4R78A

Crystal structure of lica in complex with amp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
287
structure length
287
Chain Sequence
b'GSHMEKIIKEKISSLLSQEEEVLSVEQLGGMTNQNYLAKTTNKQYIVKFFGKGTEKLINRQDEKYNLELLKDLGLDVKNYLFDIEAGIKVNEYIESAITLDSTSIKTKFDKIAPILQTIHTSAKELRGEFAPFEEIKKYESLIEEQIPYANYESVRNAVFSLEKRLADLGVDRKSCHIDLVPENFIESPQGRLYLIDWEYSSMNDPMWDLAALFLESEFTSQEEETFLSHYESDQTPVSHEKIAIYKILQDTIWSLWTVYKEEQGEDFGDYGVNRYQRAVKGLASYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of the choline kinase LicA from Streptococcus pneumoniae
pubmed doi rcsb
molecule keywords Choline kinase
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 103
structure length 287
sequence length 287
ec nomenclature ec 2.7.1.32: Choline kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01633 Choline_kinase Choline/ethanolamine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r78A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4r78A02
2HZIA 4K9YA 4EOSA 3IGOA 2A27A 2I0YA 4YBKA 4O0SA 1J1BA 5HLWA 4IX6A 4CFFA 1GZKA 4R1YA 4FTLA 3ZM9A 2VTIA 1IAHA 3N51A 3OEZA 4PTEA 4F1MA 1OBDA 4LRKA 4EQCA 3AC5A 1STCE 5DEYA 4IAKA 3A8XA 1GJOA 2PVRA 5C26A 3CGOA 2JLDA 2H96A 3OY3A 4FKIA 4GIIA 3CR0A 4AQCA 4DG2E 2ITOA 4RVKA 2JAVA 4EH7A 3MFRA 2VTTA 1RE8A 1UKIA 4X2FA 5IISA 1PKGA 2WKMA 2A0CX 2P2HA 4PNKA 2W1IA 3UG2A 4K0YA 3DY7A 5LWMA 5E8ZA 1MP8A 3QKMA 2G9XA 2OH4A 3GVUA 4V01A 2QURA 2JC6A 5IMEA 2OJIA 4ANLA 2WTKC 5EYDA 4C4JA 1OL2A 4N0SA 3PPKA 3KGAA 3MB7A 2C6KA 2OJJA 4ACDA 1APME 2BZHB 4X7QA 3VN9A 3ID6C 4AFJA 3W0RA 3NNVA 3V6SA 3BYSA 4RIYB 2C3JA 5E8TA 4F64A 4FX3A 5EM6A 3VF8A 4DTAA 3PVWA 3UOKA 5D1JA 4QP3A 3JVSA 1H24A 3FWQA 2UVZA 5DR2A 1RDQE 2IVUA 2VN9A 5HIEA 1KV1A 5I4NA 4EHVA 5IA3A 3BBTB 3KU2A 5JEBA 4YMJA 3KCKA 1O6YA 3U4WA 3DB6A 4D4RA 2R9SA 4OR5A 4PDSA 4U8ZA 2W1EA 3P9JA 3OCBA 3I5ZA 4IB0A 4WSYA 4G16A 3H30A 4FZ7A 4NT4A 3ZC5A 4DHFA 4U94A 1U4DA 1UNHA 2NP8A 4LL0A 3IPHA 4AAAA 3FZTA 5CVFA 3PE2A 3WBLA 3S1HA 2YJRA 3A7JA 4N6ZA 2BAJA 3PA3A 3PJ2A 4Y8DA 2O65A 3C1XA 4I5PA 4AF3A 2YM3A 4FZFB 5LARA 4GRBA 3ROYA 2PVMA 5HBHA 3R8VA 2CSNA 3BLRA 2PTKA 3AGMA 3EQPA 2OIDA 1FMOE 4D2SA 2UZBA 2VWWA 4YHJA 1H25A 3RPVA 3MFSA 4IZYA 4IH8A 3W10A 2R0UA 3QAME 3ZRKA 3DAJA 5E1EA 4A06A 3NGAA 4GK4A 2YAKA 4JLCA 2RGPA 1M52A 2XRUA 3NUNA 3N9XA 2W1ZA 3OP5A 2GNJA 3QD2B 1YKRA 2DS1A 1Z5MA 4QPAA 2XYNA 3K5UA 3QF9A 4D4VA 3BWFA 2VTOA 2Z60A 4NFNA 5L8KA 3QFVA 5KKRC 4ANQA 2A4LA 3UO6A 5HE2A 3R83A 5GJFA 3DPKA 4FSRA 3LKMA 5CT0A 3C4CA 1UNLA 3FSFA 3UIBA 2BHEA 1I09A 4N70A 4IWPA 5JFSA 5ANGA 3PLSA 4L44A 3ROCA 3WZDA 3NNXA 4ASDA 2PPQA 4GFOA 2C3IB 2WGJA 3F6XA 5EOBA 4I24A 4DAWA 3AMBA 1YWNA 4BC6A 5AX3A 2R3KA 2OJGA 2HWPA 3CPBA 3F3TA 3FY2A 4MTAA 4U42A 4XV3A 2VD5A 3ATSA 3NUAA 2X6EA 5CNNA 3GCUA 1KOAA 4TN6A 4QMNA 1WFCA 4GT4A 3TUBA 5A3XA 2F9GA 4HVGA 3PXQA 4I6QA 4QT1A 5HQ0A 2XJ2A 5M4CA 2WTDA 2BKZA 4DEBA 3W33A 4FT3A 4QMOA 5HE0A 2FSMX 2J5FA 2WEIA 4FUXA 4U5JA 3HRFA 1O6LA 4FIGA 3UVPA 4KBAA 3GOPA 5A46A 2GTNA 4IZ7A 2PZPA 5CASA 3OUNB 1PMEA 2VGPA 2WXVA 3MTLA 3P7BA 3SAYA 4CFUA 5ANJA 3NAXA 3O23A 4JT3A 3LM0A 4C2VA 4OTFA 1H28A 4QP2A 1TQIA 3WI6A 4CG8A 2HW7A 3GU8A 3OY1A 4K33A 4QMTA 2GHMA 5K5NA 2Z7SA 3ZEWA 5D9HA 1R1WA 2ZMCA 2PY3A 4O7VA 5EM8A 4S34A 3PFQA 4ZIMA 3E62A 3MDYA 3DKFA 5BNJA 3H3CA 4AW5A 4M13A 3F7WA 3HMOA 3SKCA 4UYNA 1BMKA 3B8QA 4FG7A 2BPMA 3GC0A 4F9CA 5HICA 1VZOA 3FQHA 4TYHA 3QC9A 3FV8A 2EWAA 2YJSA 2FO0A 5G6VA 3ZRMA 3BELA 3OCSA 3HDNA 2G2FA 3C4WA 4DG3E 3F5XA 4JBPA 4ZXTA 4FT0A 4HYIA 3UNZA 3I1AA 2ONLA 1LP4A 2AC5A 4FV2A 2XEZA 4O0YA 4RA5A 5DYJA 4R5SA 4AGUA 3DJ6A 5J9LA 2BCJA 5TT7A 1V1KA 4GYIA 4JVGA 5ETAA 3BYOA 2Z7LA 2W5HA 4F9AA 3RK7A 3QZIA 2XYUA 1U5QA 3D94A 3MW1A 2PYWA 4EQMA 3ZSHA 4AZTA 3R04A 2UW6A 3RPSA 4II5A 3TV7A 3RTPA 4G2FA 3E8CA 5GINE 1YRPA 2XIRA 2C3KA 2XMYA 2YWPA 4XS2A 3LIJA 3HEGA 3LMIA 5DRDA 5J95A 3ZDIA 4DE4A 5F20A 4ZZNA 4I0TA 1L8TA 4I4FA 4I21A 5DVRA 4FODA 5FQDC 4HGSA 3EYHA 4AN2A 4DFBA 5BVDA 3BYUA 4Z55A 4P2KA 2UZOA 4AT5A 4RFZA 1DAWA 1K3AA 5KKRB 1Y8GA 3DQXA 3WZEA 4AP7A 4F1OA 4ARKA 1JKLA 5CWZA 3R63A 3EZRA 3KXMA 3QCXA 5E9EA 3LXKA 2C47A 5H2UA 3TTIA 4BCNA 5HKMA 3TUDA 5DNRA 3ZUTA 4D5HA 4BDFA 5FEQA 4D2RA 3OXZA 2IWIA 3U6HA 2YHVA 4WG3A 3ZO1A 3C7QA 3E64A 4DEHA 4F6WA 3EQBA 3EH9A 3EKKA 3U8WA 3ZBFA 2EVAA 1PRYA 2CGUA 3R28A 2WTWA 3RCJA 2C5OA 4FE2A 4E4LA 1XH4A 5ITAA 3VUGA 5CEMA 3FKOA 2V7OA 1GOLA 1QPDA 3Q9XA 5BVKA 4FIFA 3BGQA 1ZY4A 4GYGA 5AA8A 3MPTA 3ERKA 3MFTA 1W82A 2BRGA 2XA4A 4JL9A 3ZU7A 4AGDA 2GS2A 3BI6A 4O0RA 4KRDA 2JBPA 2ONLC 2R3FA 4MXOA 5LMKA 3PXZA 3MJ2A 5BVEA 4FV6A 4FZDB 5CAUA 5IU2A 3BX5A 2F7EE 2PUUA 4FYNA 4DEGA 2R7IA 2X4FA 2JDOA 3SD0A 5GHVA 4LGHA 3ZUVA 4F6UA 2IPXA 5AUWA 4L45A 3DGKA 4YBJA 4FC0A 3QWJA 4HYUA 3AT3A 3SX9A 3MBLA 1YWRA 3U51A 4CTCA 4UWCA 5HEZA 4ITHA 3W18A 5EHOA 5J9ZA 3S00A 3FMDA 3KRWA 1G8AA 4L3JA 3PPJA 4FTKA 4GL9A 4L42A 4L8MA 5KMJA 5CYIA 4NTSA 5DBXA 3CY2A 4ERWA 3O71A 2OXDA 3QQFA 4YZ9A 3NSZA 3BQRA 4BZDA 5CEOA 4LV8A 3R7EA 4U7ZA 3AGLA 5HIDA 1OBGA 3KL8A 5CAOA 2IJMA 4FSZA 4L3LA 3DTWA 5AP5A 5EQPA 5E4HA 4A9UA 2GFCA 2OZOA 1YDRE 2YM5A 4YJSA 4J8MA 4D55A 2G15A 4MNEA 4PL5A 2FYSA 4RX5A 4GFGA 4OW8A 5ANIA 1XQZA 3FXXA 2WMTA 2GQGA 2BVAA 4JR3A 2Y4PA 3HP2A 5M55A 4C7TA 3CEKA 3CKWA 4O21A 1TVOA 3PRIA 4G3GA 4WZYA 3LCSA 4CCBA 3TKIA 4U3YA 4EQUA 3LLTA 4ZAUA 3TIYA 1MQ4A 4AA4A 2PUPA 1FGIA 4FNYA 5EI8A 2UW3A 5KMKA 1U46A 3ORTA 3Q6WA 2QOOA 4HVHA 4FV3A 2HK5A 4Z16A 3E92A 1H08A 5HESA 2R3QA 4QP8A 3NNUA 4Y5QA 4AA0A 3V5LA 4CVAA 4M68A 5D10A 3MYGA 5LMKC 3VVHA 4YNOA 5IA5A 4EK8A 3PSBA 4NW5A 4ITIA 2BHHA 4P5QA 3UOJA 4F7NA 3LM5A 3FMEA 2PWLA 3B2WA 4TY1A 2E9UA 3VO3A 1OIQA 2XIXA 3G0EA 4BDDA 3KQ7A 4IE9A 4IVCA 1NW1A 4NM7A 3QU0A 4HZRA 5FTOA 4YZNA 2Z8CA 5HG5A 2C30A 2WMQA 2UW5A 3IO7A 4QYGA 1HCLA 5KMIA 4NTTA 3TCPA 1R0PA 2GDOA 4FKRA 4C37A 1LR4A 3A99A 4C4EA 5LVOA 2H34A 3CQUA 3G33A 2AYPA 5EYMA 4EH3A 3N4TA 3VJOA 4H58A 4XX9A 4GK3A 3CSVA 3L8SA 2YM7A 3EN6A 4R7IA 2WTIA 4CLJA 5HLNA 2XNPA 3E5AA 3BU6A 3R1NA 4RLKA 4EUUA 4IB5A 2IW9A 4BGHA 4CCUA 3FI4A 3F7ZA 4FG8A 2W9FB 1OZ1A 3G2FA 3LFDA 4GW8A 4S30A 4EBVA 3UMXA 1JLUE 4ZP5A 3EHAA 2YFXA 3U54A 4BCOA 5IQEA 4NFMA 2BAKA 4KKGA 3V5WA 3ENHA 3TXOA 3ZH8A 4L7SA 4H1JA 3L8PA 1BYGA 2XBJA 3BGPA 2YAAA 2R3OA 3G9NA 5CI6A 1WVWA 1CDKA 1H27A 4FSMA 2B55A 4M14A 5K4JA 5A6OA 3ETAA 5CLPA 4CSVA 1VJYA 5M07A 2R3MA 2XK7A 3TV4A 2DYLA 5AP7A 2Q0BA 2JFLA 4WG5A 3KXZA 4IZ5A 4H05A 2VTNA 3JS2A 4HGTA 4QP4A 5IH4A 3C4FA 3QRUA 4MXCA 3COIA 4EK3A 5IQAA 4BDCA 2JKQA 3DFAA 3BEGA 2UZTA 5DT3A 4GU6A 3VRZA 3F5PA 4KINA 2IZSA 3L9PA 1HCKA 4O7SA 5CEIA 1PXLA 3COHA 4G3DA 4OTGA 4BDBA 3BU3A 4AWIA 4XHKB 1Q97A 4O7WA 3RALA 2OJFE 5K5XA 2YA9A 4E6DA 5CSVA 3AOXA 2ZDTA 3ZYAA 3KY2A 4AE9A 4EOQA 2ZMDA 3HRBA 2PVNA 4DINA 3FZ1A 5AP1A 5EW3A 5F9EA 3KXHA 5EM7A 3BRBA 4I92A 5HVYA 5HG7A 3E8EA 4X0MA 2C69A 4FNZA 4AT3A 3F5UA 3N4UA 5L2SA 2UW0A 4JBQA 4QYFA 2E9NA 1Q3WA 4FR4A 2YISA 5JGDA 4CFWA 5LWNA 1SZMA 5HHWA 4GKIA 4H3QA 2BIYA 4MAOA 5JT2A 2OWBA 4ZJIA 1BL6A 3C4EA 5E8XA 1W8CA 4E5BA 1WAKA 3RMFA 3NUXA 4CFVA 1YHVA 1YDSE 2XUUA 4ITJA 1Q8YA 3Q4UA 2W0JA 2YZLA 4V0GB 3H9OA 4H39A 5HG9A 3EN7A 4ZMFA 4PV0A 3H0YA 4XOYA 4B6LA 2R3IA 5EK7A 5E8WA 3GI3A 2VTAA 2PVHA 2CHLA 3UZTA 2ZYBA 4JAIA 2CNVA 5AP2A 3DOGA 1YVJA 1JSVA 3KB7A 5JH6A 2GHGA 2GNGA 5CALA 3FI2A 5BVFA 1MUOA 5FBOA 3SXFA 5JMSA 4UXLA 2F57A 2JITA 2PE0A 3W1FA 3BV2A 3BE2A 1XH7A 2FH9A 4BTJA 3WF9A 2RF9A 3EZVA 4MK0A 3FZOA 3R30A 1PXIA 3VBYA 2RKUA 4FKQA 4C36A 3K3IA 2O3PA 4XG4A 3V01A 4O7ZA 3OW3A 1E9HA 2YCQA 3CCNA 4G3EA 1VYZA 4FKWA 4E73A 4WT6A 3M2WA 5HE1A 3CXWA 3PVGA 5EYCA 2PVFA 3ZZWA 1UWHA 2BTRA 4D28A 4LUDA 5AUXA 4GFMA 4EOLA 4O7OA 2EU9A 1WBSA 3WF6A 3ZLSA 4ONAA 2B0QA 4WA9A 4D5KA 3HMNA 2WTCA 3DFCB 3PIYA 5I9WA 3F82A 4U79A 3QBNA 3LFSA 1CSNA 1H4LA 4AW1A 4JIAA 4FVRA 4BY9E 4WIHA 5I9VA 5EHYA 2XK4A 1Y6BA 3Q2JA 1NXKA 4TZRA 5GJGA 4JIKA 4APPA 2JD5A 3I6WA 2E2BA 4J71A 5E7RA 4KSQA 4ZSGA 1BI7A 4FIHA 2BRBA 5AUVA 5TR6A 3UGCA 3VC4A 5B2LA 4U6RA 5C8NA 3P08A 1BLXA 3OG7A 5F4NA 3LMHA 3UODA 4HJOA 4O2PA 4QYYA 3PRFA 2XNMA 4XEYA 3G9LX 3Q9YA 2QHMA 1JBPE 2C6OA 5CENA 3OHTA 4M3QA 3VW8A 1XBBA 4RX9A 3DBEA 2PMNX 4S32A 5D12A 5AP6A 4CEGA 4C34A 4M84A 4HNFA 3OEFX 4O22A 5T3QA 5CF6A 3OOGA 3POOA 2B54A 3R1SA 4R7HA 1JOWB 3CTJA 3RHXA 1JAMA 2J90A 4I22A 4LM5A 4R5YA 3IW5A 4YO4A 4J96A 4PTGA 3TN8A 1DI8A 4ZOGA 3FY0A 2R3GA 2PZ5A 3ZLWA 5CF8A 5J9YA 3M42A 4AG8A 4L53A 5M44A 3T9TA 2W1FA 4AOTA 4UY9A 4KKHA 5JK3A 3SDJA 3P78A 3B8RA 1ZOHA 4IDTA 4Q5HA 3JXWA 3F3VA 4ASZA 3QWKA 4HVSA 5IUGA 2QLUA 2IG7A 1PXJA 3AD4A 4PX6A 4RVLA 3R8ZA 4B7TA 4F63A 5C4LA 2JIUA 1U59A 2PZYA 2WU6A 3GFWA 4ZS0A 5I9YA 5KHXA 3FZRA 4FIIA 1WBNA 2XJ1A 3RPOA 3DZOA 5C4KA 5JFWA 2WMWA 3PE1A 3MH2A 4QP6A 5AJQA 3L1SA 4EOPA 3UNKA 2BIKB 3QUDA 4BTFA 3PJ1A 4ACHA 3NYNA 5FEDA 4JG8A 3W0PA 3E87A 3H9RA 5T6KA 3GCSA 3CIKA 3MPMA 3OZ6A 4DFXE 3R21A 3SQQA 1WBPA 5GIOE 1M17A 3AC4A 4O38A 4LUEA 2GQRA 2UW7A 4KS8A 4Z7GA 4Y46A 2BRMA 4BZOA 3D9VA 1UV5A 2W17A 3BZ3A 2GPHA 2UVYA 2KTYA 3TJDA 4Y85A 4FEQA 4YJRA 4YUQA 5AMNA 4LOQA 4QTAA 3AD5A 4NJ3A 4AZSA 4GCJA 2EB3A 4BHNA 4CV8A 4J99A 5IEYA 3O0GA 1XH6A 4RWIA 3UG1A 3UPXA 3UNJA 3FAAA 2HZNA 2QOBA 4RBLA 4QQTA 4TWPA 5CEKA 2WMSA 3KULA 3LQ5A 4K11A 4O82A 2WQNA 3I6UA 5KCVA 3W0NA 3R1YA 4R77A 4C4FA 1GIHA 5KO1A 3BU5A 4PDYA 2BMCA 4GIHA 4QMUA 3S3IA 3TNPC 5IEXA 4GSBA 3F9NA 5AAFA 5KMOA 3KREA 4XP3A 3LMGA 3LJ2A 4QMWA 1T45A 5BVWA 3QRKA 3FDNA 3GXLA 1W0XC 4XBUA 5HX8A 2QC6A 1H1WA 1MRVA 1YXXA 2BZKB 2YWVA 5FBNC 4BDHA 4FSTA 1H26A 4OTRA 4AZWA 4U3ZA 2OJ9A 5GIPE 4G5PA 4FSNA 3FMKA 2I0EA 1KE5A 5ANEA 4IWQA 5EW9A 3FEGA 1B39A 2VRXA 3RHKA 3NR9A 5E92A 4YC3A 5DI1A 2B52A 5J1WA 4NM0A 4E8AA 4LMUA 3PP1A 5HX6A 5JFXA 1ND4A 4ACMA 1XBCA 2FB8A 4HCUA 1KOBA 3QC4A 3EYGA 3AMAA 2PZIA 4U43A 4XNEA 3WARA 4DGOA 2XF0A 2QOLA 3DBQA 4HPTE 2F2CB 4GT3A 4KSPA 4FTJA 4J97A 2PVYA 5DEWA 5IF1A 3H0ZA 2C6LA 1A06A 1QCFA 1PXPA 1OIUA 2O8YA 3DK6A 4RVTA 5DR6A 4A4LA 4XOZA 2VZ6A 5JQ8A 1FMKA 4KB8A 1LUFA 4ZK5A 5C1QB 4DFNA 5CU6A 1UWJA 3LFCA 2XS0A 4XP0A 3GQIA 4MXZA 1Q8UA 2XNGA 4G17A 2X7GA 3TM0A 3R9RA 4RT7A 4C3RA 1Q41A 1SNUA 4GVAA 4G6NA 3OCGA 5AX9A 1BKXA 3MGYA 4G34A 4DBXA 4RIXB 2HWOA 3WOWA 5LCKA 3PIXA 4E20A 3HECA 4PMMA 2VTSA 1NA7A 1CTPE 2PMLX 5EI2A 4F7JA 3BV3A 4EHZA 4RIOA 2YDKA 4QMZA 5DT4A 3LFBA 4F09A 1Q4LA 2OF2A 3P0MA 4D1ZA 1OPJA 2GNIA 3FMMA 3WILA 1YDTE 3BBWA 1E1VA 2VTRA 3IW6A 4FSYA 4KD1A 4C59A 2ZVAA 3L8XA 3UBDA 4EZ5A 4LMNA 1UKHA 3VS3A 4YR8A 1MRUA 5J8IA 5JQ5A 5E1SA 1ZARA 3GB2A 3CPCA 5HIBA 2C5XA 3A61A 4G31A 4H3BA 5FXQA 3O7LD 5CU0A 4TW9A 3ZSIA 4PP7A 4N4SA 3D5WA 4I20A 1JVPP 1T46A 3NWWA 4KS7A 4CG9A 4YTCA 4BVUA 4MQ1A 3NUYA 4AZFA 3IG7A 1SMHA 3TI1A 3HZTA 1V0PA 3POZA 4NJDA 5DPVA 2W5AA 3KRLA 3VS4A 5A4CA 3HAMA 3D15A 3VHEA 3Q53A 3AC2A 4QP7A 3RI1A 3SW7A 2GS6A 2REIA 4PRJA 2BDWA 3MSSA 4XMOA 3D5XA 1CKIA 4NYEA 3LCKA 4X2NA 4FA2A 2OSCA 2IN6A 4FV4A 4TWOA 5AUZA 3NCZA 5A6NA 5F95A 4DFZE 3HNGA 3RWQA 5IDPA 2J6MA 3ANQA 4EK5A 3UVQA 2OICA 3HDMA 4GUBA 4IDVA 5CS6A 3HX4A 3RINA 2VO3A 5FDXA 4EJ7A 3O8UA 5FP5A 1WBVA 2ITQA 4O0WA 4PMPA 4IM3A 5C8KA 4LOOA 5DWRA 3T9IA 4J8NA 2VV9A 5D11A 3TDVA 4QYEA 3LFQA 4U98A 1SVHA 3WZJA 4NWMA 3F69A 2GHLA 5A4TA 1GZ8A 4C35A 3W0SA 4RX7A 2YIRA 4RMZA 4UX9A 2QVSE 2NRYA 4DH5A 3H9FA 5FG8A 4AGWA 3KRXA 4O84A 3VAPA 4IACA 4RFYA 4C4GA 2V55A 5LMAA 4CT1A 3DS6A 4RJ6A 2J0LA 1KE9A 1OUKA 3NUPA 4CMTA 4EJNA 5IQCA 2VAGA 3E93A 3RM6A 3TT0A 4G6OA 2OBJA 5E8UA 1XH9A 2YERA 3FQEA 5JSMA 5JKGA 5FXSA 2OIBA 3ANRA 2XNBA 2F4JA 4OLIA 3NIZA 4TRLA 5GNKA 4M15A 5IQFA 4XG2A 4BF2A 2QU5A 4WUNA 4G6LA 4L00A 2FUMA 2NNWB 3SA0A 2GCDA 3SHEA 5AP4A 4GEOA 5CF4A 3U6JA 2CKPA 2J5EA 2X2MA 4FEUA 5BQ0A 1M7QA 2PE2A 2XCHA 2GS7A 3FMNA 4BCJA 3TZ7A 5CSPA 1ZMVA 3K5VA 4IEBA 4DH1A 3LPBA 4YJOA 5HU3A 4FKOA 3VUIA 4NU1A 1WVYA 2HXLA 2WTKB 3SGCA 3UIMA 3MPAA 3VIDA 3KXNA 2CNUA 2O5KA 2Y6OA 5JGBA 4C4IA 3F2NA 2YM4A 1YXSA 1OVEA 3BHTA 4GT5A 1NY3A 4TPTA 5AM6A 3WIGA 2OGVA 1H07A 1J1CA 5L6WL 2WTVA 4AN9A 4BDAA 3A4PA 2YCSA 2PUIA 2VTQA 4USDA 4IAYA 3C50A 3C0IA 4I93A 4AACA 2P2IA 2WFYA 4MBJA 2X0GA 4XG6A 3W2CA 4OTWA 4O7YA 4KIOA 2R3JA 3ULIA 4FTQA 4TYJA 4YZMA 4EYMA 3GNIB 2VWYA 2XCKA 2BFYA 1ZWSA 3P1AA 3QD3A 4FKLA 5LQFA 2ZM3A 1OL1A 4JRNA 5AP0A 1P4OA 4O7PA 5BVOA 5AV4A 3RVGA 3SRVA 4O0VA 4DITA 3GENA 3PA4A 4XV1A 5CU4A 1J3HA 1LEZA 3GCPA 2J0KA 2ETRA 2I0VA 2JEDA 3CBLA 3ZSGA 1M2QA 4YC6A 4Q2AA 2FGIA 4P4CA 2QR8A 2J51A 3D5UA 5HD7A 3K3JA 1H00A 4L6QA 1JKSA 2WO6A 5AUYA 2C0IA 1WZYA 4ALWA 2X8DA 4YPDA 5EG3A 4DH8A 4I1ZA 1YXUA 4K8AA 4E5AX 3LXPA 1W98A 3P7AA 4I4EA 3OVVA 3R7UA 5EFQA 3MY1A 4AOJA 1RW8A 3PYYA 5LXMA 3EN4A 4EOMA 3GCQA 4FSWA 5HNIX 3V8TA 2X39A 4EK4A 3CQWA 2C6EA 3NIEA 3A7HA 1YOJA 4RWJA 3I7CA 2R5TA 4QQJA 4XV2A 4CFXA 5FUTA 3C51A 4FTTA 3VBTA 4ZY5A 2IZTA 4MX9A 1Q3DA 2XH5A 3DNEA 4OBPA 4YC8A 2CN5A 2ERZE 4TYEA 3R73A 4OT6A 3GU7A 4ZLOA 3ULZA 3GP0A 3I79A 4O0XA 4AX8A 2V62A 4I3ZA 4UZDA 3VBXA 3QUEA 4CKIA 5I9ZA 1ZY5A 4JQEA 3L9LA 2XM8A 4USFA 1H0VA 4DFYA 1DI9A 3F3WA 2FA2A 4W4WA 3RAIA 3QLGA 4RQVA 3RGFA 1DAYA 3PWYA 2H6DA 2WAJA 4QMXA 3AC1A 3VUKA 5AP3A 3BE9A 1ZOGA 2X81A 3W0OA 1YHSA 4DH3A 4RJ3A 4H36A 3P4KA 3OMVA 3PY0A 4CMOA 3KMUA 5M4FA 2ITZA 4BIBA 1EH4A 2QLQA 3EIDA 1YHWA 2Y6MA 3QQGA 3KF4A 5L8JA 2Y0AA 1R3CA 5HGIA 2XKDA 3RPYA 4GVJA 3C9WA 4C38A 4GJ2A 4EC8A 4O0UA 1Q61A 3IKAA 5HNBA 2CPKE 2WD1A 3DLZA 5DRBA 4F4PA 3BLHA 5LCJA 4IC7A 4TWCA 2Q0NA 4DEIA 3DLSA 2VO7A 4BDJA 3HYHA 2NRUA 4RVMA 5DT0A 2VTPA 4OTIA 3PXRA 2X8IA 4RJ4A 2WB8A 4IANA 2ETKA 5HCZA 4UWYA 2RL5A 3Q6UA 4WKQA 3SOCA 3UP7A 4CV9A 2VWBA 5AM7A 5BX0A 1JNKA 4PMTA 1PXNA 4QMYA 4QTEA 3KN5A 4NKSA 3O7LB 2IVSA 4UALA 4CXAA 2EXMA 2OK1A 2PMOX 1GZOA 2WZJA 3BEAA 3EFWA 2VWUA 3AMYA 4FUYA 4W8EA 5EQEA 3ZEPA 1GAGA 3NPCA 4AFEA 3LW0A 2ZV9A 4U0IA 3RZBA 3VS1A 4DEDA 5E8YA 2QG7A 4JDIA 3TKUA 4FSUA 4QMLA 4XLVA 4ASEA 5I9UA 3PY3A 3W2PA 2VTMA 3PPZA 3W16A 1FOTA 5KMMA 2VTHA 3NNWA 4QNAA 3DXQA 4G9CA 4A9YA 4Z7HA 3UVRA 2ITTA 4R1VA 2Y4IC 3L9NA 2IZRA 4OT5A 2P3GX 2XIYA 3FLSA 1SVEA 3ZUUA 4NIFB 3GCVA 3TJCA 2QG5A 3QRTA 2GTMA 2X1NA 2HZ4A 4H3PA 3R9OA 1L3RE 3HP5A 2JBOA 1YOLA 2XKCA 1M2PA 3FSKA 3PG3A 5A54A 4DA5A 2QOFA 3KF7A 2OW3A 4K1BA 2A2AA 4C4HA 3PY1A 2VNYA 5M53A 1FVVA 2UUEA 2C6MA 4EEVA 3QQLA 4EH4A 3NX8A 2VX1A 3FQSA 2NO3A 3ORIA 2NPQA 3QTWA 3R71A 1IRKA 1I44A 3FKLA 4IVAA 1A48A 4B8MA 4UN0C 5ANDA 1PXMA 2QU6A 2C5NA 4CFMA 1UVRA 2X2KA 3M11A 3RKBA 5EH0A 2R2PA 4YJNA 2C5YA 2PULA 2P33A 1AD5A 3EJ1A 3HKOA 4QP9A 4DGGA 3OXIA 3WIKA 2BDJA 3QCYA 4OBQA 2RFDA 2ITVA 3DAKA 2EXCX 2R64A 4LRJA 1RQQA 3OTVA 4ZTHA 3AXWA 3HMIA 4D9TA 5AWMA 5CAVA 2FSLX 2CKOA 3ZCLA 1AGWA 3L8VA 4TYHB 4ID7A 5JRSA 4MWHA 4BDIA 4FTUA 4LFIA 4X3FA 4G9RA 3ORXA 1JSTA 2O64A 1XJDA 2XK6A 4IAZA 2CLXA 4IFCA 4R78A 4GS6A 3PJCA 5CU3A 4ZJVA 4O7NA 4CZUA 4YP8A 5LMBA 4APCA 4L46A 3FLNC 4J7BA 2EB2A 2QKWB 4FEVA 1UU7A 3EFJA 4XV9A 3W8QA 1PMVA 3G15A 4IM0A 2ESMA 4QTCA 2PK9A 3GU4A 4NM3A 3ZFYA 4IVBA 2YACA 4M12A 1ZYCA 3C4XA 1CMKE 2ZV2A 2QONA 3D4QA 4ANBA 4BIEA 4USEA 2VGOA 1YI6A 4WG4A 1NT2A 1IR3A 2IVVA 3F2RA 1LPUA 2HZ0A 1WBWA 4WUAA 3O8PA 3SC1A 4ZTNA 3D7ZA 2YABA 3ORNA 2C6TA 2WQOA 4YJPA 3FI8A 3ITZA 4I23A 4CTBA 3DKCA 4HPUE 3PJ8A 3QALE 4RJ5A 2F7XE 4BBEA 4IIRA 4RGJA 5CANA 4JDHA 3NYOA 3TKHA 3I5NA 3ZM4A 5DGZA 5FLFA 3VBVA 2YIWA 4YURA 2W99B 3PDTA 4TTHB 3OC1A 5KNJA 4EH5A 4BBFA 1ZRZA 2ITNA 3NDMA 3VQUA 4XG3A 2GNHA 2XM9A 5GJDA 1QPJA 1ZYDA 3GEQA 4E1ZA 4QTBA 4I5HA 3V5TA 4MYGA 3SOAA 2HAKA 3WF7A 4JX7A 4DBNA 4FL3A 1H0WA 3V8WA 3F3UA 4J53A 1LEWA 5M4IA 3NYVA 2GNFA 4KABA 4X3FC 5IUIA 3EQCA 1UU9A 3PWDA 3FLWA 3IW8A 4BICA 2ZOQA 4BI0A 4YLLA 5BUJA 4O2ZA 2QHNA 5CVGA 4R3PA 2YIXA 1OMWA 4OTQA 5HCYA 4FTCA 3R00A 2HOGA 3ODZX 3P7CA 3PSDA 5C03A 4BIDA 4FK3A 4X6QC 5FDPA 1OM1A 2VO0A 4M97A 1H8FA 5CT7A 3DBFA 5BVNA 3MVMA 5F94A 3QTSA 2YITA 3LE6A 3U6IA 2C5VA 3AC8A 4UYAA 4DCEA 3FLQA 5C27A 3ZONA 2BZIB 3QXPA 3RPRA 5IPJA 4PF4A 4FSQA 4IMYA 4D9UA 2XNOA 1ZXEA 4O27B 1H1RA 4AUAA 3HGKA 1KWPA 2VWIA 3E7OA 2WOUA 2JDSA 3OBGA 1F0QA 3MB6A 2OH0E 4YNEA 2FSOX 3EOCA 1P5EA 4XBRA 5AV3A 5HTBA 5HZNA 5KMNA 4FKPA 3RAHA 4YHTA 4O83A 3TYKA 4YHFA 4FKTA 3BHUA 4EH9A 3UQFA 2HELA 1GY3A 4NZWB 3VS6A 3QTXA 4C61A 1SYKA 4MNEB 4FTRA 3ZC6A 3KRJA 2HYYA 3PZHA 2UW8A 2Y7JA 4L9IA 4YO6A 3UQCA 2YM6A 3CTQA 4DFLA 4WRGA 4ORKA 4U44A 1U54A 5DFPA 4ZMEA 3LCOA 2GNLA 5HLPA 4BCPA 3LFAA 3DK3A 1XKKA 4LV5A 1J7IA 3S4QA 1BL7A 4CFNA 3S0OA 4ZTQA 3PUPA 4HOKA 3CTHA 3Q4TA 4XRLA 3VS7A 5HG8A 4RIYA 1ZYJA 2V7AA 4W4VA 3ACKA 4PQNA 3II5A 3LJ1A 4KWPA 2V5QA 2C0OA 1KUTA 4MVFA 3OROA 4XLIA 2CDZA 3TG1A 3Q2MA 4C33A 1A9UA 5LJJA 2BTSA 3WF5A 2G2HA 3JPVA 4CQEA 5HCXA 3V51A 1QL6A 2JGZA 2J0MB 4PP9A 3C4ZA 3FC1X 5HD4A 3FXWA 4K2RA 3Q9ZA 1TQPA 2ITYA 4S31A 4W4YA 4QOXA 3OWLA 2W96B 4AW2A 5B7VA 5IA1A 3RAWA 1JQHA 2X8EA 3DT1A 2P0CA 3G5DA 3G51A 3UMWA 5T68A 5J1VA 4E4MA 2VWXA 4NW6A 5KE0A 4CKJA 5F1ZA 3QHWA 3BHVA 1IASA 5JZJA 1ZZ2A 2C6IA 2OXYA 3E3PA 2W06A 5BYZA 4B0GA 3DXNA 4L3PA 4BCFA 1ZOEA 4IZAA 3DTCA 3EL8A 3V8SA 3ZHPC 1ZAOA 2ZV8A 3LCTA 5AV2A 3KFAA 4BCIA 3LXLA 3LXNA 1YW2A 4ZTMA 3GUBA 3SXSA 2QD9A 2QQ7A 2A19B 3D2KA 4I5CA 3UZRA 3P23A 2WOTA 4MNFA 4QP1A 1RJBA 4Y5HA 3ZO2A 3W2RA 3ZTXA 4XYFA 3TTJA 2ITUA 4FYOA 4YZCA 4X3FB 4DGNA 2Z7RA 4AE6A 2CNQA 4BDGA 4CZTA 5IZFA 5G1XA 2I0HA 4CRLA 4F1TA 4X2JA 3R1QA 5I0BA 3NS9A 2J2IB 3QZFA 1PF8A 3I0QA 5EHLA 4IBMA 4FV9A 2XVDA 4I6BA 4LYNA 3CD3A 2ZAZA 1ZMWA 3FL4A 3QGYA 5H3QA 4FEWA 3FPQA 1P4FA 5IA0A 1ZLTA 3QX2A 4FIJA 4FOBA 1OKYA 3HV6A 4D4YA 3BKBA 3QYZA 2DQ7X 4FGBA 4WOVA 5CAQA 3BCEA 4PY1A 4C62A 5JFVA 1OPKA 2R3PA 4FL2A 3CS9A 4MXAA 4NM5A 3PZEA 4XCUA 3D7TA 1J7LA 2ETMA 3G6HA 3EFLA 4MD9E 4EZ7A 5JGAA 4BGGA 3V5PA 1FBNA 1IA8A 4QQCA 4QYHA 4YTFA 1G8SA 4ZTSA 3IDPA 2Q83A 3R7OA 4JX3A 4DEAA 3OT3A 5JZNA 4O81A 5J5SA 2KULA 4B99A 3Q5IA 1B38A 4U45A 4JRVA 4ALVA 4B4LA 5H8BA 4W8DA 3TACA 4BBMA 2CN8A 3DZQA 1OGUA 5AIKA 3IDBA 5ETIA 2VWVA 5M09A 4UEUA 5KZIA 3UIXA 4BCMA 4CLIA 3UJGA 1YQJA 3VUMA 4IAIA 5M06A 3E8DA 3MTFA 4JDJA 2QODA 5IQHA 2C6DA 1Q8ZA 4G5JA 2UZWE 1WMKA 4G1WA 3RAKA 3EQHA 3JY0A 3EWHA 4JDKA 3R8LA 2BZJA 1H1QA 3HA6A 3O50A 4JI9A 4LOPA 2BAQA 3MY5A 3CY3A 3P5KA 1HOWA 4FTOA 5M51A 1KE8A 5DA3A 3FYKX 3QTUA 3QTRA 3TIZA 4ZSJA 4F7LA 1PYXA 2Z7QA 4IJ9A 5HBEA 3R9NA 4JQ8A 3A7FA 4JXFA 5CVHA 4QMVA 1O9UA 4V04A 4AS0A 4BCGA 3ELJA 2WMUA 4O7RA 1OUYA 4FV7A 2UVXA 5EKNA 3DXPA 3NMUF 2JDRA 4ANMA 4EHGA 4F0GA 4PWNA 3O2MA 1XH8A 2QOHA 4IX5A 2OF4A 3Q32A 4IM2A 4M0YA 4Y95A 4ACCA 4ZZOA 2WQEA 5CEPA 4UB7A 3BPRA 4KUJA 1J91A 3QHRA 5L2TA 3R8PA 3OTUA 5IMXA 3ALNA 4J1RA 2X9FA 3UC4A 1FGKA 2J0JA 4Q9ZA 3GBZA 2CCIA 2JIIA 2WMVA 2I1MA 4A9SA 4NK9A 1JKTA 2UW9A 4V05A 2GSFA 3DDQA 3WYXA 1PMNA 3CJGA 4LRMA 3FBVA 1OPLA 4FOCA 3E8NA 3W0MA 2XNEA 3HLLA 3IW7A 5BMSA 1VYWA 4YU2A 2IO6A 2PVLA 2ZB1A 3HVCA 4FT5A 2B9IA 5DG5A 5DR9A 3RK5A 4BGQA 2CGWA 3OUKA 1YI4A 3KKVA 2E9VA 3Q4ZA 4GUEA 3ZRLA 4EL9A 5B0XA 3OFMA 5IQIA 4FT9A 5CSHA 5AAEA 2B9JA 2C4GA 5DHJA 3RNIA 2CGXA 3MA6A 5CXHA 3KEXA 4NKAA 2QO7A 2UV2A 2I7QA 3H10A 4HW7A 4IX4A 4QNYA 2HIWA 2RFSA 4LQMA 2X4ZA 5I9XA 1U54B 2ZM4A 3DKOA 3CD8A 4ZTLA 5IEVA 2DWBA 4TNDA 2XB7A 4Q9SA 2RG6A 4FTMA 5A4EA 2R3RA 3NYXA 3L9MA 2W1HA 3SW4A 4FTNA 3WE8A 3ORMA 2VWZA 4BN1A 3UOHA 3F3ZA 2JIVA 3DBCA 4BKJA 1BUHA 4FV1A 4QTDA 5EM5A 2G1TA 4I41A 3QA0A 3QGWA 4NUSA 2X6DA 5DOSA 4EH8A 4U40A 2Z2WA 4OGRA 1OECA 1YXTA 2R3NA 4F08A 4EI4A 3MFUA 5BUIA 3UO5A 1Y91A 2HENA 4YJUA 3MA3A 5L6OA 1H1SA 1CKPA 3GU6A 2B1PA 4ZSEA 1Z57A 1UU3A 3VUHA 4MH7A 1NVRA 3FHRA 4BCQA 5KMLA 3PVBA 2IZUA 3BWJA 3FZPA 4K77A 4RFMA 5CI7A 5CQWA 3O96A 3ZFMA 3PXYA 3R8UA 3MVHA 4QMPA 2W4KA 3V04A 1BX6A 3VRYA 3FE3A 1Z9XA 2XIKA 2XK9A 4MWIA 4QQ5A 3UDBA 3VQHA 3O51A 3OT8A 4JAJA 2PSQA 4GK2A 4TXCA 4FV8A 4WNMA 5FRIA 3KRRA 2YEXA 3PJ3A 3DDPA 5KBQA 3DKGA 3RWPA 2IVTA 4L43A 3HV4A 4FVPA 4ZEGA 1FPUA 3RJCA 4BR3A 1E1XA 4FNXA 3Q3BA 5DLSA 4S2ZA 5KX8A 3CP9A 3MN3A 3COMA 3MH3A 2UZEA 4L01A 3ZZEA 3QXOA 3NUUA 2XKFA 2WQMA 2BDFA 2Y9QA 3TV6A 1M14A 4RX8A 2LAVA 3VF9A 4J52A 2PHKA 4AN3A 1BI8A 1JPAA 4ZLZA 3BIZA 5DE2A 2VTJA 3VUDA 4RC2A 4BCHA 3IOPA 2R7BA 3G90X 4IWOA 4MF1A 4R6VA 2YDJA 3MS9A 3UQGA 3ZBXA 3O8TA 3C5UA 2BKKA 3BGZA 2OFUA 2WIPA 4LGGA 3GC9A 5C8MA 5D7VA 4GKHA 4RC3A 4FKGA 4RRVA 4BTMA 4NCTA 3BQCA 3E3BX 1PMUA 4HYHA 4GJ3A 1F3MC 4Y72A 4DGLC 2BILB 3D7TB 4AA5A 4DT8A 3F66A 5HVKA 2RFNA 4PNIA 2VU3A 3D83A 3S95A 3WZKA 5J87A 5IA2A 2R3LA 4ZSLA 2VNWA 4DF3A 4FTAA 3O17A 4YTHA 4R3RA 4FIEA 4JNWA 5AUTA 5DH3A 3FLYA 3MJ1A 5K4IA 3KULB 4YSJA 5CX9A 5TF9A 2W4JA 4F6SA 3HMPA 5FTGA 2WEVA 3HV3A 5IA4A 3FZSA 5CTPA 2HY0A 4UV0A 3Q5ZA 4AGCA 4BI1A 5AIRA 3RM7A 4C3FA 5LVLA 1XH5A 2YCFA 1SM2A 1WVXA 2PUNA 3HMMA 4PMSA 2QR7A 4XJ0A 1U5RA 1Q8WA 4WBBB 3VJNA 4HGLA 2YIYA 1O6KA 3V5QA 1P14A 2QKRA 3PSCA 4YLKA 2R4BA 3IK3A 3TDWA 2B9FA 4YPSA 1R0EA 5BYLA 1PXOA 3WE4A 5HU9A 2W1DA 3CKXA 2WIHA 3V6RA 2JAMA 3IW4A 4QMMA 3VS5A 5EKOA 4O6EA 1PKDA 3VNTA 4KBKA 5HBJA 3OD6X 4TYIA 3DK7A 2XJ0A 3CLYA 4FICA 4FZAB 1W83A 2WMAA 5EYKA 3SG8A 3QX4A 2PMIA 4R3CA 2B9HA 3LHJA 3EQFA 5E90A 3PIZA 1VR2A 2R3HA 1NVSA 5BYYA 5A4QA 4F0IA 4IC8A 4ZY4A 4N57A 4FT7A 4E6AA 2W5BA 3KMMA 2W4OA 4E7WA 5LVPA 5EQYA 3FMHA 2FSTX 2CMWA 4EOJA 5KZ0A 3FLZA 4JR7A 3LQ3A 3SVVA 4X2KA 3BLQA 3DJ5A 4FBXA 2VX0A 5ETFA 1GZNA 2QO2A 4NCTC 4TT7A 4DTBA 3ORKA 4O0TA 4FVQA 4P7EA 3R7IA 4DTKA 4JOAA 1G3NA 4DFUA 3C0GA 3TNQB 4DT9A 4HNIA 3F2AA 2PZRA 3KCFA 4IB3A 4RZWA 1P2AA 2BRNA 2PVKA 5ACKA 3RK9A 4C58A 2WELA 5CAPA 2AC3A 1AQ1A 4X3JA 2O2UA 3Q60A 4U9AA 4KA3A 4BRXA 2G01A 2Z02A 4I6HA 4TNBA 4WNKA 4FV0A 4CMUA 4IAFA 3QQUA 1GIIA 2UZDA 3ET7A 5HI2A 3UPZA 3EQDA 5CNOA 1OIYA 3FI3A 4EUTA 2ZM1A 3QA8A 4EHEA 3A7GA 5IUHA 2XP2A 1Q24A 3JVRA 4YTIA 3AC3A 3D5VA 4CGAA 3R02A 4KIQA 4S33A 4ENYA 3UIUA 4FL1A 3C5IA 3R9HA 3SXRA 5HE3A 2RIOA 2W05A 1PYEA 3QL8A 4JS8A 1GIJA 3DV3A 3HUCA 3LJ0A 2O63A 2ITPA 1QPEA 3GGFA 4MXXA 5FP6A 5HTCA 1F5QA 2WHBA 3I0OA 4I94A 1PW2A 2CKQA 4L68A 3FMJA 3ALOA 3D14A 4PDOA 2P4IA 2JKKA 3NVKI 4E6CA 1UU8A 3IGGA 5M56A 5J7HA 3KVWA 4JQ7A 3RP9A 2QOIA 4JG6A 4ZY6A 3PVUA 3ORZA 3I60A 4YSMA 4EONA 2OKRA 1JWHA 1OKVA 4DH7A 2WMRA 3THBA 4CD0A 4CRSA 5LVMA 3LFNA 3VW6A 4EOIA 4KBCA 4Y73A 3SLSA 4EYJA 1M2RA 4XRJA 3R22A 3ZO3A 4TL0A 4V0GA 3P79A 3IOKA 3ODYX 4C02A 1K9AA 1IA9A 4EORA 3KK9A 1Q5KA 4JBOA 4D1XA 4OBOA 5E91A 3ACJA 3JR1A 4BCKA 2VO6A 1REKA 4X6RA 4PL4A 3QQJA 3TNHA 2WMBA 1IAJA 3GU5A 4RWKA 3P86A 1XO2B 5DN3A 1W84A 3OCTA 3PTGA 3MV5A 3R7VA 3EN5A 5FXRA 1WCCA 2W1CA 5K3YA 3V3VA 4C2WA 3LCDA 4IAAA 3UTOA 4BI2A 4EKLA 3LZBA 4HYSA 1SVGA 2PU8A 3I81A 4NSTA 3VS2A 1M7NA 3GQLA 4BDEA 1OI9A 4QMSA 3QKKA 3OS3A 3GC7A 4QO9A 4IWDA 4UZHA 4FKJA 4MCVA 2F2UA 4XUFA 5CEQA 4E6QA 4EK6A 2QCSA 4EZ3A 2C1AA 5AADA 4IQ6A 2C0TA 3MWUA 1W7HA 2QNJA 2XEYA 3E88A 3FPMA 3ZDUA 4CNHA 2JFMA 4K18A 4OUCA 1G5SA 4A7CA 4AZVA 1IG1A 4M0ZA 3Q4CA 3LVPA 4LL5A 4AZEA 5AFVA 1J7UA 2GU8A 4FKSA 4XG9A 5EDRA 3HUBA 3UYSA 4F65A 1JSUA 3F61A 1OKZA 2Y8OA 3DNDA 1K2PA 3DBDA 4I5MA 3TZ9A 4DG0E 5AAGA 3KN6A 3QQHA 4YLJA 2WNTA 4YJVA 3Q9WA 5L2IA 2FVDA 4OTDA 2VTLA 4ERKA 3GT8A 1Y6AA 3T3VA 1VEBA 2OLCA 4EWQA 3W2SA 3LAUA 5TO8A 2YZAA 1R78A 4MBLA 5ETCA 4UXQA 4IVDA 1Q99A 5IQBA 1YXVA 4FNWA 4O91A 1TQMA 3TZMA 3W32A 4WNOA 4FKVA 4BB4A 2H8HA 2CKEA 4WRSA 1KE7A 4EH6A 5HORA 5M4UA 4IW0A 4EBWA 4M67A 4PTCA 2JDVA 2HCKA 3QD4A 5K9IA 4ASXA 3MIAA 2WPAA 3ATTA 1Y8YA 2BFXA 3PG1A 4IFGA 4GMYA 3CGFA 5D41A 3U9CA 3F5GA 2B53A 5EDQA 4RSSA 4AOIA 4GG7A 2PE1A 3QTQA 4DEEA 2P55A 4M8TA 1MQBA 3SRVB 2ITWA 4P5ZA 1TKIA 5JRQA 3PP0A 1FVTA 3OF0A 3NCGA 4FV5A 4JBVA 3HAVA 3T3UA 4BZNA 4D0XA 3ZLXA 3NLBA 4L7FA 3MI9A 1Y57A 4RA4A 5ANKA 1YI3A 3AT2A 4WBOA 2QI8A 2GFSA 1CM8A 4XH6A 2UZNA 3TWJA 5BMMA 2OG8A 3DA6A 4N6YA 4WD5A 5LOHA 2OFVA 4G3FA 2XIZA 3TZ8A 5HO7A 3W55A 4O86A 5L8LA 3PA5A 4BHZA 2IW6A 3Q52A 4NH1A 5E8SA 1Q8TA 5TKDA 4QMQA 4FEXA 3I7BA 2XKEA 2YDIA 4MHAA 3IS5A 4FGRA 5L2WA 2B7AA 4MD7E 4HVDA 3QQKA 3AQVA 2OZAA 4AW0A 3BYVA 1R39A 4KIPA 2F49A 3FYJX 5IQDA 3ZO4A 2ZDUA 3Q96A 1PXKA 4U41A 4WNPA 4WHZA 2I40A 2V22A 1OKWA 5FGKA 3RCDA 3OW4A 1X8BA 2C68A 1KV2A 3MVLA 2UW4A 4NL0A 4O7LA 2RFEA 3QKLA 4X21A 4HCVA 3UOLA 3JY9A 3QTIA 4PDPA 5AEPA 2F7ZE 1GNGA 2C3LA 2ZV7A 4IX3A 4O96A 4D1SA 3WF8A 4MQ2A 4JJRA 1XR1A 4R7BA 4A07A 4DLJA 3LLAA 2O0UA 4U81A 3D2IA 5AV1A 4RZVA 4ACGA 3MY0A 4O6LA 5HVJA 2WQBA 2Y4IB 3NEWA 5CSXA 3VHKA 5CF5A 3CQEA 4ZSAA 4OTHA 3R7YA 3R8MA 5CU2A 4FG9A 3DCVA 2OO8X 3H4JA 2YCRA 1H01A 4P90A 4X2GA 4IHPA 3JUHA 3R01A 3R2YA 2QO9A 3TEIA 3QZGA 3C13A 1S9JA 4O7TA 4BYJA 4D4SA 3MVJA 3R0TA 4UBAA 3U87A 3A4OX 3W2QA 5IG1A 4MXYA 3OWKA 4K6ZA 1DS5A 4JG7A 3VS0A 1FQ1B 3A7IA 4MEDA 3EN9A 2J7TA 4KKEA 3GOKA 5KBRA 2UZLA 3QLFA 5L6PA 3FUPA 2OXXA 5CQUA 3NW6A 3U9NA 4RIWA 3DJ7A 3ZOSA 4G3CA 3R9DA 3JYAA 4ZZMA 3KXGA 1QMZA 5H9BA 2BROA 3IONA 1V0OA 3D0EA 2HXQA 3NZ0A 1IEPA 3IQ7A 2R0IA 2G2IA 2VX3A 3UO4A 4J95A 2GMXA 4LG4A 5L3AA 1WBTA 2SRCA 1JKKA 1ZYSA 3UC3A 3B2TA 4M69B 3AD6A 3QCQA 1YWVA 1V0BA 5H8EA 3ZXZA 2ZB0A 5FM2A 4I6FA 4YZBA 2XBAA 5EOLA 5CXZA 3VBQA 5HNGA 2BALA 2B4SB 4EWHA 1WBOA 5H8GA 4XP2A 3KVXA 3S2PA 4ALUA 4EKKA 3HV7A 4MBIA 4DLIA 3A60A 5CSWA 5AA9A 4FZ6A 4L52A 3G6GA 3C0HA 3ORLA 4F9WA 3NW7A 1URWA 3OBJA 4M7IA 5IDNA 3U4UA 3WZUA 4DGMA 1QPCA 4RLLA 2BUJA 2ITXA 3NW5A 4D0WA 2V0DA 3HV5A 4RIXA 5EDPA 1OB3A 4FK6A 2E9PA 3FHIA 4RJ8A 4Z3VA 3IDCA 3CC6A 5A4LA 2GQSA 3EL7A 3TL8A 4E93A 3VWAA 4WO5A 3DB8A 2EUFB 4HZSA 2JKOA 3NRMA 3NUSA 3TNWA 3W0QA 2UZUE 3PXFA 3ENMA 4GH2A 2QOKA 4HVIA 5E8VA 4AT4A 5JN2A 3IECA 3E7VA 1PHKA 3DAEA 5B2MA 5BPYA 1SNXA 4RPVA 3AT4A 1KSWA 3KC3A 3MESA 3U55A 4EC9A 2VUWA 4AXAA 4KAOA 4RJ7A 4EOKA 2C1BA 4BDKA 1PY5A 3K54A 1ERKA 5A14A 5EW8A 4E26A 2XRWA 2BR1A 1XWSA 3KA0A 1CKJA 5B2KA 4W4XA 4A4XA 5BUEA 5ICPA 1KE6A 2BRHA 4Y83A 4YZDA 2A1AB 4F0FA 1DM2A 4ENXA 3T8OA 3PXKA 4A4OA 4RG0A 1XHAA 3OWPA 3QRJA 3A62A 3BHYA 3EFKA 3BHHA 3UE4A 5KHWA 3KXXA 2H9VA 2ZJWA 3W8LA 2J4ZA 3F88A 3QTZA 5CY3A 3EB0A 5FTQA 4IJPA 3ZS5A 3FKNA 5I5ZA 2PL0A 3EQRA 5IH5A 4DN5A 4FI1A 3VULA 3E63A 4ZJJA 4J98A 5LVNA 1ZMUA 2E9OA 4KNBA 3MIYA 2OI4X 2QOCA 3HL7A 2XNNA 4IADA 3A8WA 2XZSA 4EH2A 2I6LA 2X9EA 4QRCA 1B6CB 3EKNA 4PUZA 2W1GA 5M57A 4BTKA 5IH6A 4GV1A 3NAYA 4B9DA 3VBWA 4CKRA 2JDTA 2RG5A 4E5WA 1OITA 4L67A 3COKA 4RWLA 3LFFA 4Z9LA 5HO8A 4MD8E 1ATPE 4HGEA 5TOZA 3PLAE 3UP2A 4E4NA 2PVJA 3QRIA 3UYTA 3FMLA 1MRYA 2CGVA 4U80A 3ZLYA 5C9CA 2XK3A 5AV0A 4EOOA 4F9BA 3UZPA 2HW6A 4E4XA 4TYGA 3LQ8A 2ERKA 3A2CA 2J50A 4TWNA 4AU8A 5CZIA 4DC2A 3EMGA 3EQGA 4I0SA 4B8LA 3ZMMA 3N4VA 3WYYA 1REJA 3QYWA 4YGAA 4A9RA 1OIRA 3AG9A 3TNIA 4DCAA 4CT2A 1YOMA 1H1PA 3OWJA 2OZAB 4ANSA 3SG9A 4F9YA 5AUUA 3GC8A 1NVQA 2CLQA 4I0RA 3ORPA 4F7SA 3MH1A 1ZZLA 3R2BA 4YJQA 3QZHA 2QOQA 2IW8A 3SV0A 3HRCA 3G0FA 4Q5EA 4ZLYA 3V5JA 2WMXA 4UWBA 5ACBC 4ZTRA 4A9TA 3QUPA 4PL3A 5D7AA 1UNGA 4YJTA 2ACXA 2X7FA 3FL5A 4C3PA 3QD0A 5M08A 4IB1A 5IQGA 2OU7A 3EQIA 5C01A 3MH0A 2W7XA 5FM3A 4F99A 4RC4A 3FXZA 2YM8A 3OXTA 4F70A 3DQWA 1UA2A 3W2OA 1XBAA 5DIAA 4RQKA 1OL6A 4TKSA 4H1MA 3REPA 3QCSA 4FTIA 4HCTA 4C0TA 5A9UA 3ZFXA 1URCA 2LGCA 1Q62A 2YIQA 3KK8A 4FMQA 3LFEA 3TUCA 3CE3A 4FKUA 3I4BA 2CJMA 5FEEA 4MKCA 4QPSA 4ZS4A 3CJFA 2X2LA 3NVMB 3ZXTA 4D58A 2JKMA 2W9ZB 2OIQA 4U97A 5ANOA 5KUPA 2XK8A 3HA8A 4LI5A 5EI6A 4GG5A 3KMWA 2X7OA 3R6XA 3BYMA 2DUVA 5CZHA 5FD2A 2WTJA 3GFEA 3M1SA 2WU7A 2J0IA 1S9IA 4XG7A 3Q04A 1PJKA 1OL7A 3FC2A 4RIWB 3DU8A 3FJQE 2HY81 3LOKA 2UZVA 4KRCA 1OL5A 4GU9A 3OOMA 3K2LA 4DYMA 2J9MA 4BYIA 1FINA 1FVRA 2YN8A 2CCHA 4XG8A 2AUHA
chains in the Genus database with same CATH superfamily
2HZIA 4K9YA 4EOSA 3IGOA 2A27A 2I0YA 4YBKA 4O0SA 1J1BA 5HLWA 4IX6A 4CFFA 1GZKA 4R1YA 4FTLA 3ZM9A 4AAYA 2VTIA 1IAHA 3N51A 3OEZA 4PTEA 4F1MA 1OBDA 4LRKA 4EQCA 3AC5A 1STCE 5DEYA 4IAKA 3A8XA 1GJOA 2PVRA 5C26A 3CGOA 2JLDA 2H96A 3OY3A 4FKIA 4GIIA 3CR0A 4AQCA 4DG2E 2ITOA 4RVKA 2JAVA 4EH7A 3MFRA 2VTTA 1RE8A 1UKIA 4X2FA 5IISA 1PKGA 2WKMA 2A0CX 2P2HA 4PNKA 2W1IA 3UG2A 4K0YA 3DY7A 5LWMA 5E8ZA 1MP8A 3QKMA 2G9XA 2OH4A 3RNYA 3GVUA 4V01A 2QURA 2JC6A 5IMEA 2OJIA 4ANLA 2WTKC 5EYDA 4C4JA 1OL2A 4N0SA 3PPKA 3KGAA 3MB7A 2C6KA 2OJJA 4ACDA 1APME 2BZHB 4X7QA 3VN9A 3ID6C 3W0RA 4AFJA 3NNVA 3V6SA 3BYSA 4RIYB 2C3JA 5E8TA 4F64A 4FX3A 5EM6A 3VF8A 4DTAA 3PVWA 3UOKA 5D1JA 4QP3A 3JVSA 1H24A 3FWQA 2UVZA 5DR2A 1RDQE 2IVUA 2VN9A 5HIEA 1KV1A 5I4NA 4EHVA 5IA3A 3BBTB 3KU2A 5JEBA 4YMJA 3KCKA 1O6YA 3U4WA 3DB6A 4D4RA 2R9SA 4OR5A 4PDSA 4U8ZA 2W1EA 3P9JA 3OCBA 3I5ZA 4IB0A 4WSYA 4G16A 3H30A 4FZ7A 4NT4A 3ZC5A 4DHFA 4U94A 1U4DA 1UNHA 2NP8A 4LL0A 3IPHA 4AAAA 3FZTA 3KIOC 5CVFA 3PE2A 3WBLA 3S1HA 2YJRA 3A7JA 4N6ZA 2BAJA 3PA3A 3PJ2A 4Y8DA 2O65A 3C1XA 4I5PA 4AF3A 2YM3A 4FZFB 5LARA 4GRBA 3ROYA 2PVMA 5HBHA 3R8VA 2CSNA 3BLRA 2PTKA 3AGMA 3EQPA 2OIDA 1FMOE 4D2SA 2UZBA 2VWWA 4YHJA 1H25A 3RPVA 3MFSA 4IZYA 4IH8A 3W10A 2R0UA 3QAME 3ZRKA 3DAJA 5E1EA 4A06A 3NGAA 4GK4A 2YAKA 4JLCA 2RGPA 1M52A 2XRUA 3NUNA 3N9XA 2W1ZA 3OP5A 2GNJA 3QD2B 1YKRA 2DS1A 1Z5MA 4QPAA 2XYNA 3K5UA 3QF9A 4D4VA 3BWFA 2VTOA 2Z60A 4NFNA 5L8KA 3QFVA 5KKRC 4ANQA 2A4LA 3UO6A 5HE2A 3R83A 5GJFA 3DPKA 4FSRA 3LKMA 5CT0A 3C4CA 1UNLA 3FSFA 3UIBA 2BHEA 1I09A 4N70A 4IWPA 5JFSA 5ANGA 3PLSA 4L44A 3ROCA 3WZDA 3NNXA 4ASDA 2PPQA 4GFOA 2C3IB 2WGJA 3F6XA 5EOBA 4I24A 4DAWA 3AMBA 1YWNA 4BC6A 5AX3A 2R3KA 2OJGA 2HWPA 3CPBA 3F3TA 3FY2A 4MTAA 4U42A 4XV3A 2VD5A 3ATSA 3NUAA 2X6EA 5CNNA 3GCUA 1KOAA 4TN6A 4QMNA 1WFCA 4GT4A 3TUBA 5A3XA 2F9GA 4HVGA 3PXQA 4I6QA 4QT1A 5HQ0A 2XJ2A 5M4CA 2WTDA 2BKZA 4DEBA 3W33A 4FT3A 4QMOA 5HE0A 2FSMX 2J5FA 2WEIA 4FUXA 4U5JA 3HRFA 1O6LA 4FIGA 3UVPA 4KBAA 3GOPA 5A46A 2GTNA 4IZ7A 2PZPA 5CASA 3OUNB 1PMEA 2VGPA 2WXVA 3MTLA 3P7BA 3SAYA 4CFUA 5ANJA 3NAXA 3O23A 4JT3A 3LM0A 4C2VA 4OTFA 1H28A 4QP2A 1TQIA 3WI6A 4CG8A 2HW7A 3GU8A 3OY1A 4K33A 4QMTA 2GHMA 5K5NA 2Z7SA 3ZEWA 5D9HA 1R1WA 2ZMCA 2PY3A 4O7VA 5EM8A 4S34A 3PFQA 4ZIMA 3E62A 3MDYA 3DKFA 5BNJA 3H3CA 4AW5A 4M13A 3F7WA 3HMOA 3SKCA 4UYNA 1BMKA 3B8QA 4FG7A 2BPMA 3GC0A 4F9CA 5HICA 1VZOA 3FQHA 4TYHA 3QC9A 3FV8A 2EWAA 2YJSA 2FO0A 5G6VA 3ZRMA 3BELA 3OCSA 3HDNA 2G2FA 3C4WA 4DG3E 3F5XA 4JBPA 4ZXTA 4FT0A 4HYIA 3UNZA 3I1AA 2ONLA 1LP4A 2AC5A 4FV2A 2XEZA 4O0YA 4RA5A 5DYJA 4R5SA 4AGUA 3DJ6A 5J9LA 2BCJA 5TT7A 1V1KA 4GYIA 4JVGA 5ETAA 3BYOA 2Z7LA 2W5HA 4F9AA 3RK7A 3QZIA 2XYUA 1U5QA 3D94A 3MW1A 2PYWA 4EQMA 3ZSHA 4AZTA 3R04A 2UW6A 3RPSA 4II5A 3TV7A 3RTPA 4G2FA 3E8CA 5GINE 1YRPA 2XIRA 2C3KA 2XMYA 2YWPA 4XS2A 3LIJA 3HEGA 3LMIA 5DRDA 5J95A 3ZDIA 4DE4A 5F20A 4ZZNA 4I0TA 1L8TA 4I4FA 4I21A 5DVRA 4FODA 5FQDC 4HGSA 3EYHA 4AN2A 4DFBA 5BVDA 3BYUA 4Z55A 4P2KA 2UZOA 4AT5A 4RFZA 1DAWA 1K3AA 5KKRB 1Y8GA 3DQXA 3WZEA 4AP7A 4F1OA 4ARKA 1JKLA 5CWZA 3R63A 3EZRA 3KXMA 3QCXA 5E9EA 3LXKA 2C47A 5H2UA 3TTIA 4BCNA 5HKMA 3TUDA 5DNRA 3ZUTA 4D5HA 4FJVA 5FEQA 4BDFA 4D2RA 3OXZA 2IWIA 3U6HA 2YHVA 4WG3A 3ZO1A 3C7QA 3E64A 4DEHA 4F6WA 3EQBA 3EH9A 3EKKA 3U8WA 3ZBFA 2EVAA 1PRYA 2CGUA 3R28A 2WTWA 3RCJA 2C5OA 4FE2A 4E4LA 1XH4A 3VONA 5ITAA 3VUGA 5CEMA 3FKOA 2V7OA 1GOLA 1QPDA 3Q9XA 5BVKA 4FIFA 3BGQA 1ZY4A 4GYGA 5AA8A 4DDGA 3MPTA 3ERKA 3MFTA 1W82A 2BRGA 2XA4A 2XAOA 4JL9A 3ZU7A 2AEGA 4AGDA 2GS2A 3BI6A 4O0RA 4KRDA 2JBPA 2ONLC 2R3FA 4MXOA 4AQKA 5LMKA 3PXZA 3MJ2A 5BVEA 4FV6A 4FZDB 5CAUA 5IU2A 3BX5A 2F7EE 2PUUA 4FYNA 4DEGA 3TMOA 2R7IA 2X4FA 2JDOA 3SD0A 5GHVA 4LGHA 3ZUVA 4F6UA 2IPXA 5AUWA 4L45A 3DGKA 4YBJA 4FC0A 3QWJA 4HYUA 3AT3A 3SX9A 3MBLA 1YWRA 3U51A 4CTCA 4UWCA 5HEZA 4ITHA 3W18A 5EHOA 5J9ZA 3S00A 3FMDA 3KRWA 1G8AA 2XAMA 4L3JA 3PPJA 4FTKA 4GL9A 1TFFA 4L42A 4L8MA 5CYIA 5KMJA 4NTSA 5DBXA 3CY2A 4ERWA 3O71A 2OXDA 3QQFA 4YZ9A 3NSZA 3BQRA 4BZDA 5CEOA 4LV8A 3R7EA 4U7ZA 3AGLA 5HIDA 1OBGA 3KL8A 5CAOA 2IJMA 4FSZA 4L3LA 3DTWA 5AP5A 5EQPA 5E4HA 4MUQA 4A9UA 2GFCA 2OZOA 1YDRE 2YM5A 4DHJA 4YJSA 4J8MA 4D55A 2G15A 4MNEA 4PL5A 2FYSA 4RX5A 4GFGA 4OW8A 5ANIA 1XQZA 3FXXA 2WMTA 2GQGA 2BVAA 4JR3A 2Y4PA 3HP2A 5M55A 4C7TA 3CEKA 3CKWA 4O21A 1TVOA 3PRIA 4G3GA 4WZYA 3LCSA 4CCBA 3TKIA 4U3YA 4EQUA 3LLTA 4ZAUA 3TIYA 1MQ4A 4AA4A 2PUPA 1FGIA 4FNYA 5EI8A 2UW3A 5KMKA 1U46A 3ORTA 3Q6WA 2QOOA 4HVHA 4FV3A 2HK5A 4Z16A 3E92A 1H08A 5HESA 2R3QA 4QP8A 3NNUA 4Y5QA 4AA0A 3V5LA 4CVAA 4M68A 5D10A 3MYGA 5LMKC 3VVHA 4YNOA 5IA5A 4EK8A 3PSBA 4NW5A 4ITIA 2BHHA 4P5QA 3UOJA 4F7NA 3LM5A 3FMEA 2PWLA 3B2WA 4TY1A 2E9UA 3VO3A 1OIQA 2XIXA 3G0EA 4BDDA 3KQ7A 4IE9A 4IVCA 1NW1A 4NM7A 3QU0A 4HZRA 5FTOA 4YZNA 2Z8CA 5HG5A 2C30A 2WMQA 2UW5A 3IO7A 4QYGA 1HCLA 5KMIA 4NTTA 3TCPA 1R0PA 2GDOA 4FKRA 4C37A 1LR4A 3A99A 4C4EA 5LVOA 2H34A 3CQUA 3G33A 2AYPA 5EYMA 4EH3A 3N4TA 3VJOA 4H58A 4XX9A 4GK3A 3CSVA 3L8SA 2YM7A 3EN6A 4R7IA 2WTIA 4CLJA 5HLNA 2XNPA 3E5AA 3BU6A 3R1NA 4RLKA 4EUUA 4IB5A 2IW9A 4BGHA 4CCUA 3FI4A 3F7ZA 4FG8A 2W9FB 1OZ1A 3G2FA 3LFDA 4GW8A 4S30A 4EBVA 3UMXA 1JLUE 4ZP5A 3EHAA 2YFXA 3U54A 4BCOA 5IQEA 4NFMA 2BAKA 4KKGA 3V5WA 3ENHA 3TXOA 3ZH8A 4L7SA 4H1JA 3L8PA 1BYGA 2XBJA 3BGPA 1XMLA 2YAAA 2R3OA 3G9NA 5CI6A 1WVWA 1CDKA 1H27A 4FSMA 2B55A 4M14A 5K4JA 5A6OA 3ETAA 5CLPA 4CSVA 1VJYA 5M07A 2R3MA 2XK7A 3TV4A 2DYLA 5AP7A 2Q0BA 2JFLA 4WG5A 3KXZA 4IZ5A 4H05A 2VTNA 3JS2A 4HGTA 4QP4A 5IH4A 3C4FA 3QRUA 4MXCA 3COIA 4EK3A 5IQAA 4BDCA 2JKQA 3DFAA 3BEGA 2UZTA 5DT3A 4GU6A 3VRZA 3F5PA 4KINA 2IZSA 3L9PA 1HCKA 4O7SA 5CEIA 1PXLA 3COHA 4G3DA 4OTGA 4BDBA 3BU3A 4AWIA 4XHKB 1Q97A 4O7WA 3RALA 2OJFE 5K5XA 2YA9A 4E6DA 5CSVA 3AOXA 2ZDTA 3ZYAA 3KY2A 4AE9A 4EOQA 2ZMDA 3HRBA 2PVNA 4DINA 3FZ1A 5AP1A 5EW3A 5F9EA 3KXHA 5EM7A 3BRBA 4I92A 5HVYA 5HG7A 3E8EA 4X0MA 2C69A 4FNZA 4AT3A 3F5UA 3N4UA 5L2SA 2UW0A 4JBQA 4QYFA 2E9NA 1Q3WA 4FR4A 2YISA 5JGDA 4CFWA 5LWNA 1SZMA 5HHWA 4GKIA 4H3QA 2BIYA 4MAOA 5JT2A 2OWBA 4ZJIA 1BL6A 3C4EA 5E8XA 1W8CA 4E5BA 1WAKA 3RMFA 3NUXA 4CFVA 1YHVA 1YDSE 2XUUA 4ITJA 1Q8YA 3Q4UA 2W0JA 2YZLA 1OGYA 3H9OA 4V0GB 4H39A 5HG9A 3EN7A 4ZMFA 4PV0A 3H0YA 4XOYA 4B6LA 2R3IA 5EK7A 5E8WA 3GI3A 2VTAA 2PVHA 2CHLA 3UZTA 2ZYBA 4JAIA 2CNVA 5AP2A 3DOGA 1YVJA 1JSVA 3KB7A 5JH6A 2GHGA 2GNGA 5CALA 3FI2A 5BVFA 1MUOA 5FBOA 3SXFA 5JMSA 4UXLA 2F57A 2JITA 2PE0A 3W1FA 3BE2A 1XH7A 3BV2A 2FH9A 4BTJA 3WF9A 2RF9A 3EZVA 4MK0A 3FZOA 3R30A 1PXIA 3VBYA 2RKUA 4FKQA 4C36A 3K3IA 2O3PA 4XG4A 3V01A 4O7ZA 3OW3A 1E9HA 2YCQA 3CCNA 4G3EA 1VYZA 4FKWA 4E73A 4WT6A 3M2WA 5HE1A 3CXWA 3PVGA 5EYCA 2PVFA 3ZZWA 1UWHA 2BTRA 4D28A 4LUDA 5AUXA 4GFMA 4EOLA 4O7OA 2EU9A 1WBSA 4QDEA 3WF6A 3ZLSA 4ONAA 2B0QA 4WA9A 4D5KA 3HMNA 2WTCA 3DFCB 3PIYA 5I9WA 3F82A 4U79A 3QBNA 3LFSA 1CSNA 1H4LA 4AW1A 4JIAA 4FVRA 4BY9E 4WIHA 5I9VA 5EHYA 2XK4A 1Y6BA 3Q2JA 1NXKA 4TZRA 5GJGA 4DHIB 4JIKA 4APPA 2JD5A 3I6WA 2E2BA 4J71A 5E7RA 4KSQA 4ZSGA 1BI7A 4FIHA 2BRBA 5AUVA 5TR6A 3UGCA 3VC4A 5B2LA 4U6RA 5C8NA 3P08A 1BLXA 3OG7A 5F4NA 3LMHA 3UODA 4HJOA 4O2PA 4QYYA 3PRFA 2XNMA 4XEYA 3G9LX 3Q9YA 2QHMA 1JBPE 2C6OA 5CENA 3OHTA 4M3QA 3VW8A 1XBBA 4RX9A 3DBEA 2PMNX 4LV7A 4S32A 5D12A 5AP6A 4CEGA 4C34A 4M84A 4HNFA 3OEFX 4O22A 5T3QA 5CF6A 3OOGA 3POOA 2B54A 3R1SA 4R7HA 1JOWB 3CTJA 3RHXA 1JAMA 2J90A 4I22A 4LM5A 4R5YA 3IW5A 4YO4A 4J96A 4PTGA 3TN8A 1DI8A 4ZOGA 3FY0A 2R3GA 2PZ5A 3ZLWA 5CF8A 5J9YA 3M42A 4AG8A 4L53A 5M44A 3T9TA 2W1FA 4AOTA 4UY9A 4KKHA 5JK3A 3SDJA 3P78A 3B8RA 1ZOHA 4IDTA 4Q5HA 3JXWA 3F3VA 4ASZA 3QWKA 4HVSA 5IUGA 2QLUA 2IG7A 1PXJA 3AD4A 4PX6A 4RVLA 3R8ZA 4B7TA 4F63A 5C4LA 2JIUA 1U59A 2PZYA 2WU6A 3GFWA 4ZS0A 5I9YA 5KHXA 3FZRA 4FIIA 1WBNA 2XJ1A 3RPOA 3DZOA 5C4KA 5JFWA 2WMWA 3PE1A 3MH2A 4QP6A 5AJQA 3L1SA 4EOPA 3UNKA 2BIKB 1ST4A 3QUDA 3PJ1A 4BTFA 4ACHA 3NYNA 5FEDA 4JG8A 3W0PA 3E87A 3H9RA 5T6KA 3GCSA 3CIKA 3MPMA 3OZ6A 4DFXE 3R21A 3SQQA 1WBPA 5GIOE 1M17A 3AC4A 4O38A 4LUEA 2GQRA 2UW7A 4KS8A 4Z7GA 4Y46A 2BRMA 4BZOA 3D9VA 1UV5A 2W17A 3BZ3A 2GPHA 2UVYA 2KTYA 3TJDA 4Y85A 4FEQA 4YJRA 4YUQA 5AMNA 4LOQA 4QTAA 3AD5A 4NJ3A 4AZSA 4GCJA 2EB3A 4BHNA 4CV8A 4J99A 5IEYA 3O0GA 1XH6A 4RWIA 3UG1A 3UPXA 3UNJA 3FAAA 2HZNA 2QOBA 4RBLA 4QQTA 4TWPA 5CEKA 2WMSA 3KULA 3LQ5A 4K11A 4O82A 2WQNA 3I6UA 3W0NA 5KCVA 3R1YA 4R77A 4C4FA 1GIHA 5KO1A 3BU5A 4PDYA 2BMCA 4GIHA 4QMUA 3S3IA 3TNPC 5IEXA 4GSBA 3F9NA 5AAFA 5KMOA 3KREA 4XP3A 3LMGA 3LJ2A 4QMWA 1T45A 5BVWA 3QRKA 3FDNA 3GXLA 1W0XC 4XBUA 5HX8A 2QC6A 1H1WA 1MRVA 1YXXA 2BZKB 2YWVA 5FBNC 4BDHA 4FSTA 1H26A 4OTRA 4AZWA 4U3ZA 2OJ9A 5GIPE 4G5PA 4FSNA 3FMKA 2I0EA 1KE5A 5ANEA 4IWQA 5EW9A 3FEGA 1B39A 2VRXA 3RHKA 3NR9A 5E92A 4YC3A 5DI1A 2B52A 5J1WA 4NM0A 4E8AA 4LMUA 3PP1A 5HX6A 5JFXA 1ND4A 4ACMA 1XBCA 2FB8A 4HCUA 1KOBA 4DDIA 3QC4A 3EYGA 3AMAA 2PZIA 4U43A 4XNEA 3WARA 4DGOA 2XF0A 2QOLA 3DBQA 4HPTE 2F2CB 4GT3A 4KSPA 4FTJA 4J97A 2PVYA 5DEWA 5IF1A 3H0ZA 2C6LA 1A06A 1QCFA 1PXPA 1OIUA 2O8YA 3DK6A 4RVTA 5DR6A 4A4LA 4XOZA 2VZ6A 5JQ8A 1FMKA 4KB8A 1LUFA 4ZK5A 5C1QB 4DFNA 5CU6A 1UWJA 3LFCA 2XS0A 4XP0A 3GQIA 4MXZA 1Q8UA 2XNGA 4G17A 2X7GA 3TM0A 3R9RA 4RT7A 4C3RA 1Q41A 1SNUA 4GVAA 4G6NA 3OCGA 5AX9A 1BKXA 3MGYA 4G34A 4DBXA 4RIXB 2HWOA 3WOWA 5LCKA 3PIXA 4E20A 3HECA 4PMMA 2VTSA 1NA7A 1CTPE 2PMLX 5EI2A 4F7JA 3BV3A 4EHZA 4RIOA 2YDKA 4QMZA 5DT4A 3LFBA 4F09A 1Q4LA 2OF2A 3P0MA 4D1ZA 1OPJA 2GNIA 3FMMA 3WILA 1YDTE 3BBWA 1E1VA 2VTRA 3IW6A 4FSYA 4KD1A 4C59A 2ZVAA 3L8XA 3UBDA 4EZ5A 4LMNA 1UKHA 3VS3A 4YR8A 1MRUA 5J8IA 5JQ5A 5E1SA 1ZARA 3GB2A 3CPCA 5HIBA 2C5XA 3A61A 4G31A 4H3BA 5FXQA 3O7LD 5CU0A 4TW9A 3ZSIA 4PP7A 4N4SA 3D5WA 4I20A 1JVPP 1T46A 3NWWA 4KS7A 4CG9A 4YTCA 4BVUA 4MQ1A 3NUYA 4AZFA 3IG7A 1SMHA 3TI1A 3HZTA 1V0PA 3POZA 4NJDA 5DPVA 2W5AA 3KRLA 3VS4A 5A4CA 3HAMA 3D15A 3VHEA 3Q53A 3AC2A 4QP7A 3RI1A 3SW7A 2GS6A 2REIA 4PRJA 2BDWA 3MSSA 4XMOA 3D5XA 1CKIA 4NYEA 3LCKA 4X2NA 4FA2A 2OSCA 2IN6A 4FV4A 4TWOA 5AUZA 3NCZA 5A6NA 5F95A 4DFZE 3HNGA 3RWQA 5IDPA 2J6MA 3ANQA 4EK5A 3UVQA 2OICA 3HDMA 4GUBA 4IDVA 5CS6A 3HX4A 3RINA 2VO3A 5FDXA 4EJ7A 3O8UA 5FP5A 1WBVA 2ITQA 4O0WA 4PMPA 4IM3A 5C8KA 4LOOA 5DWRA 3T9IA 4J8NA 2VV9A 5D11A 3TDVA 4QYEA 3LFQA 4U98A 1SVHA 3WZJA 4NWMA 3F69A 2GHLA 5A4TA 1GZ8A 4C35A 3W0SA 4RX7A 2YIRA 4RMZA 4UX9A 2QVSE 2NRYA 4DH5A 3H9FA 5FG8A 4AGWA 3KRXA 4O84A 3VAPA 4IACA 4RFYA 4C4GA 2V55A 5LMAA 4CT1A 3DS6A 4RJ6A 2J0LA 1KE9A 1OUKA 3NUPA 4CMTA 4EJNA 5IQCA 2VAGA 3E93A 3RM6A 3TT0A 4G6OA 2OBJA 5E8UA 1XH9A 2YERA 3FQEA 5JSMA 5JKGA 5FXSA 2OIBA 3ANRA 2XNBA 2F4JA 4OLIA 3NIZA 4TRLA 5GNKA 4M15A 5IQFA 4XG2A 4BF2A 2QU5A 4WUNA 4G6LA 4L00A 2FUMA 2NNWB 3BL9A 3SA0A 2GCDA 3SHEA 5AP4A 4GEOA 5CF4A 3U6JA 2CKPA 2J5EA 2X2MA 4FEUA 5BQ0A 1M7QA 2PE2A 2XCHA 2GS7A 3FMNA 4BCJA 3TZ7A 5CSPA 1ZMVA 3K5VA 4IEBA 4DH1A 3LPBA 4YJOA 5HU3A 4FKOA 3VUIA 4NU1A 1WVYA 2HXLA 1G8JA 2WTKB 3SGCA 3UIMA 3MPAA 3VIDA 3KXNA 2CNUA 2O5KA 2Y6OA 5JGBA 4C4IA 3F2NA 2YM4A 1YXSA 1OVEA 3BHTA 4GT5A 1NY3A 4TPTA 5AM6A 3WIGA 2OGVA 1H07A 1J1CA 5L6WL 2WTVA 4AN9A 4BDAA 3A4PA 2YCSA 2PUIA 2VTQA 4USDA 4IAYA 3C50A 3C0IA 4I93A 4AACA 2P2IA 2WFYA 4MBJA 2X0GA 4XG6A 3W2CA 4OTWA 4O7YA 4KIOA 2R3JA 3ULIA 4FTQA 4TYJA 4YZMA 4EYMA 3GNIB 2NYAA 2VWYA 2XCKA 2BFYA 1ZWSA 3P1AA 3QD3A 4FKLA 5LQFA 2ZM3A 1OL1A 4JRNA 5AP0A 1P4OA 4O7PA 5BVOA 5AV4A 3RVGA 3SRVA 4O0VA 4DITA 3GENA 3NFGB 3PA4A 4XV1A 5CU4A 1J3HA 1LEZA 3GCPA 2J0KA 2ETRA 2I0VA 2JEDA 3CBLA 3ZSGA 1M2QA 4YC6A 4Q2AA 2FGIA 4P4CA 2QR8A 2J51A 3D5UA 1ST0A 3K3JA 1H00A 4L6QA 1JKSA 2WO6A 5AUYA 5HD7A 2C0IA 1WZYA 4ALWA 2X8DA 4YPDA 5EG3A 4DH8A 4I1ZA 1YXUA 4K8AA 4E5AX 3LXPA 1W98A 3P7AA 4I4EA 3OVVA 3R7UA 5EFQA 3MY1A 4AOJA 1RW8A 3PYYA 5LXMA 3EN4A 4EOMA 3GCQA 4FSWA 5HNIX 3V8TA 2X39A 4EK4A 3CQWA 2C6EA 3NIEA 3A7HA 1YOJA 4RWJA 3I7CA 2R5TA 4QQJA 4XV2A 4CFXA 5FUTA 3C51A 4FTTA 3VBTA 4ZY5A 2IZTA 4MX9A 1Q3DA 2XH5A 3DNEA 4OBPA 4YC8A 2CN5A 2ERZE 4TYEA 3R73A 4OT6A 3GU7A 4ZLOA 3ULZA 3GP0A 3I79A 4O0XA 4AX8A 2V62A 4I3ZA 4UZDA 3VBXA 3QUEA 4CKIA 5I9ZA 1ZY5A 4JQEA 3L9LA 2XM8A 4USFA 1H0VA 4DFYA 1DI9A 3F3WA 2FA2A 4W4WA 3RAIA 3QLGA 4RQVA 3RGFA 1DAYA 3PWYA 2H6DA 2WAJA 4QMXA 3AC1A 3VUKA 5AP3A 3BE9A 1ZOGA 2X81A 3W0OA 1YHSA 4DH3A 4RJ3A 4H36A 3P4KA 3OMVA 3PY0A 4CMOA 3KMUA 5M4FA 2ITZA 4BIBA 1EH4A 2QLQA 3EIDA 1YHWA 2Y6MA 3QQGA 3KF4A 5L8JA 2Y0AA 1R3CA 5HGIA 2XKDA 3RPYA 4GVJA 3C9WA 4C38A 4GJ2A 4EC8A 4O0UA 1Q61A 3IKAA 5HNBA 2CPKE 2WD1A 3DLZA 5DRBA 4F4PA 3BLHA 5LCJA 4IC7A 4TWCA 2Q0NA 4DEIA 3DLSA 2VO7A 4BDJA 3HYHA 2NRUA 4RVMA 5DT0A 2VTPA 4OTIA 3PXRA 2X8IA 4RJ4A 2WB8A 4IANA 2ETKA 5HCZA 4UWYA 2RL5A 3Q6UA 4WKQA 3SOCA 3UP7A 4CV9A 2VWBA 5AM7A 5BX0A 1JNKA 4PMTA 1PXNA 4QMYA 4QTEA 3KN5A 4NKSA 3O7LB 2IVSA 4BJJA 4UALA 4CXAA 2EXMA 2OK1A 2PMOX 1GZOA 2WZJA 3BEAA 3EFWA 2VWUA 3AMYA 4FUYA 4W8EA 5EQEA 3ZEPA 1GAGA 3NPCA 4AFEA 3LW0A 2ZV9A 4U0IA 3RZBA 3VS1A 4DEDA 5E8YA 2QG7A 4JDIA 3TKUA 4FSUA 4QMLA 4XLVA 4ASEA 5I9UA 3PY3A 3W2PA 2VTMA 3PPZA 3W16A 1FOTA 5KMMA 2VTHA 3NNWA 4QNAA 3DXQA 4G9CA 4A9YA 4Z7HA 3UVRA 2ITTA 4R1VA 2Y4IC 3L9NA 2IZRA 4OT5A 2P3GX 2XIYA 3FLSA 1SVEA 3ZUUA 4NIFB 3GCVA 3TJCA 2QG5A 3QRTA 2GTMA 2X1NA 2HZ4A 4H3PA 3R9OA 1L3RE 3HP5A 2JBOA 1YOLA 2XKCA 1M2PA 3FSKA 3PG3A 5A54A 4DA5A 2QOFA 3KF7A 2OW3A 4K1BA 2A2AA 4C4HA 3PY1A 2VNYA 5M53A 1FVVA 2UUEA 2C6MA 4EEVA 3QQLA 4EH4A 3NX8A 2VX1A 3FQSA 2NO3A 3ORIA 2NPQA 3QTWA 3R71A 1IRKA 1I44A 3FKLA 4IVAA 1A48A 4B8MA 4UN0C 5ANDA 1PXMA 2QU6A 2C5NA 4CFMA 1UVRA 2X2KA 3M11A 3RKBA 5EH0A 2R2PA 4YJNA 2C5YA 2PULA 2P33A 1AD5A 3EJ1A 3HKOA 4QP9A 4DGGA 3OXIA 3WIKA 2BDJA 3QCYA 4OBQA 2RFDA 2ITVA 3DAKA 2EXCX 2R64A 4LRJA 1RQQA 3OTVA 4ZTHA 3AXWA 3HMIA 4D9TA 5AWMA 5CAVA 2FSLX 2CKOA 3ZCLA 1AGWA 3L8VA 4TYHB 4ID7A 5JRSA 4MWHA 4BDIA 4FTUA 4LFIA 4X3FA 4G9RA 3ORXA 1JSTA 2O64A 1XJDA 2XK6A 4IAZA 2CLXA 4IFCA 4R78A 4GS6A 3PJCA 5CU3A 4ZJVA 4O7NA 4CZUA 4YP8A 5LMBA 4APCA 4L46A 3FLNC 4J7BA 2EB2A 2QKWB 4FEVA 1UU7A 3EFJA 4XV9A 3W8QA 1PMVA 3G15A 4IM0A 2ESMA 4QTCA 2PK9A 3GU4A 4NM3A 3ZFYA 4IVBA 2YACA 4M12A 1ZYCA 3C4XA 1CMKE 2ZV2A 2QONA 3D4QA 4ANBA 4BIEA 4USEA 2VGOA 1YI6A 4WG4A 3UDSA 1NT2A 1IR3A 2IVVA 3F2RA 1LPUA 2HZ0A 1WBWA 4WUAA 3O8PA 3SC1A 4ZTNA 3D7ZA 2YABA 3ORNA 2C6TA 2WQOA 4YJPA 3FI8A 3ITZA 4I23A 4CTBA 3DKCA 4HPUE 3PJ8A 3QALE 4RJ5A 2F7XE 4BBEA 4IIRA