4R78A

Crystal structure of lica in complex with amp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
287
structure length
287
Chain Sequence
GSHMEKIIKEKISSLLSQEEEVLSVEQLGGMTNQNYLAKTTNKQYIVKFFGKGTEKLINRQDEKYNLELLKDLGLDVKNYLFDIEAGIKVNEYIESAITLDSTSIKTKFDKIAPILQTIHTSAKELRGEFAPFEEIKKYESLIEEQIPYANYESVRNAVFSLEKRLADLGVDRKSCHIDLVPENFIESPQGRLYLIDWEYSSMNDPMWDLAALFLESEFTSQEEETFLSHYESDQTPVSHEKIAIYKILQDTIWSLWTVYKEEQGEDFGDYGVNRYQRAVKGLASYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Choline kinase
publication title Structural and enzymatic characterization of the choline kinase LicA from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 103
structure length 287
sequence length 287
ec nomenclature ec 2.7.1.32: Choline kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01633 Choline_kinase Choline/ethanolamine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r78A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4r78A02
4FKJA 2GQSA 3EFJA 3U9CA 3SA0A 2QNJA 3QTRA 5ANOA 5FBOA 5IEXA 2DS1A 3ORTA 4OTQA 5ACKA 3RVGA 5CF6A 1UU9A 3PSCA 5I5ZA 3ORXA 2YCRA 1Q8UA 1YKRA 2C5XA 3NUUA 4M84A 4D5KA 4DG3E 5F95A 3QGWA 3A8WA 2BKZA 2GDOA 3DDQA 3H9FA 3RM6A 3DT1A 4MBLA 2ONLC 3P7CA 2G1TA 2HZ0A 1KV2A 3ALOA 4O0RA 4O38A 4X3FC 4O91A 4CFMA 4EK5A 3FXXA 3IO7A 4QP9A 4E7WA 3NMUF 1SYKA 2ZDUA 4CRSA 3PWYA 5CANA 3KRJA 2UW6A 3MIAA 3VWAA 4Z16A 2XKCA 1PXKA 3NZ0A 3PVUA 4P5ZA 3ZLWA 4WHZA 3K5UA 3MFSA 4C62A 2HZNA 2BAQA 3IPHA 3NW5A 4PDOA 4TWOA 2J5FA 5HG9A 3T9IA 2QOLA 2YACA 2R3NA 3FZSA 3NIZA 4W4YA 3UMWA 3VS4A 3KN6A 3RK9A 1PXJA 1SMHA 3DK6A 2H34A 4X6RA 5H8EA 2IG7A 2RFNA 3Q6UA 3PY0A 2R3HA 5KHXA 5F94A 3KXGA 4NW5A 2YIRA 2W1DA 3ATTA 2X7OA 3O8UA 4FKQA 5I0BA 2OF2A 5IDNA 4TZRA 3VS6A 4NH1A 4F6UA 3ZSIA 1H08A 3LOKA 2W05A 4PWNA 4ARKA 1MQ4A 3A7FA 4TXCA 4MNFA 4Z7GA 2FUMA 1YOJA 1ZYJA 2W17A 4QPSA 3RALA 3UOLA 2OH0E 4ZSGA 2JBOA 5JT2A 3IW6A 3Q2JA 5H8BA 1OL2A 2PE1A 4QMXA 4DLIA 4HVGA 4Z7HA 4BGGA 1Q24A 2WB8A 2XJ0A 4F9WA 3KMMA 3CD3A 3TUBA 3G0FA 5CEMA 2HW7A 2R9SA 4MQ1A 2ZV7A 4X7QA 5A6NA 3FAAA 1JKTA 2ITTA 2BMCA 3TKIA 2XM9A 4D58A 5FLFA 4RJ7A 4IB5A 3DA6A 2JAMA 3ACJA 1X8BA 2OFUA 2R64A 4OUCA 3VS0A 3W2SA 2FSTX 3PIXA 4HYHA 5L8KA 3R8PA 3B2WA 1YWRA 3KVWA 1P14A 2UV2A 3UE4A 3FQHA 4EOLA 5IISA 3SDJA 3UVQA 4FV3A 2DQ7X 3ZLXA 3LFDA 5LMAA 2BVAA 4UWCA 4G17A 4ZZOA 1BLXA 2PMLX 5GINE 4FT5A 4IACA 1WBTA 4GT5A 4G9CA 4ZMFA 3QWJA 5CSWA 2Z7RA 2ZB0A 4CCUA 1OM1A 4KNBA 4IJPA 4NK9A 5JZJA 4FKPA 3VUIA 3CTHA 4AN2A 3F7ZA 3R63A 4E4XA 4YURA 2PVJA 5EI2A 3PWDA 3HGKA 4QP6A 5AM6A 3UOKA 4XMOA 2XJ1A 3Q9WA 4YBKA 4DEBA 3W33A 4MXZA 3D7TB 1V0PA 3VUKA 3OCBA 4JJRA 4RSSA 2HAKA 3VN9A 3HLLA 3OWJA 3R9NA 4FGBA 4U45A 2XRUA 3SGCA 2WTIA 2C5YA 4I3ZA 4OTRA 1E9HA 3R0TA 4F65A 3WZJA 1YWNA 5DVRA 3C1XA 1R3CA 2OWBA 3ZCLA 5L8LA 3VUMA 3NW6A 5E8TA 2YJSA 4RJ8A 2WQBA 5AV4A 3MW1A 3LPBA 2C1AA 1QCFA 4K77A 1IAJA 1FGIA 1Y57A 3BYVA 3DBEA 4RMZA 3PA4A 5KBQA 4C7TA 2BPMA 2YM3A 5E8YA 1JAMA 3UG1A 3NYXA 3QZGA 3RWPA 5JN2A 1PMUA 1OKWA 4IHPA 3QCXA 4PMPA 1GNGA 1M7QA 5IQDA 3ORZA 5AP4A 3NEWA 1YDRE 4J8MA 5IQAA 4EJNA 1IG1A 3LXNA 4FEWA 4JR3A 2XVDA 4M68A 5FEEA 4ASZA 2QCSA 4BDAA 1PKGA 3AMBA 3ODZX 5K4JA 3GXLA 2WU7A 1T46A 2O2UA 4FT7A 4KSPA 3EKNA 3RK7A 2B1PA 1W7HA 3EZRA 3SRVA 3GCVA 3C13A 3EQHA 3KKVA 3WIKA 5BVNA 2Y0AA 3LFFA 5AUVA 3EQPA 4FIIA 2OKRA 1YVJA 2B55A 3C7QA 2VTIA 4FK3A 4ZK5A 4K8AA 3QTWA 2C3KA 3LVPA 2G15A 5GIOE 3OBGA 2ZV2A 1OL1A 1ZY5A 4E26A 3DKFA 3EN9A 5BVWA 4MNEA 4IZAA 5CI7A 3WF5A 4S30A 4BCNA 3REPA 3AXWA 4O96A 3CE3A 2BKKA 4IW0A 1J91A 2XJ2A 2X7FA 4O22A 4PTGA 1PXNA 2WPAA 4RIYA 4RZVA 3ZC5A 5LJJA 1M14A 1M52A 3G6GA 3KY2A 3TTIA 4CLIA 3PZEA 2RF9A 2VTMA 3ZMMA 1ZYSA 3MY0A 1WFCA 5ANEA 3MPTA 2B0QA 2W99B 1GAGA 3I5NA 4QMSA 4FTJA 4UY9A 1WVWA 4AFJA 1ND4A 4I5MA 3MBLA 3Q3BA 5DNRA 4JQEA 2R0IA 2XNBA 5BVKA 5GJGA 4AZTA 4QMOA 2GSFA 3MTFA 5DGZA 5DE2A 3DOGA 1PW2A 2W1IA 3QYWA 2QOOA 4X2KA 3QA8A 5FGKA 1TQIA 3D2IA 3DU8A 4XG9A 3MV5A 3VS5A 5IA4A 1WBPA 3AT3A 2XK8A 3COHA 4H1MA 2GNJA 4OT6A 4NT4A 4PP9A 4YNEA 5AAGA 4WUAA 3HRCA 4FL2A 5FRIA 3LFQA 4C33A 4G6LA 5B2MA 5EYKA 4BCOA 3HMIA 4FGRA 5FM3A 3HV6A 2CNVA 2JITA 5IQEA 1OITA 3FHRA 1WZYA 5CYIA 3MN3A 4QP4A 4FKSA 3BCEA 2HY81 2ZYBA 4K0YA 4LOPA 2QKWB 2PTKA 3W8QA 4A4XA 4DFYA 2QO2A 4BCJA 3PRIA 2VO6A 4DGOA 2HW6A 3OXIA 4YGAA 4QMPA 3WYYA 4YMJA 2BDFA 3G2FA 1GIJA 5J5SA 2YM5A 3W8LA 3AT2A 3ERKA 3BQRA 5G1XA 3RKBA 3EIDA 5HVYA 4TT7A 3NWWA 3QXOA 3EFKA 2NRYA 4U81A 5F1ZA 5CY3A 4LUDA 3W0MA 1M17A 4BN1A 2OIDA 4RIXA 3RI1A 5C01A 5DG5A 4FIFA 4I93A 1BL7A 3VC4A 4BBFA 2J0KA 2KULA 4F9CA 1H27A 1LEWA 2F7XE 4JIAA 4MAOA 4F0GA 3W16A 1M7NA 5AV1A 3VBTA 4BTJA 4M12A 4AOTA 4TPTA 2C0IA 2QURA 3ACKA 3GU7A 2JKMA 3VQHA 2UZUE 5K5XA 2HK5A 4EJ7A 4XRLA 2RFEA 2WEIA 4FT9A 2XIZA 4N57A 5DBXA 3PA3A 3DB6A 3PY1A 4QMTA 5EM5A 4EZ3A 1LEZA 5AV3A 2UW3A 5BPYA 2QOIA 2BIYA 2WIHA 4YPSA 4ZAUA 2Y9QA 5DLSA 4MF1A 1U59A 5BNJA 4GW8A 4DEGA 4M69B 3BBTB 2R3OA 4BBMA 4JBVA 4L01A 3Q96A 4FZFB 3RCDA 1FVTA 4G1WA 4UALA 4JBPA 4TYJA 5HZNA 3VO3A 2WTJA 3GOKA 3OS3A 4EC9A 3C50A 4IX4A 3POZA 4DH3A 1CSNA 4ZY5A 4L45A 4MKCA 2VO7A 3QHRA 5HLPA 3OY3A 4XG6A 3BV3A 3W2OA 1CTPE 5C9CA 1KE8A 2BRGA 3UYSA 3IDCA 4GT3A 4KKGA 4MXOA 3VHKA 4BDEA 5FTQA 4FL1A 4LQMA 4QP3A 4KD1A 4W8EA 4F0IA 1XHAA 3UZPA 3KRRA 3DZQA 3W0SA 5EDQA 5L2IA 5IUHA 2ITWA 4LUEA 3KXXA 4ITIA 4QOXA 3LMHA 5HNGA 1GZ8A 4QMYA 5IQCA 3QQFA 1GIHA 2XK3A 3IG7A 5GHVA 4AT4A 4D4RA 2OW3A 5JFVA 3VULA 4J96A 4E93A 5C1QB 2BZKB 3LFEA 3QGYA 3QXPA 4DBNA 2QOKA 3MPAA 3QZFA 4J53A 4ZIMA 3ANRA 4FKIA 5JSMA 4F6SA 4QQTA 2XMYA 2Y6MA 3K5VA 5DEWA 2OU7A 2BUJA 3FLZA 1U5QA 1VYWA 3ZRKA 3KL8A 4JBOA 4FKGA 3W0NA 1UWJA 5HTBA 1YXSA 4V0GA 4HZSA 2X2MA 2YHVA 4FTRA 4ZP5A 5K5NA 4DGLC 1RW8A 3VUHA 3QTQA 5EW8A 4E6CA 5T6KA 3OCGA 4NW6A 4MD9E 4QP8A 4J7BA 4C4IA 5M4CA 2O63A 4U0IA 3VF9A 4FSNA 4QYFA 2GS6A 4YJQA 3UNJA 4QMQA 2P33A 3CQUA 4PDSA 3U87A 3A7GA 1ZYCA 4MEDA 2QOFA 3QC9A 4MD7E 4FSQA 3DNDA 4MWHA 1PHKA 5C4KA 5CENA 3DXQA 3W0RA 4FTKA 1HOWA 3BBWA 2F9GA 3A7JA 1DS5A 2W06A 1GY3A 3TNPC 2CLXA 2WTWA 3NYNA 3OP5A 5B7VA 2R3LA 4ACHA 4YJRA 4YJUA 2W96B 3PPZA 4LYNA 3UNZA 4B6LA 2WMQA 4AS0A 4E1ZA 2PVMA 4S2ZA 4C34A 1PF8A 3UZRA 4B7TA 4F9YA 1BKXA 4C4FA 3E87A 3UZTA 5IH5A 3Q53A 4WSYA 4FZDB 3S3IA 5ANKA 4J95A 2Z7SA 2JGZA 4G6NA 1F0QA 4HZRA 3ZHPC 2WKMA 4PTCA 3TUDA 2W1GA 4U6RA 3BWFA 2W7XA 2IVVA 2X8IA 1XH4A 3SHEA 4XUFA 3Q4UA 4DTAA 4AA4A 4D5HA 2XK7A 1J7UA 4UBAA 2JDTA 5CQWA 4AFEA 2G2IA 3R7YA 3IGOA 4DTKA 5CSPA 2IZRA 3BGQA 4LI5A 4YO4A 4AGCA 4B4LA 2WD1A 2HELA 2ZAZA 4HPTE 4DE4A 2Y6OA 3ZM9A 2XKEA 3BLHA 4RVKA 5CU3A 5BVEA 3O96A 3EB0A 5KE0A 4OLIA 4F99A 4FEQA 1GJOA 3QUPA 3ORIA 4JR7A 3U6HA 2O0UA 4FTLA 1PY5A 4LV8A 4W4VA 3KF4A 5K9IA 4X2GA 1XH7A 2HWOA 1U46A 4U97A 5ETCA 4BZOA 4DG2E 4HVHA 3F3TA 4D28A 2Y4PA 2FB8A 3D7ZA 4BF2A 1UA2A 2B9IA 2C5OA 5AJQA 4ZSLA 1R0EA 3QRIA 3M11A 4ZTNA 3QD3A 4AOJA 2A0CX 3QC4A 1E1VA 1WBWA 2PYWA 4YC8A 5E8UA 4PDPA 2I0YA 4L46A 4XP2A 3GGFA 2IN6A 4Y72A 1UU7A 2WMAA 4I1ZA 3E8NA 2CGXA 4BDDA 3DB8A 4O7YA 3T9TA 4OTDA 3GI3A 5EM7A 3KN5A 2PUNA 2WTKC 2CKQA 4TKSA 2C5NA 1SVHA 4IAAA 4FSTA 4OBPA 3NNXA 4WD5A 4LMNA 3PJ8A 4RJ6A 2BDJA 3FLWA 4DINA 4HGLA 2F7EE 3WIGA 4FNZA 4FZ7A 3OY1A 2QKRA 4BGHA 3W32A 1QPDA 2R5TA 3P78A 2IZUA 5A4QA 3UO5A 4R3RA 3F7WA 4XV1A 1OBDA 5CXZA 5AAEA 4UX9A 5HBEA 3BHVA 3IS5A 4L67A 4O7OA 3MPMA 4TTHB 3NDMA 3AC8A 3UVPA 4EK3A 4NUSA 3FEGA 4C35A 4M97A 4U98A 2J90A 2SRCA 3OFMA 3QRTA 3PP1A 1UU3A 2VD5A 4WBBB 4R1VA 2JFMA 4BHNA 4IAKA 5H3QA 4O82A 4MXAA 3I81A 1W0XC 2O3PA 2RFDA 3O7LD 4FODA 5HCYA 2CGWA 2HWPA 2PVRA 4GS6A 4ZS0A 1WCCA 2OH4A 3R22A 4FVQA 5HD7A 4BDBA 4E5AX 1I44A 2GQGA 2UZEA 2XNPA 3IGGA 3PPJA 4W8DA 3K2LA 4F0FA 3DKCA 3PY3A 4EZ7A 4FKTA 4ERKA 3P23A 2JIUA 4OBOA 5EOBA 3FY2A 3OWPA 4HGSA 2XCKA 3HZTA 4O7RA 4DT9A 4ZSAA 4BDGA 3RPYA 2VNYA 3PFQA 3G15A 3V5JA 1CM8A 2WQEA 1JKLA 4A06A 5B0XA 3POOA 4WG3A 4JLCA 4KBCA 4FZ6A 4YC3A 2ITPA 3MIYA 4B8MA 3PSDA 1SZMA 3WF9A 4O0VA 1Q8ZA 2WHBA 2IW6A 5JQ8A 5EW3A 4BR3A 3RM7A 3PXQA 4EUTA 2BRHA 2BROA 3LIJA 5AUXA 3W2PA 4LG4A 3MVJA 4M15A 5DT0A 4EH9A 1OPLA 4BIDA 3GT8A 1KV1A 4FV5A 3QTSA 4CV8A 1WBOA 5ANGA 2ZM1A 4LRMA 4P7EA 3VQUA 1ZMUA 3BV2A 4MWIA 3LFSA 5LVOA 2F2UA 2QO9A 4RJ5A 3VS3A 3WZEA 4GG5A 1OL7A 4YTIA 2X6DA 4B0GA 4CZTA 2F2CB 3EN4A 3D15A 4EUUA 1BI8A 2BRNA 3P7AA 4G16A 3UODA 5KMKA 3AD4A 1UKHA 4FOCA 5A46A 1YQJA 3IW8A 2FSOX 4XG2A 3ZZEA 3PXKA 2OIBA 2X81A 3VBVA 2ZOQA 5LVPA 3KF7A 4CXAA 2GTMA 1S9IA 1G8AA 4O83A 5E9EA 3F3ZA 4FNXA 4O0TA 4EEVA 3NNVA 3OUNB 3EQCA 1CKIA 1FINA 3MJ1A 5E1EA 2QVSE 4HVDA 1PYXA 3C51A 4Q5HA 4PMSA 3JPVA 4XLVA 3IDPA 3W0OA 4BCQA 5HX8A 3CTJA 5LMBA 3E3PA 3KB7A 4APPA 4JRVA 3G90X 2C4GA 4FTOA 3R7OA 1ZAOA 4AZVA 4BCGA 5BYLA 5CI6A 1OKVA 2O5KA 2YCSA 3KGAA 4EBWA 3DXPA 4ZZNA 4G2FA 4R3CA 4EH4A 5IA0A 1FVRA 3K54A 3KXNA 3OEZA 3PSBA 2JLDA 3P86A 2WZJA 5I4NA 2IJMA 3JVSA 3OW4A 4HCTA 4D2SA 4YJVA 2XNGA 2WTKB 2A4LA 4ACMA 2GNFA 3IECA 5CF4A 2XNMA 3C4WA 3W10A 4BCHA 5FTGA 1MRUA 3MY1A 3ORLA 1BYGA 4UWBA 1U54A 5HTCA 4XHKB 5T68A 1J7LA 4JG8A 1O6YA 3TV4A 2VGOA 5EOLA 2CHLA 4FKLA 4BYJA 4P5QA 1DI9A 1OL5A 3ITZA 4MD8E 1QPJA 3WE8A 1KSWA 2PZ5A 3R9OA 3OF0A 3KA0A 4DC2A 4Y5QA 2YN8A 4UEUA 2EXCX 5D12A 3C4XA 1RQQA 1J7IA 3HX4A 3TIZA 4J52A 4H3QA 5HIBA 4JDIA 3BQCA 3FZRA 2FYSA 3H9RA 2J7TA 2VTJA 1WVYA 3G9NA 4BHZA 5M53A 3R30A 4EOIA 3F69A 3ORKA 2OZAA 3AGLA 3NLBA 3BU6A 3ZXTA 4AW2A 4IAZA 3NUYA 5D7AA 1H07A 4FSUA 3FMNA 4G31A 5D9HA 3ZXZA 4R78A 3HKOA 3BGPA 4ENYA 2C6LA 2RFSA 3G33A 3ET7A 3LE6A 4CKRA 4EH5A 1KE7A 5IA1A 5CALA 3LFAA 3P7BA 4C37A 3H0ZA 4QNYA 1H0VA 5AP5A 4ASEA 2C3JA 2W1FA 1YI4A 3O8PA 3SOAA 1FOTA 2CSNA 3MB6A 2OJGA 3SD0A 2GNGA 2ZMCA 1Q8WA 3NCGA 3O8TA 4U94A 3LFBA 2UW0A 5KUPA 2WAJA 1PXIA 3RJCA 1VEBA 1APME 2IVSA 3QFVA 2YWPA 3MVHA 4FKUA 4IM3A 5DOSA 2VTSA 4ZTQA 5HO8A 2X9EA 4AZSA 4R5SA 4BZDA 5DR6A 5IDPA 1ZY4A 2VWBA 1Q3DA 2WQNA 2R2PA 3A7IA 1H25A 1VJYA 3AD5A 2CN8A 3B8RA 3E92A 4O21A 4KSQA 2GNLA 2PHKA 4R77A 5HORA 3HRFA 4U42A 5EQYA 1XQZA 3E62A 3IW7A 3BHHA 5HG7A 3WZUA 2CCIA 5HNBA 4WRSA 3FXWA 3ZBXA 5IZFA 5ETIA 4FSRA 2WELA 4MQ2A 3DBFA 4EK6A 4ZY6A 3GCSA 3SW4A 3CQEA 3W0PA 4A4OA 3FSFA 3KQ7A 4GIHA 4FTAA 3LCTA 2FH9A 4O2PA 3V51A 5D7VA 4EKKA 4WZYA 2OXYA 3HP2A 2JIVA 4RWIA 3TZ7A 2YITA 5A4CA 5LWNA 4IMYA 2XIRA 4HPUE 5IMXA 2QOBA 4RX9A 5TKDA 2OIQA 3PG3A 5M55A 5H8GA 4RIWB 2GHMA 3I0OA 2UZOA 4L53A 2HZIA 4ANQA 3ZEWA 4QMNA 5KZ0A 3LCKA 4ENXA 4KBAA 3AC2A 4IVAA 5EYDA 3WF7A 4CVAA 5KX8A 4A4LA 5KCVA 3BHYA 3KXMA 5HVKA 4C0TA 3R71A 2B54A 4JRNA 3AMAA 4CCBA 3I79A 2XEZA 2X0GA 3ALNA 4R1YA 5JK3A 3AD6A 2XBJA 3FDNA 3C5UA 1RE8A 5HKMA 3QU0A 3QBNA 1W83A 3LXKA 3DPKA 2XIXA 4UYAA 4MBIA 4BDJA 3DLSA 3I1AA 4Q9SA 4A9TA 3V5LA 3K3IA 1XBCA 4CV9A 2XK9A 1OIRA 3E93A 1R78A 4GFGA 3TM0A 3FLNC 2C0TA 3SG9A 2B53A 2P55A 4FIHA 4HCVA 4EH8A 2QI8A 5BVDA 3B2TA 2HZ4A 3BLQA 3OOGA 5IA5A 4M3QA 1DAYA 2BRMA 4ERWA 4BI0A 3H30A 2J50A 3R01A 1ZARA 4IQ6A 3TWJA 1DI8A 3NUNA 3FL4A 1XWSA 2PL0A 4IB0A 3TKHA 3IKAA 2CKEA 2VTHA 5M4UA 4R5YA 4RVLA 5C8KA 3ROCA 3IDBA 1F5QA 4E4LA 2BILB 5FXQA 2VTNA 1W98A 1XO2B 1YHVA 2DWBA 5DIAA 5DEYA 3A61A 2J6MA 5EK7A 3SXFA 3VHEA 3CQWA 1PMVA 2ACXA 2BFXA 3FLQA 2X2KA 3TACA 1WAKA 5ICPA 2VV9A 3V5TA 4FTCA 3RHXA 5CF5A 4L52A 4CMTA 3LLTA 2X2LA 3D83A 1WBSA 5EKNA 1P2AA 3MDYA 4NFNA 4IAFA 3GNIB 1E1XA 4K11A 2VWYA 2QLUA 5DA3A 4DITA 4ZSEA 4K1BA 4YU2A 5HE3A 5HLNA 2C69A 4D1ZA 4RFYA 4JBQA 4UXLA 1GIIA 5AUYA 2W9ZB 1U4DA 4XNEA 3SX9A 3MYGA 2PMNX 2FSMX 4PQNA 3V6SA 4FSWA 3PG1A 2HENA 3V3VA 5HCZA 1PKDA 3KK9A 4Y95A 5M57A 3ZBFA 4Y5HA 4GVAA 5J95A 4F09A 3QKLA 3PVBA 3PLAE 1ZMVA 3TDVA 3VVHA 2CJMA 3LLAA 2KTYA 2UVYA 3AQVA 3A2CA 2CNQA 3HYHA 4X3FB 4TRLA 2E9NA 4QT1A 4YZNA 2CDZA 3EQGA 2GMXA 2PVYA 3VBQA 3HMOA 1OIYA 4AGDA 3OCSA 3T3UA 4EBVA 3GQIA 5FP5A 5J87A 3DTWA 3NAXA 3ZFXA 4C59A 3JVRA 4GL9A 2ITNA 5J9LA 2XKDA 4IFCA 5D41A 3C0GA 4TYHB 3BYSA 3GVUA 3ZUUA 1OL6A 3ODYX 1JLUE 4OTGA 2PK9A 5FP6A 3ZO3A 4BI1A 3LJ1A 2YDKA 4XG7A 3N9XA 2OJIA 3B8QA 5A6OA 3E64A 3DAJA 2PU8A 1QL6A 2ZDTA 3OWLA 4YC6A 5DWRA 1OVEA 4S32A 4K6ZA 2BAJA 4FG8A 1W8CA 2GNHA 3E8DA 4L6QA 4NCTA 4A9RA 4MBJA 5I9UA 1CKPA 3KULB 4S33A 4BRXA 4BY9E 1SVGA 5KBRA 4NM0A 4HYSA 4BC6A 4E8AA 5L2TA 4FG9A 4EWHA 2H8HA 5F4NA 5A4LA 4C02A 2YFXA 2A1AB 3VRZA 3CEKA 4I94A 3MVMA 3HMPA 5EQEA 3ATSA 4HGEA 3I4BA 1W82A 3OT8A 5F20A 4FEVA 5M08A 3JUHA 1JOWB 3RTPA 4Y83A 2NRUA 5I9ZA 1UKIA 4GSBA 4GU6A 3LAUA 3QKMA 4O7VA 4C3FA 1QPCA 1Q41A 4GUEA 1UU8A 4JQ8A 2CGUA 1FVVA 2ZB1A 4NL0A 4O7LA 4C3RA 2R3PA 3BX5A 4O7PA 4AA5A 4DA5A 5CT7A 2J0JA 5M09A 3I7BA 3QTZA 2PVKA 4O27B 1AQ1A 4C4HA 2J51A 4FIJA 3CJFA 2HCKA 5FG8A 2C6MA 2BZIB 4J1RA 3BRBA 2XF0A 4IE9A 3ENMA 4D0XA 2ESMA 3PDTA 3O2MA 1K9AA 5B2KA 2W1ZA 3C9WA 4AZEA 3R1YA 3HV4A 1A48A 3WF6A 3IW4A 5ETFA 1GOLA 4C2WA 3UIXA 1NW1A 3P08A 4ACGA 4FZAB 4OW8A 4PV0A 4RA4A 4QTAA 5IQIA 3R00A 3SG8A 3FMMA 3UDBA 4F70A 1O6LA 5IA2A 5EI6A 4CGAA 2VZ6A 3LCOA 4ACCA 2CMWA 4BCPA 4E4MA 4XV2A 1UNHA 3BYMA 3KFAA 3PRFA 4B99A 5FDPA 5J9YA 2XA4A 2P4IA 2YIQA 4EZ5A 4DTBA 4IBMA 3BEAA 4RJ4A 2PWLA 4EL9A 1K2PA 4USDA 5AX3A 3G0EA 2JEDA 3FSKA 4TNDA 2GTNA 2GU8A 3P0MA 4QMWA 4AXAA 5CAVA 4LRKA 2FO0A 2WQOA 4P90A 3V8SA 5FXRA 5J1WA 1ZXEA 5CNNA 2IWIA 3TZ9A 3FUPA 5GJDA 2Z02A 5HCXA 1QPEA 3GCUA 3R28A 5D1JA 3NYVA 2PZPA 3KXZA 4R7IA 3KCKA 2IZTA 5JMSA 3VBXA 1JBPE 2X8DA 4L44A 1OKYA 5EG3A 4ZXTA 2XP2A 3HA6A 5AX9A 1YDSE 1NA7A 4IIRA 1OUKA 2ITUA 4GK2A 3F6XA 5LMKA 2YAAA 5CTPA 5FQDC 5TO8A 3LQ8A 3GU5A 2E9VA 1ZWSA 1H1WA 3DJ5A 2XUUA 3R83A 4D55A 3MSSA 4HVSA 2BR1A 3HAVA 2W1EA 1YRPA 1Q8TA 4QRCA 3Q2MA 3DKOA 2VTOA 5KKRC 4O81A 4ZTHA 3VBWA 5EDPA 5L6OA 4O86A 4XG3A 2UZWE 4IM0A 3RWQA 5AP7A 4YTFA 4IADA 2J0MB 3EWHA 2BZJA 1V0BA 4IWQA 2PVFA 5LARA 2WOTA 2PY3A 3VBYA 3FPQA 3AC4A 1G5SA 2OK1A 3I7CA 4Z3VA 3DKGA 3LW0A 3FC1X 4O6LA 4JG7A 4TWNA 3RPVA 4IC7A 5C8MA 5AMNA 4IVDA 1QMZA 4CQEA 5C4LA 5L6PA 4IZ7A 4UWYA 2BTRA 2OXXA 1KWPA 2OXDA 2YEXA 3CP9A 1OGUA 4H3PA 4EK8A 3D0EA 3QX4A 4KS7A 3QL8A 1KE9A 1I09A 3CR0A 5E8SA 3DLZA 3MGYA 1H1SA 4IJ9A 4UV0A 4ZTRA 3CGFA 4OTHA 4WNKA 4YO6A 5CEOA 4IB3A 2YM6A 4L00A 3HAMA 3G5DA 2XZSA 3QLFA 3LKMA 4I6BA 2B9JA 3GU8A 4FICA 3O0GA 2BDWA 5EYMA 2J0IA 5CZIA 5CASA 2V62A 3TZ8A 4ANMA 4U8ZA 4NYEA 1URCA 4PMTA 2QU5A 3QALE 4B8LA 3S1HA 5G6VA 4DHFA 5DI1A 4IFGA 1Q4LA 3D7TA 2ZV9A 2QR7A 4H3BA 3LXLA 4FT0A 2REIA 4NKAA 4RBLA 3OVVA 5L6WL 5CEIA 3HMNA 4RWJA 1H0WA 4QP1A 4BYIA 4CTBA 5CQUA 1ERKA 3MB7A 4DH5A 4F64A 4QMLA 3UJGA 2P3GX 4D1SA 4EQCA 5IH6A 4WBOA 4EOPA 4D4SA 5KHWA 1GZNA 2JKKA 2XIKA 4ZJVA 4XX9A 3ZH8A 5HG8A 1OPKA 3NRMA 3ZDIA 3F9NA 2UW9A 3R2BA 3QQHA 3M1SA 5JGDA 2I0VA 3MH2A 2QOCA 4OBQA 4FIEA 2PMIA 3NGAA 4XOZA 4X3JA 5CVGA 4ONAA 4PL4A 1PRYA 4QMMA 4CTCA 2PUPA 3TUCA 2ETKA 4RFZA 1VYZA 4G3DA 4DEIA 1URWA 1XH6A 3UOJA 5DT4A 3RINA 4CG9A 3TNIA 1DAWA 2UW8A 3WI6A 1H1PA 5M4IA 1H28A 2RIOA 3NUPA 1KOAA 3HDMA 2ITQA 3R04A 3R7VA 2B7AA 4FV4A 4JDKA 4AF3A 4D4YA 2ERKA 2ONLA 4TN6A 3U51A 1J1BA 4S31A 4X3FA 3ZO1A 5CEKA 2GQRA 3DBDA 3OROA 4L3JA 1H24A 3CIKA 3ZONA 5CSXA 2G2FA 4RLLA 4GKIA 5CEPA 4RX8A 1A06A 3F82A 4F1MA 4DT8A 3OW3A 2ETRA 3O23A 3VIDA 3HDNA 3DCVA 1H4LA 3LHJA 3PXYA 4KA3A 3ZFYA 2O65A 4L42A 3EYHA 4J8NA 5TR6A 3O50A 3OXTA 4EOMA 3KRXA 2WU6A 5IH4A 2IO6A 3DAEA 3QQLA 1MP8A 2PMOX 5AP2A 4AUAA 4E6AA 4FIGA 2QR8A 5KMOA 3NVMB 5IPJA 4CFWA 4RGJA 4EONA 2W5AA 4DGGA 3D9VA 3FQSA 4QQCA 4WUNA 2UZNA 2YISA 2WMXA 3RAIA 3KC3A 3D4QA 2YIYA 3DS6A 3Q04A 4GFMA 3NUSA 4OTWA 4RC2A 3ZYAA 5LWMA 3IQ7A 2JDOA 3E8EA 2XKFA 4YZ9A 3ZM4A 2H9VA 2JBPA 3L9PA 4AN3A 3GFEA 3PXZA 3V01A 5IU2A 2QONA 5IQBA 3GB2A 3VRYA 3AMYA 4ZMEA 3FKNA 4XCUA 3HRBA 5CF8A 5K4IA 5EDRA 4FSYA 4X21A 4QYGA 4IANA 4M13A 1REJA 3UIMA 3D2KA 4DH1A 3TZMA 1KE5A 3FMHA 3NIEA 3NCZA 4XOYA 3RGFA 3W1FA 2GS2A 4QQJA 3JS2A 3FZTA 3LCDA 3MFRA 4FTUA 4RIOA 4AW1A 4IAIA 5D10A 1VR2A 4HYUA 5L2SA 4I92A 2ITXA 4NCTC 3ZUTA 4CNHA 1OECA 2XBAA 2UVXA 4YZCA 3FQEA 4EOJA 4UB7A 3TNWA 1ATPE 1XKKA 2R0UA 3FL5A 3MJ2A 1Y6BA 4FYOA 2IW8A 3F3UA 3TT0A 4E6DA 2EWAA 5BMSA 4O7ZA 3Q4CA 1P4FA 4NWMA 2BFYA 2X9FA 3DDPA 4G3CA 5JEBA 1T45A 3FZOA 4RWLA 4JDHA 4ORKA 2H96A 4U3YA 3R73A 4FUXA 4IVCA 2VAGA 1NVRA 4XYFA 4BDIA 2JDVA 4DFXE 2VTRA 3DZOA 5EHOA 2HOGA 3MH3A 4Q5EA 1JKKA 4ITJA 5DFPA 5A4EA 2XYNA 1OKZA 3A8XA 4NM3A 2CKPA 4E5WA 2PZIA 3N51A 4FTQA 5EHYA 4EOOA 3SVVA 3MH1A 2G01A 3NR9A 3T3VA 4G5JA 4P4CA 4QTCA 3PA5A 3FI2A 3BELA 4FK6A 1JPAA 4GYGA 3C0HA 4ZLYA 3ZS5A 2B9HA 3QQGA 4TYIA 1P4OA 1REKA 3MFTA 4R3PA 3V6RA 3N4UA 3GUBA 5JQ5A 1F3MC 3EJ1A 4NM5A 4EHVA 5IA3A 4H58A 2ZM3A 3C0IA 3UPZA 5CU0A 4USEA 3HMMA 3FI3A 4L8MA 1JQHA 5E92A 4F63A 4NJDA 4AW5A 5AUWA 4L9IA 5IG1A 2BIKB 3HV7A 4AP7A 3Q60A 4CFUA 3ELJA 3KVXA 1K3AA 2EU9A 2W5HA 4EC8A 2JIIA 3EL7A 2IVUA 2BHEA 3L9NA 4GV1A 1CKJA 4C4JA 3BIZA 4LRJA 2UZLA 4F1TA 2QG5A 5FXSA 3N4TA 4KRDA 4U43A 2R7IA 3F5XA 3MY5A 3BE9A 3FMKA 4I0TA 3ZRMA 4BCMA 4IWDA 2VTPA 4I4EA 4I22A 3V8TA 3QF9A 3H0YA 3CKWA 4L3PA 3BWJA 4IM2A 1STCE 4O7SA 4LV5A 2J4ZA 4FSZA 2C3IB 4OTFA 4RJ3A 2YIWA 3DY7A 2XEYA 1OPJA 3FKOA 3N4VA 2BZHB 3COIA 3HNGA 1Y91A 4BBEA 4F7NA 3FKLA 1YOMA 2E9UA 5GNKA 3QUDA 4CFNA 3ULIA 5EM6A 1OB3A 3FV8A 3A62A 3CKXA 3QHWA 4GK4A 4G3GA 4BCFA 2GS7A 2IZSA 3Q5ZA 1FMOE 2YERA 3DQXA 4X0MA 5BYYA 4IDVA 1PXMA 2A2AA 2OJFE 3C4EA 3MVLA 2WFYA 3VW8A 3ZO4A 3U6JA 2F57A 3TV7A 1Z57A 4CT1A 2E2BA 3SRVB 4WIHA 2ITZA 3KU2A 3Q9YA 3DAKA 4YP8A 3TDWA 4XEYA 5A9UA 3F66A 4DFNA 5E8WA 4QTBA 4TNBA 3LQ3A 1ZLTA 2Z7LA 1YXVA 2UZDA 4MNEB 4C36A 5A14A 4NFMA 3TJDA 3L9MA 4GH2A 4ZTLA 5FDXA 1BI7A 2VU3A 3EKKA 3QD0A 3ZLSA 2AC3A 5CU6A 5ETAA 2ZV8A 4BKJA 3FWQA 4JL9A 4RIYB 5HESA 2VTLA 4EYJA 2XNEA 3DV3A 3R8LA 3QA0A 5F9EA 3SLSA 4TW9A 2R4BA 4E4NA 5AUUA 2YIXA 2EXMA 3ENHA 5KMIA 1PMEA 2UW5A 4U7ZA 3SW7A 4W4XA 3L8SA 2C6DA 4YJTA 3DJ7A 2Y7JA 4YR8A 2P2IA 2H6DA 4TYEA 3CXWA 3R7EA 4ZZMA 3EQBA 4XP0A 1ZOEA 2BHHA 5HHWA 5IEYA 4Q9ZA 1U5RA 3PE1A 4ZTSA 4FOBA 1Q3WA 4RG0A 3R8ZA 2C68A 3W2QA 4QMVA 3SC1A 4BI2A 3MESA 4I5PA 4FR4A 5CAOA 5I9VA 1PXPA 3BHTA 2R3GA 4JX3A 2VX3A 1O9UA 4D9TA 5CNOA 3MA3A 3EN5A 4LM5A 1PMNA 1YXXA 4HYIA 5E8XA 4QO9A 5CXHA 3FBVA 4R7BA 2Z8CA 1JSUA 5J8IA 2EUFB 3UNKA 4OT5A 3IW5A 3RCJA 1OI9A 4EOSA 4MTAA 3D5WA 4CG8A 3TV6A 3NVKI 1ZRZA 4LOOA 3RNIA 2XRWA 3MA6A 4AE9A 3MI9A 1UVRA 5E8VA 3JY9A 3OT3A 4RQKA 1XH9A 3UP7A 5AA9A 4FBXA 4X2NA 4XG8A 5EW9A 2PE2A 4F9AA 1CDKA 4MH7A 3R02A 4MCVA 4AE6A 1OUYA 1JNKA 5HE1A 2CCHA 3O71A 3PJ1A 3GBZA 1Q5KA 2OJ9A 3O17A 1YDTE 3CS9A 4YNOA 3UC3A 3HECA 3U6IA 4RIXB 4RX5A 3HUBA 4EK4A 3GC0A 4FT3A 3E5AA 4O0UA 4PTEA 3W18A 4AAAA 1IEPA 1MRYA 2X4FA 3LMGA 2AYPA 3DQWA 1LP4A 3PVGA 4NJ3A 4NTSA 1BMKA 3E7OA 4FX3A 3NW7A 4L43A 3NNUA 4CKIA 5HEZA 2BCJA 4CMUA 4UZHA 2WXVA 3OC1A 5CWZA 4F7LA 4GMYA 2W4KA 4HCUA 4ITHA 4GRBA 3FY0A 1ZOHA 1JSVA 2A27A 1YI3A 4C61A 4U80A 4YZDA 2QC6A 5FM2A 2E9PA 2P2HA 2OBJA 2RG5A 3FZPA 3AC1A 4PX6A 5DRDA 4U9AA 2VO3A 3OEFX 5ANDA 2WMTA 2I0HA 4L68A 3UC4A 2C3LA 2QG7A 4FV0A 4U40A 3CPBA 4G3FA 4QQ5A 1BX6A 2C6EA 4JAJA 4Y46A 4H36A 2NP8A 2I6LA 2ZMDA 2RL5A 4E5BA 4HW7A 3HV3A 2VWZA 5EKOA 5HI2A 5ACBC 4DGMA 3LQ5A 3SXSA 2R3QA 2QODA 4YZBA 4TWPA 4AQCA 3QLGA 3EL8A 1WBNA 2QHNA 2VWUA 3GCQA 3BYUA 2W1CA 3PIZA 2V7OA 4OR5A 4AZWA 4ZY4A 3F88A 3R8UA 5FUTA 2V7AA 4FV2A 3RHKA 1LUFA 4CEGA 2CLQA 3F3VA 1TVOA 2JD5A 2VRXA 3VNTA 3EQDA 5HIDA 2WNTA 2YZAA 4TYGA 4AOIA 4V01A 3OZ6A 4U44A 3UIBA 4L3LA 4EQUA 4P2KA 1Q61A 4QYYA 5CLPA 4YSJA 4DCEA 3OD6X 4GJ2A 1M2RA 4BIBA 1Q62A 4PMMA 3FPMA 3GP0A 3LM0A 4A7CA 2XS0A 3ORPA 4EKLA 5IEVA 3EH9A 4DBXA 3VUGA 2ITVA 4IZ5A 4YUQA 5J7HA 2GNIA 4GT4A 4IH8A 5HLWA 4GJ3A 4O0XA 5IUGA 2XYUA 3I6UA 3P5KA 4V0GB 3ZSHA 4F1OA 2OZOA 2VWXA 1DM2A 1G3NA 4EI4A 4FNYA 4S34A 1Y6AA 2AC5A 4I0SA 1R39A 3GC7A 1OIUA 2R3FA 3VUDA 2C6TA 2O8YA 2JKQA 4FV7A 1Q8YA 3D5XA 3UTOA 1ZZ2A 1XH5A 3TIYA 2GPHA 2R3JA 4F9BA 2EB3A 2JDRA 3W0QA 1GZKA 4ALVA 2FSLX 3PXRA 4RC4A 2PVHA 2VWIA 4JI9A 1OZ1A 4ZOGA 4USFA 3H3CA 2PVNA 1UNLA 3AGMA 3AG9A 4C4EA 3UMXA 3ZOSA 2UW4A 2PZYA 4TL0A 5H2UA 3DFAA 4E73A 3ORNA 3KRLA 5KZIA 3F2NA 3EMGA 4WG5A 4G5PA 4JOAA 1NVSA 3BHUA 4Y8DA 4C2VA 5BUJA 5IQFA 5BQ0A 5GJFA 2OICA 1L3RE 3QZHA 3QQUA 4GYIA 4QMZA 3PPKA 2RKUA 2YAKA 3PZHA 5KMLA 2A19B 3QRKA 1PJKA 3EFLA 4ACDA 4XH6A 3SOCA 3GOPA 4CKJA 4DG0E 5AFVA 1KUTA 3E7VA 4FKVA 1AD5A 3U4WA 3U9NA 3JY0A 4AWIA 3QX2A 5IF1A 5DN3A 1CMKE 3EHAA 4U41A 3R1NA 2VNWA 5HU3A 4RPVA 4CSVA 5AA8A 2W4OA 5TT7A 3NNWA 3NUXA 1Q99A 4HNFA 1IRKA 5E7RA 3QQKA 4TWCA 5CEQA 4ZEGA 5B2LA 3MFUA 4XRJA 4IWPA 4J98A 5JGBA 4QMUA 4YBJA 3HEGA 3UO6A 5AP0A 3Q4TA 3R1QA 2PUUA 4EWQA 5A54A 1GZOA 4YHTA 2WIPA 4GIIA 3BYOA 4WKQA 4FKWA 3DTCA 5L8JA 2ZJWA 4PY1A 5TOZA 4BGQA 1SNXA 1FPUA 3QQJA 4GEOA 3NYOA 2GHGA 5T3QA 3PXFA 4LL0A 4AGWA 4E6QA 3ZO2A 4EORA 3M2WA 2OG8A 4KABA 4ZTMA 4GCJA 4D1XA 5LVNA 2YCFA 2Z7QA 3KREA 2Q83A 2LGCA 3IONA 4KAOA 3RMFA 1M2PA 5CAPA 3L9LA 4DH7A 4RZWA 4RA5A 2P0CA 3FE3A 5LCKA 3CD8A 2V55A 1MUOA 3BGZA 3CY2A 3VS7A 1UNGA 3P4KA 3FHIA 5HICA 4DEEA 2Q0NA 1JVPP 5HIEA 5LOHA 2JKOA 4KB8A 3G6HA 4ZJIA 2W1HA 3DNEA 2C1BA 5IQHA 3I6WA 3VJNA 1SM2A 1NVQA 3G9LX 3GEQA 4NZWB 4DCAA 4BCIA 1O6KA 2X4ZA 5EFQA 4K18A 2EVAA 4J99A 4LOQA 3S00A 2VTQA 2X6EA 3EOCA 4ZJJA 4I0RA 4I5HA 4YJPA 3E3BX 2YWVA 1SNUA 4Y85A 5CVHA 4ZSJA 4PL3A 1V1KA 2J5EA 3S95A 3AC5A 4X2JA 1OBGA 1G8SA 4BB4A 4RFMA 5M51A 2X1NA 3OMVA 3F3WA 4MHAA 4GU9A 4FTIA 3FI8A 4FTTA 3UIUA 2YA9A 3WZDA 1JWHA 4U3ZA 2BAKA 4AU8A 1XBBA 4EHEA 3UVRA 2WEVA 4I21A 1NXKA 2WMUA 1B6CB 2I0EA 2JFLA 4FTNA 1YHWA 3BPRA 1NT2A 3BU3A 5CSHA 4BDHA 4FTMA 2UW7A 2UVZA 2PZRA 3EQRA 4M0YA 5E1SA 4YTHA 1H1QA 1Y8YA 4DN5A 2VX0A 3CY3A 3V5QA 3MS9A 3KMUA 3QCSA 1L8TA 4Q2AA 5FD2A 4M8TA 4N0SA 5EH0A 5AAFA 3ANQA 5DT3A 5LVMA 3Q9ZA 3FMDA 2HY0A 2I1MA 2YM4A 2YM7A 4CFXA 2UZVA 4G6OA 5AWMA 3TKUA 4BCKA 4RT7A 4WT6A 4IX3A 4JDJA 4DH8A 5BUIA 2X8EA 3E63A 4FI1A 3TXOA 4FYNA 5ANJA 3ROYA 4NKSA 3A7HA 3BEGA 4WNMA 1B39A 5A3XA 3UOHA 3QCQA 3SXRA 4PUZA 5E91A 4AX8A 3EZVA 2XB7A 2NNWB 4ANLA 5C03A 1WMKA 4GK3A 2JAVA 4AT5A 4H1JA 4HOKA 4QYHA 4RIWA 4KS8A 4KBKA 1BL6A 1TKIA 1YW2A 5CZHA 2Y8OA 3D14A 3H9OA 3P79A 3RZBA 3OXZA 2X7GA 3U8WA 3ZUVA 3D5UA 1WVXA 3EQIA 4LFIA 4YLKA 2CN5A 2VO0A 3I5ZA 4MXYA 2R3MA 4U5JA 4M0ZA 2GHLA 4G34A 4NTTA 5AM7A 4IX5A 1S9JA 4EH3A 5JGAA 1Z9XA 4L7SA 4D4VA 4DF3A 1RJBA 3AT4A 4NM7A 4WOVA 5EHLA 4MYGA 3WZKA 4HGTA 3ZRLA 3C4ZA 5E90A 5CT0A 4BIEA 2E9OA 5KO1A 3GENA 3MTLA 4LMUA 5BYZA 3TTJA 4DEAA 4FA2A 3K3JA 1Y8GA 4I6HA 5FEQA 5DPVA 4AT3A 2OSCA 2B52A 3FMLA 1XBAA 4ZLOA 2XM8A 4FVPA 3PP0A 3LXPA 3C4CA 4O0WA 3BLRA 3MWUA 4I6QA 2XK4A 2V22A 2XIYA 3PJ3A 4WO5A 3ZU7A 2HXLA 3GU4A 3KEXA 5HGIA 5HNIX 5LVLA 5KNJA 4YZMA 4MXCA 3C4FA 4L7FA 4DFLA 3VW6A 1H1RA 3GFWA 3QTUA 5JRSA 4KUJA 2W0JA 4KINA 5KMJA 5H9BA 3PIYA 4FL3A 3F61A 3AC3A 2WMWA 3L8VA 4DFZE 3OTUA 4QP7A 3RP9A 4O2ZA 5BVOA 3QUEA 2WO6A 2J0LA 2OFVA 4FV1A 1P5EA 4GUBA 3WE4A 3MH0A 1M2QA 4EH2A 3QCYA 1FBNA 4AW0A 3D94A 3O51A 4IVBA 2C5VA 2ITOA 2QU6A 4KIOA 3PJCA 5JFWA 2ITYA 3ZLYA 5CU2A 4NIFB 2IW9A 3OBJA 3PTGA 3CTQA 2W4JA 4O0SA 2B9FA 3SAYA 1NY3A 4F7JA 4YTCA 4ZLZA 3FC2A 2NO3A 2OI4X 4O6EA 4EH6A 3CSVA 4XBRA 2OO8X 3OG7A 1U54B 5AP6A 3E88A 5FEDA 5M56A 3GC9A 4O7NA 3PYYA 4HNIA 4BDCA 2PVLA 3U54A 2I7QA 3GQLA 3ETAA 3Q52A 2CGVA 4NSTA 4FSMA 2R3RA 5E8ZA 2VTAA 4N70A 4CT2A 3Q9XA 4EOQA 3H4JA 1WBVA 2HXQA 2QOQA 1H01A 4D0WA 2NPQA 3A4OX 4JX7A 2HIWA 5AUZA 2Z2WA 1Q97A 3GCPA 4DEDA 4DYMA 3LFCA 4R6VA 5KMNA 3ZFMA 3R6XA 3R8MA 4D9UA 3KCFA 4FUYA 2R7BA 3EQFA 4LGGA 3FLYA 3HVCA 4C58A 3OOMA 2OZAB 4FE2A 1YI6A 2I40A 4ANBA 4EH7A 4YHFA 4CMOA 3U4UA 4AA0A 3S2PA 3UG2A 5BX0A 2IPXA 3JXWA 4KKEA 1IR3A 3EN6A 4WA9A 4A9YA 3T8OA 2CKOA 4QTDA 4ALUA 2JDSA 2VWWA 4I20A 4TY1A 3G51A 1PYEA 3LFNA 4KRCA 1OIQA 3BKBA 5CVFA 3WYXA 4IAYA 3AOXA 4M67A 4TYHA 4GFOA 4EOKA 4JNWA 5IMEA 3ZTXA 4FC0A 4H39A 5HE2A 2OJJA 1HCLA 4X2FA 2WMBA 5JKGA 1W84A 5AV0A 2OLCA 3L1SA 1UV5A 3TCPA 4A9UA 3R2YA 4Z9LA 3P1AA 5JRQA 3A4PA 4AGUA 3UBDA 3CBLA 3QTIA 5JFXA 4MVFA 4R7HA 3UGCA 3UPXA 5J1VA 3BI6A 3QD2B 3RAHA 4YLLA 4A9SA 2UZTA 3KULA 5K3YA 4K2RA 1IA8A 5DRBA 3NAYA 4IB1A 4O84A 3RPRA 4DEHA 5KKRB 3CCNA 4YSMA 3NUAA 1IAHA 3UYTA 3V5WA 3IOKA 3ZEPA 3FJQE 3KXHA 2B4SB 3OCTA 4BZNA 3RK5A 2Z60A 3UQCA 4JIKA 5IUIA 1Z5MA 4PP7A 2QO7A 3TJCA 4KIQA 4ANSA 3DFCB 5AV2A 3WARA 3UP2A 3ZDUA 3FZ1A 5JH6A 3KK8A 4FVRA 5D11A 4RRVA 3P9JA 3Q5IA 4AZFA 5HD4A 2YDJA 4J71A 5AIRA 2XNNA 3PUPA 3HP5A 4MXXA 3R9RA 5M44A 2YZLA 3CGOA 4CD0A 2VX1A 3QRUA 1H8FA 2XNOA 4HJOA 2W9FB 4FEUA 4K33A 4PL5A 4PRJA 5EYCA 4BICA 2YABA 4UZDA 2QHMA 2WTCA 2Y4IC 3PJ2A 5BMMA 5HQ0A 1H26A 1LPUA 3L8PA 3NS9A 4KIPA 4KKHA 4D2RA 3COMA 1ZOGA 4QPAA 1JKSA 3F5UA 3II5A 3F5GA 3WF8A 4QTEA 4XBUA 4RVMA 4CLJA 5LCJA 4WRGA 2OF4A 3UQFA 3TN8A 3ZC6A 5L3AA 3BZ3A 3ORMA 4PNKA 3TG1A 2C6IA 5DH3A 3NX8A 1XR1A 4XV9A 1HCKA 1MRVA 1KE6A 4IEBA 4JG6A 4UN0C 2R3KA 4I5CA 2BALA 4KWPA 5C26A 2YM8A 4IDTA 4ZS4A 5EI8A 5AIKA 2VGPA 3CPCA 3LZBA 3NSZA 2G2HA 3SQQA 3VAPA 3RPOA 5CX9A 3VS2A 4G3EA 4ASXA 5BVFA 5ANIA 3WILA 3DBCA 3W55A 2O64A 2UZBA 4I24A 2XH5A 2ZM4A 5HBJA 4QNAA 5EM8A 3GC8A 3FYKX 4XP3A 4JS8A 2J2IB 4M14A 1YOLA 4BDKA 4FV8A 4ID7A 4MX9A 5HBHA 3LJ0A 1JSTA 4FMQA 4DFUA 4F08A 2OGVA 4FV9A 4JT3A 3KMWA 3F2RA 4LGHA 4RX7A 2ETMA 4N6ZA 4WNOA 3V5PA 3WBLA 4V05A 2JC6A 4MK0A 3VF8A 4K9YA 1MQBA 2HYYA 3OWKA 3F5PA 2J9MA 4IWOA 3RPSA 4IX6A 2G9XA 3LCSA 3HA8A 4O7TA 3PE2A 3R8VA 5JZNA 4CFFA 3DBQA 4EHZA 4N6YA 2YDIA 4CZUA 1XH8A 2C30A 5AUTA 3A99A 4ASDA 1J1CA 4E20A 2WTDA 4UYNA 2GCDA 3BE2A 1BUHA 1RDQE 5C8NA 3ZZWA 3ID6C 3H10A 2FVDA 3DXNA 5CS6A 4BTKA 3NPCA 4GG7A 5HVJA 1IASA 4U79A 3R1SA 3ZSGA 4EQMA 3L8XA 3PVWA 3JR1A 3QYZA 2QLQA 4BTMA 3HV5A 2F4JA 2LAVA 4RQVA 2FGIA 3F2AA 4IC8A 5HG5A 3V04A 5J9ZA 4UXQA 4XV3A 4GKHA 3M42A 3R7UA 4JXFA 2Q0BA 2WMVA 4O7WA 4PDYA 4J97A 4DAWA 3Q6WA 4XLIA 2YCQA 2EB2A 3Q4ZA 4GVJA 3EYGA 1IA9A 4YHJA 4AACA 4B9DA 4C38A 4DLJA 1R0PA 2V5QA 3DK7A 1XJDA 5DHJA 3UO4A 4BVUA 3PLSA 4Z55A 3QKKA 4II5A 5LMKC 4Y73A 4YPDA 2VN9A 1VZOA 2VTTA 1TQPA 3HUCA 3ULZA 3EN7A 1OMWA 3FMEA 5A4TA 4BDFA 5EQPA 4ALWA 1R1WA 2ERZE 1ZZLA 2WOUA 2QD9A 2VWVA 4FKOA 1ZYDA 3FLSA 3EFWA 3QRJA 5LXMA 4F4PA 2RG6A 2WQMA 4YJOA 1YXUA 4C3PA 4DGNA 3C5IA 4FEXA 2WMSA 1ZMWA 4FG7A 5HE0A 4I4FA 4DFBA 4M7IA 3OHTA 3W2CA 2XCHA 4JQ7A 3UQGA 5AADA 3IK3A 5AP3A 1YHSA 3TNHA 5HX6A 4F6WA 1TQMA 3FXZA 4I41A 4BTFA 5CAUA 5AEPA 5HO7A 2ZVAA 4F7SA 3U55A 3RAWA 3SKCA 5DR2A 3LJ2A 4IZYA 5CU4A 5GIPE 1EH4A 4WG4A 3RAKA 4YJNA 3VS1A 3R21A 5IQGA 5AP1A 3QD4A 2YJRA 3I60A 4FNWA 3S4QA 2WMRA 3GU6A 4W4WA 2VUWA 3WOWA 4QYEA 4G9RA 4PNIA 1KOBA 2WTVA 4CRLA 1FGKA 3CC6A 5CSVA 5CAQA 3QAME 1H00A 2RGPA 3QZIA 4XG4A 4XS2A 3E8CA 3DJ6A 3THBA 5L2WA 4WNPA 4CFVA 5I9YA 2FA2A 4QP2A 5JFSA 2PE0A 3QTXA 3V8WA 1UWHA 3VJOA 4O0YA 4EYMA 2DUVA 2F49A 2XK6A 3TI1A 4JAIA 5E4HA 2BTSA 2Y4IB 3R9DA 3TEIA 4OGRA 2F7ZE 2W5BA 1V0OA 3CJGA 4XJ0A 3TYKA 3FYJX 4C4GA 5KMMA 2GFSA 2CNUA 4NU1A 3W2RA 2V0DA 4JVGA 4X6QC 4PF4A 1AGWA 5C27A 5I9WA 2UUEA 1FQ1B 4I23A 2PULA 4YJSA 3SV0A 3OTVA 2QQ7A 2C6OA 4AG8A 3CLYA 3DK3A 2PSQA 4I6FA 2AUHA 4LL5A 4V04A 3OUKA 4A07A 1J3HA 1FMKA 3TNQB 4EHGA 4AN9A 3LMIA 3O7LB 2IVTA 4N4SA 2PPQA 4APCA 5I9XA 1B38A 5ITAA 5M06A 4RC3A 2BRBA 2DYLA 4OTIA 3S0OA 1PXOA 2R3IA 5DR9A 5HU9A 2GFCA 1SVEA 3DGKA 5FBNC 3TL8A 2C47A 3COKA 3I0QA 3QWKA 3LM5A 1YXTA 2CPKE 3KRWA 2PUIA 2WGJA 3FMJA 4RWKA 2C6KA 3R7IA 5M07A 5DYJA 4FKRA 3IOPA 3Q32A 5BUEA 3JYAA 3BU5A 3FI4A 3R9HA 4YLJA 1YWVA 2QOHA 3A60A 2X39A 5LQFA 3D5VA 4H05A 4HVIA 1A9UA 2C0OA 4RVTA 5FTOA 1PXLA 1LR4A 3HL7A 4FV6A 5TF9A 4RLKA 5M4FA
chains in the Genus database with same CATH superfamily
4FKJA 2GQSA 3EFJA 3U9CA 3SA0A 2QNJA 3QTRA 5ANOA 5FBOA 5IEXA 2DS1A 3ORTA 4OTQA 5ACKA 3RVGA 5CF6A 1UU9A 3PSCA 5I5ZA 3ORXA 2YCRA 1Q8UA 1YKRA 2C5XA 3NUUA 4M84A 4D5KA 4DG3E 5F95A 3QGWA 3A8WA 2BKZA 2GDOA 3DDQA 3H9FA 3RM6A 3DT1A 4MBLA 2ONLC 3P7CA 2G1TA 2HZ0A 1KV2A 3ALOA 4O0RA 4O38A 4X3FC 4O91A 4CFMA 4EK5A 3FXXA 3IO7A 4QP9A 4E7WA 3NMUF 1SYKA 2ZDUA 4CRSA 3PWYA 5CANA 3KRJA 2UW6A 3MIAA 3VWAA 4Z16A 2XKCA 1PXKA 3NZ0A 3PVUA 4P5ZA 3ZLWA 4WHZA 3K5UA 3MFSA 4C62A 2HZNA 2BAQA 3IPHA 3NW5A 4PDOA 4TWOA 2J5FA 5HG9A 3T9IA 2QOLA 2YACA 2R3NA 3FZSA 3NIZA 4W4YA 3UMWA 3VS4A 3KN6A 3RK9A 1PXJA 1SMHA 3DK6A 2H34A 4X6RA 5H8EA 5M56A 2IG7A 2RFNA 3Q6UA 3PY0A 2R3HA 5KHXA 5F94A 3KXGA 4NW5A 2YIRA 2W1DA 3ATTA 2X7OA 3O8UA 4FKQA 5I0BA 2OF2A 5IDNA 4TZRA 3VS6A 4NH1A 4F6UA 3ZSIA 1H08A 3LOKA 2W05A 4PWNA 4ARKA 1MQ4A 3A7FA 4TXCA 4MNFA 4Z7GA 2FUMA 1YOJA 1ZYJA 2W17A 4QPSA 3RALA 3UOLA 2OH0E 4ZSGA 2JBOA 5JT2A 3IW6A 3Q2JA 5H8BA 1OL2A 2PE1A 4QMXA 4DLIA 4HVGA 4Z7HA 4BGGA 1Q24A 2WB8A 2XJ0A 4F9WA 3KMMA 3CD3A 3TUBA 3G0FA 5CEMA 2HW7A 2R9SA 4MQ1A 2ZV7A 4X7QA 5A6NA 3FAAA 1JKTA 2ITTA 2BMCA 3TKIA 2XM9A 4D58A 5FLFA 4RJ7A 4IB5A 3DA6A 2JAMA 3ACJA 1X8BA 2OFUA 2R64A 4OUCA 3VS0A 3W2SA 2FSTX 3PIXA 4HYHA 5L8KA 3R8PA 3B2WA 1YWRA 3KVWA 2ZFYA 1P14A 2UV2A 3UE4A 3FQHA 4EOLA 5IISA 3SDJA 3UVQA 4FV3A 2DQ7X 3ZLXA 3LFDA 5LMAA 2BVAA 4UWCA 4LDTA 4G17A 4ZZOA 1BLXA 2PMLX 5GINE 4FT5A 4IACA 1WBTA 4GT5A 4G9CA 4ZMFA 3QWJA 5CSWA 2Z7RA 2ZB0A 4CCUA 1OM1A 4KNBA 4IJPA 4NK9A 5JZJA 4FKPA 3VUIA 3CTHA 4AN2A 3F7ZA 3R63A 4E4XA 4YURA 2PVJA 5EI2A 3PWDA 3HGKA 4QP6A 5AM6A 3UOKA 4XMOA 2XJ1A 3Q9WA 4YBKA 4DEBA 3W33A 4MXZA 3D7TB 1V0PA 3VUKA 3OCBA 4JJRA 4RSSA 2HAKA 3VN9A 3HLLA 3OWJA 3R9NA 4FGBA 4U45A 2XRUA 3SGCA 2WTIA 2C5YA 4I3ZA 4OTRA 1E9HA 3R0TA 4F65A 3WZJA 1YWNA 5DVRA 3C1XA 1R3CA 2OWBA 3ZCLA 5L8LA 3VUMA 3NW6A 5E8TA 2YJSA 4RJ8A 2WQBA 5AV4A 3MW1A 3LPBA 2C1AA 1QCFA 4K77A 1IAJA 1FGIA 1Y57A 3BYVA 3DBEA 4RMZA 3PA4A 5KBQA 4C7TA 2BPMA 2YM3A 5E8YA 1JAMA 3UG1A 3NYXA 3QZGA 3RWPA 5JN2A 1PMUA 1OKWA 4IHPA 3QCXA 4PMPA 1GNGA 1M7QA 5IQDA 3ORZA 5AP4A 3NEWA 1YDRE 4J8MA 5IQAA 4EJNA 1IG1A 3LXNA 4FEWA 4JR3A 2XVDA 4M68A 5FEEA 4ASZA 2QCSA 4BDAA 1PKGA 3AMBA 3ODZX 5K4JA 3GXLA 2WU7A 1T46A 2O2UA 4FT7A 4KSPA 3EKNA 3RK7A 2B1PA 3UDTA 1W7HA 3EZRA 3SRVA 3GCVA 3C13A 3EQHA 3KKVA 3WIKA 5BVNA 2Y0AA 3LFFA 5AUVA 3EQPA 4FIIA 2OKRA 1YVJA 2B55A 3C7QA 2VTIA 4FK3A 4ZK5A 4K8AA 3QTWA 2C3KA 3LVPA 2G15A 5GIOE 3OBGA 2ZV2A 1OL1A 1ZY5A 4BJJA 4E26A 3DKFA 3EN9A 5BVWA 4MNEA 4IZAA 5CI7A 3WF5A 4S30A 4BCNA 3REPA 3AXWA 4O96A 3CE3A 2BKKA 4IW0A 1J91A 2XJ2A 2X7FA 4O22A 4PTGA 1PXNA 2WPAA 4RIYA 4RZVA 3ZC5A 5LJJA 1M14A 1M52A 4JMQA 3G6GA 3KY2A 3TTIA 4CLIA 3PZEA 2RF9A 2VTMA 3ZMMA 1ZYSA 3MY0A 1WFCA 5ANEA 3MPTA 2B0QA 2W99B 1GAGA 3I5NA 4QMSA 4FTJA 4UY9A 1WVWA 4AFJA 1ND4A 4I5MA 3MBLA 3Q3BA 5DNRA 4JQEA 2R0IA 2XNBA 5BVKA 5GJGA 4AZTA 4QMOA 2GSFA 3MTFA 5DGZA 5DE2A 3DOGA 1PW2A 2W1IA 3QYWA 2QOOA 4X2KA 3QA8A 5FGKA 1TQIA 3D2IA 3DU8A 4XG9A 3MV5A 3VS5A 5IA4A 1WBPA 3AT3A 2XK8A 3COHA 4H1MA 2GNJA 4OT6A 4NT4A 4PP9A 4YNEA 5AAGA 4WUAA 3HRCA 4FL2A 5FRIA 3LFQA 4C33A 4G6LA 5B2MA 5EYKA 4BCOA 3HMIA 4FGRA 5FM3A 3HV6A 2CNVA 2JITA 5IQEA 1OITA 3FHRA 1WZYA 5CYIA 3MN3A 4QP4A 4FKSA 3BCEA 2HY81 2ZYBA 4K0YA 4LOPA 2QKWB 2PTKA 3W8QA 4A4XA 4DFYA 2QO2A 4BCJA 3PRIA 2VO6A 4DGOA 2HW6A 3OXIA 4YGAA 4QMPA 3WYYA 4YMJA 2BDFA 3G2FA 1GIJA 5J5SA 2YM5A 3W8LA 3AT2A 3ERKA 3BQRA 5G1XA 3RKBA 3EIDA 5HVYA 4TT7A 3NWWA 3QXOA 3EFKA 2NRYA 4U81A 5F1ZA 5CY3A 4LUDA 3W0MA 1M17A 4BN1A 2OIDA 4RIXA 3RI1A 5C01A 5DG5A 4FIFA 4I93A 1BL7A 3VC4A 4BBFA 2J0KA 2KULA 4F9CA 1H27A 1LEWA 2F7XE 4JIAA 4MAOA 4F0GA 4AXCA 3W16A 1M7NA 5AV1A 1TFFA 3VBTA 4BTJA 4M12A 4AOTA 4TPTA 2C0IA 2QURA 3ACKA 3GU7A 2JKMA 3VQHA 2UZUE 5K5XA 2HK5A 4EJ7A 4XRLA 3BL7A 2RFEA 2WEIA 4FT9A 2XIZA 4N57A 5DBXA 3PA3A 3DB6A 3PY1A 4QMTA 5EM5A 4EZ3A 1LEZA 5AV3A 2UW3A 5BPYA 2QOIA 2BIYA 2WIHA 4YPSA 4ZAUA 2Y9QA 5DLSA 4MF1A 1U59A 5BNJA 4GW8A 4DEGA 4M69B 3BBTB 3KIOC 2R3OA 4BBMA 4JBVA 4L01A 3Q96A 4FZFB 3RCDA 1FVTA 4G1WA 4UALA 4JBPA 4TYJA 5HZNA 3VO3A 2WTJA 3GOKA 3OS3A 4EC9A 3C50A 4IX4A 3POZA 4DH3A 1CSNA 4ZY5A 4L45A 4MKCA 2VO7A 3QHRA 5HLPA 3OY3A 4XG6A 3BV3A 3W2OA 1CTPE 5C9CA 1KE8A 2BRGA 3UYSA 3IDCA 4GT3A 4KKGA 4MXOA 3VHKA 4BDEA 5FTQA 4FL1A 4LQMA 4QP3A 4KD1A 4W8EA 4F0IA 1XHAA 3UZPA 3KRRA 3DZQA 3W0SA 5EDQA 5L2IA 5IUHA 2ITWA 4LUEA 3KXXA 4ITIA 4QOXA 3LMHA 5HNGA 1GZ8A 4QMYA 5IQCA 3QQFA 1GIHA 2XK3A 3IG7A 5GHVA 4AT4A 4D4RA 2OW3A 5JFVA 3VULA 4J96A 4E93A 5C1QB 2BZKB 3LFEA 3QGYA 3QXPA 4DBNA 2QOKA 3MPAA 3QZFA 4J53A 4ZIMA 3ANRA 4FKIA 5JSMA 4F6SA 4QQTA 2XMYA 2Y6MA 3K5VA 5DEWA 2OU7A 2BUJA 3FLZA 1U5QA 1VYWA 4QDEA 3KL8A 3ZRKA 4JBOA 4FKGA 3W0NA 1UWJA 5HTBA 1YXSA 1ZYLA 4HZSA 4V0GA 2X2MA 2YHVA 4FTRA 4ZP5A 5K5NA 4DGLC 1RW8A 3VUHA 3QTQA 5EW8A 4E6CA 5T6KA 3OCGA 4NW6A 4MD9E 4QP8A 4J7BA 4C4IA 5M4CA 2O63A 4U0IA 3VF9A 4FSNA 4QYFA 2GS6A 4YJQA 3UNJA 4QMQA 2P33A 3CQUA 4PDSA 3U87A 3A7GA 1ZYCA 4MEDA 2QOFA 3QC9A 4MD7E 4FSQA 3DNDA 4MWHA 1PHKA 5C4KA 5CENA 3DXQA 3W0RA 4FTKA 1HOWA 3BBWA 2F9GA 3A7JA 1DS5A 2W06A 1GY3A 3TNPC 2CLXA 2WTWA 3NYNA 3OP5A 5B7VA 2R3LA 4ACHA 4YJRA 4YJUA 2W96B 3PPZA 4LYNA 3UNZA 4B6LA 2WMQA 4AS0A 4E1ZA 2PVMA 4S2ZA 4C34A 1PF8A 3UZRA 4B7TA 4F9YA 1BKXA 4C4FA 3E87A 3UZTA 5IH5A 3Q53A 4WSYA 4FZDB 3S3IA 5ANKA 4J95A 2Z7SA 2JGZA 4G6NA 1F0QA 4HZRA 3ZHPC 2WKMA 4PTCA 3TUDA 2W1GA 4U6RA 3BWFA 2W7XA 2IVVA 2X8IA 1XH4A 3SHEA 4XUFA 3Q4UA 4DTAA 4AA4A 4D5HA 2XK7A 1J7UA 4UBAA 2JDTA 5CQWA 4AFEA 2G2IA 3R7YA 3IGOA 4DTKA 5CSPA 2IZRA 3BGQA 4LI5A 4YO4A 4AGCA 4B4LA 2WD1A 2HELA 2ZAZA 4HPTE 4DE4A 2Y6OA 3ZM9A 2XKEA 3BLHA 4RVKA 5CU3A 5BVEA 3O96A 3EB0A 5KE0A 4OLIA 4F99A 4FEQA 1GJOA 3QUPA 3ORIA 4JR7A 3U6HA 2O0UA 4FTLA 1PY5A 4LV8A 4W4VA 3KF4A 5K9IA 4X2GA 1XH7A 2HWOA 1U46A 4U97A 5ETCA 4BZOA 4DG2E 4HVHA 3F3TA 4D28A 2Y4PA 2FB8A 3D7ZA 4BF2A 1UA2A 2B9IA 2C5OA 5AJQA 4ZSLA 1R0EA 3QRIA 3M11A 4ZTNA 3QD3A 4AOJA 2A0CX 3QC4A 1E1VA 1WBWA 2PYWA 4YC8A 5E8UA 4PDPA 2I0YA 4L46A 4XP2A 3GGFA 2IN6A 4Y72A 1UU7A 2WMAA 4I1ZA 3E8NA 2CGXA 4BDDA 3DB8A 4O7YA 3T9TA 4OTDA 3GI3A 5EM7A 3KN5A 2PUNA 2WTKC 2CKQA 4TKSA 3PFYA 2C5NA 1SVHA 4IAAA 4FSTA 4OBPA 3NNXA 4WD5A 4LMNA 3PJ8A 4RJ6A 2BDJA 3FLWA 4DINA 4HGLA 2F7EE 3WIGA 4FNZA 4FZ7A 3OY1A 2QKRA 4BGHA 4LV7A 1QPDA 2R5TA 3P78A 2IZUA 3W32A 5A4QA 4R3RA 3F7WA 4XV1A 1OBDA 5CXZA 5AAEA 4UX9A 5HBEA 3BHVA 3IS5A 4L67A 4O7OA 3MPMA 4TTHB 3NDMA 3AC8A 3UVPA 4EK3A 4NUSA 3FEGA 4C35A 4M97A 4U98A 2J90A 2SRCA 3OFMA 3QRTA 3PP1A 1UU3A 2VD5A 4WBBB 4R1VA 2JFMA 4BHNA 4IAKA 5H3QA 4O82A 3O5AA 4MXAA 3I81A 1W0XC 2O3PA 2RFDA 3O7LD 4FODA 5HCYA 2CGWA 2HWPA 2PVRA 4GS6A 4ZS0A 1WCCA 2OH4A 3R22A 4FVQA 5HD7A 4BDBA 4E5AX 1I44A 2GQGA 2UZEA 2XNPA 3IGGA 3PPJA 4W8DA 3K2LA 4F0FA 3DKCA 3PY3A 4EZ7A 4FKTA 4ERKA 3P23A 2JIUA 4OBOA 5EOBA 3FY2A 3OWPA 4HGSA 2XCKA 3HZTA 4O7RA 4DT9A 4ZSAA 4BDGA 3RPYA 2VNYA 3PFQA 3G15A 3V5JA 1CM8A 2WQEA 1JKLA 4A06A 5B0XA 3POOA 4WG3A 4JLCA 4KBCA 4FZ6A 4YC3A 2ITPA 3MIYA 4B8MA 3PSDA 1SZMA 3WF9A 4O0VA 1Q8ZA 2WHBA 2IW6A 5JQ8A 5EW3A 4BR3A 3RM7A 3PXQA 4EUTA 2BRHA 2BROA 3LIJA 5AUXA 3W2PA 4LG4A 3MVJA 4M15A 5DT0A 4EH9A 1OPLA 4BIDA 3GT8A 1KV1A 4FV5A 3QTSA 4CV8A 1WBOA 5ANGA 2ZM1A 4LRMA 4P7EA 3VQUA 3ML1A 1ZMUA 3BV2A 4MWIA 3LFSA 5LVOA 2F2UA 2QO9A 4RJ5A 3VS3A 3WZEA 4GG5A 1OL7A 4YTIA 2X6DA 4B0GA 4CZTA 2F2CB 3EN4A 3D15A 4EUUA 1BI8A 2BRNA 3P7AA 4G16A 3UODA 5KMKA 3AD4A 1UKHA 4FOCA 5A46A 1YQJA 3IW8A 2FSOX 4XG2A 3ZZEA 3PXKA 2OIBA 2X81A 3VBVA 2ZOQA 5LVPA 3KF7A 4CXAA 2GTMA 1S9IA 1G8AA 4O83A 5E9EA 3F3ZA 4FNXA 4O0TA 4EEVA 3NNVA 3OUNB 3EQCA 1CKIA 1FINA 3MJ1A 5E1EA 2QVSE 4HVDA 1PYXA 3C51A 4Q5HA 4PMSA 3JPVA 4XLVA 3IDPA 3W0OA 4BCQA 5HX8A 3CTJA 5LMBA 3E3PA 3KB7A 4APPA 4JRVA 3G90X 2C4GA 4FTOA 3R7OA 1ZAOA 4AZVA 4BCGA 5BYLA 5CI6A 1OKVA 2O5KA 2YCSA 3KGAA 4EBWA 3DXPA 4ZZNA 4G2FA 4R3CA 4EH4A 5IA0A 1FVRA 3K54A 3KXNA 3OEZA 3PSBA 2JLDA 3P86A 2WZJA 5I4NA 2IJMA 3JVSA 3OW4A 4HCTA 4D2SA 4YJVA 2XNGA 2WTKB 2A4LA 4ACMA 2GNFA 3IECA 5CF4A 2XNMA 3C4WA 3W10A 4BCHA 5FTGA 1MRUA 3MY1A 3ORLA 1BYGA 4UWBA 1U54A 5HTCA 4XHKB 5T68A 1J7LA 4JG8A 1O6YA 3TV4A 2VGOA 5EOLA 2CHLA 4FKLA 4BYJA 4P5QA 1DI9A 1OL5A 3ITZA 4MD8E 1QPJA 3WE8A 1KSWA 2PZ5A 3R9OA 3OF0A 3KA0A 4DC2A 4Y5QA 2YN8A 4UEUA 2EXCX 5D12A 3C4XA 1RQQA 1J7IA 3HX4A 3TIZA 4J52A 4H3QA 5HIBA 4JDIA 3BQCA 3FZRA 2FYSA 3H9RA 2J7TA 2VTJA 1WVYA 3G9NA 4BHZA 5M53A 3R30A 4EOIA 3F69A 3ORKA 2OZAA 3AGLA 3NLBA 3BU6A 3ZXTA 4AW2A 4IAZA 3NUYA 5D7AA 1H07A 4FSUA 3FMNA 4G31A 5D9HA 3ZXZA 4R78A 3HKOA 3BGPA 4ENYA 2C6LA 2RFSA 3G33A 3ET7A 3LE6A 4CKRA 4EH5A 1KE7A 5IA1A 5CALA 3LFAA 3P7BA 4C37A 3H0ZA 4QNYA 1H0VA 5AP5A 4ASEA 2C3JA 2W1FA 1YI4A 3RNYA 3O8PA 3SOAA 1FOTA 2CSNA 3MB6A 2OJGA 3SD0A 2GNGA 2ZMCA 1Q8WA 3NCGA 3O8TA 4U94A 3LFBA 2UW0A 5KUPA 2WAJA 1PXIA 3RJCA 1VEBA 1APME 2IVSA 3QFVA 2YWPA 3MVHA 4FKUA 4IM3A 5DOSA 2VTSA 4ZTQA 5HO8A 2X9EA 4AZSA 4R5SA 4BZDA 5DR6A 5IDPA 1ZY4A 2VWBA 1Q3DA 2WQNA 2R2PA 3A7IA 1H25A 1VJYA 3AD5A 2CN8A 3B8RA 3E92A 4O21A 4KSQA 2GNLA 2PHKA 4R77A 5HORA 3HRFA 4U42A 5EQYA 1XQZA 3E62A 3IW7A 3BHHA 5HG7A 3WZUA 2CCIA 5HNBA 4WRSA 3FXWA 3ZBXA 5IZFA 5ETIA 4FSRA 2WELA 4MQ2A 3DBFA 4EK6A 4ZY6A 3GCSA 3SW4A 3CQEA 3W0PA 4A4OA 3FSFA 3KQ7A 4GIHA 4FTAA 3LCTA 2FH9A 4O2PA 3V51A 5D7VA 4EKKA 4WZYA 2OXYA 3HP2A 2JIVA 4RWIA 3TZ7A 2YITA 5A4CA 5LWNA 4IMYA 2XIRA 4HPUE 5IMXA 2QOBA 4RX9A 5TKDA 2OIQA 3PG3A 5M55A 5H8GA 4RIWB 2GHMA 3I0OA 2UZOA 4L53A 2HZIA 4ANQA 3ZEWA 4QMNA 5KZ0A 3LCKA 4ENXA 4KBAA 3AC2A 4IVAA 5EYDA 3WF7A 4CVAA 5KX8A 4A4LA 5KCVA 3BHYA 3KXMA 5HVKA 4C0TA 3R71A 2B54A 4JRNA 3AMAA 4CCBA 3I79A 2XEZA 2X0GA 3ALNA 4R1YA 5JK3A 3AD6A 2XBJA 3FDNA 3C5UA 1RE8A 5HKMA 3QU0A 3QBNA 1W83A 3LXKA 3DPKA 2XIXA 4UYAA 4MBIA 4BDJA 3DLSA 3I1AA 4Q9SA 4A9TA 3V5LA 3K3IA 1XBCA 4CV9A 2XK9A 1OIRA 3E93A 1R78A 4GFGA 3TM0A 3FLNC 2C0TA 3SG9A 2B53A 2P55A 4FIHA 4HCVA 4AAYA 4EH8A 2QI8A 5BVDA 3B2TA 2HZ4A 3BLQA 3OOGA 5IA5A 4M3QA 1DAYA 2BRMA 4ERWA 4BI0A 3H30A 2J50A 3R01A 1ZARA 4IQ6A 3TWJA 1DI8A 3NUNA 3FL4A 1XWSA 2PL0A 4IB0A 3TKHA 3IKAA 2CKEA 2VTHA 5M4UA 4R5YA 4RVLA 5C8KA 3ROCA 3IDBA 1F5QA 4E4LA 2BILB 5FXQA 2VTNA 1W98A 1XO2B 1YHVA 2DWBA 5DIAA 5DEYA 1G8KA 2J6MA 3A61A 5EK7A 3SXFA 3VHEA 3CQWA 1PMVA 2ACXA 2BFXA 3FLQA 2X2KA 3TACA 1WAKA 5ICPA 2VV9A 3V5TA 4FTCA 3RHXA 5CF5A 4L52A 4DHJA 4CMTA 3LLTA 2X2LA 3D83A 1WBSA 5EKNA 1P2AA 3MDYA 4NFNA 4IAFA 3GNIB 1E1XA 4K11A 2VWYA 2QLUA 5DA3A 4DITA 4ZSEA 4K1BA 4YU2A 5HE3A 5HLNA 2C69A 4D1ZA 4RFYA 4JBQA 4UXLA 1GIIA 5AUYA 2W9ZB 1U4DA 4XNEA 3SX9A 3MYGA 2PMNX 2FSMX 1ST4A 4PQNA 3V6SA 4FSWA 3PG1A 2HENA 3V3VA 5HCZA 1PKDA 3KK9A 4Y95A 5M57A 3ZBFA 4Y5HA 4GVAA 5J95A 4F09A 3QKLA 3PVBA 3PLAE 1ZMVA 3TDVA 3VVHA 2CJMA 3LLAA 2KTYA 2UVYA 3AQVA 3A2CA 2CNQA 3HYHA 4X3FB 4TRLA 2E9NA 4QT1A 4YZNA 2CDZA 3EQGA 2GMXA 2PVYA 3VBQA 3HMOA 1OIYA 4AGDA 3OCSA 3T3UA 4EBVA 3GQIA 5FP5A 5J87A 3DTWA 3NAXA 3ZFXA 4C59A 3JVRA 4GL9A 2ITNA 5J9LA 2XKDA 4IFCA 5D41A 3C0GA 4TYHB 3BYSA 3GVUA 3ZUUA 1OL6A 3ODYX 1JLUE 4OTGA 2PK9A 5FP6A 3ZO3A 4BI1A 3LJ1A 2YDKA 4XG7A 3N9XA 2OJIA 3B8QA 5A6OA 3E64A 3DAJA 2PU8A 1QL6A 2ZDTA 3OWLA 4YC6A 5DWRA 1OVEA 4S32A 4K6ZA 2BAJA 4FG8A 1W8CA 2GNHA 3E8DA 4L6QA 4NCTA 4A9RA 4MBJA 5I9UA 1CKPA 3KULB 4S33A 4BRXA 4BY9E 1SVGA 5KBRA 4NM0A 4HYSA 4BC6A 4E8AA 5L2TA 4FG9A 4EWHA 2H8HA 5F4NA 5A4LA 4C02A 2YFXA 2A1AB 3VRZA 3CEKA 4I94A 3MVMA 3HMPA 5EQEA 3ATSA 4HGEA 3I4BA 1W82A 3OT8A 5F20A 4FEVA 5M08A 3JUHA 1JOWB 3RTPA 4Y83A 2NRUA 5I9ZA 1UKIA 4GSBA 4GU6A 3LAUA 3QKMA 4O7VA 4C3FA 1QPCA 1Q41A 4GUEA 1UU8A 4JQ8A 2CGUA 1FVVA 2ZB1A 4NL0A 4O7LA 4C3RA 2R3PA 3BX5A 4O7PA 4AA5A 4DA5A 5CT7A 2J0JA 5M09A 3I7BA 3QTZA 2PVKA 4O27B 1AQ1A 4QEBA 2J51A 4C4HA 4FIJA 3CJFA 2HCKA 5FG8A 2C6MA 2BZIB 4J1RA 3BRBA 2XF0A 4IE9A 3ENMA 4D0XA 2ESMA 3PDTA 3O2MA 1K9AA 5B2KA 2W1ZA 3C9WA 4AZEA 3R1YA 3HV4A 1A48A 3WF6A 3IW4A 5ETFA 1GOLA 4C2WA 3UIXA 1NW1A 3P08A 4ACGA 4FZAB 4OW8A 4PV0A 4RA4A 4QTAA 5IQIA 3R00A 3SG8A 3FMMA 3UDBA 4F70A 1O6LA 5IA2A 5EI6A 4CGAA 2VZ6A 3LCOA 4ACCA 2CMWA 4BCPA 4E4MA 4XV2A 1UNHA 3BYMA 3KFAA 3PRFA 4B99A 5FDPA 5J9YA 2XA4A 2P4IA 2YIQA 4EZ5A 4DTBA 4IBMA 3BEAA 4RJ4A 2PWLA 4EL9A 1K2PA 4USDA 5AX3A 3G0EA 2JEDA 3FSKA 4TNDA 2GTNA 2GU8A 3P0MA 4QMWA 4AXAA 5CAVA 4LRKA 2FO0A 2WQOA 4P90A 3V8SA 5FXRA 5J1WA 1ZXEA 5CNNA 2IWIA 3TZ9A 3FUPA 5GJDA 2Z02A 5HCXA 1QPEA 3GCUA 1VLRA 3R28A 5D1JA 3NYVA 2PZPA 3KXZA 4R7IA 3KCKA 2IZTA 2XARA 5JMSA 3VBXA 1JBPE 2X8DA 4L44A 1OKYA 5EG3A 4ZXTA 2XP2A 3AKLA 3HA6A 5AX9A 1YDSE 1NA7A 4IIRA 1OUKA 2ITUA 4GK2A 3F6XA 5LMKA 2YAAA 5CTPA 5FQDC 5TO8A 3LQ8A 3GU5A 2E9VA 1ZWSA 1H1WA 3DJ5A 2XUUA 3R83A 4D55A 3MSSA 4HVSA 2BR1A 3HAVA 2W1EA 1YRPA 1Q8TA 4QRCA 3Q2MA 3DKOA 2VTOA 5KKRC 4O81A 4ZTHA 3VBWA 5EDPA 5L6OA 4O86A 4XG3A 2UZWE 4IM0A 3RWQA 5AP7A 4YTFA 4IADA 2J0MB 3EWHA 2BZJA 1V0BA 4IWQA 2PVFA 5LARA 2WOTA 2PY3A 3VBYA 3FPQA 3AC4A 1G5SA 2OK1A 3UDZA 3I7CA 4Z3VA 3DKGA 3LW0A 3FC1X 4O6LA 4JG7A 4TWNA 3RPVA 4IC7A 5C8MA 5AMNA 4IVDA 1QMZA 4CQEA 5C4LA 5L6PA 4IZ7A 4UWYA 2BTRA 2OXXA 1KWPA 2OXDA 2YEXA 3CP9A 1OGUA 4H3PA 4EK8A 3D0EA 3QX4A 4KS7A 3QL8A 1KE9A 1I09A 3CR0A 5E8SA 3DLZA 3MGYA 1H1SA 4IJ9A 4UV0A 4ZTRA 3CGFA 4OTHA 4WNKA 4YO6A 5CEOA 4IB3A 2YM6A 4L00A 3HAMA 3G5DA 2XZSA 3QLFA 3LKMA 4I6BA 2B9JA 3GU8A 4FICA 3O0GA 2BDWA 5EYMA 2J0IA 5CZIA 5CASA 2V62A 3TZ8A 4ANMA 4U8ZA 4NYEA 1URCA 4PMTA 2QU5A 3QALE 4B8LA 3S1HA 5G6VA 4DHFA 4AXEA 5DI1A 4IFGA 1Q4LA 3D7TA 2ZV9A 2QR7A 4H3BA 3LXLA 4FT0A 2REIA 4NKAA 4RBLA 3OVVA 5L6WL 5CEIA 3HMNA 4RWJA 1H0WA 4QP1A 4BYIA 4CTBA 5CQUA 1ERKA 3MB7A 4DH5A 4F64A 4QMLA 3UJGA 2P3GX 4D1SA 4EQCA 5IH6A 4WBOA 4EOPA 1XMLA 4D4SA 5KHWA 1GZNA 2JKKA 2XIKA 4ZJVA 4XX9A 3ZH8A 5HG8A 1OPKA 3NRMA 3ZDIA 3F9NA 2UW9A 3R2BA 3QQHA 3M1SA 5JGDA 2I0VA 3MH2A 2QOCA 4OBQA 4FIEA 2PMIA 3NGAA 4XOZA 4X3JA 5CVGA 4ONAA 4PL4A 2XAOA 1PRYA 4QMMA 4CTCA 2PUPA 3TUCA 2ETKA 4RFZA 1VYZA 4G3DA 4DEIA 1URWA 1XH6A 3UOJA 5DT4A 3RINA 4CG9A 3TNIA 1DAWA 2UW8A 3WI6A 1H1PA 5M4IA 1H28A 2RIOA 3NUPA 1KOAA 3HDMA 2ITQA 3R04A 3R7VA 2B7AA 4FV4A 4JDKA 4AF3A 4D4YA 2ERKA 2ONLA 4TN6A 3U51A 1J1BA 4S31A 4X3FA 3ZO1A 5CEKA 2GQRA 3DBDA 3OROA 4L3JA 4DHIB 1H24A 3CIKA 3ZONA 5CSXA 2G2FA 4RLLA 4GKIA 5CEPA 4RX8A 1A06A 3F82A 4F1MA 4DT8A 3OW3A 2ETRA 3O23A 3VIDA 3HDNA 3DCVA 1H4LA 3LHJA 3PXYA 4KA3A 3ZFYA 2O65A 4L42A 3EYHA 4J8NA 5TR6A 3O50A 3OXTA 4EOMA 3KRXA 2WU6A 5IH4A 2IO6A