4NED A;  3M3L A;  4FIM A;  2DWA A;  1B4Z A;  1AMF A;  4YMA A;  5HPQ A;  2UYE A;  3D4G A;  1XT8 A;  4JXI A;  1WOD A;  2FA7 A;  2I4B A;  3PPO A;  2VGQ A;  3EHS A;  5DVI A;  4RXL A;  3TZA A;  1IQ7 A;  3Q29 A;  2BJJ X;  1Y20 A;  4M1V A;  3EPE A;  2XHD A;  4PQJ A;  5H8H B;  1JEU A;  3SKP A;  4XXU A;  3KJ7 A;  3EQ1 A;  4JB7 A;  3GBA A;  3TCF A;  3CSG A;  4RPN A;  4F3G A;  4WXJ A;  2I4C A;  3OOA A;  3VXB A;  4U1O A;  3FXQ A;  3OMB A;  3T66 A;  5IAI A;  2F36 A;  4HCY A;  3KN7 A;  2ALU A;  3DP6 A;  1PBQ A;  2OWS A;  1ZTY A;  1YAE A;  2XD3 A;  1VFE A;  4DDD A;  2O7I A;  1JVX A;  1IIW A;  4H6D A;  1MQJ A;  3KSJ A;  5ELV A;  3TTN A;  5CRY A;  3KOS A;  3SEX A;  2I6E A;  2Y7W A;  1POY 1;  3I3V A;  4TLL B;  4WED A;  1Z7M E;  3VXC A;  1HSL A;  4LAT A;  4QFL A;  2PMS A;  2X26 A;  3FV2 A;  2GH9 A;  1NKX A;  4GVO A;  4FAJ A;  3MPL A;  2HZK A;  3QK6 A;  4IO2 A;  3T22 A;  1P1U A;  2GRV A;  4GFR A;  3GZG A;  2XXT A;  1DMB A;  3GBB A;  1B4H A;  1WVJ A;  3O6H A;  4GF8 A;  4M4G A;  1BP5 A;  1Y4C A;  3L6H A;  4GWO A;  2O1L A;  2I48 A;  2ZYK A;  1BLF A;  1B2H A;  3FV1 A;  4C0R A;  1Y3Q A;  4LUB A;  3RN8 A;  3A09 A;  4Q8R A;  2O51 A;  2Y84 A;  2QJE A;  2RCA A;  2DXR A;  3I5O A;  4MLV A;  5CBS A;  2F6G A;  3V83 A;  4IY5 A;  3TQL A;  4OFO A;  2A5T A;  4E0W A;  3OEN A;  2QSX A;  2IEE A;  5ICQ A;  4KD5 A;  2ESN A;  1LB9 A;  1FQE A;  2D21 A;  2XXH A;  4PFW A;  4ZEB A;  1JVY A;  3H03 A;  3ONM A;  4F29 A;  3PV0 E;  1XC1 A;  1AH5 A;  4ZZA A;  1N3W A;  2DE3 A;  5AA2 D;  4NF6 B;  5CBR A;  2B65 A;  1YPN A;  1IIT A;  3PPP A;  4KR5 A;  2E1S A;  3H6W A;  3LUY A;  1N0T A;  2XXI A;  3IB2 A;  3C34 A;  2V84 A;  1QUL A;  1Z7N E;  5CMM A;  1N3X A;  2AL5 A;  2R9J A;  1Q35 A;  4BDL A;  3TTM A;  2RC9 A;  4N6P A;  2QRY A;  1B46 A;  3RQT A;  3Q27 A;  1SI0 A;  1FTJ A;  3LSX A;  4R9F A;  2DYX A;  5H8N A;  1GR2 A;  4MFI A;  4O3C A;  1LAF E;  2DOJ A;  2V3T A;  3Q28 A;  1B5I A;  1FQF A;  2G93 A;  2FNC A;  1US5 A;  4Q5T A;  4OFJ A;  3QYT A;  5ISU A;  4IB2 A;  5EHM A;  1MQI A;  4DZ1 A;  3FJM A;  1DTZ A;  4H8J A;  1UTH A;  1Y9U A;  3H3G A;  5JK4 A;  2O84 X;  3UGW A;  3E4R A;  1USY E;  2PVU A;  2HQ0 A;  2REJ A;  1QUI A;  4PP0 A;  1HSE A;  2H5Y A;  4PE5 B;  2DQV A;  4XKN A;  2RC8 A;  3N26 A;  1B1H A;  4YKJ A;  3TMG A;  3L6G A;  3IAZ A;  4H1X A;  2XXX A;  3N6U A;  2P0S A;  2LAO A;  3GXA A;  2Z22 A;  3QUJ A;  3TUS A;  2YPN A;  5AA2 B;  4EQ7 A;  4FAT A;  1OLA A;  4OEV A;  3T9U A;  2DWJ A;  1ATG A;  1SI1 A;  3KFM A;  3G3K A;  4OET A;  3KN3 A;  5FHM A;  5EHS A;  1I6A A;  3CFL A;  1N76 A;  3UIF A;  1Y3P A;  1GTK A;  1J1N A;  3HST A;  4DE8 A;  3F11 A;  3K6X A;  4THI A;  2I3W A;  4EF2 A;  5JTY A;  1I6B A;  2XXY A;  4F31 B;  3O28 A;  5I2K B;  3G3G A;  1LFG A;  4F3B A;  3K02 A;  1SW5 A;  5AA1 A;  4ELQ A;  1QKA A;  3FVK A;  1MPC A;  1DTG A;  4OER A;  3T9V A;  4OES A;  3T9H B;  1B32 A;  3MP1 A;  4ZED A;  4G8N A;  4KYS A;  1MY2 A;  5H8H A;  1JW4 A;  4DXB A;  1DPP A;  2R71 A;  3BKI B;  2NUV A;  3PPR A;  2V25 A;  2GHA A;  1MDQ A;  3TEP A;  2HXW A;  2W7Y A;  3OSQ A;  3CG3 A;  1P99 A;  2DE2 A;  4F2O A;  1FQB A;  4KYE A;  3ZKK A;  4AB5 A;  1Y3N A;  1IXI A;  2AIX A;  2F34 A;  3W9V A;  4MF3 A;  4H65 A;  4PET A;  1B5H A;  5BWJ A;  4R2B A;  3K01 A;  1FQA A;  1B51 A;  1P1N A;  4ZDM A;  2XXV A;  4G77 A;  4N07 A;  4IO4 A;  5CMC A;  4YB5 A;  3RLF E;  1S50 A;  4OEN A;  1NFT A;  2ZYM A;  3MVW A;  2HEU A;  3O9P A;  3O2A A;  4C1U A;  4LQ2 A;  5FHO A;  4TQU Q;  1UTB B;  2CMO A;  1N7W A;  3MW0 A;  1A8E A;  3A3C A;  1ANF A;  3B6W A;  3KEI A;  2DSF A;  4R73 A;  1PB7 A;  1NH8 A;  3OO9 A;  2XXQ A;  3RT8 A;  5CI5 A;  4NTL A;  3RT6 B;  4YMB A;  1JQF A;  3JYR A;  3EHT A;  3Q25 A;  3SDF A;  4MLQ A;  2R6G E;  2ANJ A;  2THI A;  4QF9 A;  4RY1 A;  5KDT B;  3ILT B;  3PMW A;  1NNT A;  3U92 A;  1MXV A;  3QAX A;  1NNK A;  3M3F A;  5B70 A;  3SES A;  1IUD A;  4LA9 A;  3H6V A;  5KZT A;  4NF4 A;  4MBP A;  1QUK A;  4I8C A;  2RKM A;  3CFZ A;  3SEY A;  1S9T A;  3IOV A;  4C1T A;  4G68 B;  4JDF A;  2XXW A;  4NF6 A;  4KI0 E;  3M3K A;  2E0S A;  3R7X A;  4ZE8 A;  1NNP A;  2DWI A;  1MXX A;  1IZ1 A;  2NVU B;  3OEL A;  3PUY E;  4TOZ A;  4BDN A;  1A99 A;  2XX8 A;  4ECF A;  1MRP A;  2UYF A;  4BDM A;  2OZZ A;  3CIJ A;  3M8U A;  2XD2 A;  5H8F B;  5H8S A;  3A3U A;  1I69 A;  4IO7 A;  3MUQ A;  3B6T A;  3FZV A;  1LFH A;  3DP4 A;  4XKQ A;  1ZMG A;  3HPI A;  4F3S A;  3VFJ A;  4E0X A;  2Y7P A;  4BDO A;  3K1N A;  4DIG A;  3Q26 A;  3PUV E;  4OFL A;  2B3F A;  2NOO A;  4ZEC A;  3OEK A;  4H67 A;  3IK6 B;  1ELJ A;  1OQH A;  1EU8 A;  5DTB A;  4KFQ A;  5FHN A;  3ODB A;  4LQ5 A;  1HSJ A;  1R9Q A;  4EXL A;  4ESW A;  2A5S A;  3N94 A;  3TTK A;  1EZP A;  5A5X B;  2HAU A;  2I49 A;  2I0C A;  1AIV A;  3E3K A;  2VD2 A;  4ZEK A;  1QKB A;  1QVS A;  4I62 A;  3ZKL A;  1YCJ A;  3TCH A;  4JSD A;  4ND9 A;  2ABH A;  2YLN A;  2QMW A;  5DVF A;  1ZKB A;  3G7W A;  1B7H A;  5DEX B;  3MVX A;  2XX7 A;  3PPQ A;  4BDR A;  3USD A;  4YU0 A;  2D5W A;  5AA2 A;  1SYH A;  1P1O A;  3G3H A;  1PB9 A;  1LGB C;  1B7U A;  5L8D A;  4DXU A;  2IA4 A;  4KYD A;  4H5F A;  1XS5 A;  1OQG A;  4QSE A;  1L5T A;  4R6Y A;  3R26 A;  2PX1 A;  3JV9 A;  4OQO A;  5I2K A;  5KCJ B;  1MH3 A;  4JBZ A;  4DCY A;  3PPN A;  4L17 A;  2ONK E;  5AA4 B;  4HW8 A;  4R75 A;  1O64 A;  1LBC A;  3MPK A;  3H06 B;  1YTV A;  2PT1 A;  3S9N C;  1B6H A;  1B1X A;  2XX9 A;  1TT1 A;  5HM4 B;  2Y7I A;  3RGY A;  2O68 A;  2ZNU A;  1JW5 A;  1A8F A;  1OVT A;  3JZJ A;  1S7Y A;  5CMK A;  4RNS A;  2HFB A;  5TP9 B;  2ONR A;  1NL5 A;  4NF8 B;  1H45 A;  3SER A;  3MC2 A;  3O97 A;  4BDQ A;  3DM0 A;  4EQ9 A;  4GD5 A;  1GVC A;  2Z8D A;  3PUX E;  4G8M A;  3UOR A;  2F7C A;  3KG2 A;  1FQC A;  3K00 A;  1M5E A;  1MXU A;  1M5D A;  1FTM A;  1B3E A;  3K0V A;  5L9O A;  3TQW A;  3TOD A;  3FXU A;  3FIR A;  4UA8 A;  4QSC A;  4GRK A;  1XHY A;  1A40 A;  4RA1 A;  3H4Z A;  4RYA A;  4XIG Q;  1UTB A;  2Q8J A;  3N6T A;  3CRB A;  5I56 B;  3S2V A;  1B0L A; 
#chains in the Genus database with same CATH topology
 3VLW A;  3HO7 A;  3PU5 A;  1DSN A;  4NN3 A;  1B52 A;  2HAV A;  4RJZ A;  5T3J A;  1FPD A;  3C9H A;  5AE4 A;  3BIH A;  3EKI A;  1JNF A;  1N7X A;  3TFL A;  4YKK A;  1FPI A;  1RKM A;  3MJN A;  2H99 A;  3TTR A;  4O7I A;  3IOW A;  3IR1 A;  2NWJ A;  1AWB A;  2VD3 A;  2P1S A;  3S9M C;  5IZ1 A;  5EQ8 A;  1LAH E;  3ZSF A;  3SEW A;  1MH4 A;  4N81 A;  1D4N A;  4LZ8 A;  4FJP A;  2DE4 A;  1JET A;  4ISU A;  4HCW A;  5KDT A;  3EN3 A;  5F7V A;  3FGS A;  4OMB A;  2ZXT A;  4X48 A;  3PD9 A;  1M5F A;  3IX1 A;  3T9X B;  2DXY A;  5I59 B;  5I2N B;  3LBS A;  3ZS6 A;  4OVJ A;  4KHZ E;  4F2Q A;  1O7T A;  1FBP A;  5CC2 A;  3IJX B;  2O69 A;  4Q30 B;  1LBV A;  1NUW A;  4OTE A;  4QFP A;  1VE4 A;  4DCX A;  2I58 A;  3PMV A;  1CNQ A;  4DI4 B;  4ZZE A;  4IY6 A;  4F3P A;  3KBR A;  4KCD A;  4ELR A;  4OVT A;  1FTL A;  4POX A;  1H44 A;  1LCF A;  2Q8M A;  1D9Q A;  2PYY A;  4EQB A;  1POT A;  3OEM A;  3TEL A;  4XKP A;  3T96 B;  2Q2C A;  4K3F A;  4QRZ A;  3K6V A;  4IO5 A;  4KQP A;  4HS7 A;  1PB8 A;  2CEX A;  5ITO A;  4YAH X;  4HTG A;  2XWO A;  4FOR A;  2H9B A;  1AOV A;  1A7L A;  5H8F A;  2F7A A;  1FTO A;  1MQD A;  2XXU A;  4U23 A;  3IO6 A;  3SET A;  1EYI A;  1JW1 A;  2F8D A;  5L9M A;  3SZP A;  4MAG A;  1URD A;  3VLU A;  2ZMB A;  3C31 A;  1NUZ A;  2QS4 A;  4H46 A;  3U65 A;  3UN6 A;  1OLC A;  4ELO A;  3NOH A;  1MQG A;  3RTW B;  3O6G A;  3CFX A;  1G0I A;  4Z7E A;  4P1L A;  3QSL A;  1XOC A;  2H4I A;  1SDX A;  1YXI A;  4WKM A;  1SW1 A;  1Y4T A;  1MQH A;  1VDW A;  2UVI A;  5L9S A;  2GQ1 A;  3CSB A;  5IZ3 A;  2KQZ A;  2F78 A;  2FYI A;  2H25 A;  4H0W A;  3TDJ A;  1LAX A;  2Z8E A;  3LSL A;  4PTK A;  4MCO A;  5A5X A;  2MKZ A;  4F1V A;  3HN0 A;  4GBW A;  4Q0C A;  4YKI A;  3QIM A;  2VPO A;  1IXG A;  4G61 A;  1FPL A;  2V3Q A;  3FAT A;  4H5G A;  4HE0 A;  4BLA A;  1R9L A;  5DT6 A;  3MP8 A;  3FJG A;  4LZ5 A;  1IMA A;  5DEX A;  1D9Y A;  2XXK A;  3PUZ E;  1K9Y A;  1MM6 A;  3E78 A;  1MY1 A;  4PFT A;  2V93 A;  3B7D A;  4NGU A;  1B05 A;  1K9Z A;  2ZYN A;  3VV5 A;  3VVE A;  1SD3 A;  4PFR A;  1F9B A;  4R2F A;  4X04 A;  4IGT A;  1NMU A;  3VLV A;  3G3I A;  4FEC A;  3O66 A;  1B7Z A;  2PCR A;  1II5 A;  3G3F A;  1ZBM A;  3U1O A;  2ZNT A;  1IMC A;  3BFU A;  1ZJL A;  3E13 X;  1JP4 A;  3FJ7 A;  3QUF A;  2NXO A;  1D9V A;  5KCJ A;  4PFB A;  1KA0 A;  4G4P A;  5ITP A;  5FBP A;  4I3Y A;  3D4C A;  2D3I A;  5AA4 A;  4WEP A;  2O7U A;  5B7D A;  2O6A A;  3MAM A;  1LAG E;  2P2A A;  2Q9T A;  4NF5 B;  3K1M A;  4RK9 A;  1SVX B;  1M5C A;  5J16 A;  3TYH A;  2QMX A;  4O3A A;  4NAP A;  5TPA B;  5HBC A;  2QPQ A;  3A29 A;  4FE8 A;  3FVO A;  4KCC A;  3U8Q A;  4LN5 A;  2Z23 A;  1PC3 A;  3BFT A;  4AB6 A;  5CMB A;  1SW4 A;  3OO7 A;  1QUJ A;  1FCK A;  5IKB A;  4LP2 B;  5JTY B;  4DXC A;  3UK4 A;  1IXC A;  4OYV A;  1OMP A;  4OVQ A;  3FXR A;  3E9X A;  3TAJ A;  2GHB A;  3RPW A;  1FQD A;  5TP9 A;  4NF8 A;  4IO3 A;  4N15 A;  2DWH A;  3B6Q A;  2JJK A;  5FTH A;  5ICT A;  2Q89 A;  3EF7 A;  2DP8 A;  2B3B A;  1USY H;  4OZ9 A;  3OO6 A;  2QL3 A;  4G2Z A;  1NH7 A;  4NWD A;  1FPE A;  1RDY A;  3H7M A;  3O29 A;  3S4U A;  2XXR A;  2V3U A;  3VVD A;  5J1D A;  2CZK A;  4QFN A;  5ET7 A;  1QW0 A;  4QXD A;  4X1D A;  3DEL B;  3R6U A;  3MQ9 A;  4ZS9 A;  5K2X A;  4JVD A;  3DLN A;  4FED A;  1UQW A;  1LB8 A;  5I57 B;  3V8X B;  2OK2 A;  1VR5 A;  3OO8 A;  1LST A;  2DVZ A;  3MZB A;  1CE2 A;  2Y7K A;  4POW A;  1LLS A;  4PGP A;  3KC1 A;  4OXV A;  5I3S A;  1PEB A;  2F6P A;  3LSF B;  4YIC A;  5I56 A;  2UVH A;  2QS3 A;  5EYF A;  3I6V A;  4N8Y A;  4YB6 A;  4P56 A;  1IMF A;  3IL1 B;  2OBG A;  3K1P A;  1R6Z A;  3CG1 A;  3MVY A;  1EZ9 A;  3TKD A;  3CI8 A;  2HZL A;  2Y7R A;  3HHF A;  3C35 A;  1SQY A;  1QJM A;  1I6Q A;  3IO4 A;  1P1W A;  4EUO A;  3FUZ A;  3LC8 A;  5DVJ A;  1FJ6 A;  3PTY A;  4R72 A;  3OSR A;  3PD8 A;  5BUU A;  3H6T A;  2YJP A;  2XXP A;  1B9J A;  1H76 A;  4GQO A;  4U21 A;  5I59 A;  4PDD A;  5I2N A;  1EH3 A;  1H43 A;  5I58 B;  1TXF A;  4DLD A;  5I84 A;  4I9D A;  1PBP A;  3HHG A;  4DI3 D;  4LVQ A;  1B40 A;  1TWY A;  5LTC A;  3QXM A;  3U93 A;  1A54 A;  5DYH A;  3HV1 A;  2RCB A;  1MXY A;  2AL4 A;  4EDP A;  4KPT A;  4Z0I A;  4ESX A;  1SBP A;  1B3G A;  4X1B A;  2O1M A;  2Y5L A;  3HCQ A;  4GXA A;  4R6K A;  2F3B A;  4U1Z A;  2WKY A;  4P1E A;  5H8Q B;  3THI A;  2VT5 A;  3UA8 A;  2QS1 A;  1OIB A;  4QFK A;  1WDN A;  3K6W A;  1N84 A;  1VFD A;  3IB0 A;  5TU0 A;  2ZZX A;  4NF4 B;  4GX4 A;  4MNC A;  2UVG A;  1TFD A;  3B8B A;  3LR1 A;  4PAI A;  4F1U A;  1NV3 A;  3GYY A;  2DS9 A;  3K6U A;  1ZU0 A;  1EYK A;  4F19 A;  1Y1M A;  5K2Y A;  4NE4 A;  3VDF A;  2CZI A;  4NMY A;  1UIU A;  2OLB A;  2ZNS A;  1SW2 A;  2UVJ A;  3RTF B;  1B3L A;  2X7P A;  3MWB A;  4RPO A;  4PDH A;  2QS2 A;  3BIG A;  3UP9 A;  1IXH A;  3C33 A;  4G68 C;  2F7B A;  3KN8 A;  2Q88 A;  3T93 B;  1LCT A;  1GV8 A;  1PDA A;  4GL8 A;  4GXS B;  4HE1 A;  2M8C A;  3SEU A;  4ZE9 A;  4I1D A;  2FBP A;  4X8R A;  1IEJ A;  3K4U A;  3SEV A;  4OWD A;  1LFI A;  4U2R A;  4GIZ A;  3IB1 A;  3FD3 A;  5F1Q A;  1CB6 A;  4PFU A;  2XA5 A;  4YZZ A;  4OA4 A;  5CM6 A;  3KJT A;  1NV1 A;  4XTC Q;  1XVY A;  2G29 A;  3LV0 A;  4UAC A;  1XVX A;  2PT2 A;  1T0K A;  2QVU A;  1B58 A;  4R6H A;  1FW0 A;  3D1R A;  4MX6 A;  4ONY A;  4JWX A;  1B0H A;  2HHM A;  3ILU B;  1MY4 A;  1R1N A;  1LBB A;  4F39 A;  4N13 A;  4JVC A;  3PGF A;  2F97 A;  3MVZ A;  4TLM B;  1SPI A;  2F35 A;  1B5J A;  1MXZ A;  2ZYO A;  2DVC A;  2OWT A;  4GOT A;  4F1Y A;  1JEV A;  4P0G A;  3TPA A;  2CZL A;  1B3F A;  5M2V A;  1Y1Z A;  1N04 A;  2H98 A;  4F18 A;  1MY3 A;  1OVB A;  3U94 A;  5LOM A;  3AXF A;  3EHU A;  3C36 A;  3KZG A;  4U4S A;  3FAS A;  1FTK A;  4O7M A;  3C32 A;  4NF5 A;  1URS A;  1M5B A;  1RYX A;  5TPA A;  1DCU A;  4QFO A;  4U22 A;  4XKR A;  3WAE A;  4G68 A;  4P0I A;  4G8H A;  4GLI A;  2PFY A;  3OD7 A;  3C4M A;  3OXN A;  1P1Q A;  2GFE A;  3S9E A;  1MPD A;  1MXW A;  2AYS A;  3MZ1 A;  3U72 A;  1NNF A;  1BTJ A;  1FPK A;  1TFA A;  3FVN A;  1B3H A;  2Q2A A;  2VHA A;  4JWY A;  1H3D A;  3VVF A;  2A5T B;  1ZLQ A;  3RUM A;  1SYI A;  3TCG A;  1EZO A;  4I40 A;  3W15 C;  4H8I A;  3O6I A;  4GL0 A;  4GWW A;  3ROJ A;  2RF1 A;  4X9T A;  2KLF A;  3MZ9 A;  3V89 B;  3MBP A;  3WAF A;  3MP6 A;  1KWH A;  4N91 A;  4NWC A;  2HPG A;  1A55 A;  1AL3 A;  3DP8 A;  1BIY A;  1BKA A;  2PBW A;  4EXK A;  3E79 A;  4PAK A;  2VOZ A;  4U4X A;  5I57 A;  3PMX A;  4PC9 A;  2UXA A;  1YZ0 A;  1GGG A;  1MG1 A;  4P11 A;  4PFY A;  3MYU A;  1Q1K A;  3T1B A;  4LON B;  3G3J A;  2I3V A;  3TTL A;  3H6U A;  1UIV A;  1LBY A;  2RIN A;  1INP A;  2Z8F A;  1VSO A;  4UAB A;  3VE1 B;  5H8N B;  1RYO A;  2RC7 A;  2I0B A;  1MDP 1;  4O94 A;  4F22 A;  4ELP A;  4IGR A;  3RY3 A;  3IOU A;  4FEB A;  3FVG A;  1LBW A;  4JSO A;  1FBE A;  3CVG A;  4LZ7 A;  3S9L C;  2OJT A;  4QSD A;  3ECR A;  3FXB A;  1UTH B;  4IO6 A;  4JWO A;  3PUW E;  3CR9 A;  4R9G A;  4R74 A;  5AA3 A;  2F5X A;  2X7Q A;  1ZIU A;  1URG A;  1DPE A;  4MH5 A;  3RNN A;  1FPJ A;  3W9W A;  2HCA A;  2REG A;  3N5L A;  1DOT A;  1D3K A;  5I58 A;  4YKP A;  5FTI A;  4QBA A;  3IOR A;  3V5A A;  4YB7 A;  3P7I A;  4AQ4 A;  2Q74 A;  1MPB A;  3KOT A;  1US4 A;  4ZEF A;  1MM7 A;  4RK2 A;  2ZZV A;  4ZEI A;  4NQ8 A;  5ESY A;  1MS7 A;  3KGC A;  3K2D A;  2OCU A;  5JEI A;  4OEU A;  4QHQ A;  4OHN A;  2ONS A;  1MY0 A;  3BBR A;  3IJO B;  3LSW A;  5H8Q A;  5EQA A;  4EF1 A;  2VP1 A;  1O63 A;  4NG7 A;  3KSX A;  4O3B A;  3GLB A;  2FHY A;  3IOT A;  4NED A;  3M3L A;  4PBQ A;  4FIM A;  2DWA A;  1B4Z A;  1AMF A;  2DDK A;  4YMA A;  5HPQ A;  2UYE A;  3D4G A;  1XT8 A;  4JXI A;  1WOD A;  2FA7 A;  2I4B A;  3PPO A;  2VGQ A;  3EHS A;  4JVI A;  5DVI A;  4RXL A;  2WYK A;  4OVR A;  3TZA A;  1IQ7 A;  3Q29 A;  4GWZ A;  2BJJ X;  1Y20 A;  4M1V A;  3EPE A;  1NUY A;  2XHD A;  4PQJ A;  5H8H B;  1JEU A;  3SKP A;  4XXU A;  1LBX A;  3KJ7 A;  4AS5 A;  3EQ1 A;  4JB7 A;  3GBA A;  3TCF A;  3CSG A;  4RPN A;  4GX6 A;  4OVS A;  4F3G A;  4WXJ A;  2I4C A;  3OOA A;  3VXB A;  4U1O A;  3FXQ A;  3OMB A;  1XI6 A;  3T66 A;  5IAI A;  2F36 A;  4HCY A;  3KN7 A;  2ALU A;  3DP6 A;  1PBQ A;  2OWS A;  1ZTY A;  5ET5 A;  1YAE A;  2XD3 A;  1VFE A;  4DDD A;  1NV4 A;  2O7I A;  1JVX A;  1IIW A;  4I3E A;  4H6D A;  2P3N A;  1MQJ A;  5IZ3 B;  3KSJ A;  5ELV A;  3TTN A;  5CRY A;  3KOS A;  4OVP A;  1EYJ A;  3SEX A;  5F24 A;  2I6E A;  2Y7W A;  1POY 1;  3I3V A;  4TLL B;  4WED A;  4FBP A;  1Z7M E;  3VXC A;  1HSL A;  4LAT A;  4QFL A;  2PMS A;  4PF8 A;  2X26 A;  3FV2 A;  2GH9 A;  2QVV A;  1NKX A;  4GVO A;  4FAJ A;  3MPL A;  2HZK A;  3QK6 A;  4IO2 A;  3T22 A;  1P1U A;  2GRV A;  4PGN A;  4GFR A;  3GZG A;  2XXT A;  1DMB A;  3GBB A;  1B4H A;  1WVJ A;  3O6H A;  4GF8 A;  3QMF A;  4M4G A;  1BP5 A;  1Y4C A;  3L6H A;  4GWO A;  4N6D A;  2O1L A;  2I48 A;  3CHG A;  5I7I A;  2ZYK A;  1BLF A;  1B2H A;  1NV0 A;  3FV1 A;  4P8B A;  4C0R A;  4GWU A;  1Y3Q A;  1FRP A;  4LUB A;  3RN8 A;  3A09 A;  4Q8R A;  2O51 A;  2Y84 A;  1FPG A;  2QJE A;  2RCA A;  2DXR A;  3I5O A;  4MLV A;  5CBS A;  2F6G A;  3V83 A;  4IY5 A;  3TQL A;  4OFO A;  2A5T A;  4E0W A;  3OEN A;  2QSX A;  1LEV A;  2IEE A;  5ICQ A;  4KD5 A;  2ESN A;  1LB9 A;  1FQE A;  2D21 A;  2BJI A;  2XWV A;  2XXH A;  4PFW A;  4ZEB A;  1JVY A;  3H03 A;  3ONM A;  3RPL B;  4F29 A;  3PV0 E;  1XC1 A;  1AH5 A;  4ZZA A;  1N3W A;  2DE3 A;  5AA2 D;  4NF6 B;  5CBR A;  2B65 A;  1YPN A;  1IIT A;  3PPP A;  4KR5 A;  2E1S A;  3H6W A;  3LUY A;  1N0T A;  2XXI A;  4P9K A;  3IB2 A;  3C34 A;  2V84 A;  1QUL A;  1Z7N E;  5CMM A;  1N3X A;  2AL5 A;  2R9J A;  1Q35 A;  4BDL A;  3TTM A;  2RC9 A;  4N6P A;  2QRY A;  2L5V A;  1B46 A;  3RQT A;  3Q27 A;  1SI0 A;  1BK4 A;  1FTJ A;  3LSX A;  4R9F A;  2DYX A;  5H8N A;  1GR2 A;  4MFI A;  4O3C A;  1LAF E;  2DOJ A;  2V3T A;  3Q28 A;  1B5I A;  1FQF A;  2G93 A;  4N8G A;  2KR0 A;  2FNC A;  1US5 A;  4Q5T A;  4OFJ A;  2FVZ A;  3QYT A;  4IB2 A;  5ISU A;  5EHM A;  1MQI A;  2B4L A;  4DZ1 A;  3FJM A;  1DTZ A;  4H8J A;  1UTH A;  1Y9U A;  3H3G A;  5JK4 A;  2O84 X;  3UGW A;  4GWS A;  4PCD A;  5EQ9 A;  3E4R A;  1USY E;  4O8M A;  2PVU A;  2HQ0 A;  2REJ A;  1QUI A;  4PP0 A;  1HSE A;  2H5Y A;  4PE5 B;  2DQV A;  4XKN A;  2RC8 A;  3N26 A;  1B1H A;  3MST A;  4YKJ A;  3TMG A;  3L6G A;  3IAZ A;  4H1X A;  2XXX A;  5IGA A;  4PE3 A;  3N6U A;  2P0S A;  1IMB A;  4NX1 A;  2LAO A;  3GXA A;  2Z22 A;  3QUJ A;  3TUS A;  2WX9 A;  2YPN A;  5AA2 B;  1QGX A;  4EQ7 A;  1FTA A;  1OLA A;  4OEV A;  2DWJ A;  3T9U A;  1ATG A;  1SI1 A;  4FAT A;  3KFM A;  3G3K A;  4OET A;  3KN3 A;  5FHM A;  5EHS A;  1I6A A;  4GBV A;  3CFL A;  2Y5K A;  1N76 A;  1Q9D A;  3UIF A;  1Y3P A;  1GTK A;  2WBB A;  1J1N A;  3HST A;  4DE8 A;  3F11 A;  3K6X A;  4THI A;  2I3W A;  4EF2 A;  1FJ9 A;  5JTY A;  1I6B A;  2XXY A;  3IFA A;  4IR8 A;  4N6K A;  3O28 A;  4NHB A;  5I2K B;  4F31 B;  4PAF A;  3G3G A;  1LFG A;  4F3B A;  4KXP A;  1DBZ A;  3K02 A;  5A5L A;  1SW5 A;  5AA1 A;  4ELQ A;  1QKA A;  4PBH A;  3FVK A;  4P3L A;  1MPC A;  1DTG A;  4P47 A;  4OER A;  3KC0 A;  3T9V A;  4OES A;  3T9H B;  1B32 A;  3MP1 A;  4ZED A;  4G8N A;  4KYS A;  1MY2 A;  1FBG A;  5H8H A;  1JW4 A;  2P3V A;  4DXB A;  1NV2 A;  1DPP A;  2R71 A;  3BKI B;  2NUV A;  3PPR A;  2V25 A;  4MNP A;  2GHA A;  1MDQ A;  3TEP A;  2HXW A;  2W7Y A;  2XWI A;  1KZ8 A;  3OSQ A;  3CG3 A;  1NI9 A;  1P99 A;  2DE2 A;  4F2O A;  1FQB A;  4KYE A;  4MNI A;  3ZKK A;  4AB5 A;  1Y3N A;  4MHF A;  1IXI A;  2AIX A;  2F34 A;  3W9V A;  4MF3 A;  4H65 A;  4PET A;  1B5H A;  5ET8 A;  5BWJ A;  4R2B A;  3K01 A;  1FQA A;  1B51 A;  1FBF A;  1P1N A;  4ZDM A;  2XXV A;  4G77 A;  4N07 A;  1FBC A;  4IO4 A;  5CMC A;  4YB5 A;  3RLF E;  1S50 A;  4OEN A;  2R8T A;  1NFT A;  2ZYM A;  3MVW A;  2HEU A;  3O9P A;  3O2A A;  4C1U A;  4LQ2 A;  5FHO A;  4TQU Q;  1UTB B;  5DW8 A;  2B4M A;  2CMO A;  1N7W A;  3MW0 A;  1A8E A;  3A3C A;  1ANF A;  3B6W A;  3KEI A;  2DSF A;  4R73 A;  1PB7 A;  4N17 A;  1NH8 A;  3OO9 A;  2XXQ A;  3RT8 A;  4NF0 A;  5CI5 A;  4NTL A;  3RT6 B;  4YMB A;  1JQF A;  5ET6 A;  3JYR A;  3EHT A;  3Q25 A;  3SDF A;  4MLQ A;  2R6G E;  2ANJ A;  2VPN A;  3ISP A;  4MMP A;  2THI A;  4QF9 A;  4RY1 A;  1RDZ A;  2CEY A;  3B50 A;  5KDT B;  3ILT B;  3PMW A;  1NNT A;  2HXR A;  1FBH A;  3U92 A;  1MXV A;  3QAX A;  5EYH A;  1DK4 A;  1NNK A;  3M3F A;  5B70 A;  3SES A;  1IUD A;  4LA9 A;  3H6V A;  5KZT A;  4NF4 A;  4MBP A;  1NUX A;  1QUK A;  4I8C A;  2RKM A;  3CFZ A;  3SEY A;  1S9T A;  3IOV A;  4C1T A;  3RPL A;  4G68 B;  4JDF A;  2XXW A;  4NF6 A;  4KI0 E;  3M3K A;  2E0S A;  3R7X A;  4OAN A;  4ZE8 A;  4N4U A;  1NNP A;  2DWI A;  1MXX A;  1NV6 A;  1IME A;  1IZ1 A;  2NVU B;  3IFC A;  3OEL A;  1FBD A;  2WEF A;  3PUY E;  4TOZ A;  4BDN A;  1A99 A;  2XX8 A;  4AS4 A;  4ECF A;  1MRP A;  2UYF A;  4BDM A;  2OZZ A;  3CIJ A;  3FBP A;  5LDZ A;  3M8U A;  2XD2 A;  3HFU A;  5H8F B;  5H8S A;  3A3U A;  1I69 A;  4IO7 A;  3MUQ A;  2QFL A;  3B6T A;  3FZV A;  1LFH A;  5IZZ A;  2XWK A;  3DP4 A;  4XKQ A;  1FPF A;  1ZMG A;  4HE2 A;  3HPI A;  2WBD A;  3LUZ A;  1LBZ A;  4F3S A;  3VFJ A;  4E0X A;  2ZZW A;  2Y7P A;  4BDO A;  3K1N A;  4DIG A;  3Q26 A;  3PUV E;  4OFL A;  2B3F A;  2NOO A;  4ZEC A;  3OEK A;  4H67 A;  3IK6 B;  2OWZ A;  1ELJ A;  1OQH A;  1EU8 A;  4PFI A;  5DTB A;  4KFQ A;  5FHN A;  3ODB A;  4LQ5 A;  4GWX A;  1HSJ A;  1R9Q A;  4EXL A;  3KBZ A;  4ESW A;  2A5S A;  1G0H A;  3N94 A;  3TTK A;  1EZP A;  2QVR A;  5I5P A;  5A5X B;  2HAU A;  2I49 A;  2I0C A;  1AIV A;  3E3K A;  2VD2 A;  4ZEK A;  1QKB A;  5EYG A;  3RYD A;  1QVS A;  4I62 A;  3ZKL A;  1YCJ A;  3TCH A;  4JSD A;  4ND9 A;  2ABH A;  2YLN A;  2QMW A;  5DVF A;  1NV7 A;  1ZKB A;  3G7W A;  1B7H A;  5DEX B;  3MVX A;  2XX7 A;  3PPQ A;  4BDR A;  3USD A;  4YU0 A;  2D5W A;  2OX3 A;  5AA2 A;  1SYH A;  1P1O A;  3G3H A;  1PB9 A;  1LGB C;  1B7U A;  5L8D A;  4DXU A;  5EQ7 A;  2IA4 A;  4KYD A;  4H5F A;  4PF6 A;  1XS5 A;  1OQG A;  4QSE A;  2F3D A;  1L5T A;  4R6Y A;  2WYP A;  3T0J A;  3R26 A;  2PX1 A;  3JV9 A;  4OQO A;  5I2K A;  5KCJ B;  1MH3 A;  4JBZ A;  4DCY A;  3PPN A;  4L17 A;  2ONK E;  4GX3 A;  5AA4 B;  4HW8 A;  2CZH A;  4R75 A;  1O64 A;  1FSA A;  1LBC A;  3MPK A;  3H06 B;  1YTV A;  2PT1 A;  3S9N C;  1B6H A;  1YYZ A;  1B1X A;  2XX9 A;  4HXV A;  1TT1 A;  5HM4 B;  2Y7I A;  2V4C A;  3RGY A;  2O68 A;  4XFE A;  2ZNU A;  1JW5 A;  1A8F A;  1OVT A;  3JZJ A;  1S7Y A;  4MJO A;  5CMK A;  4RNS A;  2FIX A;  2HFB A;  1RDX A;  5TP9 B;  4XF5 A;  2ONR A;  1NL5 A;  4NF8 B;  1H45 A;  3SER A;  2FIE A;  3MC2 A;  4MEV A;  3O97 A;  4BDQ A;  3DM0 A;  4EQ9 A;  4XEQ A;  4GD5 A;  1GVC A;  2Z8D A;  3PUX E;  1NV5 A;  4G8M A;  3UOR A;  2F7C A;  3KG2 A;  1FQC A;  3K00 A;  4H45 A;  1M5E A;  1MXU A;  1M5D A;  5IM2 A;  2PFZ A;  1FTM A;  1KA1 A;  1B3E A;  3K0V A;  5L9O A;  3TQW A;  3TOD A;  3FXU A;  4MIJ A;  3FIR A;  4UA8 A;  4QSC A;  4GRK A;  1IMD A;  1XHY A;  1A40 A;  4RA1 A;  4GWY A;  3H4Z A;  4RYA A;  1FPB A;  4XIG Q;  1UTB A;  2Q8J A;  3N6T A;  3CRB A;  5I56 B;  3S2V A;  1B0L A; 
#chains in the Genus database with same CATH homology
 3VLW A;  3HO7 A;  3PU5 A;  1DSN A;  1B52 A;  2HAV A;  4RJZ A;  3C9H A;  5AE4 A;  1JNF A;  1N7X A;  3TFL A;  4YKK A;  3MJN A;  1RKM A;  2H99 A;  3TTR A;  3IOW A;  3IR1 A;  2NWJ A;  2VD3 A;  2P1S A;  3S9M C;  1LAH E;  3ZSF A;  3SEW A;  1MH4 A;  1D4N A;  4LZ8 A;  4FJP A;  2DE4 A;  1JET A;  4ISU A;  4HCW A;  5KDT A;  3EN3 A;  5F7V A;  3FGS A;  4OMB A;  2ZXT A;  4X48 A;  3PD9 A;  1M5F A;  3IX1 A;  3T9X B;  2DXY A;  5I59 B;  5I2N B;  3LBS A;  3ZS6 A;  4OVJ A;  4KHZ E;  4F2Q A;  1O7T A;  5CC2 A;  3IJX B;  2O69 A;  4Q30 B;  4OTE A;  4QFP A;  1VE4 A;  4DCX A;  2I58 A;  3PMV A;  4ZZE A;  4IY6 A;  4F3P A;  3KBR A;  4KCD A;  4ELR A;  1FTL A;  4POX A;  1H44 A;  1LCF A;  2PYY A;  4EQB A;  1POT A;  3OEM A;  3TEL A;  4XKP A;  3T96 B;  2Q2C A;  4K3F A;  4QRZ A;  3K6V A;  4IO5 A;  4KQP A;  4HS7 A;  1PB8 A;  5ITO A;  4YAH X;  4HTG A;  4FOR A;  2H9B A;  1AOV A;  1A7L A;  5H8F A;  2F7A A;  1FTO A;  1MQD A;  2XXU A;  4U23 A;  3IO6 A;  3SET A;  1JW1 A;  2F8D A;  5L9M A;  1URD A;  3VLU A;  2ZMB A;  3C31 A;  2QS4 A;  3UN6 A;  1OLC A;  4ELO A;  1MQG A;  3RTW B;  3O6G A;  3CFX A;  4Z7E A;  3QSL A;  1XOC A;  2H4I A;  1SDX A;  4WKM A;  1SW1 A;  1Y4T A;  1MQH A;  2UVI A;  5L9S A;  3CSB A;  2F78 A;  2FYI A;  2H25 A;  4H0W A;  3TDJ A;  1LAX A;  2Z8E A;  3LSL A;  5A5X A;  4F1V A;  3HN0 A;  4Q0C A;  4YKI A;  3QIM A;  1IXG A;  2V3Q A;  3FAT A;  4H5G A;  4BLA A;  1R9L A;  5DT6 A;  3MP8 A;  3FJG A;  4LZ5 A;  5DEX A;  1D9Y A;  3PUZ E;  1MM6 A;  1MY1 A;  4PFT A;  2V93 A;  3B7D A;  1B05 A;  3VVE A;  2ZYN A;  3VV5 A;  1SD3 A;  1F9B A;  4R2F A;  4IGT A;  1NMU A;  3VLV A;  3G3I A;  4FEC A;  3O66 A;  1B7Z A;  1II5 A;  3G3F A;  1ZBM A;  3U1O A;  2ZNT A;  3BFU A;  1ZJL A;  3E13 X;  3FJ7 A;  3QUF A;  2NXO A;  1D9V A;  5KCJ A;  4G4P A;  5ITP A;  3D4C A;  2D3I A;  5AA4 A;  4WEP A;  2O7U A;  5B7D A;  2O6A A;  3MAM A;  1LAG E;  2P2A A;  2Q9T A;  4NF5 B;  3K1M A;  4RK9 A;  1SVX B;  1M5C A;  3TYH A;  2QMX A;  4O3A A;  5TPA B;  5HBC A;  2QPQ A;  4FE8 A;  3FVO A;  4KCC A;  3U8Q A;  2Z23 A;  1PC3 A;  3BFT A;  4AB6 A;  5CMB A;  1SW4 A;  3OO7 A;  1QUJ A;  1FCK A;  5IKB A;  4LP2 B;  5JTY B;  4DXC A;  3UK4 A;  1IXC A;  4OYV A;  1OMP A;  3FXR A;  3E9X A;  3TAJ A;  2GHB A;  3RPW A;  1FQD A;  5TP9 A;  4NF8 A;  4IO3 A;  2DWH A;  3B6Q A;  5FTH A;  5ICT A;  2Q89 A;  3EF7 A;  2DP8 A;  2B3B A;  1USY H;  4OZ9 A;  3OO6 A;  2QL3 A;  4G2Z A;  1NH7 A;  4NWD A;  3H7M A;  3O29 A;  3S4U A;  2XXR A;  2V3U A;  3VVD A;  5J1D A;  4QFN A;  1QW0 A;  4X1D A;  3DEL B;  3R6U A;  3MQ9 A;  4ZS9 A;  5K2X A;  3DLN A;  4FED A;  1UQW A;  1LB8 A;  5I57 B;  3V8X B;  2OK2 A;  1VR5 A;  3OO8 A;  1LST A;  2DVZ A;  3MZB A;  1CE2 A;  2Y7K A;  4POW A;  1LLS A;  4OXV A;  1PEB A;  2F6P A;  3LSF B;  4YIC A;  5I56 A;  2UVH A;  2QS3 A;  5EYF A;  3I6V A;  4YB6 A;  3IL1 B;  2OBG A;  3K1P A;  1R6Z A;  3CG1 A;  3MVY A;  1EZ9 A;  3TKD A;  3CI8 A;  2HZL A;  2Y7R A;  3HHF A;  3C35 A;  1SQY A;  1QJM A;  1I6Q A;  3IO4 A;  1P1W A;  4EUO A;  3FUZ A;  3LC8 A;  5DVJ A;  4R72 A;  3OSR A;  3PD8 A;  5BUU A;  3H6T A;  2YJP A;  2XXP A;  1B9J A;  1H76 A;  4GQO A;  4U21 A;  5I59 A;  5I2N A;  1EH3 A;  1H43 A;  5I58 B;  1TXF A;  4DLD A;  5I84 A;  4I9D A;  1PBP A;  3HHG A;  4LVQ A;  1B40 A;  1TWY A;  3QXM A;  3U93 A;  1A54 A;  5DYH A;  3HV1 A;  2RCB A;  1MXY A;  2AL4 A;  4EDP A;  4KPT A;  4Z0I A;  4ESX A;  1SBP A;  1B3G A;  4X1B A;  2O1M A;  3HCQ A;  4GXA A;  4R6K A;  4U1Z A;  2WKY A;  5H8Q B;  3THI A;  3UA8 A;  2QS1 A;  1OIB A;  4QFK A;  1WDN A;  3K6W A;  1N84 A;  1VFD A;  3IB0 A;  5TU0 A;  4NF4 B;  2UVG A;  1TFD A;  3LR1 A;  4F1U A;  2DS9 A;  3K6U A;  1ZU0 A;  4F19 A;  1Y1M A;  5K2Y A;  4NE4 A;  3VDF A;  4NMY A;  1UIU A;  2OLB A;  2ZNS A;  1SW2 A;  2UVJ A;  3RTF B;  1B3L A;  2X7P A;  3MWB A;  4RPO A;  2QS2 A;  3UP9 A;  1IXH A;  3C33 A;  4G68 C;  2F7B A;  3KN8 A;  2Q88 A;  3T93 B;  1LCT A;  1GV8 A;  1PDA A;  4GL8 A;  4GXS B;  3SEU A;  2M8C A;  4ZE9 A;  4I1D A;  1IEJ A;  3K4U A;  3SEV A;  4OWD A;  1LFI A;  4U2R A;  4GIZ A;  3IB1 A;  3FD3 A;  5F1Q A;  1CB6 A;  4PFU A;  4YZZ A;  5CM6 A;  3KJT A;  4XTC Q;  1XVY A;  2G29 A;  4UAC A;  1XVX A;  2PT2 A;  1T0K A;  1B58 A;  4R6H A;  1FW0 A;  4ONY A;  4JWX A;  1B0H A;  3ILU B;  1MY4 A;  1R1N A;  1LBB A;  4F39 A;  4N13 A;  3PGF A;  2F97 A;  3MVZ A;  4TLM B;  2F35 A;  1B5J A;  1MXZ A;  2ZYO A;  2DVC A;  2OWT A;  4GOT A;  4F1Y A;  1JEV A;  4P0G A;  3TPA A;  2CZL A;  1B3F A;  5M2V A;  1Y1Z A;  1N04 A;  2H98 A;  4F18 A;  1MY3 A;  1OVB A;  3U94 A;  5LOM A;  3AXF A;  3EHU A;  3C36 A;  3KZG A;  4U4S A;  3FAS A;  1FTK A;  3C32 A;  4NF5 A;  1URS A;  1M5B A;  1RYX A;  5TPA A;  4QFO A;  4U22 A;  4XKR A;  3WAE A;  4G68 A;  4P0I A;  4G8H A;  4GLI A;  3OD7 A;  3C4M A;  3OXN A;  1P1Q A;  2GFE A;  3S9E A;  1MPD A;  1MXW A;  2AYS A;  3MZ1 A;  3U72 A;  1NNF A;  1BTJ A;  1TFA A;  3FVN A;  1B3H A;  2Q2A A;  2VHA A;  4JWY A;  1H3D A;  3VVF A;  2A5T B;  1ZLQ A;  3RUM A;  1SYI A;  3TCG A;  1EZO A;  3W15 C;  4H8I A;  3O6I A;  4GL0 A;  2RF1 A;  4X9T A;  2KLF A;  3MZ9 A;  3V89 B;  3MBP A;  3WAF A;  3MP6 A;  1KWH A;  4NWC A;  1A55 A;  1AL3 A;  3DP8 A;  1BIY A;  1BKA A;  2PBW A;  4EXK A;  2VOZ A;  4U4X A;  5I57 A;  3PMX A;  2UXA A;  1GGG A;  1MG1 A;  4P11 A;  4PFY A;  1Q1K A;  4LON B;  3G3J A;  2I3V A;  3TTL A;  3H6U A;  1UIV A;  2RIN A;  2Z8F A;  1VSO A;  3VE1 B;  5H8N B;  1RYO A;  2RC7 A;  2I0B A;  1MDP 1;  4F22 A;  4ELP A;  4IGR A;  3RY3 A;  3IOU A;  4FEB A;  3FVG A;  4JSO A;  3CVG A;  4LZ7 A;  3S9L C;  2OJT A;  4QSD A;  3ECR A;  1UTH B;  4IO6 A;  4JWO A;  3PUW E;  3CR9 A;  4R9G A;  4R74 A;  5AA3 A;  2F5X A;  2X7Q A;  1ZIU A;  1URG A;  1DPE A;  4MH5 A;  3RNN A;  3W9W A;  2HCA A;  2REG A;  3N5L A;  1DOT A;  1D3K A;  5I58 A;  4YKP A;  5FTI A;  3IOR A;  3V5A A;  4YB7 A;  3P7I A;  4AQ4 A;  1MPB A;  3KOT A;  1US4 A;  4ZEF A;  1MM7 A;  4RK2 A;  4ZEI A;  1MS7 A;  3KGC A;  3K2D A;  2OCU A;  5JEI A;  4OEU A;  4QHQ A;  4OHN A;  2ONS A;  1MY0 A;  3BBR A;  3IJO B;  3LSW A;  5H8Q A;  4EF1 A;  2VP1 A;  1O63 A;  3KSX A;  4O3B A;  3GLB A;  3IOT A;  4NED A;  3M3L A;  4FIM A;  2DWA A;  1B4Z A;  1AMF A;  4YMA A;  5HPQ A;  2UYE A;  3D4G A;  1XT8 A;  4JXI A;  1WOD A;  2FA7 A;  2I4B A;  3PPO A;  2VGQ A;  3EHS A;  5DVI A;  4RXL A;  3TZA A;  1IQ7 A;  3Q29 A;  2BJJ X;  1Y20 A;  4M1V A;  3EPE A;  2XHD A;  4PQJ A;  5H8H B;  1JEU A;  3SKP A;  4XXU A;  3KJ7 A;  3EQ1 A;  4JB7 A;  3GBA A;  3TCF A;  3CSG A;  4RPN A;  4F3G A;  4WXJ A;  2I4C A;  3OOA A;  3VXB A;  4U1O A;  3FXQ A;  3OMB A;  3T66 A;  5IAI A;  2F36 A;  4HCY A;  3KN7 A;  2ALU A;  3DP6 A;  1PBQ A;  2OWS A;  1ZTY A;  1YAE A;  2XD3 A;  1VFE A;  4DDD A;  2O7I A;  1JVX A;  1IIW A;  4H6D A;  1MQJ A;  3KSJ A;  5ELV A;  3TTN A;  5CRY A;  3KOS A;  3SEX A;  2I6E A;  2Y7W A;  1POY 1;  3I3V A;  4TLL B;  4WED A;  1Z7M E;  3VXC A;  1HSL A;  4LAT A;  4QFL A;  2PMS A;  2X26 A;  3FV2 A;  2GH9 A;  1NKX A;  4GVO A;  4FAJ A;  3MPL A;  2HZK A;  3QK6 A;  4IO2 A;  3T22 A;  1P1U A;  2GRV A;  4GFR A;  3GZG A;  2XXT A;  1DMB A;  3GBB A;  1B4H A;  1WVJ A;  3O6H A;  4GF8 A;  4M4G A;  1BP5 A;  1Y4C A;  3L6H A;  4GWO A;  2O1L A;  2I48 A;  2ZYK A;  1BLF A;  1B2H A;  3FV1 A;  4C0R A;  1Y3Q A;  4LUB A;  3RN8 A;  3A09 A;  4Q8R A;  2O51 A;  2Y84 A;  2QJE A;  2RCA A;  2DXR A;  3I5O A;  4MLV A;  5CBS A;  2F6G A;  3V83 A;  4IY5 A;  3TQL A;  4OFO A;  2A5T A;  4E0W A;  3OEN A;  2QSX A;  2IEE A;  5ICQ A;  4KD5 A;  2ESN A;  1LB9 A;  1FQE A;  2D21 A;  2XXH A;  4PFW A;  4ZEB A;  1JVY A;  3H03 A;  3ONM A;  4F29 A;  3PV0 E;  1XC1 A;  1AH5 A;  4ZZA A;  1N3W A;  2DE3 A;  5AA2 D;  4NF6 B;  5CBR A;  2B65 A;  1YPN A;  1IIT A;  3PPP A;  4KR5 A;  2E1S A;  3H6W A;  3LUY A;  1N0T A;  2XXI A;  3IB2 A;  3C34 A;  2V84 A;  1QUL A;  1Z7N E;  5CMM A;  1N3X A;  2AL5 A;  2R9J A;  1Q35 A;  4BDL A;  3TTM A;  2RC9 A;  4N6P A;  2QRY A;  1B46 A;  3RQT A;  3Q27 A;  1SI0 A;  1FTJ A;  3LSX A;  4R9F A;  2DYX A;  5H8N A;  1GR2 A;  4MFI A;  4O3C A;  1LAF E;  2DOJ A;  2V3T A;  3Q28 A;  1B5I A;  1FQF A;  2G93 A;  2FNC A;  1US5 A;  4Q5T A;  4OFJ A;  3QYT A;  5ISU A;  4IB2 A;  5EHM A;  1MQI A;  4DZ1 A;  3FJM A;  1DTZ A;  4H8J A;  1UTH A;  1Y9U A;  3H3G A;  5JK4 A;  2O84 X;  3UGW A;  3E4R A;  1USY E;  2PVU A;  2HQ0 A;  2REJ A;  1QUI A;  4PP0 A;  1HSE A;  2H5Y A;  4PE5 B;  2DQV A;  4XKN A;  2RC8 A;  3N26 A;  1B1H A;  4YKJ A;  3TMG A;  3L6G A;  3IAZ A;  4H1X A;  2XXX A;  3N6U A;  2P0S A;  2LAO A;  3GXA A;  2Z22 A;  3QUJ A;  3TUS A;  2YPN A;  5AA2 B;  4EQ7 A;  4FAT A;  1OLA A;  4OEV A;  3T9U A;  2DWJ A;  1ATG A;  1SI1 A;  3KFM A;  3G3K A;  4OET A;  3KN3 A;  5FHM A;  5EHS A;  1I6A A;  3CFL A;  1N76 A;  3UIF A;  1Y3P A;  1GTK A;  1J1N A;  3HST A;  4DE8 A;  3F11 A;  3K6X A;  4THI A;  2I3W A;  4EF2 A;  5JTY A;  1I6B A;  2XXY A;  4F31 B;  3O28 A;  5I2K B;  3G3G A;  1LFG A;  4F3B A;  3K02 A;  1SW5 A;  5AA1 A;  4ELQ A;  1QKA A;  3FVK A;  1MPC A;  1DTG A;  4OER A;  3T9V A;  4OES A;  3T9H B;  1B32 A;  3MP1 A;  4ZED A;  4G8N A;  4KYS A;  1MY2 A;  5H8H A;  1JW4 A;  4DXB A;  1DPP A;  2R71 A;  3BKI B;  2NUV A;  3PPR A;  2V25 A;  2GHA A;  1MDQ A;  3TEP A;  2HXW A;  2W7Y A;  3OSQ A;  3CG3 A;  1P99 A;  2DE2 A;  4F2O A;  1FQB A;  4KYE A;  3ZKK A;  4AB5 A;  1Y3N A;  1IXI A;  2AIX A;  2F34 A;  3W9V A;  4MF3 A;  4H65 A;  4PET A;  1B5H A;  5BWJ A;  4R2B A;  3K01 A;  1FQA A;  1B51 A;  1P1N A;  4ZDM A;  2XXV A;  4G77 A;  4N07 A;  4IO4 A;  5CMC A;  4YB5 A;  3RLF E;  1S50 A;  4OEN A;  1NFT A;  2ZYM A;  3MVW A;  2HEU A;  3O9P A;  3O2A A;  4C1U A;  4LQ2 A;  5FHO A;  4TQU Q;  1UTB B;  2CMO A;  1N7W A;  3MW0 A;  1A8E A;  3A3C A;  1ANF A;  3B6W A;  3KEI A;  2DSF A;  4R73 A;  1PB7 A;  1NH8 A;  3OO9 A;  2XXQ A;  3RT8 A;  5CI5 A;  4NTL A;  3RT6 B;  4YMB A;  1JQF A;  3JYR A;  3EHT A;  3Q25 A;  3SDF A;  4MLQ A;  2R6G E;  2ANJ A;  2THI A;  4QF9 A;  4RY1 A;  5KDT B;  3ILT B;  3PMW A;  1NNT A;  3U92 A;  1MXV A;  3QAX A;  1NNK A;  3M3F A;  5B70 A;  3SES A;  1IUD A;  4LA9 A;  3H6V A;  5KZT A;  4NF4 A;  4MBP A;  1QUK A;  4I8C A;  2RKM A;  3CFZ A;  3SEY A;  1S9T A;  3IOV A;  4C1T A;  4G68 B;  4JDF A;  2XXW A;  4NF6 A;  4KI0 E;  3M3K A;  2E0S A;  3R7X A;  4ZE8 A;  1NNP A;  2DWI A;  1MXX A;  1IZ1 A;  2NVU B;  3OEL A;  3PUY E;  4TOZ A;  4BDN A;  1A99 A;  2XX8 A;  4ECF A;  1MRP A;  2UYF A;  4BDM A;  2OZZ A;  3CIJ A;  3M8U A;  2XD2 A;  5H8F B;  5H8S A;  3A3U A;  1I69 A;  4IO7 A;  3MUQ A;  3B6T A;  3FZV A;  1LFH A;  3DP4 A;  4XKQ A;  1ZMG A;  3HPI A;  4F3S A;  3VFJ A;  4E0X A;  2Y7P A;  4BDO A;  3K1N A;  4DIG A;  3Q26 A;  3PUV E;  4OFL A;  2B3F A;  2NOO A;  4ZEC A;  3OEK A;  4H67 A;  3IK6 B;  1ELJ A;  1OQH A;  1EU8 A;  5DTB A;  4KFQ A;  5FHN A;  3ODB A;  4LQ5 A;  1HSJ A;  1R9Q A;  4EXL A;  4ESW A;  2A5S A;  3N94 A;  3TTK A;  1EZP A;  5A5X B;  2HAU A;  2I49 A;  2I0C A;  1AIV A;  3E3K A;  2VD2 A;  4ZEK A;  1QKB A;  1QVS A;  4I62 A;  3ZKL A;  1YCJ A;  3TCH A;  4JSD A;  4ND9 A;  2ABH A;  2YLN A;  2QMW A;  5DVF A;  1ZKB A;  3G7W A;  1B7H A;  5DEX B;  3MVX A;  2XX7 A;  3PPQ A;  4BDR A;  3USD A;  4YU0 A;  2D5W A;  5AA2 A;  1SYH A;  1P1O A;  3G3H A;  1PB9 A;  1LGB C;  1B7U A;  5L8D A;  4DXU A;  2IA4 A;  4KYD A;  4H5F A;  1XS5 A;  1OQG A;  4QSE A;  1L5T A;  4R6Y A;  3R26 A;  2PX1 A;  3JV9 A;  4OQO A;  5I2K A;  5KCJ B;  1MH3 A;  4JBZ A;  4DCY A;  3PPN A;  4L17 A;  2ONK E;  5AA4 B;  4HW8 A;  4R75 A;  1O64 A;  1LBC A;  3MPK A;  3H06 B;  1YTV A;  2PT1 A;  3S9N C;  1B6H A;  1B1X A;  2XX9 A;  1TT1 A;  5HM4 B;  2Y7I A;  3RGY A;  2O68 A;  2ZNU A;  1JW5 A;  1A8F A;  1OVT A;  3JZJ A;  1S7Y A;  5CMK A;  4RNS A;  2HFB A;  5TP9 B;  2ONR A;  1NL5 A;  4NF8 B;  1H45 A;  3SER A;  3MC2 A;  3O97 A;  4BDQ A;  3DM0 A;  4EQ9 A;  4GD5 A;  1GVC A;  2Z8D A;  3PUX E;  4G8M A;  3UOR A;  2F7C A;  3KG2 A;  1FQC A;  3K00 A;  1M5E A;  1MXU A;  1M5D A;  1FTM A;  1B3E A;  3K0V A;  5L9O A;  3TQW A;  3TOD A;  3FXU A;  3FIR A;  4UA8 A;  4QSC A;  4GRK A;  1XHY A;  1A40 A;  4RA1 A;  3H4Z A;  4RYA A;  4XIG Q;  1UTB A;  2Q8J A;  3N6T A;  3CRB A;  5I56 B;  3S2V A;  1B0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...