4R75A

Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous sedoheptulose-7-phosphate bound)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
318
structure length
318
Chain Sequence
KGRLVIYCSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAKVKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYTAIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQGAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTNTTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Transport of Phosphorylated Carbohydrates Promotes Intestinal Colonization and Transmission of a Bacterial Pathogen.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transport protein
molecule keywords ABC-type Fe3+ transport system, periplasmic component
total genus 117
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r75A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r75A01
3TYHA 1B3LA 1P1QA 4G2ZA 5KZTA 2H25A 1VFDA 2UVJA 1LFIA 3IOWA 4OEVA 3K6XA 3VLWA 1IZ1A 1NNKA 1MQIA 2OK2A 4UACA 4IO5A 4XKNA 1EU8A 3TAJA 2Z23A 2Y7KA 1B05A 3EHTA 4O3BA 4GD5A 4JXIA 3T9UA 1I6AA 2O68A 3E4RA 1QUJA 1CB6A 1VE4A 1O7TA 3RTWB 1ZLQA 3LBSA 4Q5TA 3MP6A 4KCCA 4RK2A 4JB7A 4F39A 1FQEA 2P1SA 3G3HA 3OD7A 3OSQA 1SYHA 2KLFA 4FORA 5KDTB 1IXCA 1Q1KA 1GR2A 1B5JA 3IO4A 2FYIA 2QS2A 4GL0A 1O63A 5H8HB 3THIA 1URSA 2QS1A 1Y4CA 5JEIA 3TCFA 1PEBA 5DEXA 1D9YA 2DOJA 2DWIA 1QUKA 2G29A 2XD3A 1JVYA 4KYEA 3DLNA 3OSRA 4F31B 4DXBA 4OFJA 3TDJA 3HHGA 5FHOA 1LB8A 1FQFA 2B3FA 2ZYNA 3K0VA 4MBPA 4ZEIA 1A40A 3V8XB 5CMKA 4NF5B 2B65A 4R75A 2ZYMA 5FHNA 1SW4A 2UYEA 4LP2B 1QKBA 1QJMA 2ABHA 4QSCA 1B7UA 2O1MA 4YB6A 4QRZA 3VVEA 2ZNTA 1B0HA 3FV2A 2I49A 3UP9A 3U72A 2ZNUA 5ITPA 3FD3A 4HCWA 3SERA 2YPNA 1B1XA 4XXUA 3M8UA 4F29A 3MQ9A 4HW8A 2VGQA 1M5FA 1N84A 3K1NA 3P7IA 3USDA 4ELOA 5I59B 4XKRA 3U8QA 1PBQA 2HZLA 1QVSA 1N7XA 4OTEA 3U1OA 2Y7WA 1MPBA 3VFJA 4E0XA 1B3HA 2XXPA 4POXA 4QFNA 2UVIA 3FIRA 2RC9A 3RQTA 4N07A 5H8QB 3BFTA 1UTBA 2ONSA 4BDRA 1Y3NA 3LC8A 3KN7A 5EHSA 4QFKA 1MM7A 3Q25A 3C33A 2Z8FA 3S2VA 3K02A 4RYAA 2QMXA 1MH4A 3UN6A 4DCYA 2AYSA 4GF8A 5L9OA 4YMAA 2O1LA 5DT6A 1ATGA 1LB9A 3OO7A 2OWTA 3DP4A 4FJPA 4KD5A 4OETA 1A8EA 2F7CA 4GVOA 4RY1A 2XD2A 1B6HA 1NL5A 2O7UA 1DSNA 2I4BA 3L6GA 3RY3A 3TZAA 2QMWA 4P0GA 3SETA 5H8SA 4FIMA 3K00A 2O6AA 3H06B 4R73A 4C0RA 4OHNA 1ZTYA 1KWHA 2IA4A 3DP6A 3FVGA 4OEUA 4BDNA 3IOTA 3RT8A 4BLAA 2RCBA 3E13X 1SD3A 3CI8A 1B40A 3MC2A 1IXGA 4OWDA 2R6GE 2XXTA 4MLQA 3T9VA 4LZ8A 1HSJA 2XXWA 4EUOA 1FQAA 1HSEA 2OJTA 3GXAA 4KQPA 4LONB 4EQBA 4KHZE 4NF6A 4YICA 1Y20A 3G3FA 5H8HA 1R6ZA 3T9HB 4ND9A 2Q2AA 5I59A 4PETA 4G68C 3OMBA 2I6EA 3M3FA 4ZEKA 5F7VA 3D4GA 4KR5A 3FXRA 3K1MA 3OXNA 4JSDA 3FXQA 1TT1A 1UIVA 1XOCA 1YPNA 3KEIA 4XKQA 5CI5A 5HM4B 2YLNA 3MJNA 4H8JA 1LFHA 3G7WA 5TP9A 3VVFA 4U4SA 2XX8A 3RGYA 2ALUA 4WKMA 2B3BA 2DYXA 2V93A 1MM6A 4YKKA 1ELJA 2E0SA 4I9DA 1XC1A 3BFUA 3JYRA 3ILUB 4IGTA 4JWOA 4NEDA 5DVFA 2QL3A 1LAHE 1GV8A 2XX9A 3O2AA 4G8NA 3JZJA 3GZGA 3QXMA 1SW2A 1S9TA 3PPPA 4GFRA 4YU0A 4DCXA 1N3XA 3B6WA 2UVHA 3MP1A 4R72A 1OQGA 1B1HA 5TP9B 4OMBA 5CBRA 4Z0IA 1R9QA 4TLLB 4G68B 1LLSA 3PUWE 2I48A 4YAHX 2LAOA 2F6PA 1B51A 4ZE8A 1GVCA 1FTLA 3Q28A 3H4ZA 1WDNA 3RPWA 5H8FB 1DMBA 2V84A 4OVJA 2F35A 3FXUA 2AIXA 3QK6A 1PC3A 2I58A 4O3AA 4P11A 1NNPA 3PUXE 3CG3A 4GXSB 1N0TA 4ZS9A 3FJGA 4EXLA 4THIA 3GBAA 4H5GA 3IORA 4F1UA 3VLUA 2VOZA 4IO3A 3B7DA 3C32A 1NMUA 2H9BA 5I57A 4FEBA 2VP1A 1Y3QA 4FATA 5AA4A 1GTKA 1B4HA 4U21A 2QPQA 1TWYA 4X1BA 4H5FA 2A5TB 1DTGA 2F7AA 1MQDA 4F2QA 1SW5A 1SYIA 1JEUA 1JW4A 1LCFA 1YCJA 2XHDA 3CFZA 3FVNA 3T22A 1A7LA 3EQ1A 2V3UA 4R6YA 5AA2A 4GIZA 1N04A 3PUYE 3UORA 3K6VA 3ZS6A 3UIFA 5I57B 5L9SA 1OVTA 4G77A 5H8QA 1LGBC 1QW0A 1CE2A 4ZEFA 3H03A 2XXRA 3QAXA 5EYFA 3KG2A 1XVXA 3LSFB 2X7QA 3R26A 1N76A 4F18A 5ISUA 3H6WA 1FTJA 3QUFA 2THIA 3N5LA 4X1DA 1SVXB 1N3WA 4OERA 2DE3A 1I69A 3OO8A 1IXHA 3VXCA 5KCJB 3H3GA 1PBPA 4ZECA 2PT1A 2HXWA 3PV0E 3EF7A 1NNFA 1A8FA 1H44A 3RTFB 1MXVA 3FVKA 3S4UA 4TQUQ 1OLCA 1Y3PA 4POWA 3TTNA 3CSBA 1LAXA 3RUMA 3UGWA 4AB5A 2GFEA 2RC7A 4IGRA 4EF2A 3QUJA 4DLDA 1B0LA 3WAEA 1XHYA 3HN0A 4JSOA 2F5XA 4PP0A 4ZDMA 2Q9TA 2BJJX 1MQGA 2ZMBA 2RCAA 3C9HA 3CIJA 3FVOA 2QRYA 3HHFA 1B52A 1LSTA 2REJA 2YJPA 1ZJLA 3E3KA 3JV9A 4QF9A 1UTHA 1OMPA 2DP8A 2OZZA 1AH5A 1XVYA 4KPTA 2GHAA 1BKAA 1MY3A 1ZKBA 3IR1A 4H67A 2I3WA 4NF8A 3RLFE 4H8IA 2HEUA 3SEUA 5AA4B 3AXFA 4YMBA 2Q88A 1FW0A 1I6BA 4R2BA 4F3SA 2Y7PA 4AB6A 4ZEDA 4LUBA 1BLFA 4NWCA 3OEMA 4OQOA 3C4MA 3LSLA 3Q27A 3FASA 2NVUB 3C35A 4MH5A 4IO6A 1FQBA 3R7XA 3S9MC 4GWOA 5BWJA 3OEKA 4M4GA 4BDLA 3LSWA 1AIVA 3QSLA 4JWXA 3CSGA 5AA3A 2DVZA 3CR9A 1YAEA 3B6QA 3K2DA 3QIMA 3FJMA 1RYXA 3MW0A 1ZMGA 3DP8A 4YKPA 4GRKA 4NF4B 1DPEA 2I0BA 2QS4A 3D4CA 4QSDA 2HQ0A 3MZBA 1MQJA 2D5WA 1FTMA 1MDP1 2HAVA 2XXVA 3MVZA 3PD9A 1I6QA 2DE2A 4JBZA 3BBRA 4KCDA 2XXQA 1H76A 1RYOA 3GLBA 1IITA 2QSXA 1MS7A 3G3JA 3IB1A 3MVXA 5I2KB 1JW1A 4G68A 3SDFA 2H99A 3RN8A 5I84A 1S50A 1ZBMA 3M3LA 3CVGA 1PB7A 4WEDA 4RK9A 5H8NA 3KJ7A 1R9LA 1B5HA 5DEXB 3ZSFA 5FHMA 3CFXA 4OFLA 4JDFA 5I58A 2PYYA 4G8MA 5FTHA 3ECRA 3CFLA 4C1TA 4DXUA 4F1YA 3N6TA 2DSFA 2F78A 1POTA 2ONKE 2PBWA 4LZ5A 2Z8EA 4Q30B 3IOUA 5TPAB 3VE1B 3H6UA 1SI0A 2AL4A 5AE4A 3C36A 3MP8A 2GRVA 4OESA 3G3KA 3IAZA 4NTLA 1JVXA 3V5AA 5I2NB 4DXCA 1B3GA 4G4PA 2Q8JA 3VDFA 1AOVA 3T96B 4RPOA 3TFLA 1L5TA 1T0KA 3FV1A 1UTBB 2UVGA 3MWBA 3MPLA 1P1NA 1Q35A 5JK4A 3O6HA 1J1NA 1IUDA 2UXAA 5A5XB 4LQ2A 1JQFA 2G93A 3G3IA 3MPKA 2QS3A 3M3KA 3HO7A 3OOAA 3PMXA 1OIBA 3E9XA 2NOOA 3A3CA 3PPNA 3B6TA 4IO4A 4RNSA 5CMCA 5L8DA 3ZKLA 1EH3A 1Y4TA 4H6DA 1MY1A 1XT8A 3EN3A 2DWAA 3ODBA 3W9WA 2X26A 1QUIA 1FQDA 4EQ9A 2IEEA 1N7WA 5M2VA 2V3TA 3O28A 3L6HA 4WXJA 2V25A 1IQ7A 4ELPA 3CRBA 1M5BA 2ZYOA 5B70A 1MY4A 4GLIA 4UA8A 5ICTA 1A55A 4XKPA 5CBSA 4FECA 2ZXTA 2Z22A 4OENA 2OWSA 3MVWA 2CZLA 3K6UA 3KSXA 3SEWA 3FJ7A 3TTMA 4ESXA 2RF1A 3IK6B 4FE8A 4G8HA 3Q26A 1FCKA 1RKMA 4GXAA 4YKJA 3V83A 1LBBA 2I3VA 1B2HA 2DXRA 2I4CA 4YKIA 4F3GA 1SBPA 2Q89A 5I2NA 1B3EA 2PX1A 2Y84A 3WAFA 3KFMA 4Q0CA 3U92A 4IB2A 1LCTA 2H98A 3N26A 3F11A 3FGSA 1O64A 2ZNSA 1JNFA 4L17A 1H45A 5B7DA 3VLVA 3KJTA 3BKIB 2NWJA 3T93B 2FNCA 2ANJA 4ECFA 3OENA 5H8NB 5I56A 3K1PA 1A99A 2VD2A 1H43A 3A09A 3H6TA 1MH3A 2HCAA 3I5OA 4R9GA 3SESA 2ESNA 4PFWA 3FZVA 4LATA 2O84X 1B7ZA 3O97A 5TU0A 3PUZE 5JTYA 3ZKKA 1EZOA 2NXOA 1EZ9A 1S7YA 2ZYKA 3PD8A 5CMBA 4ZE9A 2O69A 1MY0A 1Y1MA 3CG1A 3O29A 4ONYA 2R71A 1B9JA 1JW5A 2HZKA 1URDA 3R6UA 4R6HA 1MXZA 3I6VA 1MG1A 1MRPA 4NF5A 4PFYA 3W9VA 5H8FA 4R6KA 2O51A 1Y9UA 4LZ7A 4QFLA 3I3VA 4R74A 5I56B 1IEJA 5J1DA 3S9LC 4KYSA 4OZ9A 3TQLA 1VR5A 1B4ZA 3OO9A 2F34A 4U2RA 4DE8A 1FTOA 2Y7IA 4U4XA 5DVIA 2DXYA 2PVUA 1TFAA 4HCYA 5I58B 1LBCA 4PE5B 2PT2A 3SEXA 1NH8A 5BUUA 1BTJA 4YB7A 4NF8B 1B7HA 5KCJA 2P2AA 3EPEA 3PPRA 1OLAA 4RA1A 1FTKA 4I8CA 4F3BA 3IX1A 1P1OA 1TXFA 1USYE 3Q29A 4QSEA 3UK4A 2V3QA 3IB0A 4I1DA 1LAFE 2RC8A 3V89B 3HSTA 4PFUA 3TQWA 4M1VA 4MF3A 1MXXA 4OYVA 4YZZA 2GHBA 1UTHB 1GGGA 1SW1A 3KN8A 4KYDA 4JWYA 4NWDA 3OO6A 3EHUA 1MXWA 2DWJA 4MLVA 5CC2A 3PU5A 3K01A 2DVCA 4TOZA 3TMGA 1R1NA 2OLBA 2F36A 1Z7NE 3IL1B 4R9FA 5K2XA 3DELB 1FQCA 1Y1ZA 3HPIA 4NMYA 1MXUA 5AA1A 5ICQA 4O3CA 2F6GA 1NNTA 2DS9A 4U1ZA 3PUVE 3RNNA 1OVBA 2F7BA 4EDPA 4AQ4A 3N6UA 4I62A 3TTKA 1UIUA 2A5TA 4C1UA 1Z7ME 4ZZAA 3GBBA 4RXLA 2XXHA 3ILTB 3O9PA 4GL8A 2XXXA 1ZU0A 2XXYA 5A5XA 1BIYA 3PPOA 4HTGA 4OXVA 1P1UA 1VSOA 2P0SA 4KFQA 5L9MA 3TTLA 4NF6B 4IO7A 1MQHA 1BP5A 2D3IA 3K6WA 4X48A 3SEYA 3SEVA 4PFTA 2VHAA 4IY6A 1HSLA 1LFGA 3W15C 2FA7A 4Z7EA 1MXYA 1VFEA 1II5A 3N94A 3PGFA 4LVQA 4X9TA 3S9NC 1M5EA 5DVJA 3SKPA 2O7IA 1ZIUA 1D9VA 1DPPA 1WVJA 4P0IA 2R9JA 3TCHA 4F2OA 1YTVA 4ISUA 3FUZA 1XS5A 2PMSA 3KOTA 4NE4A 3DM0A 5EHMA 5F1QA 3VVDA 4FAJA 3MAMA 4GQOA 5AA2D 1URGA 5IKBA 3A3UA 3EHSA 2QJEA 3PPQA 5ITOA 3C31A 3KOSA 4HS7A 2H5YA 4N13A 5CM6A 3UA8A 4EQ7A 3O6GA 4U22A 1PB8A 4K3FA 4R2FA 1B58A 4U23A 5K2YA 3TKDA 1LAGE 1QKAA 1D3KA 3PMVA 4QFOA 3T66A 3TELA 3U94A 4OFOA 4PQJA 2REGA 3FATA 1P99A 1PB9A 1UQWA 3LSXA 2HAUA 4EXKA 3KSJA 5DYHA 3MZ9A 2A5SA 4DIGA 2VD3A 4BDOA 2NUVA 2DE4A 3QYTA 2XXUA 1NKXA 2RINA 4BDQA 4ELQA 4ESWA 5HPQA 5I2KA 4DZ1A 3S9EA 3T9XB 4IO2A 1AMFA 2I0CA 1B32A 3IO6A 4QFPA 1SQYA 3H7MA 4DDDA 1EZPA 2Z8DA 3MUQA 4QHQA 1F9BA 2F97A 4F3PA 1MPDA 3O66A 4H1XA 1A54A 2GH9A 1QULA 2HFBA 2Q2CA 5CMMA 4ELRA 3KGCA 4RPNA 2M8CA 4BDMA 1US4A 3TCGA 1PDAA 5IAIA 4WEPA 1POY1 3PMWA 3MVYA 1B46A 2OCUA 5DTBA 2WKYA 3HV1A 4NF4A 1B5IA 1MPCA 4RJZA 2D21A 1AL3A 4F22A 2XXIA 2DWHA 2H4IA 1IXIA 1NFTA 4IY5A 3MZ1A 4LA9A 5ELVA 3ONMA 2XX7A 4F1VA 3TEPA 3IB2A 3IJOB 1ANFA 1IIWA 1JEVA 2F8DA 2ONRA 2RKMA 3C34A 4LQ5A 1JETA 4MFIA 4N6PA 4TLMB 4XIGQ 5HBCA 1D4NA 1DOTA 4ZEBA 1WODA 4Q8RA 3G3GA 5CRYA 2AL5A 5LOMA 3KBRA 3HCQA 2X7PA 3U93A 3K4UA 2UYFA 1NH7A 3IJXB 3KN3A 4FEDA 1OQHA 1USYH 3H6VA 5TPAA 3KZGA 3LUYA 1M5DA 2CMOA 3RT6B 4E0WA 1DTZA 3IOVA 2E1SA 4U1OA 4H0WA 1SDXA 4YB5A 3TUSA 3MBPA 2OBGA 4GOTA 2DQVA 2W7YA 4H65A 1MDQA 3VV5A 5AA2B 4KI0E 3OELA 3TTRA 1SI1A 5KDTA 2Y7RA 1US5A 3O6IA 1H3DA 1MY2A 1P1WA 3TODA 5FTIA 3TPAA 3VXBA 5JTYB 4EF1A 4F19A 4XTCQ 4ZZEA 1M5CA 3LR1A 1TFDA 1B3FA
chains in the Genus database with same CATH superfamily
1B3LA 5KZTA 4XKNA 1EU8A 4JXIA 1I6AA 2O68A 1QUJA 1CB6A 1VE4A 5JK4A 3LBSA 4JB7A 4F39A 5KDTB 1Q1KA 2FYIA 4GL0A 1FPIA 1O63A 3TCFA 2DOJA 2DWIA 1QUKA 1JVYA 3DLNA 3TDJA 1FTAA 5FHOA 4XFEA 4NF5B 4N91A 2UYEA 2ABHA 3FV2A 3U72A 3FD3A 5ET6A 1N84A 3USDA 3U8QA 3MYUA 4E0XA 1B3HA 2DDKA 5H8QB 2Z8FA 3K02A 2QMXA 4DCYA 5L9OA 3OO7A 3DP4A 1A8EA 4FIMA 4OHNA 1KWHA 3DP6A 4BDNA 3FVGA 4BLAA 1SD3A 1DBZA 3MC2A 2R6GE 4N15A 1HSEA 1FPLA 4EQBA 4KHZE 5H8HA 3T9HB 2XXKA 4PETA 3M3FA 4ZEKA 3RPLA 4KR5A 3OXNA 3FXQA 1XOCA 1YPNA 5IM2A 5CI5A 2YLNA 1QGXA 2XX8A 1MM6A 4I9DA 3ILUB 2R8TA 4PBQA 4IO5A 2XX9A 3O2AA 1SW2A 1FRPA 3PTYA 5EQ7A 5TP9B 5CBRA 4YAHX 2LAOA 1B51A 5T3JA 3H4ZA 1WDNA 5H8FB 3FXUA 5AA2D 4P11A 3NOHA 3CG3A 1N0TA 4EXLA 3GBAA 4H5GA 4IO3A 2VP1A 4PDDA 1Y3QA 4FATA 2QPQA 1DTGA 2F7AA 1MQDA 5A5XB 1LCFA 2XHDA 3CFZA 4OA4A 4R6YA 3QMFA 4G77A 5H8QA 4PF6A 3QAXA 3QUFA 2THIA 3N5LA 1SVXB 1N3WA 3IFAA 3PV0E 1NNFA 1H44A 3RTFB 1OLCA 1Y3PA 3UGWA 4IGRA 4H46A 4JSOA 2F5XA 2ZMBA 3CIJA 2QRYA 3JV9A 2OZZA 3RT8A 2ZZXA 4NF8A 4GWXA 5AA4B 2I3WA 3RLFE 2MKZA 3AXFA 2Q88A 4F3SA 2Y7PA 3ISPA 2WYPA 3C35A 4JVIA 5BWJA 4BDLA 1NV2A 1AIVA 4RYAA 3QIMA 3FJMA 2QS4A 4GWSA 2HQ0A 2HAVA 4JBZA 2DE2A 1IITA 1MS7A 3MVXA 3SDFA 1ZBMA 3CVGA 1PB7A 4RK9A 3KJ7A 1B5HA 3CFXA 4OFLA 5I58A 2F3BA 4C1TA 4F1YA 2DSFA 2F78A 1POTA 2PBWA 3VE1B 4Q30B 3IOUA 3H6UA 1SI0A 2AL4A 3V5AA 4DXCA 3VDFA 1UTBB 2UVGA 3MWBA 5FBPA 1Q35A 3O6HA 2UXAA 3MPKA 3PPNA 3A3CA 4NAPA 3B6TA 3ZKLA 1Y4TA 5J16A 4H6DA 3ODBA 3W9WA 2X26A 1QUIA 1FQDA 2V3TA 3O28A 4WXJA 4UABA 5B70A 4XKPA 4OENA 3SEWA 3K6UA 3FJ7A 2RF1A 4MIJA 4G8HA 4GXAA 4YKJA 2Q89A 1D9QA 3WAFA 3KFMA 3U92A 4IB2A 2VPNA 1LCTA 3FGSA 2ZNSA 1JNFA 1NV7A 3T1BA 4FBPA 3I5OA 4N4UA 4H45A 4NX1A 3FZVA 3B8BA 5JTYA 1MY0A 1B9JA 3R6UA 3A29A 5IZ1A 2ZZWA 1LBVA 5H8FA 4R74A 3OO9A 5DVIA 1BK4A 2DXYA 1TFAA 2VPOA 5I58B 4PE5B 2Y5KA 1B7HA 5KCJA 1OLAA 1P1OA 4QSEA 2V3QA 3IB0A 3V89B 2RC8A 4PBHA 3HSTA 1LEVA 2GHBA 1GGGA 4JWYA 5CC2A 3OO6A 3K01A 2DVCA 2F36A 1MXUA 3RNNA 1OVBA 4EDPA 2XXHA 3O9PA 5I5PA 4OXVA 2P0SA 4NF6B 4IO7A 4P8BA 2D3IA 2VHAA 1LFGA 3KC0A 1MXYA 1D9VA 3KC1A 1XS5A 3KOTA 4NE4A 3MAMA 3EHSA 3UA8A 5ET5A 4U23A 3TKDA 3T66A 3PMVA 3TELA 3KBZA 4PQJA 1P99A 2FBPA 2HAUA 4ESWA 4ELQA 1NKXA 3S9EA 2I0CA 1B32A 2XWIA 2Z8DA 3MUQA 2F97A 1A54A 2HFBA 4F3PA 5CMMA 4BDMA 3TCGA 5IAIA 4WEPA 2WKYA 4NF4A 1B5IA 1NFTA 4F1VA 3IB2A 1ANFA 1JEVA 2RKMA 4LQ5A 4TLMB 1NV0A 1JETA 4MFIA 5HBCA 1WODA 2AL5A 3HCQA 3GYYA 3U93A 3H6VA 1M5DA 2E1SA 4U1OA 1SDXA 4H65A 4P9KA 5AA2B 3OELA 2Y7RA 3VXBA 4ZZEA 4OEVA 2UVHA 1B3FA 1P1QA 1VFDA 5A5LA 4N17A 1NNKA 3TAJA 2HPGA 2Z23A 1B05A 3T9UA 3RTWB 1O7TA 4Q5TA 1SYHA 1GR2A 2HXRA 1B5JA 4MX6A 2QS1A 1Y4CA 5DEXA 2XD3A 2B3FA 1FQFA 3K0VA 4MBPA 3V8XB 1A40A 4LP2B 1EYKA 2O1MA 1B0HA 3MSTA 3LV0A 4HCWA 1B1XA 2P3NA 2VGQA 1M5FA 1FPEA 4XKRA 1QVSA 2XXPA 3LC8A 5EHSA 3KN7A 4AS4A 3Q25A 3UN6A 2AYSA 1ATGA 1LB9A 4FJPA 2F7CA 4GVOA 1B6HA 1NL5A 2XWVA 2QMWA 3SETA 3K00A 4C0RA 2Q74A 2WX9A 4OEUA 4QXDA 1FBFA 3IOTA 3CI8A 4OWDA 4MLQA 2XXWA 4EUOA 5I7IA 5I3SA 3GXAA 1NUXA 4NF6A 4YICA 1Y20A 4G68C 3OMBA 3D4GA 3FXRA 3K1MA 1UIVA 4H8JA 5TP9A 3VVFA 3RGYA 4P1LA 2B3BA 2E0SA 1LAHE 4G8NA 4GFRA 3GZGA 4DCXA 1S9TA 3PPPA 3B6WA 4OMBA 4JVDA 1R9QA 4HXVA 4TLLB 3PUWE 2F6PA 4OVJA 2F35A 3QK6A 1IMCA 5DEXB 4GXSB 3IORA 1G0HA 3VLUA 3B7DA 4KXPA 1B4HA 4F2QA 1SW5A 4DXBA 5AA2A 4GIZA 3UORA 3UIFA 5EYFA 3R26A 4F18A 2PFYA 4OERA 1I69A 3FXBA 4PGNA 2PT1A 3EF7A 3FVKA 1FPBA 3CSBA 4AB5A 3WAEA 1FPFA 1MQGA 3FVOA 2RCAA 3HHFA 2YJPA 3E3KA 3HFUA 4X1BA 1UTHA 2FVZA 4KPTA 4N8GA 1MY3A 4H67A 3SEUA 4H8IA 2HEUA 4YMBA 2FIEA 4M4GA 3E78A 3QSLA 4JWXA 3CSGA 2DVZA 3B6QA 3K2DA 3DP8A 4QSDA 1DPEA 2I0BA 3D4CA 3PD9A 4OVRA 3MZBA 1MQJA 2XXVA 3MVZA 4YZZA 1H76A 1RYOA 3GLBA 1RDYA 3IB1A 4G68A 2H99A 5I84A 1S50A 3M3LA 1R9LA 5IZ3A 5EQAA 3ZSFA 5FHMA 3LUZA 4MNIA 4DXUA 4LZ5A 5AE4A 1EYIA 1JVXA 2WEFA 4GBVA 4G4PA 1L5TA 3FV1A 3MPLA 1P1NA 4N6DA 3PMXA 3ROJA 2CZIA 1XT8A 2IEEA 1CNQA 1IQ7A 1M5BA 2ZYOA 4GLIA 1A55A 5CBSA 4FECA 2Z22A 2OWSA 3MVWA 3TTMA 4FE8A 3V83A 2I3VA 1LBYA 4F3GA 5I2NA 1B3EA 2PX1A 2Y84A 4Q0CA 3D1RA 3N26A 1INPA 4L17A 1Q9DA 3KJTA 3BKIB 3T93B 2FNCA 4NGUA 4PFWA 1B7ZA 1EZOA 1EZ9A 2ZYKA 5CMBA 2R71A 3I6VA 4NF5A 2KR0A 4LZ7A 3I3VA 4KYSA 4YB7A 4NF8B 3EPEA 1FTKA 1K9ZA 1TXFA 1USYE 3Q29A 1LAFE 4GX6A 1LBWA 4PFUA 4M1VA 4MF3A 1FJ6A 3EHUA 4MLVA 2DWJA 4TOZA 1R1NA 1IMEA 4NMYA 3HPIA 5AA1A 1DCUA 4O3CA 2DS9A 4U1ZA 3PUVE 3BIGA 1UIUA 4PF8A 4GX4A 5A5XA 4NF0A 4KFQA 5L9MA 3TTLA 1NUZA 3K6WA 4X48A 4PFTA 4IY6A 1HSLA 3RPLB 2OX3A 1KA0A 4F2OA 2R9JA 4GQOA 1URGA 2XWKA 2PCRA 2H5YA 1KA1A 5LTCA 3O6GA 5K2YA 1LAGE 1D3KA 3FATA 4AS5A 3KSJA 5DYHA 3MZ9A 4DIGA 2VD3A 2BJIA 4BDOA 5ET8A 4BDQA 4DZ1A 4QFPA 2QVUA 4DDDA 4QHQA 1F9BA 4H1XA 3O66A 1QULA 3KGCA 4RPNA 3MVYA 5DTBA 3HV1A 5LDZA 1AL3A 2XXIA 2H4IA 4LA9A 3IJOB 1IIWA 3T0JA 1D4NA 5CRYA 4XEQA 3KBRA 2X7PA 4FEDA 1OQHA 1NV1A 3LUYA 3RT6B 1DTZA 3IOVA 4YB5A 3MBPA 2OBGA 3VV5A 4P3LA 5KDTA 3TPAA 5I2KA 3TODA 5FTIA 5JTYB 1M5CA 1TFDA 4G2ZA 2UVJA 1IZ1A 1RDZA 1MQIA 2OK2A 4UACA 4O3BA 4GD5A 1ZLQA 4KCCA 3G3HA 2P1SA 3OSQA 2KLFA 4FORA 2F3DA 3IO4A 2QS2A 3THIA 1URSA 1D9YA 4KYEA 3OSRA 4OFJA 2ZYNA 5CMKA 4NN3A 4MEVA 5FHNA 1QKBA 1QJMA 1B7UA 1FBCA 4P47A 4QRZA 3VVEA 2I49A 3UP9A 5ITPA 2YPNA 2HHMA 4XXUA 4ELOA 3K1NA 1PBQA 2HZLA 4OTEA 1N7XA 4QFNA 4POXA 2UVIA 3FIRA 3RQTA 3BFTA 1UTBA 1XI6A 1Y3NA 1MM7A 3C33A 3S2VA 5DT6A 4RY1A 4NHBA 3L6GA 1DSNA 3TZAA 4P0GA 1FBGA 1YYZA 3H06B 1ZTYA 2IA4A 2RCBA 3E13X 1B40A 3T9VA 3BIHA 4LZ8A 1G0IA 2OJTA 4KQPA 1FBEA 1R6ZA 4ND9A 1NUWA 4XKQA 5HM4B 4O94A 3MJNA 1LFHA 3G7WA 4PCDA 4U4SA 2DYXA 2V93A 4OVSA 1ELJA 1XC1A 3BFUA 3JYRA 4NEDA 4IGTA 2QL3A 1GV8A 3QXMA 1N3XA 4R72A 1OQGA 4G61A 4N81A 3RPWA 2V84A 4OVQA 2AIXA 4O3AA 3PUXE 4THIA 1LBZA 2VOZA 1NMUA 4P56A 5AA4A 5IGAA 1LBXA 1TWYA 4H5FA 2A5TB 1SYIA 1JEUA 3PUYE 3ZS6A 5I57B 1OVTA 1LGBC 1QW0A 4ZEFA 3LSFB 1N76A 1FBDA 1NUYA 2DE3A 3OO8A 1NV6A 3FBPA 4ZECA 2HXWA 2GQ1A 3S4UA 1MXVA 4TQUQ 3SZPA 4PGPA 2RC7A 4EF2A 4DLDA 1B0LA 3HN0A 4PP0A 4ZDMA 2BJJX 1LSTA 4YKIA 2DP8A 2GHAA 1ZKBA 1IMFA 3IR1A 4HE2A 1FW0A 4AB6A 4LUBA 4OQOA 4NWCA 3OEMA 3C4MA 3Q27A 3FASA 2NVUB 4NQ8A 1EYJA 4MH5A 4IO6A 1FQBA 4GWOA 5EQ9A 5AA3A 3CR9A 3MW0A 1ZMGA 4PAIA 4YKPA 4GRKA 1IMBA 2D5WA 1FTMA 1MDP1 4RPOA 1I6QA 2XXQA 3G3JA 1JW1A 5H8NA 4JDFA 4G8MA 4MNPA 3ECRA 5FTHA 1NI9A 2ONKE 2Z8EA 4OESA 3G3KA 3IAZA 1B3GA 2Q8JA 4OVTA 3TFLA 1T0KA 4LQ2A 2QS3A 3M3KA 4RNSA 1OIBA 5CMCA 2NOOA 4P1EA 3EN3A 2DWAA 3L6HA 2V25A 3CRBA 5ICTA 2ZXTA 2CZLA 3KSXA 1FCKA 1LBBA 3CHGA 1B2HA 1NV3A 5B7DA 2NWJA 3OENA 1H43A 3A09A 3H6TA 1MH3A 2XA5A 2ESNA 4LATA 5TU0A 1S7YA 3PD8A 4O8MA 5ICQA 4ZE9A 2O69A 1Y1MA 4GWZA 4R6HA 2HZKA 1MG1A 1MRPA 3W9VA 4R6KA 2O51A 5J1DA 3S9LC 1VR5A 1B4ZA 4U2RA 2F34A 2Y7IA 1FPKA 1FBHA 4HCYA 3PPRA 4RA1A 4I3YA 4O7MA 4F3BA 3IX1A 4OYVA 1UTHB 3KN8A 4KYDA 4NWDA 1MXWA 3PU5A 4OVPA 3TMGA 4R9FA 1Z7NE 3IL1B 5K2XA 2F6GA 1NNTA 4HE0A 4GX3A 3TTKA 4C1UA 4RXLA 3ILTB 2XXXA 4X04A 3E79A 5ESYA 4HTGA 1P1UA 1VSOA 5ET7A 1BP5A 3SEYA 3U65A 3N94A 3PGFA 1FPDA 1FSAA 4LVQA 5DVJA 2O7IA 1NV4A 1YTVA 2PMSA 5F24A 5F1QA 3DM0A 5EHMA 5IKBA 3A3UA 3PPQA 2QJEA 3C31A 3KOSA 4PC9A 4N13A 5CM6A 4EQ7A 4U22A 1PB8A 4K3FA 4R2FA 1B58A 1QKAA 4QFOA 1PB9A 1UQWA 3LSXA 4EXKA 2A5SA 3QYTA 2WBBA 3T9XB 1SQYA 3H7MA 1EZPA 1MPDA 1US4A 1POY1 2CEXA 5IZZA 1MPCA 2L5VA 4RJZA 2CZHA 1JP4A 4I40A 2DWHA 4IY5A 5ELVA 2XX7A 3C34A 4XIGQ 2ONRA 4GWWA 1DOTA 4Q8RA 3G3GA 2UYFA 3IJXB 3KN3A 1USYH 5TPAA 3KZGA 4DI3D 4H0WA 3TUSA 1YZ0A 1MDQA 1SI1A 1MY2A 1P1WA 4F1UA 4EF1A 4F19A 4XTCQ 4GBWA 3TYHA 2H25A 2OWZA 1LFIA 4I3EA 3IOWA 1KZ8A 3K6XA 3VLWA 2Y7KA 3EHTA 3E4RA 4RK2A 3MP6A 1FQEA 3OD7A 1IXCA 4PE3A 5H8HB 5JEIA 1PEBA 2G29A 4F31B 3HHGA 1LB8A 4ZEIA 4PFIA 2B65A 4R75A 2ZYMA 1SW4A 4QSCA 4YB6A 2ZNTA 2ZNUA 4LN5A 3SERA 3M8UA 4HW8A 3MQ9A 5I59B 3P7IA 2QFLA 3U1OA 2P3VA 2Y7WA 1MPBA 3VFJA 2RC9A 5DW8A 4N07A 4BDRA 2ONSA 2V4CA 4QFKA 4PAFA 1MH4A 4GF8A 4YMAA 2O1LA 2OWTA 4KD5A 4OETA 2XD2A 2O7UA 2I4BA 3RY3A 5H8SA 2O6AA 4R73A 1FBPA 1IXGA 2XXTA 1HSJA 1FQAA 4LONB 3G3FA 2Q2AA 5I59A 5EYHA 4GWYA 2I6EA 5F7VA 4JSDA 1TT1A 3KEIA 4MJOA 2ALUA 4WKMA 4YKKA 5EQ8A 4JWOA 5DVFA 5KCJB 3JZJA 3MP1A 1B1HA 4Z0IA 4G68B 4GWUA 1LLSA 2I48A 4ZE8A 1GVCA 1FTLA 3Q28A 1DMBA 1NV5A 1PC3A 2I58A 1NNPA 1YXIA 4ZS9A 3FJGA 2VT5A 3C32A 2H9BA 5I57A 4FEBA 1GTKA 4U21A 4NG7A 4MMPA 3FVNA 1JW4A 1YCJA 3T22A 1A7LA 3EQ1A 2V3UA 1N04A 4QBAA 3K6VA 4PFRA 5L9SA 4PAKA 1CE2A 3H03A 2XXRA 3KG2A 1XVXA 5ISUA 2X7QA 3H6WA 1FTJA 4X1DA 3VXCA 1IXHA 3H3GA 1PBPA 3EKIA 1A8FA 4POWA 3TTNA 1LAXA 3RUMA 1AWBA 2GFEA 5IZ3B 3QUJA 5EYGA 1XHYA 2B4MA 2Q9TA 3C9HA 1B52A 2REJA 4QF9A 1ZJLA 4F29A 4YU0A 1OMPA 1AH5A 1XVYA 1BKAA 4JVCA 4AQ4A 4PFBA 1I6BA 4R2BA 4ZEDA 4MCOA 1BLFA 3LSLA 2CEYA 3R7XA 3S9MC 3RYDA 1IMDA 3OEKA 3LSWA 4XF5A 1YAEA 1RYXA 4NF4B 3ZKKA 4KCDA 3BBRA 2QSXA 5I2KB 3RN8A 4WEDA 2QVVA 1IMAA 2PYYA 3CFLA 2CZKA 3N6TA 5TPAB 4MAGA 3C36A 3MP8A 2GRVA 4NTLA 2JJKA 5I2NB 1AOVA 3T96B 1J1NA 1IUDA 1JQFA 2G93A 3G3IA 4HE1A 3HO7A 3OOAA 3E9XA 4IO4A 5L8DA 1EH3A 1MY1A 4EQ9A 1N7WA 5M2VA 4ELPA 1MY4A 4UA8A 2ZZVA 2WYKA 4ESXA 3IK6B 3Q26A 1RKMA 2DXRA 2I4CA 1SBPA 2H98A 1VDWA 3F11A 1O64A 1H45A 3VLVA 4ECFA 2ANJA 5I56A 5H8NB 2XWOA 3K1PA 1A99A 2VD2A 2HCAA 4R9GA 3SESA 2O84X 2PFZA 3O97A 3PUZE 2NXOA 3CG1A 3O29A 4ONYA 1JW5A 1URDA 4DI4B 1MXZA 4PFYA 1Y9UA 4QFLA 5I56B 1IEJA 4OZ9A 3TQLA 4DE8A 1FTOA 4U4XA 4N6KA 2PVUA 1LBCA 2PT2A 3SEXA 1NH8A 5BUUA 1BTJA 3B50A 2P2AA 4I8CA 3UK4A 4I1DA 3TQWA 1MXXA 1DK4A 1SW1A 2FHYA 2KQZA 3IFCA 2OLBA 4PTKA 3DELB 1FQCA 1Y1ZA 2F7BA 3N6UA 4I62A 2A5TA 2Y5LA 1Z7ME 4ZZAA 3GBBA 4GL8A 1K9YA 1ZU0A 2XXYA 1BIYA 3PPOA 1MQHA 4O7IA 3SEVA 2Q8MA 2FIXA 2FA7A 2B4LA 1VFEA 3W15C 1II5A 4X9TA 4Z7EA 3S9NC 1M5EA 3SKPA 1ZIUA 1DPPA 3TCHA 1WVJA 4P0IA 4ISUA 3FUZA 4OANA 4FAJA 4PDHA 1FPJA 3VVDA 5ITOA 4HS7A 1FJ9A 4MNCA 3U94A 2REGA 4IR8A 2NUVA 2DE4A 2XXUA 2RINA 5HPQA 4IO2A 1AMFA 3IO6A 4X8RA 1SPIA 2QVRA 2GH9A 2Q2CA 4ELRA 2M8CA 1PDAA 2WBDA 3PMWA 1B46A 2OCUA 2D21A 4F22A 1IXIA 3MZ1A 3TEPA 3ONMA 2F8DA 4N6PA 1FPGA 4ZEBA 1RDXA 5LOMA 3K4UA 1NH7A 4MHFA 2CMOA 4E0WA 4GOTA 2DQVA 2W7YA 4KI0E 3TTRA 1US5A 3O6IA 1H3DA 4N8YA 3LR1A 4OFOA
chains in the Genus database with same CATH topology
3TYHA 1B3LA 1P1QA 4G2ZA 5KZTA 2H25A 1VFDA 2UVJA 1LFIA 3IOWA 4OEVA 3K6XA 3VLWA 1IZ1A 1NNKA 1MQIA 2OK2A 4UACA 4IO5A 4XKNA 1EU8A 3TAJA 2Z23A 2Y7KA 1B05A 3EHTA 4O3BA 4GD5A 4JXIA 3T9UA 1I6AA 2O68A 3E4RA 1QUJA 1CB6A 1VE4A 1O7TA 3RTWB 1ZLQA 3LBSA 4Q5TA 3MP6A 4KCCA 4RK2A 4JB7A 4F39A 1FQEA 2P1SA 3G3HA 3OD7A 3OSQA 1SYHA 2KLFA 4FORA 5KDTB 1IXCA 1Q1KA 1GR2A 1B5JA 3IO4A 2FYIA 2QS2A 4GL0A 1O63A 5H8HB 3THIA 1URSA 2QS1A 1Y4CA 5JEIA 3TCFA 1PEBA 5DEXA 1D9YA 2DOJA 2DWIA 1QUKA 2G29A 2XD3A 1JVYA 4KYEA 3DLNA 3OSRA 4F31B 4DXBA 4OFJA 3TDJA 3HHGA 5FHOA 1LB8A 1FQFA 2B3FA 2ZYNA 3K0VA 4MBPA 4ZEIA 1A40A 3V8XB 5CMKA 4NF5B 2B65A 4R75A 2ZYMA 5FHNA 1SW4A 2UYEA 4LP2B 1QKBA 1QJMA 2ABHA 4QSCA 1B7UA 2O1MA 4YB6A 4QRZA 3VVEA 2ZNTA 1B0HA 3FV2A 2I49A 3UP9A 3U72A 2ZNUA 5ITPA 3FD3A 4HCWA 3SERA 2YPNA 1B1XA 4XXUA 3M8UA 4F29A 3MQ9A 4HW8A 2VGQA 1M5FA 1N84A 3K1NA 3P7IA 3USDA 4ELOA 5I59B 4XKRA 3U8QA 1PBQA 2HZLA 1QVSA 1N7XA 4OTEA 3U1OA 2Y7WA 1MPBA 3VFJA 4E0XA 1B3HA 2XXPA 4POXA 4QFNA 2UVIA 3FIRA 2RC9A 3RQTA 4N07A 5H8QB 3BFTA 1UTBA 2ONSA 4BDRA 1Y3NA 3LC8A 3KN7A 5EHSA 4QFKA 1MM7A 3Q25A 3C33A 2Z8FA 3S2VA 3K02A 4RYAA 2QMXA 1MH4A 3UN6A 4DCYA 2AYSA 4GF8A 5L9OA 4YMAA 2O1LA 5DT6A 1ATGA 1LB9A 3OO7A 2OWTA 3DP4A 4FJPA 4KD5A 4OETA 1A8EA 2F7CA 4GVOA 4RY1A 2XD2A 1B6HA 1NL5A 2O7UA 1DSNA 2I4BA 3L6GA 3RY3A 3TZAA 2QMWA 4P0GA 3SETA 5H8SA 4FIMA 3K00A 2O6AA 3H06B 4R73A 4C0RA 4OHNA 1ZTYA 1KWHA 2IA4A 3DP6A 3FVGA 4OEUA 4BDNA 3IOTA 3RT8A 4BLAA 2RCBA 3E13X 1SD3A 3CI8A 1B40A 3MC2A 1IXGA 4OWDA 2R6GE 2XXTA 4MLQA 3T9VA 4LZ8A 1HSJA 2XXWA 4EUOA 1FQAA 1HSEA 2OJTA 3GXAA 4KQPA 4LONB 4EQBA 4KHZE 4NF6A 4YICA 1Y20A 3G3FA 5H8HA 1R6ZA 3T9HB 4ND9A 2Q2AA 5I59A 4PETA 4G68C 3OMBA 2I6EA 3M3FA 4ZEKA 5F7VA 3D4GA 4KR5A 3FXRA 3K1MA 3OXNA 4JSDA 3FXQA 1TT1A 1UIVA 1XOCA 1YPNA 3KEIA 4XKQA 5CI5A 5HM4B 2YLNA 3MJNA 4H8JA 1LFHA 3G7WA 5TP9A 3VVFA 4U4SA 2XX8A 3RGYA 2ALUA 4WKMA 2B3BA 2DYXA 2V93A 1MM6A 4YKKA 1ELJA 2E0SA 4I9DA 1XC1A 3BFUA 3JYRA 3ILUB 4IGTA 4JWOA 4NEDA 5DVFA 2QL3A 1LAHE 1GV8A 2XX9A 3O2AA 4G8NA 3JZJA 3GZGA 3QXMA 1SW2A 1S9TA 3PPPA 4GFRA 4YU0A 4DCXA 1N3XA 3B6WA 2UVHA 3MP1A 4R72A 1OQGA 1B1HA 5TP9B 4OMBA 5CBRA 4Z0IA 1R9QA 4TLLB 4G68B 1LLSA 3PUWE 2I48A 4YAHX 2LAOA 2F6PA 1B51A 4ZE8A 1GVCA 1FTLA 3Q28A 3H4ZA 1WDNA 3RPWA 5H8FB 1DMBA 2V84A 4OVJA 2F35A 3FXUA 2AIXA 3QK6A 1PC3A 2I58A 4O3AA 4P11A 1NNPA 3PUXE 3CG3A 4GXSB 1N0TA 4ZS9A 3FJGA 4EXLA 4THIA 3GBAA 4H5GA 3IORA 4F1UA 3VLUA 2VOZA 4IO3A 3B7DA 3C32A 1NMUA 2H9BA 5I57A 4FEBA 2VP1A 1Y3QA 4FATA 5AA4A 1GTKA 1B4HA 4U21A 2QPQA 1TWYA 4X1BA 4H5FA 2A5TB 1DTGA 2F7AA 1MQDA 4F2QA 1SW5A 1SYIA 1JEUA 1JW4A 1LCFA 1YCJA 2XHDA 3CFZA 3FVNA 3T22A 1A7LA 3EQ1A 2V3UA 4R6YA 5AA2A 4GIZA 1N04A 3PUYE 3UORA 3K6VA 3ZS6A 3UIFA 5I57B 5L9SA 1OVTA 4G77A 5H8QA 1LGBC 1QW0A 1CE2A 4ZEFA 3H03A 2XXRA 3QAXA 5EYFA 3KG2A 1XVXA 3LSFB 2X7QA 3R26A 1N76A 4F18A 5ISUA 3H6WA 1FTJA 3QUFA 2THIA 3N5LA 4X1DA 1SVXB 1N3WA 4OERA 2DE3A 1I69A 3OO8A 1IXHA 3VXCA 5KCJB 3H3GA 1PBPA 4ZECA 2PT1A 2HXWA 3PV0E 3EF7A 1NNFA 1A8FA 1H44A 3RTFB 1MXVA 3FVKA 3S4UA 4TQUQ 1OLCA 1Y3PA 4POWA 3TTNA 3CSBA 1LAXA 3RUMA 3UGWA 4AB5A 2GFEA 2RC7A 4IGRA 4EF2A 3QUJA 4DLDA 1B0LA 3WAEA 1XHYA 3HN0A 4JSOA 2F5XA 4PP0A 4ZDMA 2Q9TA 2BJJX 1MQGA 2ZMBA 2RCAA 3C9HA 3CIJA 3FVOA 2QRYA 3HHFA 1B52A 1LSTA 2REJA 2YJPA 1ZJLA 3E3KA 3JV9A 4QF9A 1UTHA 1OMPA 2DP8A 2OZZA 1AH5A 1XVYA 4KPTA 2GHAA 1BKAA 1MY3A 1ZKBA 3IR1A 4H67A 2I3WA 4NF8A 3RLFE 4H8IA 2HEUA 3SEUA 5AA4B 3AXFA 4YMBA 2Q88A 1FW0A 1I6BA 4R2BA 4F3SA 2Y7PA 4AB6A 4ZEDA 4LUBA 1BLFA 4NWCA 3OEMA 4OQOA 3C4MA 3LSLA 3Q27A 3FASA 2NVUB 3C35A 4MH5A 4IO6A 1FQBA 3R7XA 3S9MC 4GWOA 5BWJA 3OEKA 4M4GA 4BDLA 3LSWA 1AIVA 3QSLA 4JWXA 3CSGA 5AA3A 2DVZA 3CR9A 1YAEA 3B6QA 3K2DA 3QIMA 3FJMA 1RYXA 3MW0A 1ZMGA 3DP8A 4YKPA 4GRKA 4NF4B 1DPEA 2I0BA 2QS4A 3D4CA 4QSDA 2HQ0A 3MZBA 1MQJA 2D5WA 1FTMA 1MDP1 2HAVA 2XXVA 3MVZA 3PD9A 1I6QA 2DE2A 4JBZA 3BBRA 4KCDA 2XXQA 1H76A 1RYOA 3GLBA 1IITA 2QSXA 1MS7A 3G3JA 3IB1A 3MVXA 5I2KB 1JW1A 4G68A 3SDFA 2H99A 3RN8A 5I84A 1S50A 1ZBMA 3M3LA 3CVGA 1PB7A 4WEDA 4RK9A 5H8NA 3KJ7A 1R9LA 1B5HA 5DEXB 3ZSFA 5FHMA 3CFXA 4OFLA 4JDFA 5I58A 2PYYA 4G8MA 5FTHA 3ECRA 3CFLA 4C1TA 4DXUA 4F1YA 3N6TA 2DSFA 2F78A 1POTA 2ONKE 2PBWA 4LZ5A 2Z8EA 4Q30B 3IOUA 5TPAB 3VE1B 3H6UA 1SI0A 2AL4A 5AE4A 3C36A 3MP8A 2GRVA 4OESA 3G3KA 3IAZA 4NTLA 1JVXA 3V5AA 5I2NB 4DXCA 1B3GA 4G4PA 2Q8JA 3VDFA 1AOVA 3T96B 4RPOA 3TFLA 1L5TA 1T0KA 3FV1A 1UTBB 2UVGA 3MWBA 3MPLA 1P1NA 1Q35A 5JK4A 3O6HA 1J1NA 1IUDA 2UXAA 5A5XB 4LQ2A 1JQFA 2G93A 3G3IA 3MPKA 2QS3A 3M3KA 3HO7A 3OOAA 3PMXA 1OIBA 3E9XA 2NOOA 3A3CA 3PPNA 3B6TA 4IO4A 4RNSA 5CMCA 5L8DA 3ZKLA 1EH3A 1Y4TA 4H6DA 1MY1A 1XT8A 3EN3A 2DWAA 3ODBA 3W9WA 2X26A 1QUIA 1FQDA 4EQ9A 2IEEA 1N7WA 5M2VA 2V3TA 3O28A 3L6HA 4WXJA 2V25A 1IQ7A 4ELPA 3CRBA 1M5BA 2ZYOA 5B70A 1MY4A 4GLIA 4UA8A 5ICTA 1A55A 4XKPA 5CBSA 4FECA 2ZXTA 2Z22A 4OENA 2OWSA 3MVWA 2CZLA 3K6UA 3KSXA 3SEWA 3FJ7A 3TTMA 4ESXA 2RF1A 3IK6B 4FE8A 4G8HA 3Q26A 1FCKA 1RKMA 4GXAA 4YKJA 3V83A 1LBBA 2I3VA 1B2HA 2DXRA 2I4CA 4YKIA 4F3GA 1SBPA 2Q89A 5I2NA 1B3EA 2PX1A 2Y84A 3WAFA 3KFMA 4Q0CA 3U92A 4IB2A 1LCTA 2H98A 3N26A 3F11A 3FGSA 1O64A 2ZNSA 1JNFA 4L17A 1H45A 5B7DA 3VLVA 3KJTA 3BKIB 2NWJA 3T93B 2FNCA 2ANJA 4ECFA 3OENA 5H8NB 5I56A 3K1PA 1A99A 2VD2A 1H43A 3A09A 3H6TA 1MH3A 2HCAA 3I5OA 4R9GA 3SESA 2ESNA 4PFWA 3FZVA 4LATA 2O84X 1B7ZA 3O97A 5TU0A 3PUZE 5JTYA 3ZKKA 1EZOA 2NXOA 1EZ9A 1S7YA 2ZYKA 3PD8A 5CMBA 4ZE9A 2O69A 1MY0A 1Y1MA 3CG1A 3O29A 4ONYA 2R71A 1B9JA 1JW5A 2HZKA 1URDA 3R6UA 4R6HA 1MXZA 3I6VA 1MG1A 1MRPA 4NF5A 4PFYA 3W9VA 5H8FA 4R6KA 2O51A 1Y9UA 4LZ7A 4QFLA 3I3VA 4R74A 5I56B 1IEJA 5J1DA 3S9LC 4KYSA 4OZ9A 3TQLA 1VR5A 1B4ZA 3OO9A 2F34A 4U2RA 4DE8A 1FTOA 2Y7IA 4U4XA 5DVIA 2DXYA 2PVUA 1TFAA 4HCYA 5I58B 1LBCA 4PE5B 2PT2A 3SEXA 1NH8A 5BUUA 1BTJA 4YB7A 4NF8B 1B7HA 5KCJA 2P2AA 3EPEA 3PPRA 1OLAA 4RA1A 1FTKA 4I8CA 4F3BA 3IX1A 1P1OA 1TXFA 1USYE 3Q29A 4QSEA 3UK4A 2V3QA 3IB0A 4I1DA 1LAFE 2RC8A 3V89B 3HSTA 4PFUA 3TQWA 4M1VA 4MF3A 1MXXA 4OYVA 4YZZA 2GHBA 1UTHB 1GGGA 1SW1A 3KN8A 4KYDA 4JWYA 4NWDA 3OO6A 3EHUA 1MXWA 2DWJA 4MLVA 5CC2A 3PU5A 3K01A 2DVCA 4TOZA 3TMGA 1R1NA 2OLBA 2F36A 1Z7NE 3IL1B 4R9FA 5K2XA 3DELB 1FQCA 1Y1ZA 3HPIA 4NMYA 1MXUA 5AA1A 5ICQA 4O3CA 2F6GA 1NNTA 2DS9A 4U1ZA 3PUVE 3RNNA 1OVBA 2F7BA 4EDPA 4AQ4A 3N6UA 4I62A 3TTKA 1UIUA 2A5TA 4C1UA 1Z7ME 4ZZAA 3GBBA 4RXLA 2XXHA 3ILTB 3O9PA 4GL8A 2XXXA 1ZU0A 2XXYA 5A5XA 1BIYA 3PPOA 4HTGA 4OXVA 1P1UA 1VSOA 2P0SA 4KFQA 5L9MA 3TTLA 4NF6B 4IO7A 1MQHA 1BP5A 2D3IA 3K6WA 4X48A 3SEYA 3SEVA 4PFTA 2VHAA 4IY6A 1HSLA 1LFGA 3W15C 2FA7A 4Z7EA 1MXYA 1VFEA 1II5A 3N94A 3PGFA 4LVQA 4X9TA 3S9NC 1M5EA 5DVJA 3SKPA 2O7IA 1ZIUA 1D9VA 1DPPA 1WVJA 4P0IA 2R9JA 3TCHA 4F2OA 1YTVA 4ISUA 3FUZA 1XS5A 2PMSA 3KOTA 4NE4A 3DM0A 5EHMA 5F1QA 3VVDA 4FAJA 3MAMA 4GQOA 5AA2D 1URGA 5IKBA 3A3UA 3EHSA 2QJEA 3PPQA 5ITOA 3C31A 3KOSA 4HS7A 2H5YA 4N13A 5CM6A 3UA8A 4EQ7A 3O6GA 4U22A 1PB8A 4K3FA 4R2FA 1B58A 4U23A 5K2YA 3TKDA 1LAGE 1QKAA 1D3KA 3PMVA 4QFOA 3T66A 3TELA 3U94A 4OFOA 4PQJA 2REGA 3FATA 1P99A 1PB9A 1UQWA 3LSXA 2HAUA 4EXKA 3KSJA 5DYHA 3MZ9A 2A5SA 4DIGA 2VD3A 4BDOA 2NUVA 2DE4A 3QYTA 2XXUA 1NKXA 2RINA 4BDQA 4ELQA 4ESWA 5HPQA 5I2KA 4DZ1A 3S9EA 3T9XB 4IO2A 1AMFA 2I0CA 1B32A 3IO6A 4QFPA 1SQYA 3H7MA 4DDDA 1EZPA 2Z8DA 3MUQA 4QHQA 1F9BA 2F97A 4F3PA 1MPDA 3O66A 4H1XA 1A54A 2GH9A 1QULA 2HFBA 2Q2CA 5CMMA 4ELRA 3KGCA 4RPNA 2M8CA 4BDMA 1US4A 3TCGA 1PDAA 5IAIA 4WEPA 1POY1 3PMWA 3MVYA 1B46A 2OCUA 5DTBA 2WKYA 3HV1A 4NF4A 1B5IA 1MPCA 4RJZA 2D21A 1AL3A 4F22A 2XXIA 2DWHA 2H4IA 1IXIA 1NFTA 4IY5A 3MZ1A 4LA9A 5ELVA 3ONMA 2XX7A 4F1VA 3TEPA 3IB2A 3IJOB 1ANFA 1IIWA 1JEVA 2F8DA 2ONRA 2RKMA 3C34A 4LQ5A 1JETA 4MFIA 4N6PA 4TLMB 4XIGQ 5HBCA 1D4NA 1DOTA 4ZEBA 1WODA 4Q8RA 3G3GA 5CRYA 2AL5A 5LOMA 3KBRA 3HCQA 2X7PA 3U93A 3K4UA 2UYFA 1NH7A 3IJXB 3KN3A 4FEDA 1OQHA 1USYH 3H6VA 5TPAA 3KZGA 3LUYA 1M5DA 2CMOA 3RT6B 4E0WA 1DTZA 3IOVA 2E1SA 4U1OA 4H0WA 1SDXA 4YB5A 3TUSA 3MBPA 2OBGA 4GOTA 2DQVA 2W7YA 4H65A 1MDQA 3VV5A 5AA2B 4KI0E 3OELA 3TTRA 1SI1A 5KDTA 2Y7RA 1US5A 3O6IA 1H3DA 1MY2A 1P1WA 3TODA 5FTIA 3TPAA 3VXBA 5JTYB 4EF1A 4F19A 4XTCQ 4ZZEA 1M5CA 3LR1A 1TFDA 1B3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYH A;  1B3L A;  1P1Q A;  4G2Z A;  5KZT A;  2H25 A;  1VFD A;  2UVJ A;  1LFI A;  3IOW A;  4OEV A;  3K6X A;  3VLW A;  1IZ1 A;  1NNK A;  1MQI A;  2OK2 A;  4UAC A;  4IO5 A;  4XKN A;  1EU8 A;  3TAJ A;  2Z23 A;  2Y7K A;  1B05 A;  3EHT A;  4O3B A;  4GD5 A;  4JXI A;  3T9U A;  1I6A A;  2O68 A;  3E4R A;  1QUJ A;  1CB6 A;  1VE4 A;  1O7T A;  3RTW B;  1ZLQ A;  3LBS A;  4Q5T A;  3MP6 A;  4KCC A;  4RK2 A;  4JB7 A;  4F39 A;  1FQE A;  2P1S A;  3G3H A;  3OD7 A;  3OSQ A;  1SYH A;  2KLF A;  4FOR A;  5KDT B;  1IXC A;  1Q1K A;  1GR2 A;  1B5J A;  3IO4 A;  2FYI A;  2QS2 A;  4GL0 A;  1O63 A;  5H8H B;  3THI A;  1URS A;  2QS1 A;  1Y4C A;  5JEI A;  3TCF A;  1PEB A;  5DEX A;  1D9Y A;  2DOJ A;  2DWI A;  1QUK A;  2G29 A;  2XD3 A;  1JVY A;  4KYE A;  3DLN A;  3OSR A;  4F31 B;  4DXB A;  4OFJ A;  3TDJ A;  3HHG A;  5FHO A;  1LB8 A;  1FQF A;  2B3F A;  2ZYN A;  3K0V A;  4MBP A;  4ZEI A;  1A40 A;  3V8X B;  5CMK A;  4NF5 B;  2B65 A;  4R75 A;  2ZYM A;  5FHN A;  1SW4 A;  2UYE A;  4LP2 B;  1QKB A;  1QJM A;  2ABH A;  4QSC A;  1B7U A;  2O1M A;  4YB6 A;  4QRZ A;  3VVE A;  2ZNT A;  1B0H A;  3FV2 A;  2I49 A;  3UP9 A;  3U72 A;  2ZNU A;  5ITP A;  3FD3 A;  4HCW A;  3SER A;  2YPN A;  1B1X A;  4XXU A;  3M8U A;  4F29 A;  3MQ9 A;  4HW8 A;  2VGQ A;  1M5F A;  1N84 A;  3K1N A;  3P7I A;  3USD A;  4ELO A;  5I59 B;  4XKR A;  3U8Q A;  1PBQ A;  2HZL A;  1QVS A;  1N7X A;  4OTE A;  3U1O A;  2Y7W A;  1MPB A;  3VFJ A;  4E0X A;  1B3H A;  2XXP A;  4POX A;  4QFN A;  2UVI A;  3FIR A;  2RC9 A;  3RQT A;  4N07 A;  5H8Q B;  3BFT A;  1UTB A;  2ONS A;  4BDR A;  1Y3N A;  3LC8 A;  3KN7 A;  5EHS A;  4QFK A;  1MM7 A;  3Q25 A;  3C33 A;  2Z8F A;  3S2V A;  3K02 A;  4RYA A;  2QMX A;  1MH4 A;  3UN6 A;  4DCY A;  2AYS A;  4GF8 A;  5L9O A;  4YMA A;  2O1L A;  5DT6 A;  1ATG A;  1LB9 A;  3OO7 A;  2OWT A;  3DP4 A;  4FJP A;  4KD5 A;  4OET A;  1A8E A;  2F7C A;  4GVO A;  4RY1 A;  2XD2 A;  1B6H A;  1NL5 A;  2O7U A;  1DSN A;  2I4B A;  3L6G A;  3RY3 A;  3TZA A;  2QMW A;  4P0G A;  3SET A;  5H8S A;  4FIM A;  3K00 A;  2O6A A;  3H06 B;  4R73 A;  4C0R A;  4OHN A;  1ZTY A;  1KWH A;  2IA4 A;  3DP6 A;  3FVG A;  4OEU A;  4BDN A;  3IOT A;  3RT8 A;  4BLA A;  2RCB A;  3E13 X;  1SD3 A;  3CI8 A;  1B40 A;  3MC2 A;  1IXG A;  4OWD A;  2R6G E;  2XXT A;  4MLQ A;  3T9V A;  4LZ8 A;  1HSJ A;  2XXW A;  4EUO A;  1FQA A;  1HSE A;  2OJT A;  3GXA A;  4KQP A;  4LON B;  4EQB A;  4KHZ E;  4NF6 A;  4YIC A;  1Y20 A;  3G3F A;  5H8H A;  1R6Z A;  3T9H B;  4ND9 A;  2Q2A A;  5I59 A;  4PET A;  4G68 C;  3OMB A;  2I6E A;  3M3F A;  4ZEK A;  5F7V A;  3D4G A;  4KR5 A;  3FXR A;  3K1M A;  3OXN A;  4JSD A;  3FXQ A;  1TT1 A;  1UIV A;  1XOC A;  1YPN A;  3KEI A;  4XKQ A;  5CI5 A;  5HM4 B;  2YLN A;  3MJN A;  4H8J A;  1LFH A;  3G7W A;  5TP9 A;  3VVF A;  4U4S A;  2XX8 A;  3RGY A;  2ALU A;  4WKM A;  2B3B A;  2DYX A;  2V93 A;  1MM6 A;  4YKK A;  1ELJ A;  2E0S A;  4I9D A;  1XC1 A;  3BFU A;  3JYR A;  3ILU B;  4IGT A;  4JWO A;  4NED A;  5DVF A;  2QL3 A;  1LAH E;  1GV8 A;  2XX9 A;  3O2A A;  4G8N A;  3JZJ A;  3GZG A;  3QXM A;  1SW2 A;  1S9T A;  3PPP A;  4GFR A;  4YU0 A;  4DCX A;  1N3X A;  3B6W A;  2UVH A;  3MP1 A;  4R72 A;  1OQG A;  1B1H A;  5TP9 B;  4OMB A;  5CBR A;  4Z0I A;  1R9Q A;  4TLL B;  4G68 B;  1LLS A;  3PUW E;  2I48 A;  4YAH X;  2LAO A;  2F6P A;  1B51 A;  4ZE8 A;  1GVC A;  1FTL A;  3Q28 A;  3H4Z A;  1WDN A;  3RPW A;  5H8F B;  1DMB A;  2V84 A;  4OVJ A;  2F35 A;  3FXU A;  2AIX A;  3QK6 A;  1PC3 A;  2I58 A;  4O3A A;  4P11 A;  1NNP A;  3PUX E;  3CG3 A;  4GXS B;  1N0T A;  4ZS9 A;  3FJG A;  4EXL A;  4THI A;  3GBA A;  4H5G A;  3IOR A;  4F1U A;  3VLU A;  2VOZ A;  4IO3 A;  3B7D A;  3C32 A;  1NMU A;  2H9B A;  5I57 A;  4FEB A;  2VP1 A;  1Y3Q A;  4FAT A;  5AA4 A;  1GTK A;  1B4H A;  4U21 A;  2QPQ A;  1TWY A;  4X1B A;  4H5F A;  2A5T B;  1DTG A;  2F7A A;  1MQD A;  4F2Q A;  1SW5 A;  1SYI A;  1JEU A;  1JW4 A;  1LCF A;  1YCJ A;  2XHD A;  3CFZ A;  3FVN A;  3T22 A;  1A7L A;  3EQ1 A;  2V3U A;  4R6Y A;  5AA2 A;  4GIZ A;  1N04 A;  3PUY E;  3UOR A;  3K6V A;  3ZS6 A;  3UIF A;  5I57 B;  5L9S A;  1OVT A;  4G77 A;  5H8Q A;  1LGB C;  1QW0 A;  1CE2 A;  4ZEF A;  3H03 A;  2XXR A;  3QAX A;  5EYF A;  3KG2 A;  1XVX A;  3LSF B;  2X7Q A;  3R26 A;  1N76 A;  4F18 A;  5ISU A;  3H6W A;  1FTJ A;  3QUF A;  2THI A;  3N5L A;  4X1D A;  1SVX B;  1N3W A;  4OER A;  2DE3 A;  1I69 A;  3OO8 A;  1IXH A;  3VXC A;  5KCJ B;  3H3G A;  1PBP A;  4ZEC A;  2PT1 A;  2HXW A;  3PV0 E;  3EF7 A;  1NNF A;  1A8F A;  1H44 A;  3RTF B;  1MXV A;  3FVK A;  3S4U A;  4TQU Q;  1OLC A;  1Y3P A;  4POW A;  3TTN A;  3CSB A;  1LAX A;  3RUM A;  3UGW A;  4AB5 A;  2GFE A;  2RC7 A;  4IGR A;  4EF2 A;  3QUJ A;  4DLD A;  1B0L A;  3WAE A;  1XHY A;  3HN0 A;  4JSO A;  2F5X A;  4PP0 A;  4ZDM A;  2Q9T A;  2BJJ X;  1MQG A;  2ZMB A;  2RCA A;  3C9H A;  3CIJ A;  3FVO A;  2QRY A;  3HHF A;  1B52 A;  1LST A;  2REJ A;  2YJP A;  1ZJL A;  3E3K A;  3JV9 A;  4QF9 A;  1UTH A;  1OMP A;  2DP8 A;  2OZZ A;  1AH5 A;  1XVY A;  4KPT A;  2GHA A;  1BKA A;  1MY3 A;  1ZKB A;  3IR1 A;  4H67 A;  2I3W A;  4NF8 A;  3RLF E;  4H8I A;  2HEU A;  3SEU A;  5AA4 B;  3AXF A;  4YMB A;  2Q88 A;  1FW0 A;  1I6B A;  4R2B A;  4F3S A;  2Y7P A;  4AB6 A;  4ZED A;  4LUB A;  1BLF A;  4NWC A;  3OEM A;  4OQO A;  3C4M A;  3LSL A;  3Q27 A;  3FAS A;  2NVU B;  3C35 A;  4MH5 A;  4IO6 A;  1FQB A;  3R7X A;  3S9M C;  4GWO A;  5BWJ A;  3OEK A;  4M4G A;  4BDL A;  3LSW A;  1AIV A;  3QSL A;  4JWX A;  3CSG A;  5AA3 A;  2DVZ A;  3CR9 A;  1YAE A;  3B6Q A;  3K2D A;  3QIM A;  3FJM A;  1RYX A;  3MW0 A;  1ZMG A;  3DP8 A;  4YKP A;  4GRK A;  4NF4 B;  1DPE A;  2I0B A;  2QS4 A;  3D4C A;  4QSD A;  2HQ0 A;  3MZB A;  1MQJ A;  2D5W A;  1FTM A;  1MDP 1;  2HAV A;  2XXV A;  3MVZ A;  3PD9 A;  1I6Q A;  2DE2 A;  4JBZ A;  3BBR A;  4KCD A;  2XXQ A;  1H76 A;  1RYO A;  3GLB A;  1IIT A;  2QSX A;  1MS7 A;  3G3J A;  3IB1 A;  3MVX A;  5I2K B;  1JW1 A;  4G68 A;  3SDF A;  2H99 A;  3RN8 A;  5I84 A;  1S50 A;  1ZBM A;  3M3L A;  3CVG A;  1PB7 A;  4WED A;  4RK9 A;  5H8N A;  3KJ7 A;  1R9L A;  1B5H A;  5DEX B;  3ZSF A;  5FHM A;  3CFX A;  4OFL A;  4JDF A;  5I58 A;  2PYY A;  4G8M A;  5FTH A;  3ECR A;  3CFL A;  4C1T A;  4DXU A;  4F1Y A;  3N6T A;  2DSF A;  2F78 A;  1POT A;  2ONK E;  2PBW A;  4LZ5 A;  2Z8E A;  4Q30 B;  3IOU A;  5TPA B;  3VE1 B;  3H6U A;  1SI0 A;  2AL4 A;  5AE4 A;  3C36 A;  3MP8 A;  2GRV A;  4OES A;  3G3K A;  3IAZ A;  4NTL A;  1JVX A;  3V5A A;  5I2N B;  4DXC A;  1B3G A;  4G4P A;  2Q8J A;  3VDF A;  1AOV A;  3T96 B;  4RPO A;  3TFL A;  1L5T A;  1T0K A;  3FV1 A;  1UTB B;  2UVG A;  3MWB A;  3MPL A;  1P1N A;  1Q35 A;  5JK4 A;  3O6H A;  1J1N A;  1IUD A;  2UXA A;  5A5X B;  4LQ2 A;  1JQF A;  2G93 A;  3G3I A;  3MPK A;  2QS3 A;  3M3K A;  3HO7 A;  3OOA A;  3PMX A;  1OIB A;  3E9X A;  2NOO A;  3A3C A;  3PPN A;  3B6T A;  4IO4 A;  4RNS A;  5CMC A;  5L8D A;  3ZKL A;  1EH3 A;  1Y4T A;  4H6D A;  1MY1 A;  1XT8 A;  3EN3 A;  2DWA A;  3ODB A;  3W9W A;  2X26 A;  1QUI A;  1FQD A;  4EQ9 A;  2IEE A;  1N7W A;  5M2V A;  2V3T A;  3O28 A;  3L6H A;  4WXJ A;  2V25 A;  1IQ7 A;  4ELP A;  3CRB A;  1M5B A;  2ZYO A;  5B70 A;  1MY4 A;  4GLI A;  4UA8 A;  5ICT A;  1A55 A;  4XKP A;  5CBS A;  4FEC A;  2ZXT A;  2Z22 A;  4OEN A;  2OWS A;  3MVW A;  2CZL A;  3K6U A;  3KSX A;  3SEW A;  3FJ7 A;  3TTM A;  4ESX A;  2RF1 A;  3IK6 B;  4FE8 A;  4G8H A;  3Q26 A;  1FCK A;  1RKM A;  4GXA A;  4YKJ A;  3V83 A;  1LBB A;  2I3V A;  1B2H A;  2DXR A;  2I4C A;  4YKI A;  4F3G A;  1SBP A;  2Q89 A;  5I2N A;  1B3E A;  2PX1 A;  2Y84 A;  3WAF A;  3KFM A;  4Q0C A;  3U92 A;  4IB2 A;  1LCT A;  2H98 A;  3N26 A;  3F11 A;  3FGS A;  1O64 A;  2ZNS A;  1JNF A;  4L17 A;  1H45 A;  5B7D A;  3VLV A;  3KJT A;  3BKI B;  2NWJ A;  3T93 B;  2FNC A;  2ANJ A;  4ECF A;  3OEN A;  5H8N B;  5I56 A;  3K1P A;  1A99 A;  2VD2 A;  1H43 A;  3A09 A;  3H6T A;  1MH3 A;  2HCA A;  3I5O A;  4R9G A;  3SES A;  2ESN A;  4PFW A;  3FZV A;  4LAT A;  2O84 X;  1B7Z A;  3O97 A;  5TU0 A;  3PUZ E;  5JTY A;  3ZKK A;  1EZO A;  2NXO A;  1EZ9 A;  1S7Y A;  2ZYK A;  3PD8 A;  5CMB A;  4ZE9 A;  2O69 A;  1MY0 A;  1Y1M A;  3CG1 A;  3O29 A;  4ONY A;  2R71 A;  1B9J A;  1JW5 A;  2HZK A;  1URD A;  3R6U A;  4R6H A;  1MXZ A;  3I6V A;  1MG1 A;  1MRP A;  4NF5 A;  4PFY A;  3W9V A;  5H8F A;  4R6K A;  2O51 A;  1Y9U A;  4LZ7 A;  4QFL A;  3I3V A;  4R74 A;  5I56 B;  1IEJ A;  5J1D A;  3S9L C;  4KYS A;  4OZ9 A;  3TQL A;  1VR5 A;  1B4Z A;  3OO9 A;  2F34 A;  4U2R A;  4DE8 A;  1FTO A;  2Y7I A;  4U4X A;  5DVI A;  2DXY A;  2PVU A;  1TFA A;  4HCY A;  5I58 B;  1LBC A;  4PE5 B;  2PT2 A;  3SEX A;  1NH8 A;  5BUU A;  1BTJ A;  4YB7 A;  4NF8 B;  1B7H A;  5KCJ A;  2P2A A;  3EPE A;  3PPR A;  1OLA A;  4RA1 A;  1FTK A;  4I8C A;  4F3B A;  3IX1 A;  1P1O A;  1TXF A;  1USY E;  3Q29 A;  4QSE A;  3UK4 A;  2V3Q A;  3IB0 A;  4I1D A;  1LAF E;  2RC8 A;  3V89 B;  3HST A;  4PFU A;  3TQW A;  4M1V A;  4MF3 A;  1MXX A;  4OYV A;  4YZZ A;  2GHB A;  1UTH B;  1GGG A;  1SW1 A;  3KN8 A;  4KYD A;  4JWY A;  4NWD A;  3OO6 A;  3EHU A;  1MXW A;  2DWJ A;  4MLV A;  5CC2 A;  3PU5 A;  3K01 A;  2DVC A;  4TOZ A;  3TMG A;  1R1N A;  2OLB A;  2F36 A;  1Z7N E;  3IL1 B;  4R9F A;  5K2X A;  3DEL B;  1FQC A;  1Y1Z A;  3HPI A;  4NMY A;  1MXU A;  5AA1 A;  5ICQ A;  4O3C A;  2F6G A;  1NNT A;  2DS9 A;  4U1Z A;  3PUV E;  3RNN A;  1OVB A;  2F7B A;  4EDP A;  4AQ4 A;  3N6U A;  4I62 A;  3TTK A;  1UIU A;  2A5T A;  4C1U A;  1Z7M E;  4ZZA A;  3GBB A;  4RXL A;  2XXH A;  3ILT B;  3O9P A;  4GL8 A;  2XXX A;  1ZU0 A;  2XXY A;  5A5X A;  1BIY A;  3PPO A;  4HTG A;  4OXV A;  1P1U A;  1VSO A;  2P0S A;  4KFQ A;  5L9M A;  3TTL A;  4NF6 B;  4IO7 A;  1MQH A;  1BP5 A;  2D3I A;  3K6W A;  4X48 A;  3SEY A;  3SEV A;  4PFT A;  2VHA A;  4IY6 A;  1HSL A;  1LFG A;  3W15 C;  2FA7 A;  4Z7E A;  1MXY A;  1VFE A;  1II5 A;  3N94 A;  3PGF A;  4LVQ A;  4X9T A;  3S9N C;  1M5E A;  5DVJ A;  3SKP A;  2O7I A;  1ZIU A;  1D9V A;  1DPP A;  1WVJ A;  4P0I A;  2R9J A;  3TCH A;  4F2O A;  1YTV A;  4ISU A;  3FUZ A;  1XS5 A;  2PMS A;  3KOT A;  4NE4 A;  3DM0 A;  5EHM A;  5F1Q A;  3VVD A;  4FAJ A;  3MAM A;  4GQO A;  5AA2 D;  1URG A;  5IKB A;  3A3U A;  3EHS A;  2QJE A;  3PPQ A;  5ITO A;  3C31 A;  3KOS A;  4HS7 A;  2H5Y A;  4N13 A;  5CM6 A;  3UA8 A;  4EQ7 A;  3O6G A;  4U22 A;  1PB8 A;  4K3F A;  4R2F A;  1B58 A;  4U23 A;  5K2Y A;  3TKD A;  1LAG E;  1QKA A;  1D3K A;  3PMV A;  4QFO A;  3T66 A;  3TEL A;  3U94 A;  4OFO A;  4PQJ A;  2REG A;  3FAT A;  1P99 A;  1PB9 A;  1UQW A;  3LSX A;  2HAU A;  4EXK A;  3KSJ A;  5DYH A;  3MZ9 A;  2A5S A;  4DIG A;  2VD3 A;  4BDO A;  2NUV A;  2DE4 A;  3QYT A;  2XXU A;  1NKX A;  2RIN A;  4BDQ A;  4ELQ A;  4ESW A;  5HPQ A;  5I2K A;  4DZ1 A;  3S9E A;  3T9X B;  4IO2 A;  1AMF A;  2I0C A;  1B32 A;  3IO6 A;  4QFP A;  1SQY A;  3H7M A;  4DDD A;  1EZP A;  2Z8D A;  3MUQ A;  4QHQ A;  1F9B A;  2F97 A;  4F3P A;  1MPD A;  3O66 A;  4H1X A;  1A54 A;  2GH9 A;  1QUL A;  2HFB A;  2Q2C A;  5CMM A;  4ELR A;  3KGC A;  4RPN A;  2M8C A;  4BDM A;  1US4 A;  3TCG A;  1PDA A;  5IAI A;  4WEP A;  1POY 1;  3PMW A;  3MVY A;  1B46 A;  2OCU A;  5DTB A;  2WKY A;  3HV1 A;  4NF4 A;  1B5I A;  1MPC A;  4RJZ A;  2D21 A;  1AL3 A;  4F22 A;  2XXI A;  2DWH A;  2H4I A;  1IXI A;  1NFT A;  4IY5 A;  3MZ1 A;  4LA9 A;  5ELV A;  3ONM A;  2XX7 A;  4F1V A;  3TEP A;  3IB2 A;  3IJO B;  1ANF A;  1IIW A;  1JEV A;  2F8D A;  2ONR A;  2RKM A;  3C34 A;  4LQ5 A;  1JET A;  4MFI A;  4N6P A;  4TLM B;  4XIG Q;  5HBC A;  1D4N A;  1DOT A;  4ZEB A;  1WOD A;  4Q8R A;  3G3G A;  5CRY A;  2AL5 A;  5LOM A;  3KBR A;  3HCQ A;  2X7P A;  3U93 A;  3K4U A;  2UYF A;  1NH7 A;  3IJX B;  3KN3 A;  4FED A;  1OQH A;  1USY H;  3H6V A;  5TPA A;  3KZG A;  3LUY A;  1M5D A;  2CMO A;  3RT6 B;  4E0W A;  1DTZ A;  3IOV A;  2E1S A;  4U1O A;  4H0W A;  1SDX A;  4YB5 A;  3TUS A;  3MBP A;  2OBG A;  4GOT A;  2DQV A;  2W7Y A;  4H65 A;  1MDQ A;  3VV5 A;  5AA2 B;  4KI0 E;  3OEL A;  3TTR A;  1SI1 A;  5KDT A;  2Y7R A;  1US5 A;  3O6I A;  1H3D A;  1MY2 A;  1P1W A;  3TOD A;  5FTI A;  3TPA A;  3VXB A;  5JTY B;  4EF1 A;  4F19 A;  4XTC Q;  4ZZE A;  1M5C A;  3LR1 A;  1TFD A;  1B3F A; 
#chains in the Genus database with same CATH topology
 1B3L A;  5KZT A;  4XKN A;  1EU8 A;  4JXI A;  1I6A A;  2O68 A;  1QUJ A;  1CB6 A;  1VE4 A;  5JK4 A;  3LBS A;  4JB7 A;  4F39 A;  5KDT B;  1Q1K A;  2FYI A;  4GL0 A;  1FPI A;  1O63 A;  3TCF A;  2DOJ A;  2DWI A;  1QUK A;  1JVY A;  3DLN A;  3TDJ A;  1FTA A;  5FHO A;  4XFE A;  4NF5 B;  4N91 A;  2UYE A;  2ABH A;  3FV2 A;  3U72 A;  3FD3 A;  5ET6 A;  1N84 A;  3USD A;  3U8Q A;  3MYU A;  4E0X A;  1B3H A;  2DDK A;  5H8Q B;  2Z8F A;  3K02 A;  2QMX A;  4DCY A;  5L9O A;  3OO7 A;  3DP4 A;  1A8E A;  4FIM A;  4OHN A;  1KWH A;  3DP6 A;  4BDN A;  3FVG A;  4BLA A;  1SD3 A;  1DBZ A;  3MC2 A;  2R6G E;  4N15 A;  1HSE A;  1FPL A;  4EQB A;  4KHZ E;  5H8H A;  3T9H B;  2XXK A;  4PET A;  3M3F A;  4ZEK A;  3RPL A;  4KR5 A;  3OXN A;  3FXQ A;  1XOC A;  1YPN A;  5IM2 A;  5CI5 A;  2YLN A;  1QGX A;  2XX8 A;  1MM6 A;  4I9D A;  3ILU B;  2R8T A;  4PBQ A;  4IO5 A;  2XX9 A;  3O2A A;  1SW2 A;  1FRP A;  3PTY A;  5EQ7 A;  5TP9 B;  5CBR A;  4YAH X;  2LAO A;  1B51 A;  5T3J A;  3H4Z A;  1WDN A;  5H8F B;  3FXU A;  5AA2 D;  4P11 A;  3NOH A;  3CG3 A;  1N0T A;  4EXL A;  3GBA A;  4H5G A;  4IO3 A;  2VP1 A;  4PDD A;  1Y3Q A;  4FAT A;  2QPQ A;  1DTG A;  2F7A A;  1MQD A;  5A5X B;  1LCF A;  2XHD A;  3CFZ A;  4OA4 A;  4R6Y A;  3QMF A;  4G77 A;  5H8Q A;  4PF6 A;  3QAX A;  3QUF A;  2THI A;  3N5L A;  1SVX B;  1N3W A;  3IFA A;  3PV0 E;  1NNF A;  1H44 A;  3RTF B;  1OLC A;  1Y3P A;  3UGW A;  4IGR A;  4H46 A;  4JSO A;  2F5X A;  2ZMB A;  3CIJ A;  2QRY A;  3JV9 A;  2OZZ A;  3RT8 A;  2ZZX A;  4NF8 A;  4GWX A;  5AA4 B;  2I3W A;  3RLF E;  2MKZ A;  3AXF A;  2Q88 A;  4F3S A;  2Y7P A;  3ISP A;  2WYP A;  3C35 A;  4JVI A;  5BWJ A;  4BDL A;  1NV2 A;  1AIV A;  4RYA A;  3QIM A;  3FJM A;  2QS4 A;  4GWS A;  2HQ0 A;  2HAV A;  4JBZ A;  2DE2 A;  1IIT A;  1MS7 A;  3MVX A;  3SDF A;  1ZBM A;  3CVG A;  1PB7 A;  4RK9 A;  3KJ7 A;  1B5H A;  3CFX A;  4OFL A;  5I58 A;  2F3B A;  4C1T A;  4F1Y A;  2DSF A;  2F78 A;  1POT A;  2PBW A;  3VE1 B;  4Q30 B;  3IOU A;  3H6U A;  1SI0 A;  2AL4 A;  3V5A A;  4DXC A;  3VDF A;  1UTB B;  2UVG A;  3MWB A;  5FBP A;  1Q35 A;  3O6H A;  2UXA A;  3MPK A;  3PPN A;  3A3C A;  4NAP A;  3B6T A;  3ZKL A;  1Y4T A;  5J16 A;  4H6D A;  3ODB A;  3W9W A;  2X26 A;  1QUI A;  1FQD A;  2V3T A;  3O28 A;  4WXJ A;  4UAB A;  5B70 A;  4XKP A;  4OEN A;  3SEW A;  3K6U A;  3FJ7 A;  2RF1 A;  4MIJ A;  4G8H A;  4GXA A;  4YKJ A;  2Q89 A;  1D9Q A;  3WAF A;  3KFM A;  3U92 A;  4IB2 A;  2VPN A;  1LCT A;  3FGS A;  2ZNS A;  1JNF A;  1NV7 A;  3T1B A;  4FBP A;  3I5O A;  4N4U A;  4H45 A;  4NX1 A;  3FZV A;  3B8B A;  5JTY A;  1MY0 A;  1B9J A;  3R6U A;  3A29 A;  5IZ1 A;  2ZZW A;  1LBV A;  5H8F A;  4R74 A;  3OO9 A;  5DVI A;  1BK4 A;  2DXY A;  1TFA A;  2VPO A;  5I58 B;  4PE5 B;  2Y5K A;  1B7H A;  5KCJ A;  1OLA A;  1P1O A;  4QSE A;  2V3Q A;  3IB0 A;  3V89 B;  2RC8 A;  4PBH A;  3HST A;  1LEV A;  2GHB A;  1GGG A;  4JWY A;  5CC2 A;  3OO6 A;  3K01 A;  2DVC A;  2F36 A;  1MXU A;  3RNN A;  1OVB A;  4EDP A;  2XXH A;  3O9P A;  5I5P A;  4OXV A;  2P0S A;  4NF6 B;  4IO7 A;  4P8B A;  2D3I A;  2VHA A;  1LFG A;  3KC0 A;  1MXY A;  1D9V A;  3KC1 A;  1XS5 A;  3KOT A;  4NE4 A;  3MAM A;  3EHS A;  3UA8 A;  5ET5 A;  4U23 A;  3TKD A;  3T66 A;  3PMV A;  3TEL A;  3KBZ A;  4PQJ A;  1P99 A;  2FBP A;  2HAU A;  4ESW A;  4ELQ A;  1NKX A;  3S9E A;  2I0C A;  1B32 A;  2XWI A;  2Z8D A;  3MUQ A;  2F97 A;  1A54 A;  2HFB A;  4F3P A;  5CMM A;  4BDM A;  3TCG A;  5IAI A;  4WEP A;  2WKY A;  4NF4 A;  1B5I A;  1NFT A;  4F1V A;  3IB2 A;  1ANF A;  1JEV A;  2RKM A;  4LQ5 A;  4TLM B;  1NV0 A;  1JET A;  4MFI A;  5HBC A;  1WOD A;  2AL5 A;  3HCQ A;  3GYY A;  3U93 A;  3H6V A;  1M5D A;  2E1S A;  4U1O A;  1SDX A;  4H65 A;  4P9K A;  5AA2 B;  3OEL A;  2Y7R A;  3VXB A;  4ZZE A;  4OEV A;  2UVH A;  1B3F A;  1P1Q A;  1VFD A;  5A5L A;  4N17 A;  1NNK A;  3TAJ A;  2HPG A;  2Z23 A;  1B05 A;  3T9U A;  3RTW B;  1O7T A;  4Q5T A;  1SYH A;  1GR2 A;  2HXR A;  1B5J A;  4MX6 A;  2QS1 A;  1Y4C A;  5DEX A;  2XD3 A;  2B3F A;  1FQF A;  3K0V A;  4MBP A;  3V8X B;  1A40 A;  4LP2 B;  1EYK A;  2O1M A;  1B0H A;  3MST A;  3LV0 A;  4HCW A;  1B1X A;  2P3N A;  2VGQ A;  1M5F A;  1FPE A;  4XKR A;  1QVS A;  2XXP A;  3LC8 A;  5EHS A;  3KN7 A;  4AS4 A;  3Q25 A;  3UN6 A;  2AYS A;  1ATG A;  1LB9 A;  4FJP A;  2F7C A;  4GVO A;  1B6H A;  1NL5 A;  2XWV A;  2QMW A;  3SET A;  3K00 A;  4C0R A;  2Q74 A;  2WX9 A;  4OEU A;  4QXD A;  1FBF A;  3IOT A;  3CI8 A;  4OWD A;  4MLQ A;  2XXW A;  4EUO A;  5I7I A;  5I3S A;  3GXA A;  1NUX A;  4NF6 A;  4YIC A;  1Y20 A;  4G68 C;  3OMB A;  3D4G A;  3FXR A;  3K1M A;  1UIV A;  4H8J A;  5TP9 A;  3VVF A;  3RGY A;  4P1L A;  2B3B A;  2E0S A;  1LAH E;  4G8N A;  4GFR A;  3GZG A;  4DCX A;  1S9T A;  3PPP A;  3B6W A;  4OMB A;  4JVD A;  1R9Q A;  4HXV A;  4TLL B;  3PUW E;  2F6P A;  4OVJ A;  2F35 A;  3QK6 A;  1IMC A;  5DEX B;  4GXS B;  3IOR A;  1G0H A;  3VLU A;  3B7D A;  4KXP A;  1B4H A;  4F2Q A;  1SW5 A;  4DXB A;  5AA2 A;  4GIZ A;  3UOR A;  3UIF A;  5EYF A;  3R26 A;  4F18 A;  2PFY A;  4OER A;  1I69 A;  3FXB A;  4PGN A;  2PT1 A;  3EF7 A;  3FVK A;  1FPB A;  3CSB A;  4AB5 A;  3WAE A;  1FPF A;  1MQG A;  3FVO A;  2RCA A;  3HHF A;  2YJP A;  3E3K A;  3HFU A;  4X1B A;  1UTH A;  2FVZ A;  4KPT A;  4N8G A;  1MY3 A;  4H67 A;  3SEU A;  4H8I A;  2HEU A;  4YMB A;  2FIE A;  4M4G A;  3E78 A;  3QSL A;  4JWX A;  3CSG A;  2DVZ A;  3B6Q A;  3K2D A;  3DP8 A;  4QSD A;  1DPE A;  2I0B A;  3D4C A;  3PD9 A;  4OVR A;  3MZB A;  1MQJ A;  2XXV A;  3MVZ A;  4YZZ A;  1H76 A;  1RYO A;  3GLB A;  1RDY A;  3IB1 A;  4G68 A;  2H99 A;  5I84 A;  1S50 A;  3M3L A;  1R9L A;  5IZ3 A;  5EQA A;  3ZSF A;  5FHM A;  3LUZ A;  4MNI A;  4DXU A;  4LZ5 A;  5AE4 A;  1EYI A;  1JVX A;  2WEF A;  4GBV A;  4G4P A;  1L5T A;  3FV1 A;  3MPL A;  1P1N A;  4N6D A;  3PMX A;  3ROJ A;  2CZI A;  1XT8 A;  2IEE A;  1CNQ A;  1IQ7 A;  1M5B A;  2ZYO A;  4GLI A;  1A55 A;  5CBS A;  4FEC A;  2Z22 A;  2OWS A;  3MVW A;  3TTM A;  4FE8 A;  3V83 A;  2I3V A;  1LBY A;  4F3G A;  5I2N A;  1B3E A;  2PX1 A;  2Y84 A;  4Q0C A;  3D1R A;  3N26 A;  1INP A;  4L17 A;  1Q9D A;  3KJT A;  3BKI B;  3T93 B;  2FNC A;  4NGU A;  4PFW A;  1B7Z A;  1EZO A;  1EZ9 A;  2ZYK A;  5CMB A;  2R71 A;  3I6V A;  4NF5 A;  2KR0 A;  4LZ7 A;  3I3V A;  4KYS A;  4YB7 A;  4NF8 B;  3EPE A;  1FTK A;  1K9Z A;  1TXF A;  1USY E;  3Q29 A;  1LAF E;  4GX6 A;  1LBW A;  4PFU A;  4M1V A;  4MF3 A;  1FJ6 A;  3EHU A;  4MLV A;  2DWJ A;  4TOZ A;  1R1N A;  1IME A;  4NMY A;  3HPI A;  5AA1 A;  1DCU A;  4O3C A;  2DS9 A;  4U1Z A;  3PUV E;  3BIG A;  1UIU A;  4PF8 A;  4GX4 A;  5A5X A;  4NF0 A;  4KFQ A;  5L9M A;  3TTL A;  1NUZ A;  3K6W A;  4X48 A;  4PFT A;  4IY6 A;  1HSL A;  3RPL B;  2OX3 A;  1KA0 A;  4F2O A;  2R9J A;  4GQO A;  1URG A;  2XWK A;  2PCR A;  2H5Y A;  1KA1 A;  5LTC A;  3O6G A;  5K2Y A;  1LAG E;  1D3K A;  3FAT A;  4AS5 A;  3KSJ A;  5DYH A;  3MZ9 A;  4DIG A;  2VD3 A;  2BJI A;  4BDO A;  5ET8 A;  4BDQ A;  4DZ1 A;  4QFP A;  2QVU A;  4DDD A;  4QHQ A;  1F9B A;  4H1X A;  3O66 A;  1QUL A;  3KGC A;  4RPN A;  3MVY A;  5DTB A;  3HV1 A;  5LDZ A;  1AL3 A;  2XXI A;  2H4I A;  4LA9 A;  3IJO B;  1IIW A;  3T0J A;  1D4N A;  5CRY A;  4XEQ A;  3KBR A;  2X7P A;  4FED A;  1OQH A;  1NV1 A;  3LUY A;  3RT6 B;  1DTZ A;  3IOV A;  4YB5 A;  3MBP A;  2OBG A;  3VV5 A;  4P3L A;  5KDT A;  3TPA A;  5I2K A;  3TOD A;  5FTI A;  5JTY B;  1M5C A;  1TFD A;  4G2Z A;  2UVJ A;  1IZ1 A;  1RDZ A;  1MQI A;  2OK2 A;  4UAC A;  4O3B A;  4GD5 A;  1ZLQ A;  4KCC A;  3G3H A;  2P1S A;  3OSQ A;  2KLF A;  4FOR A;  2F3D A;  3IO4 A;  2QS2 A;  3THI A;  1URS A;  1D9Y A;  4KYE A;  3OSR A;  4OFJ A;  2ZYN A;  5CMK A;  4NN3 A;  4MEV A;  5FHN A;  1QKB A;  1QJM A;  1B7U A;  1FBC A;  4P47 A;  4QRZ A;  3VVE A;  2I49 A;  3UP9 A;  5ITP A;  2YPN A;  2HHM A;  4XXU A;  4ELO A;  3K1N A;  1PBQ A;  2HZL A;  4OTE A;  1N7X A;  4QFN A;  4POX A;  2UVI A;  3FIR A;  3RQT A;  3BFT A;  1UTB A;  1XI6 A;  1Y3N A;  1MM7 A;  3C33 A;  3S2V A;  5DT6 A;  4RY1 A;  4NHB A;  3L6G A;  1DSN A;  3TZA A;  4P0G A;  1FBG A;  1YYZ A;  3H06 B;  1ZTY A;  2IA4 A;  2RCB A;  3E13 X;  1B40 A;  3T9V A;  3BIH A;  4LZ8 A;  1G0I A;  2OJT A;  4KQP A;  1FBE A;  1R6Z A;  4ND9 A;  1NUW A;  4XKQ A;  5HM4 B;  4O94 A;  3MJN A;  1LFH A;  3G7W A;  4PCD A;  4U4S A;  2DYX A;  2V93 A;  4OVS A;  1ELJ A;  1XC1 A;  3BFU A;  3JYR A;  4NED A;  4IGT A;  2QL3 A;  1GV8 A;  3QXM A;  1N3X A;  4R72 A;  1OQG A;  4G61 A;  4N81 A;  3RPW A;  2V84 A;  4OVQ A;  2AIX A;  4O3A A;  3PUX E;  4THI A;  1LBZ A;  2VOZ A;  1NMU A;  4P56 A;  5AA4 A;  5IGA A;  1LBX A;  1TWY A;  4H5F A;  2A5T B;  1SYI A;  1JEU A;  3PUY E;  3ZS6 A;  5I57 B;  1OVT A;  1LGB C;  1QW0 A;  4ZEF A;  3LSF B;  1N76 A;  1FBD A;  1NUY A;  2DE3 A;  3OO8 A;  1NV6 A;  3FBP A;  4ZEC A;  2HXW A;  2GQ1 A;  3S4U A;  1MXV A;  4TQU Q;  3SZP A;  4PGP A;  2RC7 A;  4EF2 A;  4DLD A;  1B0L A;  3HN0 A;  4PP0 A;  4ZDM A;  2BJJ X;  1LST A;  4YKI A;  2DP8 A;  2GHA A;  1ZKB A;  1IMF A;  3IR1 A;  4HE2 A;  1FW0 A;  4AB6 A;  4LUB A;  4OQO A;  4NWC A;  3OEM A;  3C4M A;  3Q27 A;  3FAS A;  2NVU B;  4NQ8 A;  1EYJ A;  4MH5 A;  4IO6 A;  1FQB A;  4GWO A;  5EQ9 A;  5AA3 A;  3CR9 A;  3MW0 A;  1ZMG A;  4PAI A;  4YKP A;  4GRK A;  1IMB A;  2D5W A;  1FTM A;  1MDP 1;  4RPO A;  1I6Q A;  2XXQ A;  3G3J A;  1JW1 A;  5H8N A;  4JDF A;  4G8M A;  4MNP A;  3ECR A;  5FTH A;  1NI9 A;  2ONK E;  2Z8E A;  4OES A;  3G3K A;  3IAZ A;  1B3G A;  2Q8J A;  4OVT A;  3TFL A;  1T0K A;  4LQ2 A;  2QS3 A;  3M3K A;  4RNS A;  1OIB A;  5CMC A;  2NOO A;  4P1E A;  3EN3 A;  2DWA A;  3L6H A;  2V25 A;  3CRB A;  5ICT A;  2ZXT A;  2CZL A;  3KSX A;  1FCK A;  1LBB A;  3CHG A;  1B2H A;  1NV3 A;  5B7D A;  2NWJ A;  3OEN A;  1H43 A;  3A09 A;  3H6T A;  1MH3 A;  2XA5 A;  2ESN A;  4LAT A;  5TU0 A;  1S7Y A;  3PD8 A;  4O8M A;  5ICQ A;  4ZE9 A;  2O69 A;  1Y1M A;  4GWZ A;  4R6H A;  2HZK A;  1MG1 A;  1MRP A;  3W9V A;  4R6K A;  2O51 A;  5J1D A;  3S9L C;  1VR5 A;  1B4Z A;  4U2R A;  2F34 A;  2Y7I A;  1FPK A;  1FBH A;  4HCY A;  3PPR A;  4RA1 A;  4I3Y A;  4O7M A;  4F3B A;  3IX1 A;  4OYV A;  1UTH B;  3KN8 A;  4KYD A;  4NWD A;  1MXW A;  3PU5 A;  4OVP A;  3TMG A;  4R9F A;  1Z7N E;  3IL1 B;  5K2X A;  2F6G A;  1NNT A;  4HE0 A;  4GX3 A;  3TTK A;  4C1U A;  4RXL A;  3ILT B;  2XXX A;  4X04 A;  3E79 A;  5ESY A;  4HTG A;  1P1U A;  1VSO A;  5ET7 A;  1BP5 A;  3SEY A;  3U65 A;  3N94 A;  3PGF A;  1FPD A;  1FSA A;  4LVQ A;  5DVJ A;  2O7I A;  1NV4 A;  1YTV A;  2PMS A;  5F24 A;  5F1Q A;  3DM0 A;  5EHM A;  5IKB A;  3A3U A;  3PPQ A;  2QJE A;  3C31 A;  3KOS A;  4PC9 A;  4N13 A;  5CM6 A;  4EQ7 A;  4U22 A;  1PB8 A;  4K3F A;  4R2F A;  1B58 A;  1QKA A;  4QFO A;  1PB9 A;  1UQW A;  3LSX A;  4EXK A;  2A5S A;  3QYT A;  2WBB A;  3T9X B;  1SQY A;  3H7M A;  1EZP A;  1MPD A;  1US4 A;  1POY 1;  2CEX A;  5IZZ A;  1MPC A;  2L5V A;  4RJZ A;  2CZH A;  1JP4 A;  4I40 A;  2DWH A;  4IY5 A;  5ELV A;  2XX7 A;  3C34 A;  4XIG Q;  2ONR A;  4GWW A;  1DOT A;  4Q8R A;  3G3G A;  2UYF A;  3IJX B;  3KN3 A;  1USY H;  5TPA A;  3KZG A;  4DI3 D;  4H0W A;  3TUS A;  1YZ0 A;  1MDQ A;  1SI1 A;  1MY2 A;  1P1W A;  4F1U A;  4EF1 A;  4F19 A;  4XTC Q;  4GBW A;  3TYH A;  2H25 A;  2OWZ A;  1LFI A;  4I3E A;  3IOW A;  1KZ8 A;  3K6X A;  3VLW A;  2Y7K A;  3EHT A;  3E4R A;  4RK2 A;  3MP6 A;  1FQE A;  3OD7 A;  1IXC A;  4PE3 A;  5H8H B;  5JEI A;  1PEB A;  2G29 A;  4F31 B;  3HHG A;  1LB8 A;  4ZEI A;  4PFI A;  2B65 A;  4R75 A;  2ZYM A;  1SW4 A;  4QSC A;  4YB6 A;  2ZNT A;  2ZNU A;  4LN5 A;  3SER A;  3M8U A;  4HW8 A;  3MQ9 A;  5I59 B;  3P7I A;  2QFL A;  3U1O A;  2P3V A;  2Y7W A;  1MPB A;  3VFJ A;  2RC9 A;  5DW8 A;  4N07 A;  4BDR A;  2ONS A;  2V4C A;  4QFK A;  4PAF A;  1MH4 A;  4GF8 A;  4YMA A;  2O1L A;  2OWT A;  4KD5 A;  4OET A;  2XD2 A;  2O7U A;  2I4B A;  3RY3 A;  5H8S A;  2O6A A;  4R73 A;  1FBP A;  1IXG A;  2XXT A;  1HSJ A;  1FQA A;  4LON B;  3G3F A;  2Q2A A;  5I59 A;  5EYH A;  4GWY A;  2I6E A;  5F7V A;  4JSD A;  1TT1 A;  3KEI A;  4MJO A;  2ALU A;  4WKM A;  4YKK A;  5EQ8 A;  4JWO A;  5DVF A;  5KCJ B;  3JZJ A;  3MP1 A;  1B1H A;  4Z0I A;  4G68 B;  4GWU A;  1LLS A;  2I48 A;  4ZE8 A;  1GVC A;  1FTL A;  3Q28 A;  1DMB A;  1NV5 A;  1PC3 A;  2I58 A;  1NNP A;  1YXI A;  4ZS9 A;  3FJG A;  2VT5 A;  3C32 A;  2H9B A;  5I57 A;  4FEB A;  1GTK A;  4U21 A;  4NG7 A;  4MMP A;  3FVN A;  1JW4 A;  1YCJ A;  3T22 A;  1A7L A;  3EQ1 A;  2V3U A;  1N04 A;  4QBA A;  3K6V A;  4PFR A;  5L9S A;  4PAK A;  1CE2 A;  3H03 A;  2XXR A;  3KG2 A;  1XVX A;  5ISU A;  2X7Q A;  3H6W A;  1FTJ A;  4X1D A;  3VXC A;  1IXH A;  3H3G A;  1PBP A;  3EKI A;  1A8F A;  4POW A;  3TTN A;  1LAX A;  3RUM A;  1AWB A;  2GFE A;  5IZ3 B;  3QUJ A;  5EYG A;  1XHY A;  2B4M A;  2Q9T A;  3C9H A;  1B52 A;  2REJ A;  4QF9 A;  1ZJL A;  4F29 A;  4YU0 A;  1OMP A;  1AH5 A;  1XVY A;  1BKA A;  4JVC A;  4AQ4 A;  4PFB A;  1I6B A;  4R2B A;  4ZED A;  4MCO A;  1BLF A;  3LSL A;  2CEY A;  3R7X A;  3S9M C;  3RYD A;  1IMD A;  3OEK A;  3LSW A;  4XF5 A;  1YAE A;  1RYX A;  4NF4 B;  3ZKK A;  4KCD A;  3BBR A;  2QSX A;  5I2K B;  3RN8 A;  4WED A;  2QVV A;  1IMA A;  2PYY A;  3CFL A;  2CZK A;  3N6T A;  5TPA B;  4MAG A;  3C36 A;  3MP8 A;  2GRV A;  4NTL A;  2JJK A;  5I2N B;  1AOV A;  3T96 B;  1J1N A;  1IUD A;  1JQF A;  2G93 A;  3G3I A;  4HE1 A;  3HO7 A;  3OOA A;  3E9X A;  4IO4 A;  5L8D A;  1EH3 A;  1MY1 A;  4EQ9 A;  1N7W A;  5M2V A;  4ELP A;  1MY4 A;  4UA8 A;  2ZZV A;  2WYK A;  4ESX A;  3IK6 B;  3Q26 A;  1RKM A;  2DXR A;  2I4C A;  1SBP A;  2H98 A;  1VDW A;  3F11 A;  1O64 A;  1H45 A;  3VLV A;  4ECF A;  2ANJ A;  5I56 A;  5H8N B;  2XWO A;  3K1P A;  1A99 A;  2VD2 A;  2HCA A;  4R9G A;  3SES A;  2O84 X;  2PFZ A;  3O97 A;  3PUZ E;  2NXO A;  3CG1 A;  3O29 A;  4ONY A;  1JW5 A;  1URD A;  4DI4 B;  1MXZ A;  4PFY A;  1Y9U A;  4QFL A;  5I56 B;  1IEJ A;  4OZ9 A;  3TQL A;  4DE8 A;  1FTO A;  4U4X A;  4N6K A;  2PVU A;  1LBC A;  2PT2 A;  3SEX A;  1NH8 A;  5BUU A;  1BTJ A;  3B50 A;  2P2A A;  4I8C A;  3UK4 A;  4I1D A;  3TQW A;  1MXX A;  1DK4 A;  1SW1 A;  2FHY A;  2KQZ A;  3IFC A;  2OLB A;  4PTK A;  3DEL B;  1FQC A;  1Y1Z A;  2F7B A;  3N6U A;  4I62 A;  2A5T A;  2Y5L A;  1Z7M E;  4ZZA A;  3GBB A;  4GL8 A;  1K9Y A;  1ZU0 A;  2XXY A;  1BIY A;  3PPO A;  1MQH A;  4O7I A;  3SEV A;  2Q8M A;  2FIX A;  2FA7 A;  2B4L A;  1VFE A;  3W15 C;  1II5 A;  4X9T A;  4Z7E A;  3S9N C;  1M5E A;  3SKP A;  1ZIU A;  1DPP A;  3TCH A;  1WVJ A;  4P0I A;  4ISU A;  3FUZ A;  4OAN A;  4FAJ A;  4PDH A;  1FPJ A;  3VVD A;  5ITO A;  4HS7 A;  1FJ9 A;  4MNC A;  3U94 A;  2REG A;  4IR8 A;  2NUV A;  2DE4 A;  2XXU A;  2RIN A;  5HPQ A;  4IO2 A;  1AMF A;  3IO6 A;  4X8R A;  1SPI A;  2QVR A;  2GH9 A;  2Q2C A;  4ELR A;  2M8C A;  1PDA A;  2WBD A;  3PMW A;  1B46 A;  2OCU A;  2D21 A;  4F22 A;  1IXI A;  3MZ1 A;  3TEP A;  3ONM A;  2F8D A;  4N6P A;  1FPG A;  4ZEB A;  1RDX A;  5LOM A;  3K4U A;  1NH7 A;  4MHF A;  2CMO A;  4E0W A;  4GOT A;  2DQV A;  2W7Y A;  4KI0 E;  3TTR A;  1US5 A;  3O6I A;  1H3D A;  4N8Y A;  3LR1 A;  4OFO A; 
#chains in the Genus database with same CATH homology
 3TYH A;  1B3L A;  1P1Q A;  4G2Z A;  5KZT A;  2H25 A;  1VFD A;  2UVJ A;  1LFI A;  3IOW A;  4OEV A;  3K6X A;  3VLW A;  1IZ1 A;  1NNK A;  1MQI A;  2OK2 A;  4UAC A;  4IO5 A;  4XKN A;  1EU8 A;  3TAJ A;  2Z23 A;  2Y7K A;  1B05 A;  3EHT A;  4O3B A;  4GD5 A;  4JXI A;  3T9U A;  1I6A A;  2O68 A;  3E4R A;  1QUJ A;  1CB6 A;  1VE4 A;  1O7T A;  3RTW B;  1ZLQ A;  3LBS A;  4Q5T A;  3MP6 A;  4KCC A;  4RK2 A;  4JB7 A;  4F39 A;  1FQE A;  2P1S A;  3G3H A;  3OD7 A;  3OSQ A;  1SYH A;  2KLF A;  4FOR A;  5KDT B;  1IXC A;  1Q1K A;  1GR2 A;  1B5J A;  3IO4 A;  2FYI A;  2QS2 A;  4GL0 A;  1O63 A;  5H8H B;  3THI A;  1URS A;  2QS1 A;  1Y4C A;  5JEI A;  3TCF A;  1PEB A;  5DEX A;  1D9Y A;  2DOJ A;  2DWI A;  1QUK A;  2G29 A;  2XD3 A;  1JVY A;  4KYE A;  3DLN A;  3OSR A;  4F31 B;  4DXB A;  4OFJ A;  3TDJ A;  3HHG A;  5FHO A;  1LB8 A;  1FQF A;  2B3F A;  2ZYN A;  3K0V A;  4MBP A;  4ZEI A;  1A40 A;  3V8X B;  5CMK A;  4NF5 B;  2B65 A;  4R75 A;  2ZYM A;  5FHN A;  1SW4 A;  2UYE A;  4LP2 B;  1QKB A;  1QJM A;  2ABH A;  4QSC A;  1B7U A;  2O1M A;  4YB6 A;  4QRZ A;  3VVE A;  2ZNT A;  1B0H A;  3FV2 A;  2I49 A;  3UP9 A;  3U72 A;  2ZNU A;  5ITP A;  3FD3 A;  4HCW A;  3SER A;  2YPN A;  1B1X A;  4XXU A;  3M8U A;  4F29 A;  3MQ9 A;  4HW8 A;  2VGQ A;  1M5F A;  1N84 A;  3K1N A;  3P7I A;  3USD A;  4ELO A;  5I59 B;  4XKR A;  3U8Q A;  1PBQ A;  2HZL A;  1QVS A;  1N7X A;  4OTE A;  3U1O A;  2Y7W A;  1MPB A;  3VFJ A;  4E0X A;  1B3H A;  2XXP A;  4POX A;  4QFN A;  2UVI A;  3FIR A;  2RC9 A;  3RQT A;  4N07 A;  5H8Q B;  3BFT A;  1UTB A;  2ONS A;  4BDR A;  1Y3N A;  3LC8 A;  3KN7 A;  5EHS A;  4QFK A;  1MM7 A;  3Q25 A;  3C33 A;  2Z8F A;  3S2V A;  3K02 A;  4RYA A;  2QMX A;  1MH4 A;  3UN6 A;  4DCY A;  2AYS A;  4GF8 A;  5L9O A;  4YMA A;  2O1L A;  5DT6 A;  1ATG A;  1LB9 A;  3OO7 A;  2OWT A;  3DP4 A;  4FJP A;  4KD5 A;  4OET A;  1A8E A;  2F7C A;  4GVO A;  4RY1 A;  2XD2 A;  1B6H A;  1NL5 A;  2O7U A;  1DSN A;  2I4B A;  3L6G A;  3RY3 A;  3TZA A;  2QMW A;  4P0G A;  3SET A;  5H8S A;  4FIM A;  3K00 A;  2O6A A;  3H06 B;  4R73 A;  4C0R A;  4OHN A;  1ZTY A;  1KWH A;  2IA4 A;  3DP6 A;  3FVG A;  4OEU A;  4BDN A;  3IOT A;  3RT8 A;  4BLA A;  2RCB A;  3E13 X;  1SD3 A;  3CI8 A;  1B40 A;  3MC2 A;  1IXG A;  4OWD A;  2R6G E;  2XXT A;  4MLQ A;  3T9V A;  4LZ8 A;  1HSJ A;  2XXW A;  4EUO A;  1FQA A;  1HSE A;  2OJT A;  3GXA A;  4KQP A;  4LON B;  4EQB A;  4KHZ E;  4NF6 A;  4YIC A;  1Y20 A;  3G3F A;  5H8H A;  1R6Z A;  3T9H B;  4ND9 A;  2Q2A A;  5I59 A;  4PET A;  4G68 C;  3OMB A;  2I6E A;  3M3F A;  4ZEK A;  5F7V A;  3D4G A;  4KR5 A;  3FXR A;  3K1M A;  3OXN A;  4JSD A;  3FXQ A;  1TT1 A;  1UIV A;  1XOC A;  1YPN A;  3KEI A;  4XKQ A;  5CI5 A;  5HM4 B;  2YLN A;  3MJN A;  4H8J A;  1LFH A;  3G7W A;  5TP9 A;  3VVF A;  4U4S A;  2XX8 A;  3RGY A;  2ALU A;  4WKM A;  2B3B A;  2DYX A;  2V93 A;  1MM6 A;  4YKK A;  1ELJ A;  2E0S A;  4I9D A;  1XC1 A;  3BFU A;  3JYR A;  3ILU B;  4IGT A;  4JWO A;  4NED A;  5DVF A;  2QL3 A;  1LAH E;  1GV8 A;  2XX9 A;  3O2A A;  4G8N A;  3JZJ A;  3GZG A;  3QXM A;  1SW2 A;  1S9T A;  3PPP A;  4GFR A;  4YU0 A;  4DCX A;  1N3X A;  3B6W A;  2UVH A;  3MP1 A;  4R72 A;  1OQG A;  1B1H A;  5TP9 B;  4OMB A;  5CBR A;  4Z0I A;  1R9Q A;  4TLL B;  4G68 B;  1LLS A;  3PUW E;  2I48 A;  4YAH X;  2LAO A;  2F6P A;  1B51 A;  4ZE8 A;  1GVC A;  1FTL A;  3Q28 A;  3H4Z A;  1WDN A;  3RPW A;  5H8F B;  1DMB A;  2V84 A;  4OVJ A;  2F35 A;  3FXU A;  2AIX A;  3QK6 A;  1PC3 A;  2I58 A;  4O3A A;  4P11 A;  1NNP A;  3PUX E;  3CG3 A;  4GXS B;  1N0T A;  4ZS9 A;  3FJG A;  4EXL A;  4THI A;  3GBA A;  4H5G A;  3IOR A;  4F1U A;  3VLU A;  2VOZ A;  4IO3 A;  3B7D A;  3C32 A;  1NMU A;  2H9B A;  5I57 A;  4FEB A;  2VP1 A;  1Y3Q A;  4FAT A;  5AA4 A;  1GTK A;  1B4H A;  4U21 A;  2QPQ A;  1TWY A;  4X1B A;  4H5F A;  2A5T B;  1DTG A;  2F7A A;  1MQD A;  4F2Q A;  1SW5 A;  1SYI A;  1JEU A;  1JW4 A;  1LCF A;  1YCJ A;  2XHD A;  3CFZ A;  3FVN A;  3T22 A;  1A7L A;  3EQ1 A;  2V3U A;  4R6Y A;  5AA2 A;  4GIZ A;  1N04 A;  3PUY E;  3UOR A;  3K6V A;  3ZS6 A;  3UIF A;  5I57 B;  5L9S A;  1OVT A;  4G77 A;  5H8Q A;  1LGB C;  1QW0 A;  1CE2 A;  4ZEF A;  3H03 A;  2XXR A;  3QAX A;  5EYF A;  3KG2 A;  1XVX A;  3LSF B;  2X7Q A;  3R26 A;  1N76 A;  4F18 A;  5ISU A;  3H6W A;  1FTJ A;  3QUF A;  2THI A;  3N5L A;  4X1D A;  1SVX B;  1N3W A;  4OER A;  2DE3 A;  1I69 A;  3OO8 A;  1IXH A;  3VXC A;  5KCJ B;  3H3G A;  1PBP A;  4ZEC A;  2PT1 A;  2HXW A;  3PV0 E;  3EF7 A;  1NNF A;  1A8F A;  1H44 A;  3RTF B;  1MXV A;  3FVK A;  3S4U A;  4TQU Q;  1OLC A;  1Y3P A;  4POW A;  3TTN A;  3CSB A;  1LAX A;  3RUM A;  3UGW A;  4AB5 A;  2GFE A;  2RC7 A;  4IGR A;  4EF2 A;  3QUJ A;  4DLD A;  1B0L A;  3WAE A;  1XHY A;  3HN0 A;  4JSO A;  2F5X A;  4PP0 A;  4ZDM A;  2Q9T A;  2BJJ X;  1MQG A;  2ZMB A;  2RCA A;  3C9H A;  3CIJ A;  3FVO A;  2QRY A;  3HHF A;  1B52 A;  1LST A;  2REJ A;  2YJP A;  1ZJL A;  3E3K A;  3JV9 A;  4QF9 A;  1UTH A;  1OMP A;  2DP8 A;  2OZZ A;  1AH5 A;  1XVY A;  4KPT A;  2GHA A;  1BKA A;  1MY3 A;  1ZKB A;  3IR1 A;  4H67 A;  2I3W A;  4NF8 A;  3RLF E;  4H8I A;  2HEU A;  3SEU A;  5AA4 B;  3AXF A;  4YMB A;  2Q88 A;  1FW0 A;  1I6B A;  4R2B A;  4F3S A;  2Y7P A;  4AB6 A;  4ZED A;  4LUB A;  1BLF A;  4NWC A;  3OEM A;  4OQO A;  3C4M A;  3LSL A;  3Q27 A;  3FAS A;  2NVU B;  3C35 A;  4MH5 A;  4IO6 A;  1FQB A;  3R7X A;  3S9M C;  4GWO A;  5BWJ A;  3OEK A;  4M4G A;  4BDL A;  3LSW A;  1AIV A;  3QSL A;  4JWX A;  3CSG A;  5AA3 A;  2DVZ A;  3CR9 A;  1YAE A;  3B6Q A;  3K2D A;  3QIM A;  3FJM A;  1RYX A;  3MW0 A;  1ZMG A;  3DP8 A;  4YKP A;  4GRK A;  4NF4 B;  1DPE A;  2I0B A;  2QS4 A;  3D4C A;  4QSD A;  2HQ0 A;  3MZB A;  1MQJ A;  2D5W A;  1FTM A;  1MDP 1;  2HAV A;  2XXV A;  3MVZ A;  3PD9 A;  1I6Q A;  2DE2 A;  4JBZ A;  3BBR A;  4KCD A;  2XXQ A;  1H76 A;  1RYO A;  3GLB A;  1IIT A;  2QSX A;  1MS7 A;  3G3J A;  3IB1 A;  3MVX A;  5I2K B;  1JW1 A;  4G68 A;  3SDF A;  2H99 A;  3RN8 A;  5I84 A;  1S50 A;  1ZBM A;  3M3L A;  3CVG A;  1PB7 A;  4WED A;  4RK9 A;  5H8N A;  3KJ7 A;  1R9L A;  1B5H A;  5DEX B;  3ZSF A;  5FHM A;  3CFX A;  4OFL A;  4JDF A;  5I58 A;  2PYY A;  4G8M A;  5FTH A;  3ECR A;  3CFL A;  4C1T A;  4DXU A;  4F1Y A;  3N6T A;  2DSF A;  2F78 A;  1POT A;  2ONK E;  2PBW A;  4LZ5 A;  2Z8E A;  4Q30 B;  3IOU A;  5TPA B;  3VE1 B;  3H6U A;  1SI0 A;  2AL4 A;  5AE4 A;  3C36 A;  3MP8 A;  2GRV A;  4OES A;  3G3K A;  3IAZ A;  4NTL A;  1JVX A;  3V5A A;  5I2N B;  4DXC A;  1B3G A;  4G4P A;  2Q8J A;  3VDF A;  1AOV A;  3T96 B;  4RPO A;  3TFL A;  1L5T A;  1T0K A;  3FV1 A;  1UTB B;  2UVG A;  3MWB A;  3MPL A;  1P1N A;  1Q35 A;  5JK4 A;  3O6H A;  1J1N A;  1IUD A;  2UXA A;  5A5X B;  4LQ2 A;  1JQF A;  2G93 A;  3G3I A;  3MPK A;  2QS3 A;  3M3K A;  3HO7 A;  3OOA A;  3PMX A;  1OIB A;  3E9X A;  2NOO A;  3A3C A;  3PPN A;  3B6T A;  4IO4 A;  4RNS A;  5CMC A;  5L8D A;  3ZKL A;  1EH3 A;  1Y4T A;  4H6D A;  1MY1 A;  1XT8 A;  3EN3 A;  2DWA A;  3ODB A;  3W9W A;  2X26 A;  1QUI A;  1FQD A;  4EQ9 A;  2IEE A;  1N7W A;  5M2V A;  2V3T A;  3O28 A;  3L6H A;  4WXJ A;  2V25 A;  1IQ7 A;  4ELP A;  3CRB A;  1M5B A;  2ZYO A;  5B70 A;  1MY4 A;  4GLI A;  4UA8 A;  5ICT A;  1A55 A;  4XKP A;  5CBS A;  4FEC A;  2ZXT A;  2Z22 A;  4OEN A;  2OWS A;  3MVW A;  2CZL A;  3K6U A;  3KSX A;  3SEW A;  3FJ7 A;  3TTM A;  4ESX A;  2RF1 A;  3IK6 B;  4FE8 A;  4G8H A;  3Q26 A;  1FCK A;  1RKM A;  4GXA A;  4YKJ A;  3V83 A;  1LBB A;  2I3V A;  1B2H A;  2DXR A;  2I4C A;  4YKI A;  4F3G A;  1SBP A;  2Q89 A;  5I2N A;  1B3E A;  2PX1 A;  2Y84 A;  3WAF A;  3KFM A;  4Q0C A;  3U92 A;  4IB2 A;  1LCT A;  2H98 A;  3N26 A;  3F11 A;  3FGS A;  1O64 A;  2ZNS A;  1JNF A;  4L17 A;  1H45 A;  5B7D A;  3VLV A;  3KJT A;  3BKI B;  2NWJ A;  3T93 B;  2FNC A;  2ANJ A;  4ECF A;  3OEN A;  5H8N B;  5I56 A;  3K1P A;  1A99 A;  2VD2 A;  1H43 A;  3A09 A;  3H6T A;  1MH3 A;  2HCA A;  3I5O A;  4R9G A;  3SES A;  2ESN A;  4PFW A;  3FZV A;  4LAT A;  2O84 X;  1B7Z A;  3O97 A;  5TU0 A;  3PUZ E;  5JTY A;  3ZKK A;  1EZO A;  2NXO A;  1EZ9 A;  1S7Y A;  2ZYK A;  3PD8 A;  5CMB A;  4ZE9 A;  2O69 A;  1MY0 A;  1Y1M A;  3CG1 A;  3O29 A;  4ONY A;  2R71 A;  1B9J A;  1JW5 A;  2HZK A;  1URD A;  3R6U A;  4R6H A;  1MXZ A;  3I6V A;  1MG1 A;  1MRP A;  4NF5 A;  4PFY A;  3W9V A;  5H8F A;  4R6K A;  2O51 A;  1Y9U A;  4LZ7 A;  4QFL A;  3I3V A;  4R74 A;  5I56 B;  1IEJ A;  5J1D A;  3S9L C;  4KYS A;  4OZ9 A;  3TQL A;  1VR5 A;  1B4Z A;  3OO9 A;  2F34 A;  4U2R A;  4DE8 A;  1FTO A;  2Y7I A;  4U4X A;  5DVI A;  2DXY A;  2PVU A;  1TFA A;  4HCY A;  5I58 B;  1LBC A;  4PE5 B;  2PT2 A;  3SEX A;  1NH8 A;  5BUU A;  1BTJ A;  4YB7 A;  4NF8 B;  1B7H A;  5KCJ A;  2P2A A;  3EPE A;  3PPR A;  1OLA A;  4RA1 A;  1FTK A;  4I8C A;  4F3B A;  3IX1 A;  1P1O A;  1TXF A;  1USY E;  3Q29 A;  4QSE A;  3UK4 A;  2V3Q A;  3IB0 A;  4I1D A;  1LAF E;  2RC8 A;  3V89 B;  3HST A;  4PFU A;  3TQW A;  4M1V A;  4MF3 A;  1MXX A;  4OYV A;  4YZZ A;  2GHB A;  1UTH B;  1GGG A;  1SW1 A;  3KN8 A;  4KYD A;  4JWY A;  4NWD A;  3OO6 A;  3EHU A;  1MXW A;  2DWJ A;  4MLV A;  5CC2 A;  3PU5 A;  3K01 A;  2DVC A;  4TOZ A;  3TMG A;  1R1N A;  2OLB A;  2F36 A;  1Z7N E;  3IL1 B;  4R9F A;  5K2X A;  3DEL B;  1FQC A;  1Y1Z A;  3HPI A;  4NMY A;  1MXU A;  5AA1 A;  5ICQ A;  4O3C A;  2F6G A;  1NNT A;  2DS9 A;  4U1Z A;  3PUV E;  3RNN A;  1OVB A;  2F7B A;  4EDP A;  4AQ4 A;  3N6U A;  4I62 A;  3TTK A;  1UIU A;  2A5T A;  4C1U A;  1Z7M E;  4ZZA A;  3GBB A;  4RXL A;  2XXH A;  3ILT B;  3O9P A;  4GL8 A;  2XXX A;  1ZU0 A;  2XXY A;  5A5X A;  1BIY A;  3PPO A;  4HTG A;  4OXV A;  1P1U A;  1VSO A;  2P0S A;  4KFQ A;  5L9M A;  3TTL A;  4NF6 B;  4IO7 A;  1MQH A;  1BP5 A;  2D3I A;  3K6W A;  4X48 A;  3SEY A;  3SEV A;  4PFT A;  2VHA A;  4IY6 A;  1HSL A;  1LFG A;  3W15 C;  2FA7 A;  4Z7E A;  1MXY A;  1VFE A;  1II5 A;  3N94 A;  3PGF A;  4LVQ A;  4X9T A;  3S9N C;  1M5E A;  5DVJ A;  3SKP A;  2O7I A;  1ZIU A;  1D9V A;  1DPP A;  1WVJ A;  4P0I A;  2R9J A;  3TCH A;  4F2O A;  1YTV A;  4ISU A;  3FUZ A;  1XS5 A;  2PMS A;  3KOT A;  4NE4 A;  3DM0 A;  5EHM A;  5F1Q A;  3VVD A;  4FAJ A;  3MAM A;  4GQO A;  5AA2 D;  1URG A;  5IKB A;  3A3U A;  3EHS A;  2QJE A;  3PPQ A;  5ITO A;  3C31 A;  3KOS A;  4HS7 A;  2H5Y A;  4N13 A;  5CM6 A;  3UA8 A;  4EQ7 A;  3O6G A;  4U22 A;  1PB8 A;  4K3F A;  4R2F A;  1B58 A;  4U23 A;  5K2Y A;  3TKD A;  1LAG E;  1QKA A;  1D3K A;  3PMV A;  4QFO A;  3T66 A;  3TEL A;  3U94 A;  4OFO A;  4PQJ A;  2REG A;  3FAT A;  1P99 A;  1PB9 A;  1UQW A;  3LSX A;  2HAU A;  4EXK A;  3KSJ A;  5DYH A;  3MZ9 A;  2A5S A;  4DIG A;  2VD3 A;  4BDO A;  2NUV A;  2DE4 A;  3QYT A;  2XXU A;  1NKX A;  2RIN A;  4BDQ A;  4ELQ A;  4ESW A;  5HPQ A;  5I2K A;  4DZ1 A;  3S9E A;  3T9X B;  4IO2 A;  1AMF A;  2I0C A;  1B32 A;  3IO6 A;  4QFP A;  1SQY A;  3H7M A;  4DDD A;  1EZP A;  2Z8D A;  3MUQ A;  4QHQ A;  1F9B A;  2F97 A;  4F3P A;  1MPD A;  3O66 A;  4H1X A;  1A54 A;  2GH9 A;  1QUL A;  2HFB A;  2Q2C A;  5CMM A;  4ELR A;  3KGC A;  4RPN A;  2M8C A;  4BDM A;  1US4 A;  3TCG A;  1PDA A;  5IAI A;  4WEP A;  1POY 1;  3PMW A;  3MVY A;  1B46 A;  2OCU A;  5DTB A;  2WKY A;  3HV1 A;  4NF4 A;  1B5I A;  1MPC A;  4RJZ A;  2D21 A;  1AL3 A;  4F22 A;  2XXI A;  2DWH A;  2H4I A;  1IXI A;  1NFT A;  4IY5 A;  3MZ1 A;  4LA9 A;  5ELV A;  3ONM A;  2XX7 A;  4F1V A;  3TEP A;  3IB2 A;  3IJO B;  1ANF A;  1IIW A;  1JEV A;  2F8D A;  2ONR A;  2RKM A;  3C34 A;  4LQ5 A;  1JET A;  4MFI A;  4N6P A;  4TLM B;  4XIG Q;  5HBC A;  1D4N A;  1DOT A;  4ZEB A;  1WOD A;  4Q8R A;  3G3G A;  5CRY A;  2AL5 A;  5LOM A;  3KBR A;  3HCQ A;  2X7P A;  3U93 A;  3K4U A;  2UYF A;  1NH7 A;  3IJX B;  3KN3 A;  4FED A;  1OQH A;  1USY H;  3H6V A;  5TPA A;  3KZG A;  3LUY A;  1M5D A;  2CMO A;  3RT6 B;  4E0W A;  1DTZ A;  3IOV A;  2E1S A;  4U1O A;  4H0W A;  1SDX A;  4YB5 A;  3TUS A;  3MBP A;  2OBG A;  4GOT A;  2DQV A;  2W7Y A;  4H65 A;  1MDQ A;  3VV5 A;  5AA2 B;  4KI0 E;  3OEL A;  3TTR A;  1SI1 A;  5KDT A;  2Y7R A;  1US5 A;  3O6I A;  1H3D A;  1MY2 A;  1P1W A;  3TOD A;  5FTI A;  3TPA A;  3VXB A;  5JTY B;  4EF1 A;  4F19 A;  4XTC Q;  4ZZE A;  1M5C A;  3LR1 A;  1TFD A;  1B3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...