4R7CA

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with dimethylammonium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
KDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4r7cA00
3SPCA 4PA7A 4MTOA 4X89A 3WG7C 4MSWC 5KUKA 2WLKA 2ZXWC 3EFFK 4PA3A 3F7YC 5E1AC 4PA9A 3RVZA 5CBGA 3IGAC 4MTGA 2HVJC 4RUEA 4RUFA 5EBWC 1R3LC 2Q6AA 3TCUA 1R3IC 4R6ZA 2Q67A 3SYAA 3SYQA 3AG3C 3AG2C 3STZC 4XDKA 4PDVA 5BZBA 3K08A 4HZ3A 1XL6A 2AHZA 4I9WA 4BW5A 2DYSC 3SPHA 4CBCA 1K4CC 2A9HA 1S5HC 2QTOA 2WLIA 5B1BC 2K1EA 4MW8A 2DWDC 4MS2A 4MW3A 4GX1A 1JVMA 5KUMA 1ZWIC 4MVRA 3ABKC 3RW0A 2OCCC 3KG2A 4MVQA 3E8FA 3E8BA 3E83A 3E86A 3LDEA 4TWKA 2HFEC 3K0DA 4LBEC 3OUFA 1OCRC 2EILC 3IFXA 3LUTB 2EINC 2X6CA 4G28B 4JTCB 3F5WC 1LNQA 2BOCC 4QE9A 2YEVA 2HG5C 1OCOC 2R9RB 1KKDA 4GX5A 4JTDB 2DYRC 4EKWA 3T2MA 2WLMA 4X8AA 3SPGA 5EC2C 3FB6C 2ATKC 5CBHA 5IY5C 5B1AC 3HPLC 3E89A 3FB5C 4MVMA 2X6AA 1M57C 1V55C 1K4DC 2WLLA 3GB7C 2HVKC 4XDJA 3SYOA 4WFEA 1BL8A 3ASNC 3BEHA 4P9OA 4R8CA 3SJQC 5CBFA 4F4LA 4LP8A 3AG4C 1QLEC 2KB1A 3ABLC 2WLNA 1R3JC 1G4YB 3OR6C 4XDLA 2Q68A 1ORQC 2A79B 2DWEC 2H8PC 2HJFC 2A0LA 3K04A 4H37A 4MVOA 4P2ZA 3ZRSA 4X88A 4MVZA 4PA4A 3UM7A 2ITDC 3LDCA 3STLC 5J9PC 3UKMA 4GX2A 4QE7A 4G27B 2WLJA 4MTFA 3LDDA 5EK0A 4PA6A 5EBMC 3R65A 3K0GA 3K06A 2WLIB 4MVSA 3PJSK 4QNHB 2QKSA 1P7BA 3AG1C 3F7VC 3OUSA 4GX0A 4R50A 3ASOC 4R7CA 4WFFA 5EC1C 3RVYA 3VOUA 4UUJC 4PDLA 3SPIA 2Y69C 2ZD9A 3E8GA 4HYOA 4J9ZB 2W0FC 2JK5C 3LNMB 4P30A 4LCUC 3SPJA 1XL4A 4H33A 4PDRA 3SYCA 2BOBC 3OGCC 3OR7C 4J9YB 5B3SC 4OXSA 3E8HA 3FB8C 2AHYA 2P7TC 1V54C 3T1CA 3T4DA 1OCZC 4MVUA 1OCCC 3SYPA 4RAIA 3K03A 4P9PA 4WFGA 2EIKC 1M56C 2IH3C 4WFHA 3TETA 3T4ZA 2ITCC 3X2QC 3ZJZA 3RBZA 5EBLC 1J95A 2WLLB 3JYCA 4KFMA 4DXWA 2IH1C 1R3KC 2EIJC 4RO2A 3FB7C 4ZBMA 2NLJC 2Q69A 2WLHA 3ABMC 4PDMA 2X6BA 2EIMC 4JTAB
chains in the Genus database with same CATH superfamily
2QR4A 1YHQV 3M7MX 4MTGA 3JAMN 5LMNB 1HR0B 4O2BB 3S3WA 5D5PA 4PI0A 2Q4PA 3ML0A 4CS4A 2A9HA 2IJKA 1IX9A 3K9AA 5LGTA 4GKJB 4HNAB 5DEDA 1CXZB 4DK0A 2UUAO 1BSMA 1PPJH 3JD4A 4PI2A 5GTHZ 3A8TA 5L3CA 2JEUA 2BOCC 2F95B 3ZHUA 1KKDA 2JGDB 3CMEV 4O4JA 3JALA 3FB5C 2QWOB 4B3TB 3GB7C 4OGQB 1M93A 3CCUV 5JCOA 1HNXO 3BA9A 1Y74A 1G4YB 5JJNB 1GN4A 1ORQC 1IDSA 1SQGA 4MVOA 4JI3O 1AJNA 3WB2A 2X0LA 3STLC 5CB4B 3UKMA 5JH7B 2ZE6A 4NXMB 4GX0A 1ZX3A 3J81N 4YJ2A 4K0KO 1FPOA 2UXDB 1GK9A 4JI1B 4PDLA 4CZZA 4NVPA 1VQ7V 4UFZA 1AI7A 1FFXB 4AHCA 3E35A 4O4LB 2C2AA 3FB8C 1H38A 2ZKOA 2P67A 4RAIA 3C3SA 1IBKB 2ZXWB 4WFHA 4X1YB 2FYUH 3K79A 4ZHQB 4U7OA 1OCOB 2BE3A 3ABMC 2EIMC 3OFNG 1Z5VA 4FLYA 5JQGA 2WLKA 4DR4O 1LUWA 1NTZH 1R3LC 2HKOA 2QWQB 4DR3B 1Q86W 4UB8Z 4F6EA 1NS1A 1XL6A 5GONA 5EYPA 3ZMVA 4DV7B 4LR3A 4CH5A 2Q0AA 2JJ2G 3CCSV 4KXRA 4DR1O 1OV9A 2HR3A 1AP5A 5LP6C 4JTCB 4DR6B 3D36C 1NVPD 4FIPC 4DV2B 4CC6A 3ASNB 4DV4B 4B3SB 1TVKA 1COWG 2JEXA 1M9NA 1V55C 2B5UA 4HBNA 1SESA 1AP6A 2XASA 2NN4A 4WFEA 1JFFA 2LP7A 1NH2B 1F51A 5IT9N 2WLNA 5J2UA 5KHKA 2H8PC 3K04A 1YZBA 1VQOV 4JI0B 4H0LB 2JDIG 2WWWA 4PELA 1JX9A 5H6QA 4MTFA 4JI8O 4DV0O 1SQQH 1VARA 2HLDG 4FLZA 4GKJO 4MVSA 3IC7A 1Y67A 2EZOA 5LGNA 3Q4HA 3CCVV 4HYOA 4IHJA 2R70A 2IW5A 1N4CA 2W0XA 3ZHRA 4I7ZB 3SJBC 4NB5A 2XAGA 3K03A 1CEZA 1IXMA 1K8AW 4B3TO 5EBLC 1G8MA 3CRCA 4DK1A 5CA0B 4EFBA 1OZ0A 3JAWA 4I50B 1CP9A 3QTCA 1BS3A 1IXBA 4MSWC 2LO1A 5KAFZ 5CA3A 2Z3YA 1B06A 1R3IC 2XOKG 5LL6Y 2QSAA 1M90W 1KB9F 2JRIA 3N2GB 3UO3A 1Q43A 4JGSA 2NNUA 5B1NA 1VQPV 1MSDA 1FXHA 1BT8A 4UV9A 1BHAA 4JI7B 2UXDO 3JSNA 1ZWIC 1Q90D 1NU1H 3FYIB 3TK1A 1AJPA 1KKCA 4FJCC 1IBLO 4ZOLB 4TOIA 1RPOA 4I4TA 2A3QA 3CJHB 2R9RB 3K9SA 4X8AA 5C8YB 2V1DA 3RYHA 1IBKO 1XMOB 4B3RB 3BABA 2UXNA 5FLXN 5FPRA 3OD4A 5D5QA 4JYAO 2EJ7A 4DV5O 4O4HB 2EBOA 1GAXA 2DWEC 1JCHA 4DR3O 4GLXA 2ADPA 2QGNA 3U11A 1WN7A 1X4TA 2B9ZA 3HKBB 2OT5A 4UB6Z 1XUQA 3ZHQA 1DGSA 4YXWG 2QKSA 2GHYA 1AROP 3ZHVA 3H1IH 3HB3B 3HKDB 4R7CA 4UXNA 4LF5B 4DO2A 4LFAB 4J9ZB 3ETDA 1BE3H 2BTOA 2JK5C 1GO3F 4FFKA 1K5SA 1VEWA 1E1QG 4J42A 1V54C 1OCZC 4MVUA 1P84F 3MHSC 1R6TA 5IJ9B 3T4ZA 1JPXA 1J5EO 1EFRG 2H3OA 3JAKA 3OE7G 3ETGA 3WG7C 1U97A 4PA7A 4PA9A 4RWUA 2YDEA 4Q20A 1V55B 3HKCB 1AR5A 2NR5A 3HKEA 1VIBA 1R1BA 5JCOC 5LXTA 4MTXA 1FFTB 2DN9A 1OHHG 2K1EA 4D7SA 2KQXA 4N23A 1WP7A 3B77A 2IJHA 4OPAA 4F6RB 3APOA 4JAVA 3SJCC 2X7RB 2RQ6A 4FZ1A 2W6JG 4YHHO 3N27A 3CCJV 4LNUA 2IM9A 5BMVA 2WLMA 4FFBA 2UUBB 2X6AA 4UVBA 1NVPB 1EN6A 5B1OA 4TUYA 2HVKC 3BRCA 3OM3B 3OW2U 1XHXA 2ZT9B 1K7DA 1VQNV 3FAVA 5LMUO 2BTQA 4JYYA 2HJFC 1S3JA 2CH7A 2Y4TA 3L71H 4I55A 3QG5A 5IJ0B 2JIZG 4PA4A 5CA1A 1PP9H 2ZIMA 2PI5A 4LFBB 1R73A 5AG2A 3CC4V 2VQFB 2O57A 1N0JA 3QNEA 3JD1A 1FXKA 2Y69C 4WCEV 2KG7A 3LNMB 3O65A 3CEIA 1N33O 3SPJA 3LSQA 2ZR3A 2AHYA 3T4DA 3SYPA 1KD1W 1GN2A 4WFGA 4IYHA 3ZIAG 1YITV 5FL7G 1UFIA 3T1YO 5TISZ 2Q69A 3E22A 3CCMV 3RT3C 4DW0A 4ASUG 3F7YC 4O4IB 3BA8A 3SYQA 3CCRV 1QLNA 3RYFB 2GV9A 3ZMZA 1AR1B 4UCOA 2F23A 2GBOA 1HNWO 4B08A 4K8XA 5KHGA 1AI4A 1IVSA 4MW8A 1SQPH 4FLVA 2DQ3A 2JVDA 3GWOA 5LA6B 2A06H 3E8BA 4JI5O 2YSUB 2GUZB 3K0DA 5LBQA 3JCZA 5DECA 2F4VO 1M57B 2VQEO 1Q81W 4GX5A 2YXLA 2EX3A 1L0NH 2AXTZ 1TUEB 3AK1A 3I56V 1QU7A 4JI6O 1N34B 3N2KA 1QR9A 1V54B 1OCZB 1R6NA 4I5SA 3RYIB 4NYKA 3AG4C 3OTOB 4DR2O 1MNGA 4NXNB 4XDLA 3M99B 1X59A 4PD4F 4AI8A 1PM9A 4YIPA 1FAFA 1H2LA 4E2LA 2ZE7A 3UCSC 4JI2B 3WG7B 4JI4B 1SQFA 2CDYA 3SR2C 5EK0A 2JJ1G 2GTSA 4PA6A 4FLWA 4LH7A 1S77D 3GVMA 1K97A 2KSDA 2LGWA 3JARB 5CMUA 1AI6A 4TV8A 1Q3EA 2E3CA 2EIKB 1VP7A 3OR7C 3RYCB 4X64O 5B3SC 3BPZA 2XAHA 4J41A 3T1CA 4FLXA 1TUBA 5J2TA 1BQZA 5LGUA 1J95A 4J7KA 3A2FA 5JVDB 4K35A 4AQYB 5K1XA 1PNLA 1PV0A 3RVZA 5CBGA 4RUEA 5B1BB 3DXRA 2FKXA 3SYAA 5L3GA 2Q7HA 3DSQA 4NTXA 3L75H 4DYLA 4X65O 3B2EE 2QWRB 3D8CA 1D2DA 2WLIA 1K34A 3B4SA 3OAAG 4X20A 2ODMA 4TQDA 1RPRA 3I55V 2ETNA 4LWSB 1BHBA 1Y76A 5JQGB 4TWKA 2DE0X 3J80N 2FL4A 5IY5B 2EINC 2Y4UA 1S5LZ 3OMAB 3FYEB 3CYOA 2WPDG 3IJ4A 5EYPB 3S3XA 2Y69B 4FZ0A 4FVMA 4DUZO 1QLEB 4LFCB 4MVMA 1HNZB 5IYCO 2UUCB 4YY3O 1DF5A 3L70H 4RQFA 4DV1B 4UCUA 3BHPA 1VQ4V 2Q0OC 4R8CA 2CGOA 2PYJA 3ZRWA 5KHHA 4G2KA 2RJZA 3C90A 2V7QG 4KHPO 3A0HZ 3AG1B 2ITDC 2YIBA 4L87A 1US6A 2EJRA 2YS8A 1TVKB 2ZR2A 1MZFA 2UXXA 3F7VC 3ASOC 4B7EA 3JATA 1JJOA 3CMAV 5J2UB 3FFQA 4LCUC 3OMIB 1XL4A 2YICA 4PDRA 4X1IA 4BR6A 2CTRA 2YEVB 3B8NA 2QM8A 5B66Z 1TGOA 3ZN0A 4Z2WA 4WBNB 1N34O 2WLLB 4DXWA 2DW4A 1SA0B 1M1KW 3AG3B 3FB7C 1ZSPA 4O2AA 3ZMSA 4X89A 4MTOA 3T1HO 3EFFK 5IDJA 2BSKA 5E1AC 3I5DA 3IGAC 1IBMO 4JV5O 4JZGA 1M5IA 2FMLA 4FLUA 3R66A 3JASB 5LOVB 5IWAB 1QVFU 3AG4B 4JF3A 1PNMA 5HFMA 2IBZH 1N8RW 2EZPA 3JAWB 1L0LH 4D6TH 4MVRA 3RW0A 2OCCC 3E83A 1B04A 3NXSA 4DR5B 4UVAA 1I94B 4QE9A 1VQ8V 1LNQA 4DW1A 4LF6B 3K58A 4WFBV 4GKKB 4KUMA 1FXKC 4Z1MG 1WPBA 2RNBA 1XILA 4DV3B 2LFRA 4N21A 5B3SB 3ZS8C 4FM2A 4AQYO 3UO2A 3FKSG 5H6RA 1XNRO 3LSUA 5A2QN 3K5MA 3C3TA 4DRXA 1PL4A 4IIJB 4O2BA 4X88A 4MVZA 3LNNA 2D3OW 2E5LO 3WB0A 4BWAA 5BR8B 3FX7A 4DUYO 4W4KA 4ZIBA 1SF9A 4HNAA 4WFFA 3MD0A 2OIGA 3OT7A 3W7TA 4X62O 2WA3A 1N0NA 1D5NA 2AZ0A 3ABUA 4CS2A 3CE2A 3OGIB 3EVKA 5LMNO 1HR0O 3E8HA 2EIJB 1RM1C 1LR1A 1TA8A 4H13B 4LFCO 3TETA 2D2CB 3X2QC 5IYZB 5HFLA 4DV1O 1R3KC 2QTSA 2CUGA 4PDMA 4JTAB 2CAZC 2RN9A 1P49A 1ZUQA 1MZEA 5L3BA 1N32B 1NI8A 4R6ZA 5CB4A 1MSWD 4HZ3A 3ZHTA 5IE9A 1IURA 5JH7A 2DYSC 2CTWA 2DMXA 4OPHA 5KMGB 4JYBA 4ABMA 4JZ2A 2DWDC 3JAKB 1QR8A 1Y4MA 3CRQA 3K5LA 3BFRA 3NR7A 4MVQA 2PUSA 4C7UA 5FPOA 2BCCH 1MMMA 2F66C 1FFXA 2EILC 2X6CA 3G4SV 1H2GA 1VQKV 1VF6A 1JA8A 5LXTB 2DYRC 1MA1A 2Q5ZA 3HPLC 4U3JB 4X1YA 3ZMTA 4NXMO 4DR7B 4ZHQA 1O9GA 1QCEA 2YC0A 5EZYA 4JI1O 2XHBA 2KKWA 4F4LA 3ZX6A 3H1LH 1DTOA 4YJ3B 3LSSA 3G71V 2UU9B 4IGGA 1JOYA 1FD9A 1SC5B 3KCXA 2E74B 4A5UB 3FAVB 4UUJC 1S72V 2ZD9A 5KX5A 2ZNJA 2YIBD 1I5XA 1EZJA 4I55B 2CH7B 1BMFG 3K3WA 3UT5B 3QO8A 3ABMB 1YF2A 5E79Z 2EIMB 1EN5A 2Y0PA 3BCCH 1PL0A 2YIDA 3JD3A 4HAMA 4DV7O 3GWKC 2P5OA 4J7JA 3R65A 4EFEA 1WPXA 2B1IA 1FXKB 2ZQMA 5KUKA 2KG7B 4TT3G 1W59A 5ITZB 1NZ6A 2PI4A 2WAMA 4DR6O 2YIAA 3CCQV 4DV2O 2AHZA 4I9WA 4DV4O 4YIOA 4B3SO 3CWBH 3K59A 1XI1A 4LF4B 1VQ5V 4GUNA 1S0VA 4ICGA 5LP6B 1VQ9V 2CGNA 1G6UA 3E22B 1RSOB 4UV8A 2RCVA 4B3MB 2P06A 1YTFD 4G28B 4JI0O 4ZI7A 1WB8A 1K5QA 1U96A 1SRYA 3SPGA 5B1AC 1XNQB 5CA0A 3SYOA 4NTWA 4CH4A 3SDLA 4D7TA 1KUQA 4GCZA 3G67A 1N32O 1R3JC 3OR6C 3X2QB 3ZRSA 1NTKH 4LF7B 1HP8A 3JCUZ 3A0RA 4KL1A 3VQWA 1XMQB 2IU0A 1H2MA 3TGUH 1WB7A 1GH6A 2F43G 1NR7A 2E75B 4ZOLA 1JMKC 1KQSU 1GM7A 1GM9A 1XHZA 1R6KA 3OGCC 4X1KB 5IYDO 2N05A 5GTIZ 3U10A 4TV9A 5C8YA 3QF7A 1M56C 1N36B 2EILB 2XTAA 2ITCC 1IZ3A 4WF9V 4JI7O 4I0XB 3SPCA 4O4HA 1THZA 2ARHA 5LHHA 5F2VO 4KP4A 4UCVA 1NBMG 2UU9O 5LHGA 2ZM6B 3DC6A 5KLVH 5FNVB 2QTOA 1VF7A 1XMOO 4B3RO 2LJ2A 4MS2A 3HKDA 3W7WA 3QO5A 3KG2A 3E86A 3LDEA 4UCSA 1OCRC 3H01A 3F5WC 1RP3B 3H9VA 1S5JA 3L74H 5LYJA 1ZTEA 5IJ9A 4X20B 4LF5O 1MG1A 1F7YA 2UUAB 2VRZA 4LFAO 4LF8B 4GT1A 4CS3A 1YXBA 3P32A 4BAYA 5L3EA 1Y66A 4NR1A 2A7WA 5KA6A 1RFYA 2QKCA 4UCRA 2PGGA 1KC8W 1LUVA 1HNXB 4B3MO 4F6RA 3ABTA 3ZRWB 1WAZA 3G6BA 4JPRA 4H33A 4JI3B 4QJFB 2XAFA 3ZCCA 1VQLV 2Y0IA 1YVWA 4O4JB 2IH3C 3JALB 3CX5F 4J10A 1VMGA 1VF6C 4RO2A 4K0KB 1SZTA 2WLHA 4E4EA 3K5OA 2ZXWC 5B1AB 1DF4A 1Y74B 1Q6UA 5B5EZ 5GW7A 3STZC 4PDVA 2LW7A 1H2NA 1BZKA 2N74A 1XMQO 1K4CC 2UUBO 4GYCB 2QKAA 2Q73A 1UJWB 4XBFA 1K92A 1QVGU 3SJAC 1JVMA 4IL6Z 4YJ2B 2GTAA 5JJJB 2CTPA 1TAEA 2ZINA 2BSKB 3HR0A 4DR4B 3WB1A 4H44B 5LHIA 1YTFB 4LF9B 1W0KG 3FB6C 4OX9B 1L8DA 3OTFA 3E89A 3H1KH 1K4DC 1BQ0A 4LFBO 2VQFO 3ASNC 2MW2B 3ETQA 3P30A 4DR1B 1M56B 2KB1A 3ABLC 4LH6A 1H8EG 4P2ZA 2P22C 3CHXA 1P7GA 2DOSA 4FLTA 5GONB 2YXHA 3LDDA 1WJZA 4X66B 3A0BZ 3J7AU 3PJSK 3CXCU 1DK1A 3ZRXA 5JWPA 5LA6A 1Q6IA 4CH6A 2M7WA 2GUZA 2W0FC 4P30A 1HWYA 4DRXB 5H9CA 3TJTA 5EIBD 4J9YB 3AK2A 2ZE8A 1KP2A 1I7FA 1FXVA 2P7TC 4JI8B 4DV0B 1OCRB 4J11A 3RBZA 1P4RA 1BCCH 2Y48A 2NLJC 2AW9A 1JFFB 2QDOA 3RYIA 3L73H 4LF8O 4QIWF 2F1MA 3TCUA 3ZRVA 2Q67A 3B40A 3APQA 1SS3A 3KKYA 4J7ZA 1I5YA 1GTOA 3ZMUA 3TXQA 4PJ0Z 1FYJA 2RDCA 2AZ2A 2JGUA 5CN0A 2DJVA 4DV6B 3VQYA 3JARA 3ABKC 3IC9A 2YI9A 3Q4HB 5EIBC 3OTOO 4IHJB 5C93A 2V4DA 4NXNO 1V9PA 2FTKA 2R9IA 1ZL8A 3RYCA 2HG5C 1M4UA 3G80A 1YJWV 4EKWA 1ROPA 3BAAA 1YSCA 3T2MA 1YJNV 4JI2O 2M6YA 4JI4O 2ZDIA 3PN1A 4GZRB 3CC7V 1WLEA 1H2KA 1SZXA 4XDJA 1WA8A 5JVDA 1BL8A 4QPKA 1Q82W 1JQ0A 4UCTA 4LP8A 3MAQA 1IBLB 1T5EA 2ZE5A 2QE7G 1KP3A 5KHJA 3WU2Z 4WFAV 3H1HH 5EBMC 4QNHB 2PF4E 4R50A 2P4VA 3WFVA 1JJ2U 4JYAB 4LWSA 3VOUA 2UXBB 5EZYB 4DV5B 4EB6A 2Q7EA 2OCHA 3ICXA 1FS0G 4CC5A 2GSMB 3SYCA 4I4TB 3RGBA 4LF9O 2JS5A 1G1XB 3DTUB 2QWPB 4MT8A 2RMKB 4OX9O 3RYHB 2IJJA 3VQVA 1JR9A 1XBLA 1PKXA 4KFMA 4IYIA 1SQXH 3DGEA 1GRJA 1SQBH 1XDCA 1SKVA 4JYCA 5KX5B 1K3EA 3P3NA 1SQVH 4TQFA 2F93B 2QM4A 2Q6AA 1GKFA 5BZBA 2JGDA 4JAUA 1HDJA 4CBCA 4X66O 3ABLB 1J5EB 2GDSA 1HNZO 2EINB 2XT9A 2UUCO 1VF5B 4MW3A 4UVCA 3G6EV 4K3AA 2VWJA 2UXCB 1NJIW 3BY6A 1KBHA 1FKAO 1AB3A 1S76D 2YEVA 1F4MA 3CXHF 4AILC 4J80A 4FM0A 4W4LA 3U0ZA 4FPPA 2WSSG 4WBNA 2WLLA 1AJQA 1SA0A 4U3FH 3BEHA 3SGIA 1NQTA 1YDXA 3O9OA 2Q68A 1B6QA 4H37A 3K57A 4FK5C 4O4LA 3HKEB 4ZI7B 3W7XA 4YHHB 3CC2V 2QA4V 3ASOB 2XUMA 1AI5A 4NKGB 3JASA 4GX2A 5LOVA 1I0HA 1GM8A 4DV6O 3OUSA 4NTYA 5EC1C 1EZVH 5LMUB 1YJ9V 1SERA 5DN6G 3DC5A 1NT2B 4RQEA 1B3QA 1AVMA 1XQ8A 4OXSA 1YIJV 3ABKB 4LNUB 5BMVB 5KHIA 4FFBB 5IWAO 3OMNB 2N04A 4TUYB 2G38A 1E1RG 1FJGB 2Q9LA 1N33B 4RUFA 2BTQB 4IIJA 4DR5O 1I94O 3FD9A 3ZHSA 4LF6O 2QJ1A 2YI8A 4GKKO 1ENVA 4TV9B 4Q6GA 2OCCB 4L8JA 2HHHB 3SPHA 5CA1B 1KECA 4DV3O 1SETA 1Q8IA 3T1YB 2VWKA 2UXBO 3IAYA 2QM7A 2WA4A 1Q7YW 3B09A 1I08A 1GMGA 2HFEC 2OWOA 4X9QA 1K73W 3K5NA 3VQXA 4Z1VA 4JTDB 3UQ8A 1W0JG 1HNWB 5K1PA 5BR8O 2QWNB 2OTJV 3MDSA 5IYZA 1M57C 1KU9A 2QEXV 3CRAA 3L72H 1Z2GA 3THOA 3KCYA 3P3PA 1VQMV 4JI5B 2YUAA 1AILA 4QPJA 1XEQA 4TSFG 1H8HG 3EHBB 5JJEB 2F4VB 4QGPA 2A79B 2CTQA 2VQEB 2A0LA 1W2BU 4PHZA 4QE7A 5LYJB 2WLJA 3ETEA 5KMGA 4FM1A 5A9GA 1QHTA 1D5AA 3K0GA 1L1FA 3M8AA 4JI6B 1AR4A 1DLBA 2LQTA 5DM6V 4I50A 2UXCO 1RM1B 4DR2B 3D3QA 1KMIZ 4BIUA 1CPYA 1QNMA 1OCCC 3N2GA 1Y6XA 2ADQB 2EIKC 1QBZA 4U3JA 1GN3A 2P4KA 5KA5A 1YEWA 2OIEA 3N2KB 2P90A 2EULA 2X6BA 4FMTA 2ZDIC 2DYSB 4PA3A 2B1GA 2E76B 3CP1A 3CCLV 2R72A 4X64B 3AG2C 4YJ3A 3CJHA 5H5NA 4BW5A 3E2EA 4ZKIA 3QO7A 2MK3A 5B1BC 1EN4A 4DR7O 1K33A 5KAIZ 1ZLZA 3MHHC 1HW7A 2DYRB 3E8FA 4TV8B 1WNSA 4LBEC 3OUFA 2HEPA 3IFXA 3L9DA 3LUTB 2LW1A 2Z0AA 2CE4A 3KZIZ 3UT5A 2IJIA 4X65B 1UPGA 1TUBB 5J2TB 5EC2C 3HKBA 5IY5C 2OTLV 3CCEV 1E79G 3EXAA 2HJDA 2K9PA 1YI2V 4P9OA 3CRRA 3CRMA 2ZIOA 3CD6V 4K8ZA 1FJGO 1QLEC 2XAJA 5ITZA 1VQ6V 3DXRB 3RN4A 3VBBA 2XAQA 3UM7A 1Q6HA 2Q7GA 5J9PC 1NR1A 2HHHO 4G27B 1GN6A 4DUZB 3CB2A 4CH3A 2WLIB 4YY3B 5BY1A 5LP6A 3JSLA 5H2FZ 1P7BA 3AG1C 3TXSA 3OEHG 1RSOA 3D36A 3RVYA 5IYBO 2YXYA 4B7KA 3E8GA 1Y76B 3W7SA 1XOUA 1PD3A 5L3DA 2P6JA 3HKCA 4KHPB 2BOBC 2JS3A 3ZBHA 1EBOA 2LGQA 4JASA 1KYOF 4P9PA 3AEIA 4LF4O 3B8MA 3H1JH 2IH1C 4BIOA 4ZBMA 1Q5OA 2OYQA 5L3FA 4U7NA 4LC1A 3BVOA 1O9HA 1MABG 5EBWC 1XREA 1MOFA 2HVJC 1YCIA 3AG3C 2XNDG 4XDKA 1F4NA 3QVNA 3K08A 2Z5UA 3OEEG 1H2SB 1S5HC 1WP8A 1A32A 2VS0A 4BIZA 1XNQO 2W6IG 3W7UA 4GX1A 5KUMA 1QQCA 3JATB 3RWRD 1F23A 3T1HB 3ZN1A 1IBMB 4X1KA 4IT5A 4X1IB 2L35A 1OCOC 5IJ0A 4JV5B 3JD0A 4LF7O 4I9QA 1NH2D 5CBHA 2ATKC 2IU3A 1PNKA 1EM1A 1BGYH 2H94A 3F5TA 3D3IA 3AK3A 4I0XA 1OCCB 3SJQC 4O2AB 5CBFA 3CSXA 1NKDA 1ZL8B 3AG7A 1URFA 3CS5A 3LDCA 1OJHA 5FNVA 2AGAA 2PYLA 1N36O 3K06A 4PV1B 2L6LA 1K9MW 2CK3G 3AG2B 1WA8B 4JAAA 3CPWU 2FB5A 1XNRB 2Q8VA 3SPIA 2R9AA 5BXZA 4O4IA 2DQ0A 2ILMA 3ZEDA 2E5LB 4BW9A 3RYFA 2HP8A 4EEQA 2ZM6O 1Z5WA 4DUYB 3RFRA 1ZAUA 2PZSA 2PTMA 3ZJZA 2ZCEA 3JYCA 2PY5A 1NTMH 2EIJC 3JD2A 2LFSA 4EB6B 4X62B 2ZNIA
chains in the Genus database with same CATH topology
1FXKB 2ZQMA 5KUKA 4TT3G 4JYCA 1YHQV 1K3EA 4ASUG 3F7YC 4MTGA 2Q6AA 2PI4A 2WAMA 1GKFA 3SYQA 3CCRV 1QLNA 5BZBA 3ZMZA 1AR1B 3CCQV 2AHZA 4I9WA 4JAUA 3ML0A 4CBCA 2A9HA 3ABLB 1VQ5V 2IJKA 1S0VA 1AI4A 3K9AA 5LGTA 4MW8A 2EINB 4MW3A 1VQ9V 4UVCA 3G6EV 2DQ3A 3GWOA 4UV8A 1NJIW 3E8BA 3BY6A 1YTFD 3JD4A 2YSUB 5LBQA 3K0DA 3JCZA 5L3CA 1S76D 4G28B 1M57B 2JEUA 2BOCC 1Q81W 2YEVA 1KKDA 1F4MA 4GX5A 1K5QA 1SRYA 3SPGA 1TUEB 3CMEV 5B1AC 3FB5C 4FPPA 2WSSG 3I56V 2WLLA 3GB7C 1AJQA 3CCUV 3SYOA 1QR9A 1V54B 3BEHA 1OCZB 1R6NA 1NQTA 4I5SA 4GCZA 3AG4C 1R3JC 1G4YB 3OR6C 3M99B 2Q68A 1B6QA 1ORQC 4H37A 4XDLA 4YXWG 3X2QB 4MVOA 3ZRSA 4FK5C 3CC2V 3W7XA 1AJNA 4E2LA 2QA4V 3ASOB 1AI5A 2X0LA 3STLC 3WG7B 3UKMA 4GX2A 3A0RA 1GM8A 5EK0A 2JJ1G 4PA6A 2IU0A 1S77D 3OUSA 1K97A 4GX0A 5EC1C 1GK9A 5CMUA 1AI6A 1YJ9V 4PDLA 1SERA 4CZZA 2F43G 5DN6G 1VQ7V 1AI7A 1NR7A 4RQEA 2EIKB 1KQSU 1GM7A 1GM9A 1R6KA 3E35A 3OGCC 5IYDO 3OR7C 2C2AA 4OXSA 5B3SC 3FB8C 2XAHA 1YIJV 1H38A 3T1CA 3ABKB 2P67A 4RAIA 1M56C 3OMNB 2ZXWB 4WFHA 2EILB 2ITCC 3K79A 4WF9V 5LGUA 1J95A 4U7OA 1OCOB 3ABMC 2EIMC 3OFNG 3SPCA 1E1RG 2WLKA 1PNLA 1THZA 3RVZA 5CBGA 4RUFA 4RUEA 5LHHA 5B1BB 1R3LC 4KP4A 2HKOA 3SYAA 5L3GA 1NBMG 1Q86W 1ENVA 1XL6A 5LHGA 2OCCB 3SPHA 3ZMVA 2QTOA 2WLIA 1K34A 1KECA 3OAAG 4MS2A 3W7WA 1RPRA 1SETA 3QO5A 2JJ2G 3I55V 3CCSV 2QM7A 1Q7YW 3KG2A 1BHBA 3E86A 3LDEA 1GMGA 4TWKA 2HFEC 5IY5B 1OCRC 2HR3A 3H01A 1K73W 2EINC 4JTCB 3F5WC 3OMAB 3FYEB 3CYOA 1NVPD 2WPDG 4FIPC 4JTDB 1W0JG 3ASNB 2Y69B 2OTJV 1COWG 1QLEB 4MVMA 2JEXA 1M57C 1M9NA 1V55C 5IYCO 2QEXV 1DF5A 2B5UA 4RQFA 1SESA 1VQ4V 2XASA 1NH2B 4WFEA 2LP7A 1F51A 1MG1A 4R8CA 1VQMV 4QPJA 4TSFG 1H8HG 3ZRWA 2WLNA 3EHBB 4G2KA 2H8PC 2A79B 4GT1A 3K04A 2A0LA 2V7QG 3P32A 1VQOV 1W2BU 3AG1B 2JDIG 4BAYA 2ITDC 5L3EA 2WWWA 4PELA 4QE7A 4L87A 2WLJA 1JX9A 3ETEA 2EJRA 4MTFA 5H6QA 1Y66A 2ZR2A 2HLDG 5KA6A 3K0GA 1L1FA 4MVSA 3IC7A 2UXXA 3F7VC 1DLBA 3ASOC 5DM6V 2EZOA 1KC8W 5LGNA 1RM1B 3CCVV 3ABTA 4HYOA 3ZRWB 3CMAV 2IW5A 4JPRA 4LCUC 3OMIB 1XL4A 4H33A 4PDRA 4QJFB 4BIUA 2XAFA 2YEVB 1CPYA 2XAGA 3ZCCA 3B8NA 1OCCC 1VQLV 3K03A 2QM8A 1CEZA 2EIKC 1QBZA 1IXMA 3ZN0A 1K8AW 2IH3C 5EBLC 1G8MA 5KA5A 2WLLB 4DXWA 2DW4A 4RO2A 1OZ0A 1M1KW 3AG3B 3FB7C 1SZTA 2P90A 1CP9A 2WLHA 2X6BA 4FMTA 3ZMSA 2ZDIC 4X89A 4MTOA 4MSWC 2DYSB 2ZXWC 3EFFK 4PA3A 5IDJA 5CA3A 5B1AB 1DF4A 5E1AC 2B1GA 3IGAC 2Z3YA 3CP1A 1R3IC 3CCLV 2XOKG 5GW7A 3AG2C 3STZC 1M90W 4PDVA 4BW5A 3E2EA 4ZKIA 3QO7A 2MK3A 2NNUA 4JGSA 3AG4B 1K4CC 1QVFU 5B1NA 1VQPV 5B1BC 4JF3A 1FXHA 1PNMA 1K33A 4XBFA 5HFMA 1UJWB 4UV9A 1N8RW 1K92A 1BHAA 2EZPA 1QVGU 1JVMA 1ZWIC 4MVRA 3RW0A 3MHHC 2OCCC 2DYRB 3E8FA 3E83A 3FYIB 3TK1A 1AJPA 4LBEC 3OUFA 4FJCC 3IFXA 3LUTB 3NXSA 5LHIA 4UVAA 1RPOA 4QE9A 1LNQA 1VQ8V 1YTFB 2R9RB 4WFBV 4KUMA 2IJIA 1W0KG 4X8AA 1FXKC 4Z1MG 2V1DA 5EC2C 3FB6C 5IY5C 2OTLV 3CCEV 3E89A 1E79G 1K4DC 2UXNA 2LFRA 4N21A 5B3SB 1YI2V 3ASNC 4P9OA 3P30A 3FKSG 5H6RA 3CD6V 1QLEC 1M56B 2XAJA 2KB1A 3ABLC 1VQ6V 2EBOA 2DWEC 1H8EG 4P2ZA 1JCHA 4X88A 3VBBA 4MVZA 2D3OW 2XAQA 3UM7A 5J9PC 1NR1A 4G27B 3LDDA 2OT5A 2WLIB 3PJSK 3CXCU 2QKSA 1P7BA 2GHYA 1AROP 3AG1C 3MD0A 3HB3B 4R7CA 4WFFA 3OEHG 3ZRXA 4UXNA 3D36A 3RVYA 4DO2A 5IYBO 3W7TA 2M7WA 3E8GA 3W7SA 4J9ZB 2W0FC 3ETDA 2JK5C 3ABUA 1GO3F 1PD3A 4P30A 1HWYA 5H9CA 1K5SA 5L3DA 2P6JA 1E1QG 2BOBC 4J9YB 1EBOA 3E8HA 4JASA 1KP2A 2EIJB 2P7TC 1FXVA 1V54C 1OCZC 1RM1C 4MVUA 3MHSC 4P9PA 3AEIA 1OCRB 3TETA 3T4ZA 1JPXA 3X2QC 3B8MA 5HFLA 3RBZA 1EFRG 1P4RA 2IH1C 1R3KC 3OE7G 4ZBMA 2Y48A 2NLJC 3ETGA 4PDMA 3WG7C 4JTAB 4PA7A 5L3FA 4U7NA 4QIWF 4LC1A 5L3BA 4PA9A 1MABG 2HVJC 5EBWC 1MOFA 1V55B 4Q20A 3TCUA 3ZRVA 4R6ZA 2Q67A 3AG3C 2XNDG 4XDKA 1F4NA 1I5YA 1MSWD 3K08A 4HZ3A 4MTXA 1FFTB 1GTOA 3ZMUA 2Z5UA 2DYSC 3OEEG 1S5HC 1OHHG 4JYBA 2K1EA 4BIZA 2DWDC 5CN0A 2W6IG 3W7UA 4GX1A 1QR8A 4N23A 5KUMA 1Y4MA 3B77A 2IJHA 3ABKC 4MVQA 1F23A 4JAVA 3ZN1A 5C93A 2EILC 2X7RB 2FTKA 2R9IA 2X6CA 3G4SV 1H2GA 1VQKV 2HG5C 2W6JG 1OCOC 1YJWV 3JD0A 2DYRC 4EKWA 1ROPA 1YSCA 3T2MA 3CCJV 1YJNV 2WLMA 2ZDIA 1NH2D 5CBHA 2ATKC 3CC7V 2IU3A 3HPLC 3ZMTA 1WLEA 2X6AA 1PNKA 4UVBA 1NVPB 2H94A 5B1OA 1QCEA 2HVKC 3D3IA 3OM3B 4XDJA 3OW2U 1VQNV 1K7DA 1Q82W 1BL8A 4QPKA 1JQ0A 1OCCB 3SJQC 5CBFA 4F4LA 4LP8A 1NKDA 2HJFC 1S3JA 1DTOA 2JIZG 4PA4A 2QE7G 3LSSA 1KP3A 3LDCA 3G71V 4WFAV 1JOYA 5EBMC 3R65A 3K06A 2PI5A 4QNHB 1R73A 1K9MW 4R50A 2CK3G 3AG2B 3CC4V 3WFVA 1JJ2U 3CPWU 3VOUA 4UUJC 3QNEA 1S72V 3JD1A 1FXKA 2Y69C 2ZD9A 3SPIA 4WCEV 3LNMB 1FS0G 2GSMB 3SPJA 1I5XA 1EZJA 3LSQA 2DQ0A 3SYCA 1BMFG 3K3WA 2ZR3A 2AHYA 3DTUB 3T4DA 3QO8A 4MT8A 3SYPA 1KD1W 3ABMB 2EIMB 4WFGA 1PL0A 2IJJA 3JD3A 4HAMA 3ZJZA 3ZIAG 1PKXA 1YITV 3JYCA 4KFMA 5FL7G 2EIJC 3CCMV 2Q69A 3JD2A 2LFSA 3DGEA 1WPXA 2B1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPC A;  4PA7 A;  4MTO A;  4X89 A;  3WG7 C;  4MSW C;  5KUK A;  2WLK A;  2ZXW C;  3EFF K;  4PA3 A;  3F7Y C;  5E1A C;  4PA9 A;  3RVZ A;  5CBG A;  3IGA C;  4MTG A;  2HVJ C;  4RUE A;  4RUF A;  5EBW C;  1R3L C;  2Q6A A;  3TCU A;  1R3I C;  4R6Z A;  2Q67 A;  3SYA A;  3SYQ A;  3AG3 C;  3AG2 C;  3STZ C;  4XDK A;  4PDV A;  5BZB A;  3K08 A;  4HZ3 A;  1XL6 A;  2AHZ A;  4I9W A;  4BW5 A;  2DYS C;  3SPH A;  4CBC A;  1K4C C;  2A9H A;  1S5H C;  2QTO A;  2WLI A;  5B1B C;  2K1E A;  4MW8 A;  2DWD C;  4MS2 A;  4MW3 A;  4GX1 A;  1JVM A;  5KUM A;  1ZWI C;  4MVR A;  3ABK C;  3RW0 A;  2OCC C;  3KG2 A;  4MVQ A;  3E8F A;  3E8B A;  3E83 A;  3E86 A;  3LDE A;  4TWK A;  2HFE C;  3K0D A;  4LBE C;  3OUF A;  1OCR C;  2EIL C;  3IFX A;  3LUT B;  2EIN C;  2X6C A;  4G28 B;  4JTC B;  3F5W C;  1LNQ A;  2BOC C;  4QE9 A;  2YEV A;  2HG5 C;  1OCO C;  2R9R B;  1KKD A;  4GX5 A;  4JTD B;  2DYR C;  4EKW A;  3T2M A;  2WLM A;  4X8A A;  3SPG A;  5EC2 C;  3FB6 C;  2ATK C;  5CBH A;  5IY5 C;  5B1A C;  3HPL C;  3E89 A;  3FB5 C;  4MVM A;  2X6A A;  1M57 C;  1V55 C;  1K4D C;  2WLL A;  3GB7 C;  2HVK C;  4XDJ A;  3SYO A;  4WFE A;  1BL8 A;  3ASN C;  3BEH A;  4P9O A;  4R8C A;  3SJQ C;  5CBF A;  4F4L A;  4LP8 A;  3AG4 C;  1QLE C;  2KB1 A;  3ABL C;  2WLN A;  1R3J C;  1G4Y B;  3OR6 C;  4XDL A;  2Q68 A;  1ORQ C;  2A79 B;  2DWE C;  2H8P C;  2HJF C;  2A0L A;  3K04 A;  4H37 A;  4MVO A;  4P2Z A;  3ZRS A;  4X88 A;  4MVZ A;  4PA4 A;  3UM7 A;  2ITD C;  3LDC A;  3STL C;  5J9P C;  3UKM A;  4GX2 A;  4QE7 A;  4G27 B;  2WLJ A;  4MTF A;  3LDD A;  5EK0 A;  4PA6 A;  5EBM C;  3R65 A;  3K0G A;  3K06 A;  2WLI B;  4MVS A;  3PJS K;  4QNH B;  2QKS A;  1P7B A;  3AG1 C;  3F7V C;  3OUS A;  4GX0 A;  4R50 A;  3ASO C;  4R7C A;  4WFF A;  5EC1 C;  3RVY A;  3VOU A;  4UUJ C;  4PDL A;  3SPI A;  2Y69 C;  2ZD9 A;  3E8G A;  4HYO A;  4J9Z B;  2W0F C;  2JK5 C;  3LNM B;  4P30 A;  4LCU C;  3SPJ A;  1XL4 A;  4H33 A;  4PDR A;  3SYC A;  2BOB C;  3OGC C;  3OR7 C;  4J9Y B;  5B3S C;  4OXS A;  3E8H A;  3FB8 C;  2AHY A;  2P7T C;  1V54 C;  3T1C A;  3T4D A;  1OCZ C;  4MVU A;  1OCC C;  3SYP A;  4RAI A;  3K03 A;  4P9P A;  4WFG A;  2EIK C;  1M56 C;  2IH3 C;  4WFH A;  3TET A;  3T4Z A;  2ITC C;  3X2Q C;  3ZJZ A;  3RBZ A;  5EBL C;  1J95 A;  2WLL B;  3JYC A;  4KFM A;  4DXW A;  2IH1 C;  1R3K C;  2EIJ C;  4RO2 A;  3FB7 C;  4ZBM A;  2NLJ C;  2Q69 A;  2WLH A;  3ABM C;  4PDM A;  2X6B A;  2EIM C;  4JTA B; 
#chains in the Genus database with same CATH topology
 2QR4 A;  1YHQ V;  3M7M X;  4MTG A;  3JAM N;  5LMN B;  1HR0 B;  4O2B B;  3S3W A;  5D5P A;  4PI0 A;  2Q4P A;  3ML0 A;  4CS4 A;  2A9H A;  2IJK A;  1IX9 A;  3K9A A;  5LGT A;  4GKJ B;  4HNA B;  5DED A;  1CXZ B;  4DK0 A;  2UUA O;  1BSM A;  1PPJ H;  3JD4 A;  4PI2 A;  5GTH Z;  3A8T A;  5L3C A;  2JEU A;  2BOC C;  2F95 B;  3ZHU A;  1KKD A;  2JGD B;  3CME V;  4O4J A;  3JAL A;  3FB5 C;  2QWO B;  4B3T B;  3GB7 C;  4OGQ B;  1M93 A;  3CCU V;  5JCO A;  1HNX O;  3BA9 A;  1Y74 A;  1G4Y B;  5JJN B;  1GN4 A;  1ORQ C;  1IDS A;  1SQG A;  4MVO A;  4JI3 O;  1AJN A;  3WB2 A;  2X0L A;  3STL C;  5CB4 B;  3UKM A;  5JH7 B;  2ZE6 A;  4NXM B;  4GX0 A;  1ZX3 A;  3J81 N;  4YJ2 A;  4K0K O;  1FPO A;  2UXD B;  1GK9 A;  4JI1 B;  4PDL A;  4CZZ A;  4NVP A;  1VQ7 V;  4UFZ A;  1AI7 A;  1FFX B;  4AHC A;  3E35 A;  4O4L B;  2C2A A;  3FB8 C;  1H38 A;  2ZKO A;  2P67 A;  4RAI A;  3C3S A;  1IBK B;  2ZXW B;  4WFH A;  4X1Y B;  2FYU H;  3K79 A;  4ZHQ B;  4U7O A;  1OCO B;  2BE3 A;  3ABM C;  2EIM C;  3OFN G;  1Z5V A;  4FLY A;  5JQG A;  2WLK A;  4DR4 O;  1LUW A;  1NTZ H;  1R3L C;  2HKO A;  2QWQ B;  4DR3 B;  1Q86 W;  4UB8 Z;  4F6E A;  1NS1 A;  1XL6 A;  5GON A;  5EYP A;  3ZMV A;  4DV7 B;  4LR3 A;  4CH5 A;  2Q0A A;  2JJ2 G;  3CCS V;  4KXR A;  4DR1 O;  1OV9 A;  2HR3 A;  1AP5 A;  5LP6 C;  4JTC B;  4DR6 B;  3D36 C;  1NVP D;  4FIP C;  4DV2 B;  4CC6 A;  3ASN B;  4DV4 B;  4B3S B;  1TVK A;  1COW G;  2JEX A;  1M9N A;  1V55 C;  2B5U A;  4HBN A;  1SES A;  1AP6 A;  2XAS A;  2NN4 A;  4WFE A;  1JFF A;  2LP7 A;  1NH2 B;  1F51 A;  5IT9 N;  2WLN A;  5J2U A;  5KHK A;  2H8P C;  3K04 A;  1YZB A;  1VQO V;  4JI0 B;  4H0L B;  2JDI G;  2WWW A;  4PEL A;  1JX9 A;  5H6Q A;  4MTF A;  4JI8 O;  4DV0 O;  1SQQ H;  1VAR A;  2HLD G;  4FLZ A;  4GKJ O;  4MVS A;  3IC7 A;  1Y67 A;  2EZO A;  5LGN A;  3Q4H A;  3CCV V;  4HYO A;  4IHJ A;  2R70 A;  2IW5 A;  1N4C A;  2W0X A;  3ZHR A;  4I7Z B;  3SJB C;  4NB5 A;  2XAG A;  3K03 A;  1CEZ A;  1IXM A;  1K8A W;  4B3T O;  5EBL C;  1G8M A;  3CRC A;  4DK1 A;  5CA0 B;  4EFB A;  1OZ0 A;  3JAW A;  4I50 B;  1CP9 A;  3QTC A;  1BS3 A;  1IXB A;  4MSW C;  2LO1 A;  5KAF Z;  5CA3 A;  2Z3Y A;  1B06 A;  1R3I C;  2XOK G;  5LL6 Y;  2QSA A;  1M90 W;  1KB9 F;  2JRI A;  3N2G B;  3UO3 A;  1Q43 A;  4JGS A;  2NNU A;  5B1N A;  1VQP V;  1MSD A;  1FXH A;  1BT8 A;  4UV9 A;  1BHA A;  4JI7 B;  2UXD O;  3JSN A;  1ZWI C;  1Q90 D;  1NU1 H;  3FYI B;  3TK1 A;  1AJP A;  1KKC A;  4FJC C;  1IBL O;  4ZOL B;  4TOI A;  1RPO A;  4I4T A;  2A3Q A;  3CJH B;  2R9R B;  3K9S A;  4X8A A;  5C8Y B;  2V1D A;  3RYH A;  1IBK O;  1XMO B;  4B3R B;  3BAB A;  2UXN A;  5FLX N;  5FPR A;  3OD4 A;  5D5Q A;  4JYA O;  2EJ7 A;  4DV5 O;  4O4H B;  2EBO A;  1GAX A;  2DWE C;  1JCH A;  4DR3 O;  4GLX A;  2ADP A;  2QGN A;  3U11 A;  1WN7 A;  1X4T A;  2B9Z A;  3HKB B;  2OT5 A;  4UB6 Z;  1XUQ A;  3ZHQ A;  1DGS A;  4YXW G;  2QKS A;  2GHY A;  1ARO P;  3ZHV A;  3H1I H;  3HB3 B;  3HKD B;  4R7C A;  4UXN A;  4LF5 B;  4DO2 A;  4LFA B;  4J9Z B;  3ETD A;  1BE3 H;  2BTO A;  2JK5 C;  1GO3 F;  4FFK A;  1K5S A;  1VEW A;  1E1Q G;  4J42 A;  1V54 C;  1OCZ C;  4MVU A;  1P84 F;  3MHS C;  1R6T A;  5IJ9 B;  3T4Z A;  1JPX A;  1J5E O;  1EFR G;  2H3O A;  3JAK A;  3OE7 G;  3ETG A;  3WG7 C;  1U97 A;  4PA7 A;  4PA9 A;  4RWU A;  2YDE A;  4Q20 A;  1V55 B;  3HKC B;  1AR5 A;  2NR5 A;  3HKE A;  1VIB A;  1R1B A;  5JCO C;  5LXT A;  4MTX A;  1FFT B;  2DN9 A;  1OHH G;  2K1E A;  4D7S A;  2KQX A;  4N23 A;  1WP7 A;  3B77 A;  2IJH A;  4OPA A;  4F6R B;  3APO A;  4JAV A;  3SJC C;  2X7R B;  2RQ6 A;  4FZ1 A;  2W6J G;  4YHH O;  3N27 A;  3CCJ V;  4LNU A;  2IM9 A;  5BMV A;  2WLM A;  4FFB A;  2UUB B;  2X6A A;  4UVB A;  1NVP B;  1EN6 A;  5B1O A;  4TUY A;  2HVK C;  3BRC A;  3OM3 B;  3OW2 U;  1XHX A;  2ZT9 B;  1K7D A;  1VQN V;  3FAV A;  5LMU O;  2BTQ A;  4JYY A;  2HJF C;  1S3J A;  2CH7 A;  2Y4T A;  3L71 H;  4I55 A;  3QG5 A;  5IJ0 B;  2JIZ G;  4PA4 A;  5CA1 A;  1PP9 H;  2ZIM A;  2PI5 A;  4LFB B;  1R73 A;  5AG2 A;  3CC4 V;  2VQF B;  2O57 A;  1N0J A;  3QNE A;  3JD1 A;  1FXK A;  2Y69 C;  4WCE V;  2KG7 A;  3LNM B;  3O65 A;  3CEI A;  1N33 O;  3SPJ A;  3LSQ A;  2ZR3 A;  2AHY A;  3T4D A;  3SYP A;  1KD1 W;  1GN2 A;  4WFG A;  4IYH A;  3ZIA G;  1YIT V;  5FL7 G;  1UFI A;  3T1Y O;  5TIS Z;  2Q69 A;  3E22 A;  3CCM V;  3RT3 C;  4DW0 A;  4ASU G;  3F7Y C;  4O4I B;  3BA8 A;  3SYQ A;  3CCR V;  1QLN A;  3RYF B;  2GV9 A;  3ZMZ A;  1AR1 B;  4UCO A;  2F23 A;  2GBO A;  1HNW O;  4B08 A;  4K8X A;  5KHG A;  1AI4 A;  1IVS A;  4MW8 A;  1SQP H;  4FLV A;  2DQ3 A;  2JVD A;  3GWO A;  5LA6 B;  2A06 H;  3E8B A;  4JI5 O;  2YSU B;  2GUZ B;  3K0D A;  5LBQ A;  3JCZ A;  5DEC A;  2F4V O;  1M57 B;  2VQE O;  1Q81 W;  4GX5 A;  2YXL A;  2EX3 A;  1L0N H;  2AXT Z;  1TUE B;  3AK1 A;  3I56 V;  1QU7 A;  4JI6 O;  1N34 B;  3N2K A;  1QR9 A;  1V54 B;  1OCZ B;  1R6N A;  4I5S A;  3RYI B;  4NYK A;  3AG4 C;  3OTO B;  4DR2 O;  1MNG A;  4NXN B;  4XDL A;  3M99 B;  1X59 A;  4PD4 F;  4AI8 A;  1PM9 A;  4YIP A;  1FAF A;  1H2L A;  4E2L A;  2ZE7 A;  3UCS C;  4JI2 B;  3WG7 B;  4JI4 B;  1SQF A;  2CDY A;  3SR2 C;  5EK0 A;  2JJ1 G;  2GTS A;  4PA6 A;  4FLW A;  4LH7 A;  1S77 D;  3GVM A;  1K97 A;  2KSD A;  2LGW A;  3JAR B;  5CMU A;  1AI6 A;  4TV8 A;  1Q3E A;  2E3C A;  2EIK B;  1VP7 A;  3OR7 C;  3RYC B;  4X64 O;  5B3S C;  3BPZ A;  2XAH A;  4J41 A;  3T1C A;  4FLX A;  1TUB A;  5J2T A;  1BQZ A;  5LGU A;  1J95 A;  4J7K A;  3A2F A;  5JVD B;  4K35 A;  4AQY B;  5K1X A;  1PNL A;  1PV0 A;  3RVZ A;  5CBG A;  4RUE A;  5B1B B;  3DXR A;  2FKX A;  3SYA A;  5L3G A;  2Q7H A;  3DSQ A;  4NTX A;  3L75 H;  4DYL A;  4X65 O;  3B2E E;  2QWR B;  3D8C A;  1D2D A;  2WLI A;  1K34 A;  3B4S A;  3OAA G;  4X20 A;  2ODM A;  4TQD A;  1RPR A;  3I55 V;  2ETN A;  4LWS B;  1BHB A;  1Y76 A;  5JQG B;  4TWK A;  2DE0 X;  3J80 N;  2FL4 A;  5IY5 B;  2EIN C;  2Y4U A;  1S5L Z;  3OMA B;  3FYE B;  3CYO A;  2WPD G;  3IJ4 A;  5EYP B;  3S3X A;  2Y69 B;  4FZ0 A;  4FVM A;  4DUZ O;  1QLE B;  4LFC B;  4MVM A;  1HNZ B;  5IYC O;  2UUC B;  4YY3 O;  1DF5 A;  3L70 H;  4RQF A;  4DV1 B;  4UCU A;  3BHP A;  1VQ4 V;  2Q0O C;  4R8C A;  2CGO A;  2PYJ A;  3ZRW A;  5KHH A;  4G2K A;  2RJZ A;  3C90 A;  2V7Q G;  4KHP O;  3A0H Z;  3AG1 B;  2ITD C;  2YIB A;  4L87 A;  1US6 A;  2EJR A;  2YS8 A;  1TVK B;  2ZR2 A;  1MZF A;  2UXX A;  3F7V C;  3ASO C;  4B7E A;  3JAT A;  1JJO A;  3CMA V;  5J2U B;  3FFQ A;  4LCU C;  3OMI B;  1XL4 A;  2YIC A;  4PDR A;  4X1I A;  4BR6 A;  2CTR A;  2YEV B;  3B8N A;  2QM8 A;  5B66 Z;  1TGO A;  3ZN0 A;  4Z2W A;  4WBN B;  1N34 O;  2WLL B;  4DXW A;  2DW4 A;  1SA0 B;  1M1K W;  3AG3 B;  3FB7 C;  1ZSP A;  4O2A A;  3ZMS A;  4X89 A;  4MTO A;  3T1H O;  3EFF K;  5IDJ A;  2BSK A;  5E1A C;  3I5D A;  3IGA C;  1IBM O;  4JV5 O;  4JZG A;  1M5I A;  2FML A;  4FLU A;  3R66 A;  3JAS B;  5LOV B;  5IWA B;  1QVF U;  3AG4 B;  4JF3 A;  1PNM A;  5HFM A;  2IBZ H;  1N8R W;  2EZP A;  3JAW B;  1L0L H;  4D6T H;  4MVR A;  3RW0 A;  2OCC C;  3E83 A;  1B04 A;  3NXS A;  4DR5 B;  4UVA A;  1I94 B;  4QE9 A;  1VQ8 V;  1LNQ A;  4DW1 A;  4LF6 B;  3K58 A;  4WFB V;  4GKK B;  4KUM A;  1FXK C;  4Z1M G;  1WPB A;  2RNB A;  1XIL A;  4DV3 B;  2LFR A;  4N21 A;  5B3S B;  3ZS8 C;  4FM2 A;  4AQY O;  3UO2 A;  3FKS G;  5H6R A;  1XNR O;  3LSU A;  5A2Q N;  3K5M A;  3C3T A;  4DRX A;  1PL4 A;  4IIJ B;  4O2B A;  4X88 A;  4MVZ A;  3LNN A;  2D3O W;  2E5L O;  3WB0 A;  4BWA A;  5BR8 B;  3FX7 A;  4DUY O;  4W4K A;  4ZIB A;  1SF9 A;  4HNA A;  4WFF A;  3MD0 A;  2OIG A;  3OT7 A;  3W7T A;  4X62 O;  2WA3 A;  1N0N A;  1D5N A;  2AZ0 A;  3ABU A;  4CS2 A;  3CE2 A;  3OGI B;  3EVK A;  5LMN O;  1HR0 O;  3E8H A;  2EIJ B;  1RM1 C;  1LR1 A;  1TA8 A;  4H13 B;  4LFC O;  3TET A;  2D2C B;  3X2Q C;  5IYZ B;  5HFL A;  4DV1 O;  1R3K C;  2QTS A;  2CUG A;  4PDM A;  4JTA B;  2CAZ C;  2RN9 A;  1P49 A;  1ZUQ A;  1MZE A;  5L3B A;  1N32 B;  1NI8 A;  4R6Z A;  5CB4 A;  1MSW D;  4HZ3 A;  3ZHT A;  5IE9 A;  1IUR A;  5JH7 A;  2DYS C;  2CTW A;  2DMX A;  4OPH A;  5KMG B;  4JYB A;  4ABM A;  4JZ2 A;  2DWD C;  3JAK B;  1QR8 A;  1Y4M A;  3CRQ A;  3K5L A;  3BFR A;  3NR7 A;  4MVQ A;  2PUS A;  4C7U A;  5FPO A;  2BCC H;  1MMM A;  2F66 C;  1FFX A;  2EIL C;  2X6C A;  3G4S V;  1H2G A;  1VQK V;  1VF6 A;  1JA8 A;  5LXT B;  2DYR C;  1MA1 A;  2Q5Z A;  3HPL C;  4U3J B;  4X1Y A;  3ZMT A;  4NXM O;  4DR7 B;  4ZHQ A;  1O9G A;  1QCE A;  2YC0 A;  5EZY A;  4JI1 O;  2XHB A;  2KKW A;  4F4L A;  3ZX6 A;  3H1L H;  1DTO A;  4YJ3 B;  3LSS A;  3G71 V;  2UU9 B;  4IGG A;  1JOY A;  1FD9 A;  1SC5 B;  3KCX A;  2E74 B;  4A5U B;  3FAV B;  4UUJ C;  1S72 V;  2ZD9 A;  5KX5 A;  2ZNJ A;  2YIB D;  1I5X A;  1EZJ A;  4I55 B;  2CH7 B;  1BMF G;  3K3W A;  3UT5 B;  3QO8 A;  3ABM B;  1YF2 A;  5E79 Z;  2EIM B;  1EN5 A;  2Y0P A;  3BCC H;  1PL0 A;  2YID A;  3JD3 A;  4HAM A;  4DV7 O;  3GWK C;  2P5O A;  4J7J A;  3R65 A;  4EFE A;  1WPX A;  2B1I A;  1FXK B;  2ZQM A;  5KUK A;  2KG7 B;  4TT3 G;  1W59 A;  5ITZ B;  1NZ6 A;  2PI4 A;  2WAM A;  4DR6 O;  2YIA A;  3CCQ V;  4DV2 O;  2AHZ A;  4I9W A;  4DV4 O;  4YIO A;  4B3S O;  3CWB H;  3K59 A;  1XI1 A;  4LF4 B;  1VQ5 V;  4GUN A;  1S0V A;  4ICG A;  5LP6 B;  1VQ9 V;  2CGN A;  1G6U A;  3E22 B;  1RSO B;  4UV8 A;  2RCV A;  4B3M B;  2P06 A;  1YTF D;  4G28 B;  4JI0 O;  4ZI7 A;  1WB8 A;  1K5Q A;  1U96 A;  1SRY A;  3SPG A;  5B1A C;  1XNQ B;  5CA0 A;  3SYO A;  4NTW A;  4CH4 A;  3SDL A;  4D7T A;  1KUQ A;  4GCZ A;  3G67 A;  1N32 O;  1R3J C;  3OR6 C;  3X2Q B;  3ZRS A;  1NTK H;  4LF7 B;  1HP8 A;  3JCU Z;  3A0R A;  4KL1 A;  3VQW A;  1XMQ B;  2IU0 A;  1H2M A;  3TGU H;  1WB7 A;  1GH6 A;  2F43 G;  1NR7 A;  2E75 B;  4ZOL A;  1JMK C;  1KQS U;  1GM7 A;  1GM9 A;  1XHZ A;  1R6K A;  3OGC C;  4X1K B;  5IYD O;  2N05 A;  5GTI Z;  3U10 A;  4TV9 A;  5C8Y A;  3QF7 A;  1M56 C;  1N36 B;  2EIL B;  2XTA A;  2ITC C;  1IZ3 A;  4WF9 V;  4JI7 O;  4I0X B;  3SPC A;  4O4H A;  1THZ A;  2ARH A;  5LHH A;  5F2V O;  4KP4 A;  4UCV A;  1NBM G;  2UU9 O;  5LHG A;  2ZM6 B;  3DC6 A;  5KLV H;  5FNV B;  2QTO A;  1VF7 A;  1XMO O;  4B3R O;  2LJ2 A;  4MS2 A;  3HKD A;  3W7W A;  3QO5 A;  3KG2 A;  3E86 A;  3LDE A;  4UCS A;  1OCR C;  3H01 A;  3F5W C;  1RP3 B;  3H9V A;  1S5J A;  3L74 H;  5LYJ A;  1ZTE A;  5IJ9 A;  4X20 B;  4LF5 O;  1MG1 A;  1F7Y A;  2UUA B;  2VRZ A;  4LFA O;  4LF8 B;  4GT1 A;  4CS3 A;  1YXB A;  3P32 A;  4BAY A;  5L3E A;  1Y66 A;  4NR1 A;  2A7W A;  5KA6 A;  1RFY A;  2QKC A;  4UCR A;  2PGG A;  1KC8 W;  1LUV A;  1HNX B;  4B3M O;  4F6R A;  3ABT A;  3ZRW B;  1WAZ A;  3G6B A;  4JPR A;  4H33 A;  4JI3 B;  4QJF B;  2XAF A;  3ZCC A;  1VQL V;  2Y0I A;  1YVW A;  4O4J B;  2IH3 C;  3JAL B;  3CX5 F;  4J10 A;  1VMG A;  1VF6 C;  4RO2 A;  4K0K B;  1SZT A;  2WLH A;  4E4E A;  3K5O A;  2ZXW C;  5B1A B;  1DF4 A;  1Y74 B;  1Q6U A;  5B5E Z;  5GW7 A;  3STZ C;  4PDV A;  2LW7 A;  1H2N A;  1BZK A;  2N74 A;  1XMQ O;  1K4C C;  2UUB O;  4GYC B;  2QKA A;  2Q73 A;  1UJW B;  4XBF A;  1K92 A;  1QVG U;  3SJA C;  1JVM A;  4IL6 Z;  4YJ2 B;  2GTA A;  5JJJ B;  2CTP A;  1TAE A;  2ZIN A;  2BSK B;  3HR0 A;  4DR4 B;  3WB1 A;  4H44 B;  5LHI A;  1YTF B;  4LF9 B;  1W0K G;  3FB6 C;  4OX9 B;  1L8D A;  3OTF A;  3E89 A;  3H1K H;  1K4D C;  1BQ0 A;  4LFB O;  2VQF O;  3ASN C;  2MW2 B;  3ETQ A;  3P30 A;  4DR1 B;  1M56 B;  2KB1 A;  3ABL C;  4LH6 A;  1H8E G;  4P2Z A;  2P22 C;  3CHX A;  1P7G A;  2DOS A;  4FLT A;  5GON B;  2YXH A;  3LDD A;  1WJZ A;  4X66 B;  3A0B Z;  3J7A U;  3PJS K;  3CXC U;  1DK1 A;  3ZRX A;  5JWP A;  5LA6 A;  1Q6I A;  4CH6 A;  2M7W A;  2GUZ A;  2W0F C;  4P30 A;  1HWY A;  4DRX B;  5H9C A;  3TJT A;  5EIB D;  4J9Y B;  3AK2 A;  2ZE8 A;  1KP2 A;  1I7F A;  1FXV A;  2P7T C;  4JI8 B;  4DV0 B;  1OCR B;  4J11 A;  3RBZ A;  1P4R A;  1BCC H;  2Y48 A;  2NLJ C;  2AW9 A;  1JFF B;  2QDO A;  3RYI A;  3L73 H;  4LF8 O;  4QIW F;  2F1M A;  3TCU A;  3ZRV A;  2Q67 A;  3B40 A;  3APQ A;  1SS3 A;  3KKY A;  4J7Z A;  1I5Y A;  1GTO A;  3ZMU A;  3TXQ A;  4PJ0 Z;  1FYJ A;  2RDC A;  2AZ2 A;  2JGU A;  5CN0 A;  2DJV A;  4DV6 B;  3VQY A;  3JAR A;  3ABK C;  3IC9 A;  2YI9 A;  3Q4H B;  5EIB C;  3OTO O;  4IHJ B;  5C93 A;  2V4D A;  4NXN O;  1V9P A;  2FTK A;  2R9I A;  1ZL8 A;  3RYC A;  2HG5 C;  1M4U A;  3G80 A;  1YJW V;  4EKW A;  1ROP A;  3BAA A;  1YSC A;  3T2M A;  1YJN V;  4JI2 O;  2M6Y A;  4JI4 O;  2ZDI A;  3PN1 A;  4GZR B;  3CC7 V;  1WLE A;  1H2K A;  1SZX A;  4XDJ A;  1WA8 A;  5JVD A;  1BL8 A;  4QPK A;  1Q82 W;  1JQ0 A;  4UCT A;  4LP8 A;  3MAQ A;  1IBL B;  1T5E A;  2ZE5 A;  2QE7 G;  1KP3 A;  5KHJ A;  3WU2 Z;  4WFA V;  3H1H H;  5EBM C;  4QNH B;  2PF4 E;  4R50 A;  2P4V A;  3WFV A;  1JJ2 U;  4JYA B;  4LWS A;  3VOU A;  2UXB B;  5EZY B;  4DV5 B;  4EB6 A;  2Q7E A;  2OCH A;  3ICX A;  1FS0 G;  4CC5 A;  2GSM B;  3SYC A;  4I4T B;  3RGB A;  4LF9 O;  2JS5 A;  1G1X B;  3DTU B;  2QWP B;  4MT8 A;  2RMK B;  4OX9 O;  3RYH B;  2IJJ A;  3VQV A;  1JR9 A;  1XBL A;  1PKX A;  4KFM A;  4IYI A;  1SQX H;  3DGE A;  1GRJ A;  1SQB H;  1XDC A;  1SKV A;  4JYC A;  5KX5 B;  1K3E A;  3P3N A;  1SQV H;  4TQF A;  2F93 B;  2QM4 A;  2Q6A A;  1GKF A;  5BZB A;  2JGD A;  4JAU A;  1HDJ A;  4CBC A;  4X66 O;  3ABL B;  1J5E B;  2GDS A;  1HNZ O;  2EIN B;  2XT9 A;  2UUC O;  1VF5 B;  4MW3 A;  4UVC A;  3G6E V;  4K3A A;  2VWJ A;  2UXC B;  1NJI W;  3BY6 A;  1KBH A;  1FKA O;  1AB3 A;  1S76 D;  2YEV A;  1F4M A;  3CXH F;  4AIL C;  4J80 A;  4FM0 A;  4W4L A;  3U0Z A;  4FPP A;  2WSS G;  4WBN A;  2WLL A;  1AJQ A;  1SA0 A;  4U3F H;  3BEH A;  3SGI A;  1NQT A;  1YDX A;  3O9O A;  2Q68 A;  1B6Q A;  4H37 A;  3K57 A;  4FK5 C;  4O4L A;  3HKE B;  4ZI7 B;  3W7X A;  4YHH B;  3CC2 V;  2QA4 V;  3ASO B;  2XUM A;  1AI5 A;  4NKG B;  3JAS A;  4GX2 A;  5LOV A;  1I0H A;  1GM8 A;  4DV6 O;  3OUS A;  4NTY A;  5EC1 C;  1EZV H;  5LMU B;  1YJ9 V;  1SER A;  5DN6 G;  3DC5 A;  1NT2 B;  4RQE A;  1B3Q A;  1AVM A;  1XQ8 A;  4OXS A;  1YIJ V;  3ABK B;  4LNU B;  5BMV B;  5KHI A;  4FFB B;  5IWA O;  3OMN B;  2N04 A;  4TUY B;  2G38 A;  1E1R G;  1FJG B;  2Q9L A;  1N33 B;  4RUF A;  2BTQ B;  4IIJ A;  4DR5 O;  1I94 O;  3FD9 A;  3ZHS A;  4LF6 O;  2QJ1 A;  2YI8 A;  4GKK O;  1ENV A;  4TV9 B;  4Q6G A;  2OCC B;  4L8J A;  2HHH B;  3SPH A;  5CA1 B;  1KEC A;  4DV3 O;  1SET A;  1Q8I A;  3T1Y B;  2VWK A;  2UXB O;  3IAY A;  2QM7 A;  2WA4 A;  1Q7Y W;  3B09 A;  1I08 A;  1GMG A;  2HFE C;  2OWO A;  4X9Q A;  1K73 W;  3K5N A;  3VQX A;  4Z1V A;  4JTD B;  3UQ8 A;  1W0J G;  1HNW B;  5K1P A;  5BR8 O;  2QWN B;  2OTJ V;  3MDS A;  5IYZ A;  1M57 C;  1KU9 A;  2QEX V;  3CRA A;  3L72 H;  1Z2G A;  3THO A;  3KCY A;  3P3P A;  1VQM V;  4JI5 B;  2YUA A;  1AIL A;  4QPJ A;  1XEQ A;  4TSF G;  1H8H G;  3EHB B;  5JJE B;  2F4V B;  4QGP A;  2A79 B;  2CTQ A;  2VQE B;  2A0L A;  1W2B U;  4PHZ A;  4QE7 A;  5LYJ B;  2WLJ A;  3ETE A;  5KMG A;  4FM1 A;  5A9G A;  1QHT A;  1D5A A;  3K0G A;  1L1F A;  3M8A A;  4JI6 B;  1AR4 A;  1DLB A;  2LQT A;  5DM6 V;  4I50 A;  2UXC O;  1RM1 B;  4DR2 B;  3D3Q A;  1KMI Z;  4BIU A;  1CPY A;  1QNM A;  1OCC C;  3N2G A;  1Y6X A;  2ADQ B;  2EIK C;  1QBZ A;  4U3J A;  1GN3 A;  2P4K A;  5KA5 A;  1YEW A;  2OIE A;  3N2K B;  2P90 A;  2EUL A;  2X6B A;  4FMT A;  2ZDI C;  2DYS B;  4PA3 A;  2B1G A;  2E76 B;  3CP1 A;  3CCL V;  2R72 A;  4X64 B;  3AG2 C;  4YJ3 A;  3CJH A;  5H5N A;  4BW5 A;  3E2E A;  4ZKI A;  3QO7 A;  2MK3 A;  5B1B C;  1EN4 A;  4DR7 O;  1K33 A;  5KAI Z;  1ZLZ A;  3MHH C;  1HW7 A;  2DYR B;  3E8F A;  4TV8 B;  1WNS A;  4LBE C;  3OUF A;  2HEP A;  3IFX A;  3L9D A;  3LUT B;  2LW1 A;  2Z0A A;  2CE4 A;  3KZI Z;  3UT5 A;  2IJI A;  4X65 B;  1UPG A;  1TUB B;  5J2T B;  5EC2 C;  3HKB A;  5IY5 C;  2OTL V;  3CCE V;  1E79 G;  3EXA A;  2HJD A;  2K9P A;  1YI2 V;  4P9O A;  3CRR A;  3CRM A;  2ZIO A;  3CD6 V;  4K8Z A;  1FJG O;  1QLE C;  2XAJ A;  5ITZ A;  1VQ6 V;  3DXR B;  3RN4 A;  3VBB A;  2XAQ A;  3UM7 A;  1Q6H A;  2Q7G A;  5J9P C;  1NR1 A;  2HHH O;  4G27 B;  1GN6 A;  4DUZ B;  3CB2 A;  4CH3 A;  2WLI B;  4YY3 B;  5BY1 A;  5LP6 A;  3JSL A;  5H2F Z;  1P7B A;  3AG1 C;  3TXS A;  3OEH G;  1RSO A;  3D36 A;  3RVY A;  5IYB O;  2YXY A;  4B7K A;  3E8G A;  1Y76 B;  3W7S A;  1XOU A;  1PD3 A;  5L3D A;  2P6J A;  3HKC A;  4KHP B;  2BOB C;  2JS3 A;  3ZBH A;  1EBO A;  2LGQ A;  4JAS A;  1KYO F;  4P9P A;  3AEI A;  4LF4 O;  3B8M A;  3H1J H;  2IH1 C;  4BIO A;  4ZBM A;  1Q5O A;  2OYQ A;  5L3F A;  4U7N A;  4LC1 A;  3BVO A;  1O9H A;  1MAB G;  5EBW C;  1XRE A;  1MOF A;  2HVJ C;  1YCI A;  3AG3 C;  2XND G;  4XDK A;  1F4N A;  3QVN A;  3K08 A;  2Z5U A;  3OEE G;  1H2S B;  1S5H C;  1WP8 A;  1A32 A;  2VS0 A;  4BIZ A;  1XNQ O;  2W6I G;  3W7U A;  4GX1 A;  5KUM A;  1QQC A;  3JAT B;  3RWR D;  1F23 A;  3T1H B;  3ZN1 A;  1IBM B;  4X1K A;  4IT5 A;  4X1I B;  2L35 A;  1OCO C;  5IJ0 A;  4JV5 B;  3JD0 A;  4LF7 O;  4I9Q A;  1NH2 D;  5CBH A;  2ATK C;  2IU3 A;  1PNK A;  1EM1 A;  1BGY H;  2H94 A;  3F5T A;  3D3I A;  3AK3 A;  4I0X A;  1OCC B;  3SJQ C;  4O2A B;  5CBF A;  3CSX A;  1NKD A;  1ZL8 B;  3AG7 A;  1URF A;  3CS5 A;  3LDC A;  1OJH A;  5FNV A;  2AGA A;  2PYL A;  1N36 O;  3K06 A;  4PV1 B;  2L6L A;  1K9M W;  2CK3 G;  3AG2 B;  1WA8 B;  4JAA A;  3CPW U;  2FB5 A;  1XNR B;  2Q8V A;  3SPI A;  2R9A A;  5BXZ A;  4O4I A;  2DQ0 A;  2ILM A;  3ZED A;  2E5L B;  4BW9 A;  3RYF A;  2HP8 A;  4EEQ A;  2ZM6 O;  1Z5W A;  4DUY B;  3RFR A;  1ZAU A;  2PZS A;  2PTM A;  3ZJZ A;  2ZCE A;  3JYC A;  2PY5 A;  1NTM H;  2EIJ C;  3JD2 A;  2LFS A;  4EB6 B;  4X62 B;  2ZNI A; 
#chains in the Genus database with same CATH homology
 1FXK B;  2ZQM A;  5KUK A;  4TT3 G;  4JYC A;  1YHQ V;  1K3E A;  4ASU G;  3F7Y C;  4MTG A;  2Q6A A;  2PI4 A;  2WAM A;  1GKF A;  3SYQ A;  3CCR V;  1QLN A;  5BZB A;  3ZMZ A;  1AR1 B;  3CCQ V;  2AHZ A;  4I9W A;  4JAU A;  3ML0 A;  4CBC A;  2A9H A;  3ABL B;  1VQ5 V;  2IJK A;  1S0V A;  1AI4 A;  3K9A A;  5LGT A;  4MW8 A;  2EIN B;  4MW3 A;  1VQ9 V;  4UVC A;  3G6E V;  2DQ3 A;  3GWO A;  4UV8 A;  1NJI W;  3E8B A;  3BY6 A;  1YTF D;  3JD4 A;  2YSU B;  5LBQ A;  3K0D A;  3JCZ A;  5L3C A;  1S76 D;  4G28 B;  1M57 B;  2JEU A;  2BOC C;  1Q81 W;  2YEV A;  1KKD A;  1F4M A;  4GX5 A;  1K5Q A;  1SRY A;  3SPG A;  1TUE B;  3CME V;  5B1A C;  3FB5 C;  4FPP A;  2WSS G;  3I56 V;  2WLL A;  3GB7 C;  1AJQ A;  3CCU V;  3SYO A;  1QR9 A;  1V54 B;  3BEH A;  1OCZ B;  1R6N A;  1NQT A;  4I5S A;  4GCZ A;  3AG4 C;  1R3J C;  1G4Y B;  3OR6 C;  3M99 B;  2Q68 A;  1B6Q A;  1ORQ C;  4H37 A;  4XDL A;  4YXW G;  3X2Q B;  4MVO A;  3ZRS A;  4FK5 C;  3CC2 V;  3W7X A;  1AJN A;  4E2L A;  2QA4 V;  3ASO B;  1AI5 A;  2X0L A;  3STL C;  3WG7 B;  3UKM A;  4GX2 A;  3A0R A;  1GM8 A;  5EK0 A;  2JJ1 G;  4PA6 A;  2IU0 A;  1S77 D;  3OUS A;  1K97 A;  4GX0 A;  5EC1 C;  1GK9 A;  5CMU A;  1AI6 A;  1YJ9 V;  4PDL A;  1SER A;  4CZZ A;  2F43 G;  5DN6 G;  1VQ7 V;  1AI7 A;  1NR7 A;  4RQE A;  2EIK B;  1KQS U;  1GM7 A;  1GM9 A;  1R6K A;  3E35 A;  3OGC C;  5IYD O;  3OR7 C;  2C2A A;  4OXS A;  5B3S C;  3FB8 C;  2XAH A;  1YIJ V;  1H38 A;  3T1C A;  3ABK B;  2P67 A;  4RAI A;  1M56 C;  3OMN B;  2ZXW B;  4WFH A;  2EIL B;  2ITC C;  3K79 A;  4WF9 V;  5LGU A;  1J95 A;  4U7O A;  1OCO B;  3ABM C;  2EIM C;  3OFN G;  3SPC A;  1E1R G;  2WLK A;  1PNL A;  1THZ A;  3RVZ A;  5CBG A;  4RUF A;  4RUE A;  5LHH A;  5B1B B;  1R3L C;  4KP4 A;  2HKO A;  3SYA A;  5L3G A;  1NBM G;  1Q86 W;  1ENV A;  1XL6 A;  5LHG A;  2OCC B;  3SPH A;  3ZMV A;  2QTO A;  2WLI A;  1K34 A;  1KEC A;  3OAA G;  4MS2 A;  3W7W A;  1RPR A;  1SET A;  3QO5 A;  2JJ2 G;  3I55 V;  3CCS V;  2QM7 A;  1Q7Y W;  3KG2 A;  1BHB A;  3E86 A;  3LDE A;  1GMG A;  4TWK A;  2HFE C;  5IY5 B;  1OCR C;  2HR3 A;  3H01 A;  1K73 W;  2EIN C;  4JTC B;  3F5W C;  3OMA B;  3FYE B;  3CYO A;  1NVP D;  2WPD G;  4FIP C;  4JTD B;  1W0J G;  3ASN B;  2Y69 B;  2OTJ V;  1COW G;  1QLE B;  4MVM A;  2JEX A;  1M57 C;  1M9N A;  1V55 C;  5IYC O;  2QEX V;  1DF5 A;  2B5U A;  4RQF A;  1SES A;  1VQ4 V;  2XAS A;  1NH2 B;  4WFE A;  2LP7 A;  1F51 A;  1MG1 A;  4R8C A;  1VQM V;  4QPJ A;  4TSF G;  1H8H G;  3ZRW A;  2WLN A;  3EHB B;  4G2K A;  2H8P C;  2A79 B;  4GT1 A;  3K04 A;  2A0L A;  2V7Q G;  3P32 A;  1VQO V;  1W2B U;  3AG1 B;  2JDI G;  4BAY A;  2ITD C;  5L3E A;  2WWW A;  4PEL A;  4QE7 A;  4L87 A;  2WLJ A;  1JX9 A;  3ETE A;  2EJR A;  4MTF A;  5H6Q A;  1Y66 A;  2ZR2 A;  2HLD G;  5KA6 A;  3K0G A;  1L1F A;  4MVS A;  3IC7 A;  2UXX A;  3F7V C;  1DLB A;  3ASO C;  5DM6 V;  2EZO A;  1KC8 W;  5LGN A;  1RM1 B;  3CCV V;  3ABT A;  4HYO A;  3ZRW B;  3CMA V;  2IW5 A;  4JPR A;  4LCU C;  3OMI B;  1XL4 A;  4H33 A;  4PDR A;  4QJF B;  4BIU A;  2XAF A;  2YEV B;  1CPY A;  2XAG A;  3ZCC A;  3B8N A;  1OCC C;  1VQL V;  3K03 A;  2QM8 A;  1CEZ A;  2EIK C;  1QBZ A;  1IXM A;  3ZN0 A;  1K8A W;  2IH3 C;  5EBL C;  1G8M A;  5KA5 A;  2WLL B;  4DXW A;  2DW4 A;  4RO2 A;  1OZ0 A;  1M1K W;  3AG3 B;  3FB7 C;  1SZT A;  2P90 A;  1CP9 A;  2WLH A;  2X6B A;  4FMT A;  3ZMS A;  2ZDI C;  4X89 A;  4MTO A;  4MSW C;  2DYS B;  2ZXW C;  3EFF K;  4PA3 A;  5IDJ A;  5CA3 A;  5B1A B;  1DF4 A;  5E1A C;  2B1G A;  3IGA C;  2Z3Y A;  3CP1 A;  1R3I C;  3CCL V;  2XOK G;  5GW7 A;  3AG2 C;  3STZ C;  1M90 W;  4PDV A;  4BW5 A;  3E2E A;  4ZKI A;  3QO7 A;  2MK3 A;  2NNU A;  4JGS A;  3AG4 B;  1K4C C;  1QVF U;  5B1N A;  1VQP V;  5B1B C;  4JF3 A;  1FXH A;  1PNM A;  1K33 A;  4XBF A;  5HFM A;  1UJW B;  4UV9 A;  1N8R W;  1K92 A;  1BHA A;  2EZP A;  1QVG U;  1JVM A;  1ZWI C;  4MVR A;  3RW0 A;  3MHH C;  2OCC C;  2DYR B;  3E8F A;  3E83 A;  3FYI B;  3TK1 A;  1AJP A;  4LBE C;  3OUF A;  4FJC C;  3IFX A;  3LUT B;  3NXS A;  5LHI A;  4UVA A;  1RPO A;  4QE9 A;  1LNQ A;  1VQ8 V;  1YTF B;  2R9R B;  4WFB V;  4KUM A;  2IJI A;  1W0K G;  4X8A A;  1FXK C;  4Z1M G;  2V1D A;  5EC2 C;  3FB6 C;  5IY5 C;  2OTL V;  3CCE V;  3E89 A;  1E79 G;  1K4D C;  2UXN A;  2LFR A;  4N21 A;  5B3S B;  1YI2 V;  3ASN C;  4P9O A;  3P30 A;  3FKS G;  5H6R A;  3CD6 V;  1QLE C;  1M56 B;  2XAJ A;  2KB1 A;  3ABL C;  1VQ6 V;  2EBO A;  2DWE C;  1H8E G;  4P2Z A;  1JCH A;  4X88 A;  3VBB A;  4MVZ A;  2D3O W;  2XAQ A;  3UM7 A;  5J9P C;  1NR1 A;  4G27 B;  3LDD A;  2OT5 A;  2WLI B;  3PJS K;  3CXC U;  2QKS A;  1P7B A;  2GHY A;  1ARO P;  3AG1 C;  3MD0 A;  3HB3 B;  4R7C A;  4WFF A;  3OEH G;  3ZRX A;  4UXN A;  3D36 A;  3RVY A;  4DO2 A;  5IYB O;  3W7T A;  2M7W A;  3E8G A;  3W7S A;  4J9Z B;  2W0F C;  3ETD A;  2JK5 C;  3ABU A;  1GO3 F;  1PD3 A;  4P30 A;  1HWY A;  5H9C A;  1K5S A;  5L3D A;  2P6J A;  1E1Q G;  2BOB C;  4J9Y B;  1EBO A;  3E8H A;  4JAS A;  1KP2 A;  2EIJ B;  2P7T C;  1FXV A;  1V54 C;  1OCZ C;  1RM1 C;  4MVU A;  3MHS C;  4P9P A;  3AEI A;  1OCR B;  3TET A;  3T4Z A;  1JPX A;  3X2Q C;  3B8M A;  5HFL A;  3RBZ A;  1EFR G;  1P4R A;  2IH1 C;  1R3K C;  3OE7 G;  4ZBM A;  2Y48 A;  2NLJ C;  3ETG A;  4PDM A;  3WG7 C;  4JTA B;  4PA7 A;  5L3F A;  4U7N A;  4QIW F;  4LC1 A;  5L3B A;  4PA9 A;  1MAB G;  2HVJ C;  5EBW C;  1MOF A;  1V55 B;  4Q20 A;  3TCU A;  3ZRV A;  4R6Z A;  2Q67 A;  3AG3 C;  2XND G;  4XDK A;  1F4N A;  1I5Y A;  1MSW D;  3K08 A;  4HZ3 A;  4MTX A;  1FFT B;  1GTO A;  3ZMU A;  2Z5U A;  2DYS C;  3OEE G;  1S5H C;  1OHH G;  4JYB A;  2K1E A;  4BIZ A;  2DWD C;  5CN0 A;  2W6I G;  3W7U A;  4GX1 A;  1QR8 A;  4N23 A;  5KUM A;  1Y4M A;  3B77 A;  2IJH A;  3ABK C;  4MVQ A;  1F23 A;  4JAV A;  3ZN1 A;  5C93 A;  2EIL C;  2X7R B;  2FTK A;  2R9I A;  2X6C A;  3G4S V;  1H2G A;  1VQK V;  2HG5 C;  2W6J G;  1OCO C;  1YJW V;  3JD0 A;  2DYR C;  4EKW A;  1ROP A;  1YSC A;  3T2M A;  3CCJ V;  1YJN V;  2WLM A;  2ZDI A;  1NH2 D;  5CBH A;  2ATK C;  3CC7 V;  2IU3 A;  3HPL C;  3ZMT A;  1WLE A;  2X6A A;  1PNK A;  4UVB A;  1NVP B;  2H94 A;  5B1O A;  1QCE A;  2HVK C;  3D3I A;  3OM3 B;  4XDJ A;  3OW2 U;  1VQN V;  1K7D A;  1Q82 W;  1BL8 A;  4QPK A;  1JQ0 A;  1OCC B;  3SJQ C;  5CBF A;  4F4L A;  4LP8 A;  1NKD A;  2HJF C;  1S3J A;  1DTO A;  2JIZ G;  4PA4 A;  2QE7 G;  3LSS A;  1KP3 A;  3LDC A;  3G71 V;  4WFA V;  1JOY A;  5EBM C;  3R65 A;  3K06 A;  2PI5 A;  4QNH B;  1R73 A;  1K9M W;  4R50 A;  2CK3 G;  3AG2 B;  3CC4 V;  3WFV A;  1JJ2 U;  3CPW U;  3VOU A;  4UUJ C;  3QNE A;  1S72 V;  3JD1 A;  1FXK A;  2Y69 C;  2ZD9 A;  3SPI A;  4WCE V;  3LNM B;  1FS0 G;  2GSM B;  3SPJ A;  1I5X A;  1EZJ A;  3LSQ A;  2DQ0 A;  3SYC A;  1BMF G;  3K3W A;  2ZR3 A;  2AHY A;  3DTU B;  3T4D A;  3QO8 A;  4MT8 A;  3SYP A;  1KD1 W;  3ABM B;  2EIM B;  4WFG A;  1PL0 A;  2IJJ A;  3JD3 A;  4HAM A;  3ZJZ A;  3ZIA G;  1PKX A;  1YIT V;  3JYC A;  4KFM A;  5FL7 G;  2EIJ C;  3CCM V;  2Q69 A;  3JD2 A;  2LFS A;  3DGE A;  1WPX A;  2B1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...