4R7CA

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with dimethylammonium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
KDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
molecule keywords Potassium channel protein
molecule tags Transport protein
source organism Bacillus cereus atcc 14579
total genus 34
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r7cA00
3SPJA 3E8GA 4JTDB 2Q6AA 4P30A 4PA4A 4BW5A 3AG1C 4MW8A 3AG3C 4PA7A 1M56C 3X2QC 3SPHA 3T2MA 4MTGA 4G27B 3T4ZA 3F5WC 4GX2A 4MVZA 4RO2A 4MW3A 4WFEA 3SPCA 4LBEC 3E86A 2ITCC 2WLNA 4PDVA 4MTOA 4GX5A 3SJQC 2WLJA 1V54C 3VOUA 1OCCC 1ZWIC 2DWEC 4HZ3A 4X89A 4WFGA 3RVZA 2NLJC 2KB1A 3SYQA 5EK0A 3ASNC 2Q67A 3K03A 4ZBMA 2W0FC 4KFMA 5EC1C 1R3JC 4X8AA 4CBCA 4GX0A 2EILC 5B3SC 4XDJA 1S5HC 1JVMA 2JK5C 3ZJZA 4H33A 3K04A 1BL8A 4PDMA 1K4DC 5CBFA 3LDDA 5BZBA 2K1EA 2DYRC 3LDCA 4XDLA 3GB7C 3AG4C 5B1AC 4OXSA 4MS2A 3HPLC 4MVRA 4P9PA 3K0GA 3T1CA 4WFFA 2EINC 3E83A 2ZD9A 2QTOA 2EIJC 2WLHA 1LNQA 1R3IC 3OR6C 3WG7C 5J9PC 2BOBC 2IH3C 3F7VC 1ORQC 2H8PC 4RUFA 1R3KC 3ABKC 2ATKC 3E89A 3IGAC 3UKMA 3ZRSA 4QE9A 3STZC 2A9HA 3E8BA 1M57C 1G4YB 3KG2A 1OCOC 3E8HA 2R9RB 2IH1C 5IY5C 5KUMA 4I9WA 3FB5C 1OCZC 4F4LA 4MVQA 4X88A 4P2ZA 3LNMB 4PDLA 5E1AC 3UM7A 3TETA 4JTAB 5EBMC 3LUTB 4RAIA 3SYPA 3STLC 5CBGA 4R50A 4DXWA 3K0DA 3RBZA 1XL6A 3JYCA 4MVUA 2AHZA 3OUFA 4R7CA 4MVSA 4R8CA 2AHYA 5EBWC 4HYOA 2X6AA 3E8FA 3OGCC 1XL4A 2QKSA 2EIKC 2WLKA 4R6ZA 3RVYA 3R65A 3LDEA 4J9YB 2OCCC 2P7TC 3RW0A 3ASOC 4UUJC 5EBLC 2ITDC 2HVJC 4P9OA 2WLIB 1K4CC 1P7BA 2WLIA 3K06A 4MVMA 2EIMC 4GX1A 3SPGA 3FB7C 3BEHA 1OCRC 3TCUA 3SPIA 4LP8A 1QLEC 4PA9A 3IFXA 4LCUC 2HVKC 2BOCC 3EFFK 3SYAA 4EKWA 1KKDA 2Y69C 2A79B 2HJFC 2X6CA 2Q68A 3SYOA 1J95A 2YEVA 2HG5C 3SYCA 4G28B 4WFHA 5B1BC 4QE7A 2Q69A 4PA3A 4MVOA 3AG2C 4MTFA 4MSWC 3ABLC 2DYSC 5EC2C 3K08A 4H37A 2X6BA 4RUEA 3OUSA 4PDRA 1V55C 1R3LC 2A0LA 3ABMC 2DWDC 3T4DA 4QNHB 3FB8C 4XDKA 2HFEC 2WLMA 4J9ZB 3FB6C 5KUKA 3F7YC 3OR7C 2ZXWC 3PJSK 5CBHA 4TWKA 4PA6A 2WLLB 2WLLA 4JTCB
chains in the Genus database with same CATH superfamily
3E8GA 3N2KA 3AG1C 1SQBH 3VQXA 1NVPB 1F4NA 4QGPA 1FD9A 5LA6A 1GMGA 2ZCEA 1P4RA 1SKVA 4G2KA 2DWEC 4I0XB 1YI2V 2VQFO 3ZRWB 5B3SC 2EILC 1YSCA 2DMXA 4LF8O 2ZE8A 4I4TA 3LDCA 4LH6A 2YS8A 4MVRA 4FZ1A 2IBZH 1GM9A 2ZD9A 1BGYH 3QO7A 2BOBC 3CRQA 4RUFA 1FJGO 1GTOA 3P30A 2UUBO 2A9HA 4JI2O 5EIBD 1P49A 2UXXA 4YHHO 3N2GB 2Q0OC 4JZ2A 1I7FA 4F4LA 3IAYA 4X88A 2ADPA 5EBMC 3QF7A 4GKJO 3CCQV 2Q5ZA 1HP8A 2EZPA 1XL6A 2C2AA 3JARB 4GCZA 4BIOA 2AHYA 3CMEV 3M7MX 1JOYA 2BSKB 1AP6A 1F7YA 4DRXB 4F6EA 1D2DA 5IWAO 1H8EG 4TV8A 1AR1B 3APOA 2ETNA 4LFAB 5CB4B 3AG2B 4NXMB 1AI7A 1KYOF 2DYSB 3SJCC 1WN7A 1GN4A 4YXWG 4DR3O 1KKCA 2X0LA 4OX9B 4O2BA 4CZZA 4JI6B 4JTCB 1TVKA 4KHPO 3FAVA 2V1DA 3FYEB 2JJ2G 4X20A 4UVAA 1OJHA 2WA4A 1Q90D 2Q73A 1JA8A 5JCOC 4K35A 5JVDA 3W7TA 2XTAA 3ABMB 5LGTA 2BTQB 1GRJA 1K8AW 2GHYA 1KP2A 1UFIA 2PGGA 3K03A 4ZBMA 2JS3A 4X8AA 4FM1A 2NR5A 2JK5C 3UO2A 3MD0A 5CA1B 5LHHA 1MG1A 3K9AA 2DW4A 2GTSA 1JR9A 4P9PA 1QNMA 2PTMA 4FPPA 3WG7B 3E83A 1WJZA 5B5EZ 4TSFG 3T1HO 5J9PC 1P7GA 2P22C 1R3KC 4DR2O 1V54B 2JVDA 1VQ4V 2Y0IA 2W6JG 4FLXA 1T5EA 3E22A 1MA1A 1ZLZA 2LO1A 5IY5B 4X64O 1SETA 2E5LB 5IYZA 1H2SB 4HNAA 4MVQA 4P2ZA 2OYQA 5EYPB 4X9QA 3FD9A 3ZX6A 2FKXA 3O9OA 5IYDO 5IDJA 1IBKO 3CS5A 4R7CA 3CXCU 4ASUG 4YJ3B 1VQ6V 1K7DA 4YY3B 5K1PA 4MVMA 4GX1A 1XI1A 1AILA 4UXNA 1ENVA 3RYHA 1ZAUA 4YIPA 3CWBH 4LCUC 4EKWA 3ZBHA 4DR1B 2Q68A 1J95A 1TGOA 2HG5C 4IT5A 5JH7B 1SQGA 4B3TO 3CRMA 4A5UB 4YJ2B 2IU0A 5LMUO 1IVSA 2LW7A 1PNLA 4JAVA 1XREA 3DXRA 2OIEA 1E79G 3P3NA 1BHAA 4AQYB 3G4SV 5BY1A 3CC7V 1XMOO 4NVPA 3T2MA 5LXTB 4MW3A 3E86A 2GSMB 1FXVA 4WBNA 2ZINA 3LNNA 4GYCB 1NTZH 4TUYA 2ZXWB 3EVKA 2ZQMA 3HKBA 4DV0B 1XNRB 1Q82W 3AEIA 4CH3A 4H13B 3B40A 2BCCH 2NN4A 3ZIAG 2F93B 2YIBA 1HDJA 4J11A 2JGUA 2WLHA 1YZBA 2P90A 1BT8A 4X66O 1GN3A 1FXKA 2ZNJA 3CEIA 1URFA 3H9VA 4DV4B 3E8HA 4E2LA 3K5LA 2QWQB 1IZ3A 3HKEB 2XNDG 2QSAA 1PD3A 3TETA 2F23A 2HHHO 4DK1A 2EINB 2UXDO 1M9NA 4FLWA 4R8CA 3ABKB 5TISZ 3FYIB 1YF2A 4NYKA 3SPGA 1PV0A 2ZT9B 1J5EO 1QLEB 1SESA 2MW2B 5LP6C 3SPIA 2Y69B 2HVKC 4WCEV 4X1YB 2HJFC 1WPBA 2UXCB 3CCJV 2W6IG 1Q5OA 3BA8A 1HNXB 2JGDA 2Y4TA 1MSDA 4UV8A 5FNVA 2LGWA 1Q43A 4UCOA 1FAFA 2NNUA 3FB8C 4JYYA 3CJHA 2EIMB 1KMIZ 4FIPC 3D36A 1I0HA 4P30A 1XMQB 4MW8A 5KAIZ 1NTMH 1COWG 4G27B 2ZM6B 4MVZA 4DR5O 3BPZA 1CEZA 2ITCC 2B9ZA 4MTOA 4ZHQB 4GX5A 1ZWIC 4WFAV 3SYQA 2Y4UA 4UVCA 1EFRG 1FFXB 3S3XA 1GAXA 4GX0A 3AK2A 3ZJZA 1VF7A 2RJZA 3L9DA 2H94A 5CBFA 1G8MA 3LDDA 5IJ9B 3X2QB 4CS2A 1PM9A 4IHJA 1VQPV 3LSUA 2JRIA 4TT3G 1K3EA 2QR4A 2FYUH 2R72A 4QE9A 2BE3A 5GTHZ 3KG2A 5JJNB 1PP9H 3MHSC 3CCSV 1W2BU 2YEVB 1N36B 1KP3A 1MNGA 1Z5WA 3JAKA 3ZHSA 5L3EA 3CHXA 4J9YB 1GH6A 5KMGA 4P9OA 1AI6A 2IU3A 4J7KA 2CK3G 3SYAA 2FB5A 1NBMG 4DV1O 3ZHQA 2HR3A 1GK9A 1QR8A 4FFBA 5LGNA 1VQ8V 5LA6B 3QVNA 2IW5A 3JCZA 4HAMA 1VMGA 1WA8A 2AZ2A 1BZKA 3ABMC 1SF9A 1GN2A 3F7YC 3TK1A 1OCRB 2WLLA 5F2VO 2F1MA 3IC7A 3GWKC 4NXNB 3SPHA 2QKCA 1N8RW 1N33B 5H6QA 4LF6B 4O4IA 4I55B 3SJQC 1VIBA 1V54C 4HZ3A 2NLJC 1QHTA 2W0FC 4DUZO 1AR5A 3TXSA 5DECA 4DV7O 4JV5O 4HBNA 3CXHF 3UO3A 1DK1A 2OIGA 4DR4O 4XDLA 2XAQA 3HB3B 1KD1W 5B1AC 3P32A 4DUYO 1IURA 3T1CA 1ZL8A 4LF9O 3UT5A 2ILMA 4K3AA 3K79A 2VQFB 1HR0O 2V4DA 3OEHG 3F5TA 1NR1A 4LF8B 3H1KH 1NH2D 3ZMUA 1XQ8A 5CA3A 4TV8B 5IYBO 3RYFA 2DYRB 3AG4B 1K33A 5CN0A 1RFYA 2YIDA 3G6BA 5JJEB 4NR1A 1PKXA 1FJGB 2UUBB 3RYCA 4I50A 2EIKB 2QKSA 4JI2B 4O2BB 3LDEA 5LL6Y 2E3CA 5LHIA 2HVJC 3P3PA 2QTSA 4I5SA 1TVKB 1JX9A 3MAQA 1B06A 1SQQH 3FAVB 2PY5A 3EFFK 4X20B 4GKJB 4Q20A 1IXBA 1QU7A 4G28B 5B1BC 1GN6A 3ZEDA 3HR0A 3UQ8A 4JI0B 1ZTEA 3D3IA 3ASOB 4UCUA 3T4DA 3FB6C 4O4LA 2ZXWC 1OHHG 4GZRB 1ZSPA 1GM7A 2UUCO 4X65O 3OMNB 4KL1A 2ZIOA 3G6EV 5LMNO 3RWRD 3CYOA 1R73A 1BCCH 1JFFA 4DR3B 1L0LH 2OWOA 1IBMO 1AROP 2EX3A 2YICA 4AILC 1R6TA 4LNUA 4FLTA 4U7NA 2QEXV 4LR3A 1Y76A 1Q8IA 4KHPB 4MTXA 3CCVV 4JASA 3B8MA 4H33A 5IYZB 5KX5A 4HNAB 4LFCO 5KHHA 3H01A 4C7UA 5J2TA 2OTJV 1VARA 3JSNA 5FL7G 5D5QA 2VWKA 1SA0A 2ODMA 2EIJB 3CCMV 2EINC 1TUBB 5JCOA 1Y4MA 2H8PC 3JALB 3ABKC 3J80N 3K58A 2N05A 1H8HG 2DJVA 3K5NA 1B6QA 3L72H 4ZOLB 4LFBO 5D5PA 2XAJA 1NKDA 5KUMA 4JI8O 2JEXA 3OD4A 3SDLA 5KAFZ 4B3MO 3T1HB 3LUTB 4DR2B 1BE3H 2HEPA 5ITZA 2JJ1G 5GW7A 2IJIA 5LYJA 4L87A 4O2AB 3IC9A 1DF5A 4X64B 4DK0A 2EIMC 4D7SA 3OTFA 2PYLA 3DXRB 3G67A 1EM1A 4O4JB 4PA9A 2YDEA 5JWPA 2Z0AA 4O4HA 1IBKB 2ZR2A 4PV1B 4WBNB 3OUSA 1R3LC 3HKDB 1F51A 4QNHB 4TUYB 4N23A 4BWAA 4JTDB 4PA4A 4B3TB 4TV9A 1N32O 1VQ7V 2LW1A 3X2QC 4BIUA 3K5MA 2LQTA 3QO8A 3D8CA 4LBEC 4PI0A 1MZEA 3VOUA 3E2EA 4J7JA 4FLVA 2N04A 2G38A 4NB5A 2Q9LA 4KP4A 1XMOB 1CPYA 1QR9A 2Y48A 2GBOA 2CTRA 4JI4O 4W4LA 2F43G 5CMUA 5GONB 4B3SO 2ATKC 4I7ZB 1K73W 1W0KG 1D5NA 5L3BA 2CH7B 4EB6A 2IH1C 2XAFA 4B08A 4EFBA 1OCZC 2AW9A 3UM7A 2YSUB 4X1IA 3K57A 4B3RO 4X66B 3JYCA 2AHZA 3CX5F 2Q8VA 3CJHB 2KG7A 2ITDC 1M57B 3EHBB 1OCRC 5L3GA 3EXAA 1IX9A 1TA8A 3IFXA 2HHHB 5JJJB 1EBOA 3CCEV 2UXDB 3SR2C 2XOKG 3VQYA 5KA6A 4LH7A 1SERA 2CE4A 4UCVA 1TAEA 2QWRB 4L8JA 4RWUA 1BQ0A 1VEWA 2XASA 1J5EB 1YHQV 2QM4A 3JATB 4CH5A 4UCTA 3G80A 1I94O 2EJRA 5LP6A 1FPOA 5IE9A 1XNQO 2ZE5A 1X4TA 3KCXA 1XBLA 1VF6C 3RT3C 3HKCA 3ZHRA 5J2UB 1YTFD 2WPDG 3FX7A 4Z1MG 3F5WC 5IYCO 1GM8A 1AJPA 1QQCA 3BRCA 4BIZA 4UCSA 2AGAA 5A2QN 2D2CB 2A3QA 1GKFA 2YIAA 2BTOA 2ZDIA 4IIJB 4B7EA 4NTYA 3B4SA 4Z1VA 2VQEO 2Q67A 5CA0A 1AB3A 1FS0G 1U96A 4KFMA 4U7OA 1R3JC 3ZRWA 1M90W 1JVMA 1K4DC 1K5QA 2DYRC 3T1YO 3K5OA 3JAKB 3AG4C 1M56B 3BA9A 3JASA 1FKAO 4LWSA 2UU9B 1W59A 1H2MA 3DSQA 2IH3C 3A0RA 4DO2A 4Z2WA 5KMGB 1XOUA 4JI3B 1G4YB 1JJOA 4J80A 4DV2O 4UB6Z 4FVMA 3JD3A 1YJ9V 2R9RB 3H1HH 5H9CA 4KXRA 2EULA 2XAHA 1R1BA 4FFBB 4FLYA 3KKYA 3SYPA 2YUAA 3ETQA 1RSOA 1HWYA 2UXNA 4MVUA 3OGIB 3JARA 5B1OA 5EBWC 1WA8B 1QLNA 4H44B 3ZHTA 2PI5A 3ASOC 1YXBA 2WLIB 2P5OA 2UUAO 3BEHA 1RM1C 3CP1A 4DRXA 4F6RA 1K5SA 1HNWO 2P4KA 5EC2C 3WB0A 3K59A 2R9IA 1Y74A 2YI8A 3O65A 2A0LA 1PNMA 3I5DA 1OZ0A 4DV1B 5CBHA 2CDYA 1EZJA 2HP8A 2E76B 1F23A 1BHBA 5FPOA 4GUNA 2Q6AA 1SQPH 3B8NA 3CRCA 5BMVA 4K0KO 2VWJA 1ZL8B 4JF3A 2RQ6A 4NKGB 5FPRA 4FLUA 2EBOA 4FFKA 1SQVH 1BMFG 5B3SB 1QBZA 2EILB 1WPXA 3JCUZ 3RYFB 2Q7EA 1I5XA 2WA3A 2ZKOA 1A32A 5CA1A 1S5LZ 4TOIA 4FK5C 3C3TA 3RYCB 1E1RG 2QTOA 1LNQA 2F4VO 3OEEG 3CRRA 3UKMA 4JYAB 1OCCB 1N34O 3H1IH 2QGNA 4DUZB 2YIBD 5GTIZ 4DV7B 4JI5O 4I9QA 1L0NH 4JV5B 4X1KB 2DQ0A 3TGUH 1LUWA 4PJ0Z 1O9GA 3AK1A 1S5JA 1HW7A 3SJAC 1ZX3A 1Q6IA 4RAIA 1EN4A 2L35A 4DV6O 3STLC 4R50A 3BAAA 1AVMA 2GUZA 2Q0AA 1HR0B 1KQSU 4TQDA 2XUMA 3CD6V 4YJ3A 4ZI7B 3TJTA 2P7TC 2UXBO 4O4LB 1K4CC 4IL6Z 1OCOB 2EJ7A 1PL0A 3BABA 4OPHA 2AXTZ 2DE0X 2X6CA 1YEWA 4DV0O 1FXHA 3GWOA 3SYCA 2JIZG 2YXLA 5JH7A 1JFFB 1QVFU 3AG2C 2F66C 2DYSC 2CUGA 4PDRA 3JSLA 4LNUB 4DV3O 3FFQA 4NTXA 2DN9A 2HFEC 2QJ1A 2WLMA 3OFNG 1Q7YW 5EZYB 5KX5B 3QNEA 1XHZA 2LJ2A 4WFBV 3N2KB 3I55V 5LOVA 1PL4A 5J2TB 5HFLA 1VQ9V 4JYCA 3WFVA 3JD4A 1SA0B 2E75B 1NU1H 3T4ZA 4RO2A 2YI9A 5IJ0A 4U3JA 2XAGA 1E1QG 5B1NA 1NS1A 2OTLV 3CB2A 5EK0A 5KHIA 3OT7A 5EC1C 2UUCB 1EN6A 4CBCA 1S5HC 1L8DA 1Z5VA 1EN5A 1BL8A 1Y67A 4I4TB 5LMNB 1HNZB 5DEDA 3DC5A 2P67A 3K0GA 1X59A 3WG7C 3K9SA 5LYJB 3E89A 3ETGA 5C8YA 4DR6O 3E8BA 1M57C 4LF5O 1AR4A 4BAYA 4LFCB 4JZGA 4GKKO 5IY5C 4TQFA 1S76D 2XT9A 4DW0A 3LNMB 3B09A 5H6RA 3L73H 1XMQO 3ABUA 4FZ0A 2CTWA 3RBZA 5IT9N 3C3SA 1MMMA 2WLKA 1Q6UA 3R65A 4LFBB 1DGSA 4Q6GA 4W4KA 2FL4A 1P7BA 3OMIB 4JI8B 3ZMZA 4B3MB 4LP8A 2BOCC 4X1YA 4CS4A 2IJKA 4PELA 1WAZA 4QE7A 5LHGA 3ZN1A 5KHJA 1EZVH 2X6BA 1VQLV 1KU9A 3ETDA 3BHPA 4CC5A 4YHHB 3ZS8C 4TWKA 3CSXA 3B77A 1M56C 3M8AA 3BY6A 4X62O 1S77D 2PUSA 2A06H 4BW9A 3WB1A 3ABLB 4WFEA 5JVDB 1KBHA 4DYLA 4XBFA 4X89A 1WLEA 4UB8Z 2ZE6A 1VQOV 1O9HA 2LGQA 5IWAB 1Y6XA 1N32B 2L6LA 4XDJA 2R9AA 1SQFA 1D5AA 5BZBA 5IJ9A 3UCSC 3AG3B 2LFSA 3SGIA 1R3IC 2YXYA 3F7VC 2CGOA 2LP7A 2KG7B 1N4CA 4AHCA 2EZOA 4DW1A 3E22B 2GDSA 2ZR3A 3ZMTA 5L3CA 1RPOA 2WSSG 4JI4B 3CMAV 1YITV 5E1AC 4PDLA 3VBBA 1M4UA 4B3SB 1JPXA 2QWOB 4QIWF 1IBLO 1THZA 1K9MW 1BQZA 1PPJH 3RYHB 5BR8O 4D6TH 1QLEC 1CXZB 3HKCB 2Y69C 4B3RB 4J10A 3SYOA 1IXMA 3GVMA 2QA4V 3OM3B 2B1GA 2Z5UA 3W7SA 1KB9F 1FFTB 1UJWB 2OCCB 2P6JA 5CA0B 3ZCCA 5KUKA 3OTOO 3DC6A 1OV9A 4JI1O 1B3QA 4BW5A 3ABTA 5H5NA 2IJJA 3JASB 4LWSB 1WP7A 4JI7O 3CCRV 4QJFB 3L74H 1YJWV 4I55A 4UVBA 2CAZC 1FYJA 2WLJA 1OCCC 4KUMA 2B1IA 1I94B 1L1FA 2P06A 2KB1A 2RCVA 3U11A 2RMKB 1XNQB 3HKBB 1Y66A 3WU2Z 3JAWA 4LF7O 1VF6A 2IJHA 3R66A 2V7QG 1YJNV 4MS2A 1RSOB 3G71V 3J81N 1MOFA 4JGSA 5LMUB 3Q4HA 4OPAA 5K1XA 1VF5B 1ORQC 2VQEB 4JI0O 5EIBC 2OCHA 1XHXA 3OW2U 1FXKB 3THOA 4NTWA 1OCOC 1LR1A 4ZIBA 3RN4A 3T1YB 4F6RB 1WB8A 2ZIMA 3FB5C 1YDXA 4PD4F 2QDOA 1QCEA 2KSDA 3W7XA 2KQXA 1H38A 1VQKV 1Y74B 4LF4O 4GLXA 3QG5A 4HYOA 3RFRA 1G1XB 4DV2B 3CCUV 4DV5O 3RW0A 2ZE7A 1S72V 3A0HZ 3FB7C 1SC5B 1SS3A 4DR7O 4PHZA 5BMVB 2A79B 5H2FZ 4FMTA 5JQGA 3A0BZ 1JJ2U 2Q69A 2GTAA 1UPGA 4MTFA 2JGDB 4H37A 3RYIA 4IYHA 3CCLV 5FNVB 2UUAB 1V9PA 1G6UA 1HNWB 2CTQA 5KHKA 1N0NA 4GX2A 3BCCH 2WAMA 5KLVH 1PNKA 2DOSA 2H3OA 3U10A 1NZ6A 4E4EA 3VQWA 4K0KB 4PDMA 4EEQA 5B1AB 2FTKA 5B66Z 1K34A 2GUZB 3JD1A 5C93A 3W7WA 4IHJB 4WFFA 1ROPA 2A7WA 1TUBA 2W0XA 4UV9A 3JALA 1CP9A 4FM0A 1IDSA 3DTUB 3STZC 3ASNB 4I0XA 1AI5A 4ZOLA 2QKAA 4OGQB 3VQVA 1M1KW 4I9WA 1US6A 1W0JG 2JDIG 4DR5B 2F4VB 2F95B 1H2NA 4FJCC 3A8TA 4DXWA 1N34B 1AJNA 3I56V 1Q86W 4LFAO 4JI5B 4NXMO 2X6AA 3E8FA 1NH2B 1XILA 2B5UA 2ADQB 2EIKC 4R6ZA 3N27A 4O2AA 1MABG 1P84F 2R70A 3TCUA 1M93A 4OX9O 5LOVB 2Q4PA 4O4JA 4PI2A 3N2GA 4DV6B 4JI6O 5B1BB 4JYBA 3JAMN 5IJ0B 4U3JB 1U97A 1KC8W 3ABLC 2UXBB 4RUEA 2PYJA 1S3JA 1RP3B 3FKSG 3ZN0A 2CTPA 3HKDA 2IM9A 3MHHC 4UCRA 1MSWD 5BXZA 2BSKA 4PA6A 3ZMSA 2WLLB 2WWWA 4BR6A 3M99B 3AG3C 4UFZA 1DTOA 5CB4A 4DV3B 3E35A 5A9GA 4O4IB 4QPKA 5C8YB 1Q6HA 3APQA 1V55B 1MZFA 3RVZA 1NVPD 4WFGA 1XEQA 1JMKC 5HFMA 4JAAA 3IJ4A 2DQ3A 1QVGU 1VQMV 3AG1B 3K3WA 2YC0A 2K1EA 3ZHVA 2QWNB 2AZ0A 1S0VA 3HPLC 4D7TA 3U0ZA 2E5LO 2QWPB 2EIJC 3UT5B 1SQXH 2Z3YA 5GONA 2M7WA 3CPWU 1WNSA 2BTQA 3KZIZ 3S3WA 2CH7A 4YY3O 4CS3A 4WF9V 1JCHA 4JTAB 3SJBC 3OAAG 4DR1O 3OMAB 1AP5A 3MDSA 4I50B 1I5YA 3OUFA 3NR7A 3H1LH 4MVSA 4DR6B 2ZDIC 4LF5B 2Q7HA 3RVYA 1Q3EA 4N21A 1NQTA 2OCCC 5FLXN 4GKKB 4IYIA 4ABMA 1NJIW 1VQNV 1Z2GA 2CGNA 4CH4A 4DR4B 4DUYB 3AG7A 4LF9B 4AQYO 5EYPA 4PA3A 4MVOA 5LBQA 4RQEA 2RDCA 2UU9O 4U3FH 5LGUA 2PF4E 2DWDC 2N74A 4K8ZA 3ZRVA 1R6NA 3JATA 1YVWA 4JI3O 4IGGA 3C90A 4FM2A 3ML0A 1XNRO 4PA7A 5KHGA 5J2UA 2KKWA 1NI8A 2OT5A 3BFRA 3CE2A 3SPCA 2WLNA 1F4MA 4YJ2A 1SRYA 4IIJA 1Y76B 1FXKC 4JAUA 5AG2A 3LSQA 1M5IA 3K04A 4X62B 4DV4O 1LUVA 4H0LB 3CC4V 4OXSA 2X7RB 2FMLA 5LXTA 1YIJV 4J41A 3J7AU 3CC2V 1K97A 3AK3A 2MK3A 1B04A 3PN1A 5E79Z 3QO5A 4B7KA 4X65B 1OCZB 1K92A 4CH6A 2M6YA 2K9PA 3K0DA 1AI4A 2UXCO 1IBMB 4CC6A 5ITZB 2VS0A 3CRAA 3L75H 2PI4A 1XL4A 1HNXO 5DM6V 3D3QA 3H1JH 4UUJC 5EBLC 2HKOA 3L71H 2WLIA 3ICXA 1GO3F 3JD0A 4ZKIA 4ICGA 1NTKH 3DGEA 3D36C 1JQ0A 1XDCA 1KKDA 4O4HB 3HKEA 4WFHA 1N0JA 1IBLB 1XUQA 2QE7G 3K08A 2ZM6O 4MT8A 3RGBA 5BR8B 2ARHA 4XDKA 3W7UA 4JYAO 4J9ZB 2Y0PA 1RPRA 1BSMA 3PJSK 1R6KA 3OE7G 4J42A 3JAWB 2JEUA 3SPJA 4EFEA 3TXQA 4TV9B 1H2GA 4LC1A 1SZXA 3BVOA 2Q7GA 4MTGA 2PZSA 3Q4HB 4YIOA 3LSSA 4PDVA 3ZRXA 2QM8A 3OTOB 3L70H 1NR7A 1AJQA 4JI1B 3ASNC 1WP8A 5L3DA 1YTFB 2RN9A 1WB7A 2O57A 3ZMVA 4JI7B 3ETEA 3WB2A 2LFRA 3GB7C 1VQ5V 4J7ZA 4K8XA 4AI8A 1N36O 4JPRA 4RQFA 2GV9A 3OR6C 3QTCA 1Q81W 3IGAC 3ZRSA 4ZHQA 1I08A 4GT1A 4X1KA 4EB6B 3B2EE 4LF7B 1FFXA 1VP7A 2VRZA 2ZNIA 1H2KA 5JQGB 5L3FA 1ZUQA 4X1IB 2P4VA 3A2FA 5CBGA 1YCIA 2QM7A 2HJDA 3RYIB 3OGCC 3KCYA 4ZI7A 1NT2B 1TUEB 2D3OW 3K06A 2XHBA 1BS3A 1RM1B 3ZHUA 1H2LA 4FLZA 2HLDG 1KECA 2YEVA 1HNZO 2JS5A 4LF4B 2E74B 5DN6G 2RNBA 1DF4A 4MSWC 5KA5A 4DV5B 4NXNO 3JD2A 1N33O 1SZTA 1V55C 4LF6O 4DR7B 3OR7C 3NXSA 4QPJA 2YXHA 5EZYA 5LP6B 1KUQA 1DLBA
chains in the Genus database with same CATH topology
3E8GA 2Q6AA 3AG1C 3B8NA 3IC7A 3SPHA 1NVPB 1F4NA 1N8RW 4JF3A 1GMGA 4GX2A 5H6QA 1P4RA 2WAMA 1PNKA 3SJQC 1V54C 4G2KA 2DWEC 2EBOA 4HZ3A 2NLJC 1YI2V 1BMFG 5B3SB 1QBZA 2EILB 1WPXA 2W0FC 3ZRWB 5B3SC 2EILC 1YSCA 1I5XA 4PDMA 5B1AB 3LDCA 4XDLA 2XAQA 3HB3B 1KD1W 2FTKA 5B1AC 3P32A 4FK5C 4MVRA 1K34A 3JD1A 5C93A 3W7WA 1GM9A 3T1CA 4WFFA 1ROPA 2ZD9A 1E1RG 2QTOA 3QO7A 1LNQA 4UV9A 2BOBC 3OEEG 4RUFA 3K79A 3UKMA 1GTOA 3P30A 1CP9A 1OCCB 3OEHG 1NR1A 3DTUB 3STZC 3ASNB 2A9HA 1AI5A 1NH2D 2DQ0A 3ZMUA 2UXXA 5CA3A 5IYBO 1M1KW 4I9WA 4F4LA 2DYRB 1W0JG 3AG4B 4X88A 1K33A 2JDIG 5EBMC 4RAIA 4FJCC 3CCQV 5CN0A 3STLC 4R50A 4DXWA 1PKXA 2EZPA 1XL6A 1KQSU 2C2AA 1AJNA 3I56V 4GCZA 1Q86W 2EIKB 2AHYA 3CMEV 2X6AA 3E8FA 1NH2B 3CD6V 2QKSA 2B5UA 2EIKC 4R6ZA 3LDEA 5LHIA 2P7TC 1JOYA 1MABG 2HVJC 1K4CC 1OCOB 4I5SA 1PL0A 3TCUA 1JX9A 1H8EG 3EFFK 4Q20A 2X6CA 5B1BB 1FXHA 1AR1B 3GWOA 3SYCA 2JIZG 4G28B 5B1BC 4JYBA 3AG2B 1AI7A 2DYSB 3AG2C 1QVFU 1KC8W 3ABLC 2DYSC 4RUEA 4PDRA 1S3JA 3FKSG 3ZN0A 3D3IA 3ASOB 3MHHC 4YXWG 3T4DA 2X0LA 1MSWD 2HFEC 2WLMA 3OFNG 4CZZA 3FB6C 1Q7YW 2ZXWC 1OHHG 4PA6A 3ZMSA 2WWWA 2WLLB 3QNEA 4JTCB 4WFBV 1GM7A 3I55V 3M99B 2V1DA 3FYEB 2JJ2G 1VQ9V 5HFLA 4JYCA 3AG3C 3WFVA 3OMNB 4UVAA 3JD4A 3G6EV 1DTOA 3T4ZA 3CYOA 1R73A 4RO2A 3E35A 4QPKA 2XAGA 1V55B 3W7TA 1AROP 1E1QG 3ABMB 5B1NA 3RVZA 5LGTA 1NVPD 4U7NA 4WFGA 2OTLV 2QEXV 5HFMA 5EK0A 1K8AW 2GHYA 1KP2A 3K03A 4ZBMA 5EC1C 2DQ3A 4X8AA 4CBCA 4MTXA 3CCVV 1S5HC 4JASA 2JK5C 1QVGU 3B8MA 4H33A 3MD0A 1BL8A 1VQMV 3AG1B 5LHHA 3K3WA 1MG1A 2K1EA 3K9AA 2DW4A 3H01A 2OTJV 1S0VA 3HPLC 4P9PA 5FL7G 2P67A 3K0GA 2EIJB 4FPPA 3WG7B 2EINC 3E83A 3CCMV 4TSFG 2EIJC 3WG7C 5J9PC 2Z3YA 1Y4MA 2H8PC 1R3KC 3ABKC 1V54B 3E89A 3ETGA 2M7WA 1VQ4V 2W6JG 3CPWU 1H8HG 3E8BA 1M57C 1B6QA 4BAYA 5IY5B 2XAJA 1NKDA 5IY5C 1SETA 5KUMA 4WF9V 1S76D 2JEXA 1JCHA 4MVQA 4P2ZA 3LNMB 5H6RA 4JTAB 3LUTB 3ABUA 3OAAG 5IYDO 3OMAB 3RBZA 5IDJA 1I5YA 3OUFA 4R7CA 4MVSA 3CXCU 2JJ1G 2ZDIC 5GW7A 2IJIA 2WLKA 3RVYA 4L87A 4ASUG 4N21A 3R65A 1VQ6V 1DF5A 1NQTA 1K7DA 2OCCC 1F23A 1P7BA 1NJIW 4MVMA 2EIMC 3OMIB 4GX1A 4UXNA 1VQNV 3ZMZA 1ENVA 4LP8A 4PA9A 4LCUC 4EKWA 2BOCC 2IJKA 2Q68A 1J95A 4PELA 2HG5C 4QE7A 5LHGA 4PA3A 4MVOA 3ZN1A 5LBQA 4RQEA 2ZR2A 2X6BA 1VQLV 3OUSA 5LGUA 2IU0A 1R3LC 1F51A 2DWDC 3ETDA 4QNHB 3ZRVA 1PNLA 1R6NA 4TWKA 4JAVA 4N23A 1E79G 1BHAA 3B77A 3G4SV 4JTDB 4PA4A 3CC7V 1VQ7V 3ML0A 4PA7A 1M56C 3X2QC 3T2MA 4BIUA 3BY6A 1S77D 3QO8A 3ABLB 2OT5A 4MW3A 4WFEA 3SPCA 4LBEC 3E86A 2WLNA 2GSMB 1FXVA 1F4MA 4XBFA 3VOUA 1SRYA 4X89A 1FXKC 3E2EA 1WLEA 4JAUA 1VQOV 2ZXWB 2ZQMA 4KP4A 3LSQA 4XDJA 3K04A 1Q82W 1CPYA 3AEIA 1QR9A 2Y48A 5BZBA 3AG3B 3CC4V 2LFSA 4OXSA 3ZIAG 2X7RB 2F43G 2WLHA 1R3IC 5CMUA 1YIJV 3F7VC 2P90A 3CC2V 2LP7A 2ATKC 1K97A 1K73W 1FXKA 1W0KG 2EZOA 2MK3A 5L3BA 2ZR3A 3QO5A 3E8HA 3ZMTA 2IH1C 4E2LA 5L3CA 1RPOA 2XAFA 2WSSG 1OCZB 1K92A 2XNDG 1OCZC 3CMAV 1PD3A 1YITV 5E1AC 3TETA 4PDLA 3UM7A 2YSUB 3VBBA 2EINB 1AI4A 1M9NA 3K0DA 1JPXA 3JYCA 2AHZA 4R8CA 2PI4A 3ABKB 4QIWF 1XL4A 5DM6V 3FYIB 4UUJC 1THZA 2ITDC 5EBLC 1M57B 2HKOA 2WLIA 1K9MW 3EHBB 3SPGA 1GO3F 3JD0A 4ZKIA 1OCRC 5L3GA 1QLEB 1SESA 3DGEA 3SPIA 1QLEC 2Y69B 3IFXA 1JQ0A 2HVKC 4WCEV 1KKDA 2Y69C 1EBOA 2HJFC 3CCEV 3SYOA 1IXMA 2QA4V 3OM3B 4WFHA 2XOKG 3CCJV 2W6IG 5KA6A 1SERA 2B1GA 2Z5UA 2QE7G 3K08A 3W7SA 1FFTB 4UV8A 1UJWB 2OCCB 2P6JA 2XASA 4MT8A 2NNUA 3FB8C 4XDKA 3W7UA 4J9ZB 3ZCCA 1YHQV 2EIMB 1RPRA 5KUKA 3PJSK 1R6KA 3OE7G 2EJRA 4FIPC 2JEUA 3D36A 3SPJA 4BW5A 3ABTA 4P30A 2IJJA 4MW8A 1H2GA 4LC1A 1YTFD 2WPDG 1COWG 4MTGA 4G27B 3CCRV 4Z1MG 3F5WC 4MVZA 1GM8A 4QJFB 5IYCO 1CEZA 3LSSA 2ITCC 1AJPA 4PDVA 1YJWV 4MTOA 4BIZA 4UVBA 4GX5A 3ZRXA 1GKFA 2WLJA 2QM8A 2ZDIA 1OCCC 1ZWIC 4KUMA 4WFAV 1NR7A 2B1IA 1L1FA 2KB1A 1AJQA 3SYQA 3ASNC 2Q67A 4UVCA 1EFRG 1FS0G 4KFMA 4U7OA 1R3JC 3ZRWA 1M90W 4GX0A 5L3DA 1YTFB 3ZJZA 1JVMA 1Y66A 3ZMVA 1K4DC 2H94A 1K5QA 5CBFA 1G8MA 3ETEA 3LDDA 2IJHA 2DYRC 2LFRA 2V7QG 3GB7C 3AG4C 1M56B 3X2QB 1YJNV 1VQ5V 4MS2A 3G71V 1MOFA 4JPRA 4RQFA 1VQPV 4JGSA 3OR6C 2IH3C 4TT3G 1Q81W 1ORQC 3A0RA 3IGAC 3ZRSA 1K3EA 4DO2A 3OW2U 4QE9A 1FXKB 4GT1A 1G4YB 3KG2A 3JD3A 1OCOC 1YJ9V 2R9RB 5H9CA 3MHSC 3CCSV 3FB5C 1W2BU 2YEVB 2XAHA 5L3FA 1KP3A 1QCEA 3SYPA 5CBGA 3W7XA 1HWYA 1H38A 2UXNA 2QM7A 4MVUA 5L3EA 1VQKV 5B1OA 5EBWC 1QLNA 4HYOA 3OGCC 3CCUV 4J9YB 2PI5A 1TUEB 3RW0A 3ASOC 1S72V 2D3OW 4P9OA 2WLIB 3K06A 1AI6A 1RM1B 3FB7C 3BEHA 1RM1C 3CP1A 2IU3A 2CK3G 3SYAA 1NBMG 1K5SA 2A79B 2HLDG 1KECA 2YEVA 4FMTA 2HR3A 1GK9A 1QR8A 1VQ8V 5LGNA 1JJ2U 2Q69A 2IW5A 5DN6G 4MTFA 1DF4A 4MSWC 5EC2C 5KA5A 3JCZA 4H37A 3JD2A 2R9IA 4HAMA 1SZTA 3CCLV 1V55C 2A0LA 3ABMC 1PNMA 1OZ0A 3TK1A 3F7YC 3OR7C 1OCRB 3NXSA 4QPJA 5CBHA 1EZJA 2WLLA 1BHBA 1DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPJ A;  3E8G A;  4JTD B;  2Q6A A;  4P30 A;  4PA4 A;  4BW5 A;  3AG1 C;  4MW8 A;  3AG3 C;  4PA7 A;  1M56 C;  3X2Q C;  3SPH A;  3T2M A;  4MTG A;  4G27 B;  3T4Z A;  3F5W C;  4GX2 A;  4MVZ A;  4RO2 A;  4MW3 A;  4WFE A;  3SPC A;  4LBE C;  3E86 A;  2ITC C;  2WLN A;  4PDV A;  4MTO A;  4GX5 A;  3SJQ C;  2WLJ A;  1V54 C;  3VOU A;  1OCC C;  1ZWI C;  2DWE C;  4HZ3 A;  4X89 A;  4WFG A;  3RVZ A;  2NLJ C;  2KB1 A;  3SYQ A;  5EK0 A;  3ASN C;  2Q67 A;  3K03 A;  4ZBM A;  2W0F C;  4KFM A;  5EC1 C;  1R3J C;  4X8A A;  4CBC A;  4GX0 A;  2EIL C;  5B3S C;  4XDJ A;  1S5H C;  1JVM A;  2JK5 C;  3ZJZ A;  4H33 A;  3K04 A;  1BL8 A;  4PDM A;  1K4D C;  5CBF A;  3LDD A;  5BZB A;  2K1E A;  2DYR C;  3LDC A;  4XDL A;  3GB7 C;  3AG4 C;  5B1A C;  4OXS A;  4MS2 A;  3HPL C;  4MVR A;  4P9P A;  3K0G A;  3T1C A;  4WFF A;  2EIN C;  3E83 A;  2ZD9 A;  2QTO A;  2EIJ C;  2WLH A;  1LNQ A;  1R3I C;  3OR6 C;  3WG7 C;  5J9P C;  2BOB C;  2IH3 C;  3F7V C;  1ORQ C;  2H8P C;  4RUF A;  1R3K C;  3ABK C;  2ATK C;  3E89 A;  3IGA C;  3UKM A;  3ZRS A;  4QE9 A;  3STZ C;  2A9H A;  3E8B A;  1M57 C;  1G4Y B;  3KG2 A;  1OCO C;  3E8H A;  2R9R B;  2IH1 C;  5IY5 C;  5KUM A;  4I9W A;  3FB5 C;  1OCZ C;  4F4L A;  4MVQ A;  4X88 A;  4P2Z A;  3LNM B;  4PDL A;  5E1A C;  3UM7 A;  3TET A;  4JTA B;  5EBM C;  3LUT B;  4RAI A;  3SYP A;  3STL C;  5CBG A;  4R50 A;  4DXW A;  3K0D A;  3RBZ A;  1XL6 A;  3JYC A;  4MVU A;  2AHZ A;  3OUF A;  4R7C A;  4MVS A;  4R8C A;  2AHY A;  5EBW C;  4HYO A;  2X6A A;  3E8F A;  3OGC C;  1XL4 A;  2QKS A;  2EIK C;  2WLK A;  4R6Z A;  3RVY A;  3R65 A;  3LDE A;  4J9Y B;  2OCC C;  2P7T C;  3RW0 A;  3ASO C;  4UUJ C;  5EBL C;  2ITD C;  2HVJ C;  4P9O A;  2WLI B;  1K4C C;  1P7B A;  2WLI A;  3K06 A;  4MVM A;  2EIM C;  4GX1 A;  3SPG A;  3FB7 C;  3BEH A;  1OCR C;  3TCU A;  3SPI A;  4LP8 A;  1QLE C;  4PA9 A;  3IFX A;  4LCU C;  2HVK C;  2BOC C;  3EFF K;  3SYA A;  4EKW A;  1KKD A;  2Y69 C;  2A79 B;  2HJF C;  2X6C A;  2Q68 A;  3SYO A;  1J95 A;  2YEV A;  2HG5 C;  3SYC A;  4G28 B;  4WFH A;  5B1B C;  4QE7 A;  2Q69 A;  4PA3 A;  4MVO A;  3AG2 C;  4MTF A;  4MSW C;  3ABL C;  2DYS C;  5EC2 C;  3K08 A;  4H37 A;  2X6B A;  4RUE A;  3OUS A;  4PDR A;  1V55 C;  1R3L C;  2A0L A;  3ABM C;  2DWD C;  3T4D A;  4QNH B;  3FB8 C;  4XDK A;  2HFE C;  2WLM A;  4J9Z B;  3FB6 C;  5KUK A;  3F7Y C;  3OR7 C;  2ZXW C;  3PJS K;  5CBH A;  4TWK A;  4PA6 A;  2WLL B;  2WLL A;  4JTC B; 
#chains in the Genus database with same CATH topology
 3E8G A;  3N2K A;  3AG1 C;  1SQB H;  3VQX A;  1NVP B;  1F4N A;  4QGP A;  1FD9 A;  5LA6 A;  1GMG A;  2ZCE A;  1P4R A;  1SKV A;  4G2K A;  2DWE C;  4I0X B;  1YI2 V;  2VQF O;  3ZRW B;  5B3S C;  2EIL C;  1YSC A;  2DMX A;  4LF8 O;  2ZE8 A;  4I4T A;  3LDC A;  4LH6 A;  2YS8 A;  4MVR A;  4FZ1 A;  2IBZ H;  1GM9 A;  2ZD9 A;  1BGY H;  3QO7 A;  2BOB C;  3CRQ A;  4RUF A;  1FJG O;  1GTO A;  3P30 A;  2UUB O;  2A9H A;  4JI2 O;  5EIB D;  1P49 A;  2UXX A;  4YHH O;  3N2G B;  2Q0O C;  4JZ2 A;  1I7F A;  4F4L A;  3IAY A;  4X88 A;  2ADP A;  5EBM C;  3QF7 A;  4GKJ O;  3CCQ V;  2Q5Z A;  1HP8 A;  2EZP A;  1XL6 A;  2C2A A;  3JAR B;  4GCZ A;  4BIO A;  2AHY A;  3CME V;  3M7M X;  1JOY A;  2BSK B;  1AP6 A;  1F7Y A;  4DRX B;  4F6E A;  1D2D A;  5IWA O;  1H8E G;  4TV8 A;  1AR1 B;  3APO A;  2ETN A;  4LFA B;  5CB4 B;  3AG2 B;  4NXM B;  1AI7 A;  1KYO F;  2DYS B;  3SJC C;  1WN7 A;  1GN4 A;  4YXW G;  4DR3 O;  1KKC A;  2X0L A;  4OX9 B;  4O2B A;  4CZZ A;  4JI6 B;  4JTC B;  1TVK A;  4KHP O;  3FAV A;  2V1D A;  3FYE B;  2JJ2 G;  4X20 A;  4UVA A;  1OJH A;  2WA4 A;  1Q90 D;  2Q73 A;  1JA8 A;  5JCO C;  4K35 A;  5JVD A;  3W7T A;  2XTA A;  3ABM B;  5LGT A;  2BTQ B;  1GRJ A;  1K8A W;  2GHY A;  1KP2 A;  1UFI A;  2PGG A;  3K03 A;  4ZBM A;  2JS3 A;  4X8A A;  4FM1 A;  2NR5 A;  2JK5 C;  3UO2 A;  3MD0 A;  5CA1 B;  5LHH A;  1MG1 A;  3K9A A;  2DW4 A;  2GTS A;  1JR9 A;  4P9P A;  1QNM A;  2PTM A;  4FPP A;  3WG7 B;  3E83 A;  1WJZ A;  5B5E Z;  4TSF G;  3T1H O;  5J9P C;  1P7G A;  2P22 C;  1R3K C;  4DR2 O;  1V54 B;  2JVD A;  1VQ4 V;  2Y0I A;  2W6J G;  4FLX A;  1T5E A;  3E22 A;  1MA1 A;  1ZLZ A;  2LO1 A;  5IY5 B;  4X64 O;  1SET A;  2E5L B;  5IYZ A;  1H2S B;  4HNA A;  4MVQ A;  4P2Z A;  2OYQ A;  5EYP B;  4X9Q A;  3FD9 A;  3ZX6 A;  2FKX A;  3O9O A;  5IYD O;  5IDJ A;  1IBK O;  3CS5 A;  4R7C A;  3CXC U;  4ASU G;  4YJ3 B;  1VQ6 V;  1K7D A;  4YY3 B;  5K1P A;  4MVM A;  4GX1 A;  1XI1 A;  1AIL A;  4UXN A;  1ENV A;  3RYH A;  1ZAU A;  4YIP A;  3CWB H;  4LCU C;  4EKW A;  3ZBH A;  4DR1 B;  2Q68 A;  1J95 A;  1TGO A;  2HG5 C;  4IT5 A;  5JH7 B;  1SQG A;  4B3T O;  3CRM A;  4A5U B;  4YJ2 B;  2IU0 A;  5LMU O;  1IVS A;  2LW7 A;  1PNL A;  4JAV A;  1XRE A;  3DXR A;  2OIE A;  1E79 G;  3P3N A;  1BHA A;  4AQY B;  3G4S V;  5BY1 A;  3CC7 V;  1XMO O;  4NVP A;  3T2M A;  5LXT B;  4MW3 A;  3E86 A;  2GSM B;  1FXV A;  4WBN A;  2ZIN A;  3LNN A;  4GYC B;  1NTZ H;  4TUY A;  2ZXW B;  3EVK A;  2ZQM A;  3HKB A;  4DV0 B;  1XNR B;  1Q82 W;  3AEI A;  4CH3 A;  4H13 B;  3B40 A;  2BCC H;  2NN4 A;  3ZIA G;  2F93 B;  2YIB A;  1HDJ A;  4J11 A;  2JGU A;  2WLH A;  1YZB A;  2P90 A;  1BT8 A;  4X66 O;  1GN3 A;  1FXK A;  2ZNJ A;  3CEI A;  1URF A;  3H9V A;  4DV4 B;  3E8H A;  4E2L A;  3K5L A;  2QWQ B;  1IZ3 A;  3HKE B;  2XND G;  2QSA A;  1PD3 A;  3TET A;  2F23 A;  2HHH O;  4DK1 A;  2EIN B;  2UXD O;  1M9N A;  4FLW A;  4R8C A;  3ABK B;  5TIS Z;  3FYI B;  1YF2 A;  4NYK A;  3SPG A;  1PV0 A;  2ZT9 B;  1J5E O;  1QLE B;  1SES A;  2MW2 B;  5LP6 C;  3SPI A;  2Y69 B;  2HVK C;  4WCE V;  4X1Y B;  2HJF C;  1WPB A;  2UXC B;  3CCJ V;  2W6I G;  1Q5O A;  3BA8 A;  1HNX B;  2JGD A;  2Y4T A;  1MSD A;  4UV8 A;  5FNV A;  2LGW A;  1Q43 A;  4UCO A;  1FAF A;  2NNU A;  3FB8 C;  4JYY A;  3CJH A;  2EIM B;  1KMI Z;  4FIP C;  3D36 A;  1I0H A;  4P30 A;  1XMQ B;  4MW8 A;  5KAI Z;  1NTM H;  1COW G;  4G27 B;  2ZM6 B;  4MVZ A;  4DR5 O;  3BPZ A;  1CEZ A;  2ITC C;  2B9Z A;  4MTO A;  4ZHQ B;  4GX5 A;  1ZWI C;  4WFA V;  3SYQ A;  2Y4U A;  4UVC A;  1EFR G;  1FFX B;  3S3X A;  1GAX A;  4GX0 A;  3AK2 A;  3ZJZ A;  1VF7 A;  2RJZ A;  3L9D A;  2H94 A;  5CBF A;  1G8M A;  3LDD A;  5IJ9 B;  3X2Q B;  4CS2 A;  1PM9 A;  4IHJ A;  1VQP V;  3LSU A;  2JRI A;  4TT3 G;  1K3E A;  2QR4 A;  2FYU H;  2R72 A;  4QE9 A;  2BE3 A;  5GTH Z;  3KG2 A;  5JJN B;  1PP9 H;  3MHS C;  3CCS V;  1W2B U;  2YEV B;  1N36 B;  1KP3 A;  1MNG A;  1Z5W A;  3JAK A;  3ZHS A;  5L3E A;  3CHX A;  4J9Y B;  1GH6 A;  5KMG A;  4P9O A;  1AI6 A;  2IU3 A;  4J7K A;  2CK3 G;  3SYA A;  2FB5 A;  1NBM G;  4DV1 O;  3ZHQ A;  2HR3 A;  1GK9 A;  1QR8 A;  4FFB A;  5LGN A;  1VQ8 V;  5LA6 B;  3QVN A;  2IW5 A;  3JCZ A;  4HAM A;  1VMG A;  1WA8 A;  2AZ2 A;  1BZK A;  3ABM C;  1SF9 A;  1GN2 A;  3F7Y C;  3TK1 A;  1OCR B;  2WLL A;  5F2V O;  2F1M A;  3IC7 A;  3GWK C;  4NXN B;  3SPH A;  2QKC A;  1N8R W;  1N33 B;  5H6Q A;  4LF6 B;  4O4I A;  4I55 B;  3SJQ C;  1VIB A;  1V54 C;  4HZ3 A;  2NLJ C;  1QHT A;  2W0F C;  4DUZ O;  1AR5 A;  3TXS A;  5DEC A;  4DV7 O;  4JV5 O;  4HBN A;  3CXH F;  3UO3 A;  1DK1 A;  2OIG A;  4DR4 O;  4XDL A;  2XAQ A;  3HB3 B;  1KD1 W;  5B1A C;  3P32 A;  4DUY O;  1IUR A;  3T1C A;  1ZL8 A;  4LF9 O;  3UT5 A;  2ILM A;  4K3A A;  3K79 A;  2VQF B;  1HR0 O;  2V4D A;  3OEH G;  3F5T A;  1NR1 A;  4LF8 B;  3H1K H;  1NH2 D;  3ZMU A;  1XQ8 A;  5CA3 A;  4TV8 B;  5IYB O;  3RYF A;  2DYR B;  3AG4 B;  1K33 A;  5CN0 A;  1RFY A;  2YID A;  3G6B A;  5JJE B;  4NR1 A;  1PKX A;  1FJG B;  2UUB B;  3RYC A;  4I50 A;  2EIK B;  2QKS A;  4JI2 B;  4O2B B;  3LDE A;  5LL6 Y;  2E3C A;  5LHI A;  2HVJ C;  3P3P A;  2QTS A;  4I5S A;  1TVK B;  1JX9 A;  3MAQ A;  1B06 A;  1SQQ H;  3FAV B;  2PY5 A;  3EFF K;  4X20 B;  4GKJ B;  4Q20 A;  1IXB A;  1QU7 A;  4G28 B;  5B1B C;  1GN6 A;  3ZED A;  3HR0 A;  3UQ8 A;  4JI0 B;  1ZTE A;  3D3I A;  3ASO B;  4UCU A;  3T4D A;  3FB6 C;  4O4L A;  2ZXW C;  1OHH G;  4GZR B;  1ZSP A;  1GM7 A;  2UUC O;  4X65 O;  3OMN B;  4KL1 A;  2ZIO A;  3G6E V;  5LMN O;  3RWR D;  3CYO A;  1R73 A;  1BCC H;  1JFF A;  4DR3 B;  1L0L H;  2OWO A;  1IBM O;  1ARO P;  2EX3 A;  2YIC A;  4AIL C;  1R6T A;  4LNU A;  4FLT A;  4U7N A;  2QEX V;  4LR3 A;  1Y76 A;  1Q8I A;  4KHP B;  4MTX A;  3CCV V;  4JAS A;  3B8M A;  4H33 A;  5IYZ B;  5KX5 A;  4HNA B;  4LFC O;  5KHH A;  3H01 A;  4C7U A;  5J2T A;  2OTJ V;  1VAR A;  3JSN A;  5FL7 G;  5D5Q A;  2VWK A;  1SA0 A;  2ODM A;  2EIJ B;  3CCM V;  2EIN C;  1TUB B;  5JCO A;  1Y4M A;  2H8P C;  3JAL B;  3ABK C;  3J80 N;  3K58 A;  2N05 A;  1H8H G;  2DJV A;  3K5N A;  1B6Q A;  3L72 H;  4ZOL B;  4LFB O;  5D5P A;  2XAJ A;  1NKD A;  5KUM A;  4JI8 O;  2JEX A;  3OD4 A;  3SDL A;  5KAF Z;  4B3M O;  3T1H B;  3LUT B;  4DR2 B;  1BE3 H;  2HEP A;  5ITZ A;  2JJ1 G;  5GW7 A;  2IJI A;  5LYJ A;  4L87 A;  4O2A B;  3IC9 A;  1DF5 A;  4X64 B;  4DK0 A;  2EIM C;  4D7S A;  3OTF A;  2PYL A;  3DXR B;  3G67 A;  1EM1 A;  4O4J B;  4PA9 A;  2YDE A;  5JWP A;  2Z0A A;  4O4H A;  1IBK B;  2ZR2 A;  4PV1 B;  4WBN B;  3OUS A;  1R3L C;  3HKD B;  1F51 A;  4QNH B;  4TUY B;  4N23 A;  4BWA A;  4JTD B;  4PA4 A;  4B3T B;  4TV9 A;  1N32 O;  1VQ7 V;  2LW1 A;  3X2Q C;  4BIU A;  3K5M A;  2LQT A;  3QO8 A;  3D8C A;  4LBE C;  4PI0 A;  1MZE A;  3VOU A;  3E2E A;  4J7J A;  4FLV A;  2N04 A;  2G38 A;  4NB5 A;  2Q9L A;  4KP4 A;  1XMO B;  1CPY A;  1QR9 A;  2Y48 A;  2GBO A;  2CTR A;  4JI4 O;  4W4L A;  2F43 G;  5CMU A;  5GON B;  4B3S O;  2ATK C;  4I7Z B;  1K73 W;  1W0K G;  1D5N A;  5L3B A;  2CH7 B;  4EB6 A;  2IH1 C;  2XAF A;  4B08 A;  4EFB A;  1OCZ C;  2AW9 A;  3UM7 A;  2YSU B;  4X1I A;  3K57 A;  4B3R O;  4X66 B;  3JYC A;  2AHZ A;  3CX5 F;  2Q8V A;  3CJH B;  2KG7 A;  2ITD C;  1M57 B;  3EHB B;  1OCR C;  5L3G A;  3EXA A;  1IX9 A;  1TA8 A;  3IFX A;  2HHH B;  5JJJ B;  1EBO A;  3CCE V;  2UXD B;  3SR2 C;  2XOK G;  3VQY A;  5KA6 A;  4LH7 A;  1SER A;  2CE4 A;  4UCV A;  1TAE A;  2QWR B;  4L8J A;  4RWU A;  1BQ0 A;  1VEW A;  2XAS A;  1J5E B;  1YHQ V;  2QM4 A;  3JAT B;  4CH5 A;  4UCT A;  3G80 A;  1I94 O;  2EJR A;  5LP6 A;  1FPO A;  5IE9 A;  1XNQ O;  2ZE5 A;  1X4T A;  3KCX A;  1XBL A;  1VF6 C;  3RT3 C;  3HKC A;  3ZHR A;  5J2U B;  1YTF D;  2WPD G;  3FX7 A;  4Z1M G;  3F5W C;  5IYC O;  1GM8 A;  1AJP A;  1QQC A;  3BRC A;  4BIZ A;  4UCS A;  2AGA A;  5A2Q N;  2D2C B;  2A3Q A;  1GKF A;  2YIA A;  2BTO A;  2ZDI A;  4IIJ B;  4B7E A;  4NTY A;  3B4S A;  4Z1V A;  2VQE O;  2Q67 A;  5CA0 A;  1AB3 A;  1FS0 G;  1U96 A;  4KFM A;  4U7O A;  1R3J C;  3ZRW A;  1M90 W;  1JVM A;  1K4D C;  1K5Q A;  2DYR C;  3T1Y O;  3K5O A;  3JAK B;  3AG4 C;  1M56 B;  3BA9 A;  3JAS A;  1FKA O;  4LWS A;  2UU9 B;  1W59 A;  1H2M A;  3DSQ A;  2IH3 C;  3A0R A;  4DO2 A;  4Z2W A;  5KMG B;  1XOU A;  4JI3 B;  1G4Y B;  1JJO A;  4J80 A;  4DV2 O;  4UB6 Z;  4FVM A;  3JD3 A;  1YJ9 V;  2R9R B;  3H1H H;  5H9C A;  4KXR A;  2EUL A;  2XAH A;  1R1B A;  4FFB B;  4FLY A;  3KKY A;  3SYP A;  2YUA A;  3ETQ A;  1RSO A;  1HWY A;  2UXN A;  4MVU A;  3OGI B;  3JAR A;  5B1O A;  5EBW C;  1WA8 B;  1QLN A;  4H44 B;  3ZHT A;  2PI5 A;  3ASO C;  1YXB A;  2WLI B;  2P5O A;  2UUA O;  3BEH A;  1RM1 C;  3CP1 A;  4DRX A;  4F6R A;  1K5S A;  1HNW O;  2P4K A;  5EC2 C;  3WB0 A;  3K59 A;  2R9I A;  1Y74 A;  2YI8 A;  3O65 A;  2A0L A;  1PNM A;  3I5D A;  1OZ0 A;  4DV1 B;  5CBH A;  2CDY A;  1EZJ A;  2HP8 A;  2E76 B;  1F23 A;  1BHB A;  5FPO A;  4GUN A;  2Q6A A;  1SQP H;  3B8N A;  3CRC A;  5BMV A;  4K0K O;  2VWJ A;  1ZL8 B;  4JF3 A;  2RQ6 A;  4NKG B;  5FPR A;  4FLU A;  2EBO A;  4FFK A;  1SQV H;  1BMF G;  5B3S B;  1QBZ A;  2EIL B;  1WPX A;  3JCU Z;  3RYF B;  2Q7E A;  1I5X A;  2WA3 A;  2ZKO A;  1A32 A;  5CA1 A;  1S5L Z;  4TOI A;  4FK5 C;  3C3T A;  3RYC B;  1E1R G;  2QTO A;  1LNQ A;  2F4V O;  3OEE G;  3CRR A;  3UKM A;  4JYA B;  1OCC B;  1N34 O;  3H1I H;  2QGN A;  4DUZ B;  2YIB D;  5GTI Z;  4DV7 B;  4JI5 O;  4I9Q A;  1L0N H;  4JV5 B;  4X1K B;  2DQ0 A;  3TGU H;  1LUW A;  4PJ0 Z;  1O9G A;  3AK1 A;  1S5J A;  1HW7 A;  3SJA C;  1ZX3 A;  1Q6I A;  4RAI A;  1EN4 A;  2L35 A;  4DV6 O;  3STL C;  4R50 A;  3BAA A;  1AVM A;  2GUZ A;  2Q0A A;  1HR0 B;  1KQS U;  4TQD A;  2XUM A;  3CD6 V;  4YJ3 A;  4ZI7 B;  3TJT A;  2P7T C;  2UXB O;  4O4L B;  1K4C C;  4IL6 Z;  1OCO B;  2EJ7 A;  1PL0 A;  3BAB A;  4OPH A;  2AXT Z;  2DE0 X;  2X6C A;  1YEW A;  4DV0 O;  1FXH A;  3GWO A;  3SYC A;  2JIZ G;  2YXL A;  5JH7 A;  1JFF B;  1QVF U;  3AG2 C;  2F66 C;  2DYS C;  2CUG A;  4PDR A;  3JSL A;  4LNU B;  4DV3 O;  3FFQ A;  4NTX A;  2DN9 A;  2HFE C;  2QJ1 A;  2WLM A;  3OFN G;  1Q7Y W;  5EZY B;  5KX5 B;  3QNE A;  1XHZ A;  2LJ2 A;  4WFB V;  3N2K B;  3I55 V;  5LOV A;  1PL4 A;  5J2T B;  5HFL A;  1VQ9 V;  4JYC A;  3WFV A;  3JD4 A;  1SA0 B;  2E75 B;  1NU1 H;  3T4Z A;  4RO2 A;  2YI9 A;  5IJ0 A;  4U3J A;  2XAG A;  1E1Q G;  5B1N A;  1NS1 A;  2OTL V;  3CB2 A;  5EK0 A;  5KHI A;  3OT7 A;  5EC1 C;  2UUC B;  1EN6 A;  4CBC A;  1S5H C;  1L8D A;  1Z5V A;  1EN5 A;  1BL8 A;  1Y67 A;  4I4T B;  5LMN B;  1HNZ B;  5DED A;  3DC5 A;  2P67 A;  3K0G A;  1X59 A;  3WG7 C;  3K9S A;  5LYJ B;  3E89 A;  3ETG A;  5C8Y A;  4DR6 O;  3E8B A;  1M57 C;  4LF5 O;  1AR4 A;  4BAY A;  4LFC B;  4JZG A;  4GKK O;  5IY5 C;  4TQF A;  1S76 D;  2XT9 A;  4DW0 A;  3LNM B;  3B09 A;  5H6R A;  3L73 H;  1XMQ O;  3ABU A;  4FZ0 A;  2CTW A;  3RBZ A;  5IT9 N;  3C3S A;  1MMM A;  2WLK A;  1Q6U A;  3R65 A;  4LFB B;  1DGS A;  4Q6G A;  4W4K A;  2FL4 A;  1P7B A;  3OMI B;  4JI8 B;  3ZMZ A;  4B3M B;  4LP8 A;  2BOC C;  4X1Y A;  4CS4 A;  2IJK A;  4PEL A;  1WAZ A;  4QE7 A;  5LHG A;  3ZN1 A;  5KHJ A;  1EZV H;  2X6B A;  1VQL V;  1KU9 A;  3ETD A;  3BHP A;  4CC5 A;  4YHH B;  3ZS8 C;  4TWK A;  3CSX A;  3B77 A;  1M56 C;  3M8A A;  3BY6 A;  4X62 O;  1S77 D;  2PUS A;  2A06 H;  4BW9 A;  3WB1 A;  3ABL B;  4WFE A;  5JVD B;  1KBH A;  4DYL A;  4XBF A;  4X89 A;  1WLE A;  4UB8 Z;  2ZE6 A;  1VQO V;  1O9H A;  2LGQ A;  5IWA B;  1Y6X A;  1N32 B;  2L6L A;  4XDJ A;  2R9A A;  1SQF A;  1D5A A;  5BZB A;  5IJ9 A;  3UCS C;  3AG3 B;  2LFS A;  3SGI A;  1R3I C;  2YXY A;  3F7V C;  2CGO A;  2LP7 A;  2KG7 B;  1N4C A;  4AHC A;  2EZO A;  4DW1 A;  3E22 B;  2GDS A;  2ZR3 A;  3ZMT A;  5L3C A;  1RPO A;  2WSS G;  4JI4 B;  3CMA V;  1YIT V;  5E1A C;  4PDL A;  3VBB A;  1M4U A;  4B3S B;  1JPX A;  2QWO B;  4QIW F;  1IBL O;  1THZ A;  1K9M W;  1BQZ A;  1PPJ H;  3RYH B;  5BR8 O;  4D6T H;  1QLE C;  1CXZ B;  3HKC B;  2Y69 C;  4B3R B;  4J10 A;  3SYO A;  1IXM A;  3GVM A;  2QA4 V;  3OM3 B;  2B1G A;  2Z5U A;  3W7S A;  1KB9 F;  1FFT B;  1UJW B;  2OCC B;  2P6J A;  5CA0 B;  3ZCC A;  5KUK A;  3OTO O;  3DC6 A;  1OV9 A;  4JI1 O;  1B3Q A;  4BW5 A;  3ABT A;  5H5N A;  2IJJ A;  3JAS B;  4LWS B;  1WP7 A;  4JI7 O;  3CCR V;  4QJF B;  3L74 H;  1YJW V;  4I55 A;  4UVB A;  2CAZ C;  1FYJ A;  2WLJ A;  1OCC C;  4KUM A;  2B1I A;  1I94 B;  1L1F A;  2P06 A;  2KB1 A;  2RCV A;  3U11 A;  2RMK B;  1XNQ B;  3HKB B;  1Y66 A;  3WU2 Z;  3JAW A;  4LF7 O;  1VF6 A;  2IJH A;  3R66 A;  2V7Q G;  1YJN V;  4MS2 A;  1RSO B;  3G71 V;  3J81 N;  1MOF A;  4JGS A;  5LMU B;  3Q4H A;  4OPA A;  5K1X A;  1VF5 B;  1ORQ C;  2VQE B;  4JI0 O;  5EIB C;  2OCH A;  1XHX A;  3OW2 U;  1FXK B;  3THO A;  4NTW A;  1OCO C;  1LR1 A;  4ZIB A;  3RN4 A;  3T1Y B;  4F6R B;  1WB8 A;  2ZIM A;  3FB5 C;  1YDX A;  4PD4 F;  2QDO A;  1QCE A;  2KSD A;  3W7X A;  2KQX A;  1H38 A;  1VQK V;  1Y74 B;  4LF4 O;  4GLX A;  3QG5 A;  4HYO A;  3RFR A;  1G1X B;  4DV2 B;  3CCU V;  4DV5 O;  3RW0 A;  2ZE7 A;  1S72 V;  3A0H Z;  3FB7 C;  1SC5 B;  1SS3 A;  4DR7 O;  4PHZ A;  5BMV B;  2A79 B;  5H2F Z;  4FMT A;  5JQG A;  3A0B Z;  1JJ2 U;  2Q69 A;  2GTA A;  1UPG A;  4MTF A;  2JGD B;  4H37 A;  3RYI A;  4IYH A;  3CCL V;  5FNV B;  2UUA B;  1V9P A;  1G6U A;  1HNW B;  2CTQ A;  5KHK A;  1N0N A;  4GX2 A;  3BCC H;  2WAM A;  5KLV H;  1PNK A;  2DOS A;  2H3O A;  3U10 A;  1NZ6 A;  4E4E A;  3VQW A;  4K0K B;  4PDM A;  4EEQ A;  5B1A B;  2FTK A;  5B66 Z;  1K34 A;  2GUZ B;  3JD1 A;  5C93 A;  3W7W A;  4IHJ B;  4WFF A;  1ROP A;  2A7W A;  1TUB A;  2W0X A;  4UV9 A;  3JAL A;  1CP9 A;  4FM0 A;  1IDS A;  3DTU B;  3STZ C;  3ASN B;  4I0X A;  1AI5 A;  4ZOL A;  2QKA A;  4OGQ B;  3VQV A;  1M1K W;  4I9W A;  1US6 A;  1W0J G;  2JDI G;  4DR5 B;  2F4V B;  2F95 B;  1H2N A;  4FJC C;  3A8T A;  4DXW A;  1N34 B;  1AJN A;  3I56 V;  1Q86 W;  4LFA O;  4JI5 B;  4NXM O;  2X6A A;  3E8F A;  1NH2 B;  1XIL A;  2B5U A;  2ADQ B;  2EIK C;  4R6Z A;  3N27 A;  4O2A A;  1MAB G;  1P84 F;  2R70 A;  3TCU A;  1M93 A;  4OX9 O;  5LOV B;  2Q4P A;  4O4J A;  4PI2 A;  3N2G A;  4DV6 B;  4JI6 O;  5B1B B;  4JYB A;  3JAM N;  5IJ0 B;  4U3J B;  1U97 A;  1KC8 W;  3ABL C;  2UXB B;  4RUE A;  2PYJ A;  1S3J A;  1RP3 B;  3FKS G;  3ZN0 A;  2CTP A;  3HKD A;  2IM9 A;  3MHH C;  4UCR A;  1MSW D;  5BXZ A;  2BSK A;  4PA6 A;  3ZMS A;  2WLL B;  2WWW A;  4BR6 A;  3M99 B;  3AG3 C;  4UFZ A;  1DTO A;  5CB4 A;  4DV3 B;  3E35 A;  5A9G A;  4O4I B;  4QPK A;  5C8Y B;  1Q6H A;  3APQ A;  1V55 B;  1MZF A;  3RVZ A;  1NVP D;  4WFG A;  1XEQ A;  1JMK C;  5HFM A;  4JAA A;  3IJ4 A;  2DQ3 A;  1QVG U;  1VQM V;  3AG1 B;  3K3W A;  2YC0 A;  2K1E A;  3ZHV A;  2QWN B;  2AZ0 A;  1S0V A;  3HPL C;  4D7T A;  3U0Z A;  2E5L O;  2QWP B;  2EIJ C;  3UT5 B;  1SQX H;  2Z3Y A;  5GON A;  2M7W A;  3CPW U;  1WNS A;  2BTQ A;  3KZI Z;  3S3W A;  2CH7 A;  4YY3 O;  4CS3 A;  4WF9 V;  1JCH A;  4JTA B;  3SJB C;  3OAA G;  4DR1 O;  3OMA B;  1AP5 A;  3MDS A;  4I50 B;  1I5Y A;  3OUF A;  3NR7 A;  3H1L H;  4MVS A;  4DR6 B;  2ZDI C;  4LF5 B;  2Q7H A;  3RVY A;  1Q3E A;  4N21 A;  1NQT A;  2OCC C;  5FLX N;  4GKK B;  4IYI A;  4ABM A;  1NJI W;  1VQN V;  1Z2G A;  2CGN A;  4CH4 A;  4DR4 B;  4DUY B;  3AG7 A;  4LF9 B;  4AQY O;  5EYP A;  4PA3 A;  4MVO A;  5LBQ A;  4RQE A;  2RDC A;  2UU9 O;  4U3F H;  5LGU A;  2PF4 E;  2DWD C;  2N74 A;  4K8Z A;  3ZRV A;  1R6N A;  3JAT A;  1YVW A;  4JI3 O;  4IGG A;  3C90 A;  4FM2 A;  3ML0 A;  1XNR O;  4PA7 A;  5KHG A;  5J2U A;  2KKW A;  1NI8 A;  2OT5 A;  3BFR A;  3CE2 A;  3SPC A;  2WLN A;  1F4M A;  4YJ2 A;  1SRY A;  4IIJ A;  1Y76 B;  1FXK C;  4JAU A;  5AG2 A;  3LSQ A;  1M5I A;  3K04 A;  4X62 B;  4DV4 O;  1LUV A;  4H0L B;  3CC4 V;  4OXS A;  2X7R B;  2FML A;  5LXT A;  1YIJ V;  4J41 A;  3J7A U;  3CC2 V;  1K97 A;  3AK3 A;  2MK3 A;  1B04 A;  3PN1 A;  5E79 Z;  3QO5 A;  4B7K A;  4X65 B;  1OCZ B;  1K92 A;  4CH6 A;  2M6Y A;  2K9P A;  3K0D A;  1AI4 A;  2UXC O;  1IBM B;  4CC6 A;  5ITZ B;  2VS0 A;  3CRA A;  3L75 H;  2PI4 A;  1XL4 A;  1HNX O;  5DM6 V;  3D3Q A;  3H1J H;  4UUJ C;  5EBL C;  2HKO A;  3L71 H;  2WLI A;  3ICX A;  1GO3 F;  3JD0 A;  4ZKI A;  4ICG A;  1NTK H;  3DGE A;  3D36 C;  1JQ0 A;  1XDC A;  1KKD A;  4O4H B;  3HKE A;  4WFH A;  1N0J A;  1IBL B;  1XUQ A;  2QE7 G;  3K08 A;  2ZM6 O;  4MT8 A;  3RGB A;  5BR8 B;  2ARH A;  4XDK A;  3W7U A;  4JYA O;  4J9Z B;  2Y0P A;  1RPR A;  1BSM A;  3PJS K;  1R6K A;  3OE7 G;  4J42 A;  3JAW B;  2JEU A;  3SPJ A;  4EFE A;  3TXQ A;  4TV9 B;  1H2G A;  4LC1 A;  1SZX A;  3BVO A;  2Q7G A;  4MTG A;  2PZS A;  3Q4H B;  4YIO A;  3LSS A;  4PDV A;  3ZRX A;  2QM8 A;  3OTO B;  3L70 H;  1NR7 A;  1AJQ A;  4JI1 B;  3ASN C;  1WP8 A;  5L3D A;  1YTF B;  2RN9 A;  1WB7 A;  2O57 A;  3ZMV A;  4JI7 B;  3ETE A;  3WB2 A;  2LFR A;  3GB7 C;  1VQ5 V;  4J7Z A;  4K8X A;  4AI8 A;  1N36 O;  4JPR A;  4RQF A;  2GV9 A;  3OR6 C;  3QTC A;  1Q81 W;  3IGA C;  3ZRS A;  4ZHQ A;  1I08 A;  4GT1 A;  4X1K A;  4EB6 B;  3B2E E;  4LF7 B;  1FFX A;  1VP7 A;  2VRZ A;  2ZNI A;  1H2K A;  5JQG B;  5L3F A;  1ZUQ A;  4X1I B;  2P4V A;  3A2F A;  5CBG A;  1YCI A;  2QM7 A;  2HJD A;  3RYI B;  3OGC C;  3KCY A;  4ZI7 A;  1NT2 B;  1TUE B;  2D3O W;  3K06 A;  2XHB A;  1BS3 A;  1RM1 B;  3ZHU A;  1H2L A;  4FLZ A;  2HLD G;  1KEC A;  2YEV A;  1HNZ O;  2JS5 A;  4LF4 B;  2E74 B;  5DN6 G;  2RNB A;  1DF4 A;  4MSW C;  5KA5 A;  4DV5 B;  4NXN O;  3JD2 A;  1N33 O;  1SZT A;  1V55 C;  4LF6 O;  4DR7 B;  3OR7 C;  3NXS A;  4QPJ A;  2YXH A;  5EZY A;  5LP6 B;  1KUQ A;  1DLB A; 
#chains in the Genus database with same CATH homology
 3E8G A;  2Q6A A;  3AG1 C;  3B8N A;  3IC7 A;  3SPH A;  1NVP B;  1F4N A;  1N8R W;  4JF3 A;  1GMG A;  4GX2 A;  5H6Q A;  1P4R A;  2WAM A;  1PNK A;  3SJQ C;  1V54 C;  4G2K A;  2DWE C;  2EBO A;  4HZ3 A;  2NLJ C;  1YI2 V;  1BMF G;  5B3S B;  1QBZ A;  2EIL B;  1WPX A;  2W0F C;  3ZRW B;  5B3S C;  2EIL C;  1YSC A;  1I5X A;  4PDM A;  5B1A B;  3LDC A;  4XDL A;  2XAQ A;  3HB3 B;  1KD1 W;  2FTK A;  5B1A C;  3P32 A;  4FK5 C;  4MVR A;  1K34 A;  3JD1 A;  5C93 A;  3W7W A;  1GM9 A;  3T1C A;  4WFF A;  1ROP A;  2ZD9 A;  1E1R G;  2QTO A;  3QO7 A;  1LNQ A;  4UV9 A;  2BOB C;  3OEE G;  4RUF A;  3K79 A;  3UKM A;  1GTO A;  3P30 A;  1CP9 A;  1OCC B;  3OEH G;  1NR1 A;  3DTU B;  3STZ C;  3ASN B;  2A9H A;  1AI5 A;  1NH2 D;  2DQ0 A;  3ZMU A;  2UXX A;  5CA3 A;  5IYB O;  1M1K W;  4I9W A;  4F4L A;  2DYR B;  1W0J G;  3AG4 B;  4X88 A;  1K33 A;  2JDI G;  5EBM C;  4RAI A;  4FJC C;  3CCQ V;  5CN0 A;  3STL C;  4R50 A;  4DXW A;  1PKX A;  2EZP A;  1XL6 A;  1KQS U;  2C2A A;  1AJN A;  3I56 V;  4GCZ A;  1Q86 W;  2EIK B;  2AHY A;  3CME V;  2X6A A;  3E8F A;  1NH2 B;  3CD6 V;  2QKS A;  2B5U A;  2EIK C;  4R6Z A;  3LDE A;  5LHI A;  2P7T C;  1JOY A;  1MAB G;  2HVJ C;  1K4C C;  1OCO B;  4I5S A;  1PL0 A;  3TCU A;  1JX9 A;  1H8E G;  3EFF K;  4Q20 A;  2X6C A;  5B1B B;  1FXH A;  1AR1 B;  3GWO A;  3SYC A;  2JIZ G;  4G28 B;  5B1B C;  4JYB A;  3AG2 B;  1AI7 A;  2DYS B;  3AG2 C;  1QVF U;  1KC8 W;  3ABL C;  2DYS C;  4RUE A;  4PDR A;  1S3J A;  3FKS G;  3ZN0 A;  3D3I A;  3ASO B;  3MHH C;  4YXW G;  3T4D A;  2X0L A;  1MSW D;  2HFE C;  2WLM A;  3OFN G;  4CZZ A;  3FB6 C;  1Q7Y W;  2ZXW C;  1OHH G;  4PA6 A;  3ZMS A;  2WWW A;  2WLL B;  3QNE A;  4JTC B;  4WFB V;  1GM7 A;  3I55 V;  3M99 B;  2V1D A;  3FYE B;  2JJ2 G;  1VQ9 V;  5HFL A;  4JYC A;  3AG3 C;  3WFV A;  3OMN B;  4UVA A;  3JD4 A;  3G6E V;  1DTO A;  3T4Z A;  3CYO A;  1R73 A;  4RO2 A;  3E35 A;  4QPK A;  2XAG A;  1V55 B;  3W7T A;  1ARO P;  1E1Q G;  3ABM B;  5B1N A;  3RVZ A;  5LGT A;  1NVP D;  4U7N A;  4WFG A;  2OTL V;  2QEX V;  5HFM A;  5EK0 A;  1K8A W;  2GHY A;  1KP2 A;  3K03 A;  4ZBM A;  5EC1 C;  2DQ3 A;  4X8A A;  4CBC A;  4MTX A;  3CCV V;  1S5H C;  4JAS A;  2JK5 C;  1QVG U;  3B8M A;  4H33 A;  3MD0 A;  1BL8 A;  1VQM V;  3AG1 B;  5LHH A;  3K3W A;  1MG1 A;  2K1E A;  3K9A A;  2DW4 A;  3H01 A;  2OTJ V;  1S0V A;  3HPL C;  4P9P A;  5FL7 G;  2P67 A;  3K0G A;  2EIJ B;  4FPP A;  3WG7 B;  2EIN C;  3E83 A;  3CCM V;  4TSF G;  2EIJ C;  3WG7 C;  5J9P C;  2Z3Y A;  1Y4M A;  2H8P C;  1R3K C;  3ABK C;  1V54 B;  3E89 A;  3ETG A;  2M7W A;  1VQ4 V;  2W6J G;  3CPW U;  1H8H G;  3E8B A;  1M57 C;  1B6Q A;  4BAY A;  5IY5 B;  2XAJ A;  1NKD A;  5IY5 C;  1SET A;  5KUM A;  4WF9 V;  1S76 D;  2JEX A;  1JCH A;  4MVQ A;  4P2Z A;  3LNM B;  5H6R A;  4JTA B;  3LUT B;  3ABU A;  3OAA G;  5IYD O;  3OMA B;  3RBZ A;  5IDJ A;  1I5Y A;  3OUF A;  4R7C A;  4MVS A;  3CXC U;  2JJ1 G;  2ZDI C;  5GW7 A;  2IJI A;  2WLK A;  3RVY A;  4L87 A;  4ASU G;  4N21 A;  3R65 A;  1VQ6 V;  1DF5 A;  1NQT A;  1K7D A;  2OCC C;  1F23 A;  1P7B A;  1NJI W;  4MVM A;  2EIM C;  3OMI B;  4GX1 A;  4UXN A;  1VQN V;  3ZMZ A;  1ENV A;  4LP8 A;  4PA9 A;  4LCU C;  4EKW A;  2BOC C;  2IJK A;  2Q68 A;  1J95 A;  4PEL A;  2HG5 C;  4QE7 A;  5LHG A;  4PA3 A;  4MVO A;  3ZN1 A;  5LBQ A;  4RQE A;  2ZR2 A;  2X6B A;  1VQL V;  3OUS A;  5LGU A;  2IU0 A;  1R3L C;  1F51 A;  2DWD C;  3ETD A;  4QNH B;  3ZRV A;  1PNL A;  1R6N A;  4TWK A;  4JAV A;  4N23 A;  1E79 G;  1BHA A;  3B77 A;  3G4S V;  4JTD B;  4PA4 A;  3CC7 V;  1VQ7 V;  3ML0 A;  4PA7 A;  1M56 C;  3X2Q C;  3T2M A;  4BIU A;  3BY6 A;  1S77 D;  3QO8 A;  3ABL B;  2OT5 A;  4MW3 A;  4WFE A;  3SPC A;  4LBE C;  3E86 A;  2WLN A;  2GSM B;  1FXV A;  1F4M A;  4XBF A;  3VOU A;  1SRY A;  4X89 A;  1FXK C;  3E2E A;  1WLE A;  4JAU A;  1VQO V;  2ZXW B;  2ZQM A;  4KP4 A;  3LSQ A;  4XDJ A;  3K04 A;  1Q82 W;  1CPY A;  3AEI A;  1QR9 A;  2Y48 A;  5BZB A;  3AG3 B;  3CC4 V;  2LFS A;  4OXS A;  3ZIA G;  2X7R B;  2F43 G;  2WLH A;  1R3I C;  5CMU A;  1YIJ V;  3F7V C;  2P90 A;  3CC2 V;  2LP7 A;  2ATK C;  1K97 A;  1K73 W;  1FXK A;  1W0K G;  2EZO A;  2MK3 A;  5L3B A;  2ZR3 A;  3QO5 A;  3E8H A;  3ZMT A;  2IH1 C;  4E2L A;  5L3C A;  1RPO A;  2XAF A;  2WSS G;  1OCZ B;  1K92 A;  2XND G;  1OCZ C;  3CMA V;  1PD3 A;  1YIT V;  5E1A C;  3TET A;  4PDL A;  3UM7 A;  2YSU B;  3VBB A;  2EIN B;  1AI4 A;  1M9N A;  3K0D A;  1JPX A;  3JYC A;  2AHZ A;  4R8C A;  2PI4 A;  3ABK B;  4QIW F;  1XL4 A;  5DM6 V;  3FYI B;  4UUJ C;  1THZ A;  2ITD C;  5EBL C;  1M57 B;  2HKO A;  2WLI A;  1K9M W;  3EHB B;  3SPG A;  1GO3 F;  3JD0 A;  4ZKI A;  1OCR C;  5L3G A;  1QLE B;  1SES A;  3DGE A;  3SPI A;  1QLE C;  2Y69 B;  3IFX A;  1JQ0 A;  2HVK C;  4WCE V;  1KKD A;  2Y69 C;  1EBO A;  2HJF C;  3CCE V;  3SYO A;  1IXM A;  2QA4 V;  3OM3 B;  4WFH A;  2XOK G;  3CCJ V;  2W6I G;  5KA6 A;  1SER A;  2B1G A;  2Z5U A;  2QE7 G;  3K08 A;  3W7S A;  1FFT B;  4UV8 A;  1UJW B;  2OCC B;  2P6J A;  2XAS A;  4MT8 A;  2NNU A;  3FB8 C;  4XDK A;  3W7U A;  4J9Z B;  3ZCC A;  1YHQ V;  2EIM B;  1RPR A;  5KUK A;  3PJS K;  1R6K A;  3OE7 G;  2EJR A;  4FIP C;  2JEU A;  3D36 A;  3SPJ A;  4BW5 A;  3ABT A;  4P30 A;  2IJJ A;  4MW8 A;  1H2G A;  4LC1 A;  1YTF D;  2WPD G;  1COW G;  4MTG A;  4G27 B;  3CCR V;  4Z1M G;  3F5W C;  4MVZ A;  1GM8 A;  4QJF B;  5IYC O;  1CEZ A;  3LSS A;  2ITC C;  1AJP A;  4PDV A;  1YJW V;  4MTO A;  4BIZ A;  4UVB A;  4GX5 A;  3ZRX A;  1GKF A;  2WLJ A;  2QM8 A;  2ZDI A;  1OCC C;  1ZWI C;  4KUM A;  4WFA V;  1NR7 A;  2B1I A;  1L1F A;  2KB1 A;  1AJQ A;  3SYQ A;  3ASN C;  2Q67 A;  4UVC A;  1EFR G;  1FS0 G;  4KFM A;  4U7O A;  1R3J C;  3ZRW A;  1M90 W;  4GX0 A;  5L3D A;  1YTF B;  3ZJZ A;  1JVM A;  1Y66 A;  3ZMV A;  1K4D C;  2H94 A;  1K5Q A;  5CBF A;  1G8M A;  3ETE A;  3LDD A;  2IJH A;  2DYR C;  2LFR A;  2V7Q G;  3GB7 C;  3AG4 C;  1M56 B;  3X2Q B;  1YJN V;  1VQ5 V;  4MS2 A;  3G71 V;  1MOF A;  4JPR A;  4RQF A;  1VQP V;  4JGS A;  3OR6 C;  2IH3 C;  4TT3 G;  1Q81 W;  1ORQ C;  3A0R A;  3IGA C;  3ZRS A;  1K3E A;  4DO2 A;  3OW2 U;  4QE9 A;  1FXK B;  4GT1 A;  1G4Y B;  3KG2 A;  3JD3 A;  1OCO C;  1YJ9 V;  2R9R B;  5H9C A;  3MHS C;  3CCS V;  3FB5 C;  1W2B U;  2YEV B;  2XAH A;  5L3F A;  1KP3 A;  1QCE A;  3SYP A;  5CBG A;  3W7X A;  1HWY A;  1H38 A;  2UXN A;  2QM7 A;  4MVU A;  5L3E A;  1VQK V;  5B1O A;  5EBW C;  1QLN A;  4HYO A;  3OGC C;  3CCU V;  4J9Y B;  2PI5 A;  1TUE B;  3RW0 A;  3ASO C;  1S72 V;  2D3O W;  4P9O A;  2WLI B;  3K06 A;  1AI6 A;  1RM1 B;  3FB7 C;  3BEH A;  1RM1 C;  3CP1 A;  2IU3 A;  2CK3 G;  3SYA A;  1NBM G;  1K5S A;  2A79 B;  2HLD G;  1KEC A;  2YEV A;  4FMT A;  2HR3 A;  1GK9 A;  1QR8 A;  1VQ8 V;  5LGN A;  1JJ2 U;  2Q69 A;  2IW5 A;  5DN6 G;  4MTF A;  1DF4 A;  4MSW C;  5EC2 C;  5KA5 A;  3JCZ A;  4H37 A;  3JD2 A;  2R9I A;  4HAM A;  1SZT A;  3CCL V;  1V55 C;  2A0L A;  3ABM C;  1PNM A;  1OZ0 A;  3TK1 A;  3F7Y C;  3OR7 C;  1OCR B;  3NXS A;  4QPJ A;  5CBH A;  1EZJ A;  2WLL A;  1BHB A;  1DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...