4R7KA

1.88 angstrom resolution crystal structure of hypothetical protein jhp0584 from helicobacter pylori.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
168
structure length
167
Chain Sequence
AMTTMNAIRWPKKWIPGETDNFVSNEVIVKGLDFNKVVQHLRDASHWEKYYKNSGNIHMYHQDNTILKDKTRFFETFGFLVEAEVEEFELKDAILRLAWRGWNEAKGDEYLEVYHAWLVEKLDNDRVRILTQESQSGVPAKALAKSVPNAMLNGHQAWLDGLVAYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein jhp0584
publication title 1.88 Angstrom Resolution Crystal Structure of Hypothetical Protein jhp0584 from Helicobacter pylori.
rcsb
source organism Helicobacter pylori j99
molecule tags Structural genomics, unknown function
total genus 49
structure length 167
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4r7kA00
1ICXA 3KDJA 4REHA 1T27A 3Q6AA 1KCMA 2L9PA 2L65A 3R6PA 4LA7A 3H3TA 3OH8A 4JHIA 4IGWA 3C0VA 3NI8A 1LN3A 4N3EA 4DS8A 4C94A 1XFSA 1ZXFA 1X53A 4A8GA 3NJ0A 3OJIA 3NMTA 2KCZA 1JSSA 1TXCA 2KF2A 4M9BA 4BK7A 1B6FA 5E46A 3FO5A 3H3RA 1H2OA 4LGBA 1VJHA 3KLXA 4IHRA 4QIPA 3K3KA 3QN1A 5JNNA 3NMVA 4B9RA 3JRQB 2LF2A 4LGAA 2E3SA 4XRTA 3KB3A 3NR4A 4IH2A 2Z9YA 4C9CA 4A8VA 3UQHA 3NS2A 3P0LA 4IGVA 3NMPA 1IFVA 4MNSA 1XDFA 2M89A 3NEGA 3RT2A 3Q63A 2LE1A 4A81A 4REJA 4A84A 3JRSA 4A83A 3Q64A 1XN6A 2A1LA 4MA6A 2QPVA 4M9WA 2LIOA 1UW5A 2E3MA 3ELIA 4DSCA 3TFZA 4FPWA 3OQUA 4JDLA 2M47A 4LG5A 5E4MA 2FLHA 2LCGA 3IJTA 5E4BA 3TVRA 5I9JA 2E3NA 3UIDA 1E09A 2NN5A 3P51A 3TVQA 3NJOA 2LAKA 5JO1A 3NJ1A 2N4BA 2I9YA 4JHGA 4JHHA 1XUVA 1LN1A 3QSZA 3P9VA 4REIA 3F08A 2FFSA 4A8UA 1LLTA 3KAZA 4N0GC 4A86A 2VQ5A 4RYVA 4BKCA 3NMNA 1LN2A 3E85A 4MAPA 4OICA 4IGXA 5E4DA 3KDIA 2EJXA 2VNEA 4WVOA 2E3OA 4BK6A 4PSBA 1XN5A 4C9IA 2GKDA 4IH0A 1BV1A 3GGNA 1BTVA 2N4AA 3OTLA 2Q3QA 4BTZA 3RD6A 2QIMA 3H3QA 3NEFA 2E3RA 4A88A 3K90A 2KTEA 2LPXA 3PU2A 1TW0A 1FSKA 3H3SA 2RERA 2WQLA 2NS9A 2Z9ZA 2RESA 3WG8A 3IE5A 4DSBA 1Z94A 2BK0A 2E3QA 3UJLA 2L8OA 4XRWA 1EM2A 5C9YA 4JDAA 3CNWA 2LUZA 3W9KA 4GY9A 2K7HA 3KL1A 4Z3LA 2D4RA 2REZA 2LDKA 2MOUA 5BRLA 4R7KA 3ZVUA 2KEWA 2LEQA 2PSOA 3TL1A 5JO2A 4IGYA 3RT0C 2K5GA 3KB0A 5AMWA 4A85A 4BKDA 2R55A 5I8FA 4Q0KA 3PUTA 2E3PA 4Y31A 3KDHA 2PCSA 1QMRA 1T17A 3W9RA 2IL5A 2LGHA 3KAYA 4A80A 1FM4A 3NMHA 4A87A
chains in the Genus database with same CATH superfamily
1ICXA 3KDJA 4REHA 1T27A 3Q6AA 1KCMA 2L9PA 2L65A 3R6PA 4LA7A 4JHYA 4QDFA 3GKEA 3H3TA 3OH8A 4IGWA 3C0VA 2LAFA 1LN3A 3NI8A 4JHIA 4N3EA 4C94A 1XFSA 4DS8A 1ZXFA 1X53A 4A8GA 3NJ0A 3OJIA 3F73A 3NMTA 2KCZA 1JSSA 1TXCA 3TGOC 2KF2A 4M9BA 4BK7A 1B6FA 5E46A 3FO5A 3H3RA 1H2OA 4LGBA 1VJHA 3KLXA 4IHRA 4QIPA 3K3KA 4N76A 3QN1A 5JNNA 3GOBA 3NMVA 4B9RA 3JRQB 2LF2A 4LGAA 2E3SA 4XRTA 3KB3A 3NR4A 4IH2A 2Z9YA 4C9CA 5EKQC 4NCAA 4A8VA 3UQHA 2ZYLA 3NS2A 3P0LA 3GB4A 4IGVA 3NMPA 1IFVA 4MNSA 1XDFA 2M89A 3NEGA 3RT2A 4E6FA 3Q63A 2LE1A 4A81A 3HO1A 4REJA 4A84A 3JRSA 4A83A 3Q64A 1XN6A 2A1LA 4QDCA 4MA6A 2QPVA 4M9WA 2LIOA 1UW5A 2E3MA 3ELIA 4N47A 4DSCA 4FPWA 3OQUA 4JDLA 2M47A 4LG5A 5E4MA 2FLHA 2LCGA 3IJTA 5E4BA 3TVRA 5I9JA 2E3NA 3UIDA 1E09A 2NN5A 3P51A 3TVQA 3HK2A 3NJOA 2LAKA 5JO1A 3NJ1A 2N4BA 3HM9A 2I9YA 4JHGA 4JHHA 1XUVA 1LN1A 3QSZA 3P9VA 4REIA 3F08A 2FFSA 4A8UA 1LLTA 3KAZA 4N0GC 4A86A 2VQ5A 4RYVA 4BKCA 3NMNA 1LN2A 3E85A 4MAPA 3DLHA 4OICA 4IGXA 5E4DA 3KDIA 2EJXA 2VNEA 4WVOA 2E3OA 4BK6A 4PSBA 3GTSA 1XN5A 4C9IA 2GKDA 3HVRA 4IH0A 1BV1A 3GGNA 1BTVA 2N4AA 3OTLA 2Q3QA 4BTZA 4QDFB 3RD6A 2QIMA 3H3QA 3NEFA 2E3RA 4A88A 3K90A 4N41A 2KTEA 2LPXA 3GTEA 3PU2A 1TW0A 1FSKA 3H3SA 2RERA 2WQLA 2NS9A 2Z9ZA 2RESA 3WG8A 3IE5A 4DSBA 3NQNA 1Z94A 2BK0A 2E3QA 3UJLA 2L8OA 4XRWA 1EM2A 2YH6A 5C9YA 3DLBA 4JDAA 3CNWA 2LUZA 3W9KA 3HXMA 4GY9A 2K7HA 3KL1A 4Z3LA 3TFZA 2D4RA 2REZA 2LDKA 2MOUA 5BRLA 4R7KA 3ZVUA 2KEWA 2LEQA 2PSOA 3TL1A 3GL0A 4NCBA 5JO2A 4IGYA 3RT0C 2K5GA 3KB0A 4QCKA 5AMWA 4A85A 2R55A 4BKDA 5I8FA 4Q0KA 3PUTA 2E3PA 4Y31A 3KDHA 2PCSA 1QMRA 4KPYA 1T17A 3GL2A 3W9RA 2IL5A 2LGHA 3KAYA 4QDDA 4A80A 1FM4A 3HJFA 3NMHA 4A87A
chains in the Genus database with same CATH topology
1ICXA 3KDJA 4REHA 1T27A 3Q6AA 1KCMA 2L9PA 2L65A 3R6PA 4LA7A 4JHYA 4QDFA 3GKEA 3H3TA 3OH8A 4IGWA 3C0VA 2LAFA 1LN3A 3NI8A 4JHIA 4N3EA 4C94A 1XFSA 4DS8A 1ZXFA 1X53A 4A8GA 3NJ0A 3OJIA 3F73A 3NMTA 2KCZA 1JSSA 1TXCA 3TGOC 2KF2A 4M9BA 4BK7A 1B6FA 5E46A 3FO5A 3H3RA 1H2OA 4LGBA 1VJHA 3KLXA 4IHRA 4QIPA 3K3KA 4N76A 3QN1A 5JNNA 3GOBA 3NMVA 4B9RA 3JRQB 2LF2A 4LGAA 2E3SA 4XRTA 3KB3A 3NR4A 4IH2A 2Z9YA 4C9CA 5EKQC 4NCAA 4A8VA 3UQHA 2ZYLA 3NS2A 3P0LA 3GB4A 4IGVA 3NMPA 1IFVA 4MNSA 1XDFA 2M89A 3NEGA 3RT2A 4E6FA 3Q63A 2LE1A 4A81A 3HO1A 4REJA 4A84A 3JRSA 4A83A 3Q64A 1XN6A 2A1LA 4QDCA 4MA6A 2QPVA 4M9WA 2LIOA 1UW5A 2E3MA 3ELIA 4N47A 4DSCA 4FPWA 3OQUA 4JDLA 2M47A 4LG5A 5E4MA 2FLHA 2LCGA 3IJTA 5E4BA 3TVRA 5I9JA 2E3NA 3UIDA 1E09A 2NN5A 3P51A 3TVQA 3HK2A 3NJOA 2LAKA 5JO1A 3NJ1A 2N4BA 3HM9A 2I9YA 4JHGA 4JHHA 1XUVA 1LN1A 3QSZA 3P9VA 4REIA 3F08A 2FFSA 4A8UA 1LLTA 3KAZA 4N0GC 4A86A 2VQ5A 4RYVA 4BKCA 3NMNA 1LN2A 3E85A 4MAPA 3DLHA 4OICA 4IGXA 5E4DA 3KDIA 2EJXA 2VNEA 4WVOA 2E3OA 4BK6A 4PSBA 3GTSA 1XN5A 4C9IA 2GKDA 3HVRA 4IH0A 1BV1A 3GGNA 1BTVA 2N4AA 3OTLA 2Q3QA 4BTZA 4QDFB 3RD6A 2QIMA 3H3QA 3NEFA 2E3RA 4A88A 3K90A 4N41A 2KTEA 2LPXA 3GTEA 3PU2A 1TW0A 1FSKA 3H3SA 2RERA 2WQLA 2NS9A 2Z9ZA 2RESA 3WG8A 3IE5A 4DSBA 3NQNA 1Z94A 2BK0A 2E3QA 3UJLA 2L8OA 4XRWA 1EM2A 2YH6A 5C9YA 3DLBA 4JDAA 3CNWA 2LUZA 3W9KA 3HXMA 4GY9A 2K7HA 3KL1A 4Z3LA 3TFZA 2D4RA 2REZA 2LDKA 2MOUA 5BRLA 4R7KA 3ZVUA 2KEWA 2LEQA 2PSOA 3TL1A 3GL0A 4NCBA 5JO2A 4IGYA 3RT0C 2K5GA 3KB0A 4QCKA 5AMWA 4A85A 2R55A 4BKDA 5I8FA 4Q0KA 3PUTA 2E3PA 4Y31A 3KDHA 2PCSA 1QMRA 4KPYA 1T17A 3GL2A 3W9RA 2IL5A 2LGHA 3KAYA 4QDDA 4A80A 1FM4A 3HJFA 3NMHA 4A87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICX A;  3KDJ A;  4REH A;  1T27 A;  3Q6A A;  1KCM A;  2L9P A;  2L65 A;  3R6P A;  4LA7 A;  3H3T A;  3OH8 A;  4JHI A;  4IGW A;  3C0V A;  3NI8 A;  1LN3 A;  4N3E A;  4DS8 A;  4C94 A;  1XFS A;  1ZXF A;  1X53 A;  4A8G A;  3NJ0 A;  3OJI A;  3NMT A;  2KCZ A;  1JSS A;  1TXC A;  2KF2 A;  4M9B A;  4BK7 A;  1B6F A;  5E46 A;  3FO5 A;  3H3R A;  1H2O A;  4LGB A;  1VJH A;  3KLX A;  4IHR A;  4QIP A;  3K3K A;  3QN1 A;  5JNN A;  3NMV A;  4B9R A;  3JRQ B;  2LF2 A;  4LGA A;  2E3S A;  4XRT A;  3KB3 A;  3NR4 A;  4IH2 A;  2Z9Y A;  4C9C A;  4A8V A;  3UQH A;  3NS2 A;  3P0L A;  4IGV A;  3NMP A;  1IFV A;  4MNS A;  1XDF A;  2M89 A;  3NEG A;  3RT2 A;  3Q63 A;  2LE1 A;  4A81 A;  4REJ A;  4A84 A;  3JRS A;  4A83 A;  3Q64 A;  1XN6 A;  2A1L A;  4MA6 A;  2QPV A;  4M9W A;  2LIO A;  1UW5 A;  2E3M A;  3ELI A;  4DSC A;  3TFZ A;  4FPW A;  3OQU A;  4JDL A;  2M47 A;  4LG5 A;  5E4M A;  2FLH A;  2LCG A;  3IJT A;  5E4B A;  3TVR A;  5I9J A;  2E3N A;  3UID A;  1E09 A;  2NN5 A;  3P51 A;  3TVQ A;  3NJO A;  2LAK A;  5JO1 A;  3NJ1 A;  2N4B A;  2I9Y A;  4JHG A;  4JHH A;  1XUV A;  1LN1 A;  3QSZ A;  3P9V A;  4REI A;  3F08 A;  2FFS A;  4A8U A;  1LLT A;  3KAZ A;  4N0G C;  4A86 A;  2VQ5 A;  4RYV A;  4BKC A;  3NMN A;  1LN2 A;  3E85 A;  4MAP A;  4OIC A;  4IGX A;  5E4D A;  3KDI A;  2EJX A;  2VNE A;  4WVO A;  2E3O A;  4BK6 A;  4PSB A;  1XN5 A;  4C9I A;  2GKD A;  4IH0 A;  1BV1 A;  3GGN A;  1BTV A;  2N4A A;  3OTL A;  2Q3Q A;  4BTZ A;  3RD6 A;  2QIM A;  3H3Q A;  3NEF A;  2E3R A;  4A88 A;  3K90 A;  2KTE A;  2LPX A;  3PU2 A;  1TW0 A;  1FSK A;  3H3S A;  2RER A;  2WQL A;  2NS9 A;  2Z9Z A;  2RES A;  3WG8 A;  3IE5 A;  4DSB A;  1Z94 A;  2BK0 A;  2E3Q A;  3UJL A;  2L8O A;  4XRW A;  1EM2 A;  5C9Y A;  4JDA A;  3CNW A;  2LUZ A;  3W9K A;  4GY9 A;  2K7H A;  3KL1 A;  4Z3L A;  2D4R A;  2REZ A;  2LDK A;  2MOU A;  5BRL A;  4R7K A;  3ZVU A;  2KEW A;  2LEQ A;  2PSO A;  3TL1 A;  5JO2 A;  4IGY A;  3RT0 C;  2K5G A;  3KB0 A;  5AMW A;  4A85 A;  4BKD A;  2R55 A;  5I8F A;  4Q0K A;  3PUT A;  2E3P A;  4Y31 A;  3KDH A;  2PCS A;  1QMR A;  1T17 A;  3W9R A;  2IL5 A;  2LGH A;  3KAY A;  4A80 A;  1FM4 A;  3NMH A;  4A87 A; 
#chains in the Genus database with same CATH topology
 1ICX A;  3KDJ A;  4REH A;  1T27 A;  3Q6A A;  1KCM A;  2L9P A;  2L65 A;  3R6P A;  4LA7 A;  4JHY A;  4QDF A;  3GKE A;  3H3T A;  3OH8 A;  4IGW A;  3C0V A;  2LAF A;  1LN3 A;  3NI8 A;  4JHI A;  4N3E A;  4C94 A;  1XFS A;  4DS8 A;  1ZXF A;  1X53 A;  4A8G A;  3NJ0 A;  3OJI A;  3F73 A;  3NMT A;  2KCZ A;  1JSS A;  1TXC A;  3TGO C;  2KF2 A;  4M9B A;  4BK7 A;  1B6F A;  5E46 A;  3FO5 A;  3H3R A;  1H2O A;  4LGB A;  1VJH A;  3KLX A;  4IHR A;  4QIP A;  3K3K A;  4N76 A;  3QN1 A;  5JNN A;  3GOB A;  3NMV A;  4B9R A;  3JRQ B;  2LF2 A;  4LGA A;  2E3S A;  4XRT A;  3KB3 A;  3NR4 A;  4IH2 A;  2Z9Y A;  4C9C A;  5EKQ C;  4NCA A;  4A8V A;  3UQH A;  2ZYL A;  3NS2 A;  3P0L A;  3GB4 A;  4IGV A;  3NMP A;  1IFV A;  4MNS A;  1XDF A;  2M89 A;  3NEG A;  3RT2 A;  4E6F A;  3Q63 A;  2LE1 A;  4A81 A;  3HO1 A;  4REJ A;  4A84 A;  3JRS A;  4A83 A;  3Q64 A;  1XN6 A;  2A1L A;  4QDC A;  4MA6 A;  2QPV A;  4M9W A;  2LIO A;  1UW5 A;  2E3M A;  3ELI A;  4N47 A;  4DSC A;  4FPW A;  3OQU A;  4JDL A;  2M47 A;  4LG5 A;  5E4M A;  2FLH A;  2LCG A;  3IJT A;  5E4B A;  3TVR A;  5I9J A;  2E3N A;  3UID A;  1E09 A;  2NN5 A;  3P51 A;  3TVQ A;  3HK2 A;  3NJO A;  2LAK A;  5JO1 A;  3NJ1 A;  2N4B A;  3HM9 A;  2I9Y A;  4JHG A;  4JHH A;  1XUV A;  1LN1 A;  3QSZ A;  3P9V A;  4REI A;  3F08 A;  2FFS A;  4A8U A;  1LLT A;  3KAZ A;  4N0G C;  4A86 A;  2VQ5 A;  4RYV A;  4BKC A;  3NMN A;  1LN2 A;  3E85 A;  4MAP A;  3DLH A;  4OIC A;  4IGX A;  5E4D A;  3KDI A;  2EJX A;  2VNE A;  4WVO A;  2E3O A;  4BK6 A;  4PSB A;  3GTS A;  1XN5 A;  4C9I A;  2GKD A;  3HVR A;  4IH0 A;  1BV1 A;  3GGN A;  1BTV A;  2N4A A;  3OTL A;  2Q3Q A;  4BTZ A;  4QDF B;  3RD6 A;  2QIM A;  3H3Q A;  3NEF A;  2E3R A;  4A88 A;  3K90 A;  4N41 A;  2KTE A;  2LPX A;  3GTE A;  3PU2 A;  1TW0 A;  1FSK A;  3H3S A;  2RER A;  2WQL A;  2NS9 A;  2Z9Z A;  2RES A;  3WG8 A;  3IE5 A;  4DSB A;  3NQN A;  1Z94 A;  2BK0 A;  2E3Q A;  3UJL A;  2L8O A;  4XRW A;  1EM2 A;  2YH6 A;  5C9Y A;  3DLB A;  4JDA A;  3CNW A;  2LUZ A;  3W9K A;  3HXM A;  4GY9 A;  2K7H A;  3KL1 A;  4Z3L A;  3TFZ A;  2D4R A;  2REZ A;  2LDK A;  2MOU A;  5BRL A;  4R7K A;  3ZVU A;  2KEW A;  2LEQ A;  2PSO A;  3TL1 A;  3GL0 A;  4NCB A;  5JO2 A;  4IGY A;  3RT0 C;  2K5G A;  3KB0 A;  4QCK A;  5AMW A;  4A85 A;  2R55 A;  4BKD A;  5I8F A;  4Q0K A;  3PUT A;  2E3P A;  4Y31 A;  3KDH A;  2PCS A;  1QMR A;  4KPY A;  1T17 A;  3GL2 A;  3W9R A;  2IL5 A;  2LGH A;  3KAY A;  4QDD A;  4A80 A;  1FM4 A;  3HJF A;  3NMH A;  4A87 A; 
#chains in the Genus database with same CATH homology
 1ICX A;  3KDJ A;  4REH A;  1T27 A;  3Q6A A;  1KCM A;  2L9P A;  2L65 A;  3R6P A;  4LA7 A;  4JHY A;  4QDF A;  3GKE A;  3H3T A;  3OH8 A;  4IGW A;  3C0V A;  2LAF A;  1LN3 A;  3NI8 A;  4JHI A;  4N3E A;  4C94 A;  1XFS A;  4DS8 A;  1ZXF A;  1X53 A;  4A8G A;  3NJ0 A;  3OJI A;  3F73 A;  3NMT A;  2KCZ A;  1JSS A;  1TXC A;  3TGO C;  2KF2 A;  4M9B A;  4BK7 A;  1B6F A;  5E46 A;  3FO5 A;  3H3R A;  1H2O A;  4LGB A;  1VJH A;  3KLX A;  4IHR A;  4QIP A;  3K3K A;  4N76 A;  3QN1 A;  5JNN A;  3GOB A;  3NMV A;  4B9R A;  3JRQ B;  2LF2 A;  4LGA A;  2E3S A;  4XRT A;  3KB3 A;  3NR4 A;  4IH2 A;  2Z9Y A;  4C9C A;  5EKQ C;  4NCA A;  4A8V A;  3UQH A;  2ZYL A;  3NS2 A;  3P0L A;  3GB4 A;  4IGV A;  3NMP A;  1IFV A;  4MNS A;  1XDF A;  2M89 A;  3NEG A;  3RT2 A;  4E6F A;  3Q63 A;  2LE1 A;  4A81 A;  3HO1 A;  4REJ A;  4A84 A;  3JRS A;  4A83 A;  3Q64 A;  1XN6 A;  2A1L A;  4QDC A;  4MA6 A;  2QPV A;  4M9W A;  2LIO A;  1UW5 A;  2E3M A;  3ELI A;  4N47 A;  4DSC A;  4FPW A;  3OQU A;  4JDL A;  2M47 A;  4LG5 A;  5E4M A;  2FLH A;  2LCG A;  3IJT A;  5E4B A;  3TVR A;  5I9J A;  2E3N A;  3UID A;  1E09 A;  2NN5 A;  3P51 A;  3TVQ A;  3HK2 A;  3NJO A;  2LAK A;  5JO1 A;  3NJ1 A;  2N4B A;  3HM9 A;  2I9Y A;  4JHG A;  4JHH A;  1XUV A;  1LN1 A;  3QSZ A;  3P9V A;  4REI A;  3F08 A;  2FFS A;  4A8U A;  1LLT A;  3KAZ A;  4N0G C;  4A86 A;  2VQ5 A;  4RYV A;  4BKC A;  3NMN A;  1LN2 A;  3E85 A;  4MAP A;  3DLH A;  4OIC A;  4IGX A;  5E4D A;  3KDI A;  2EJX A;  2VNE A;  4WVO A;  2E3O A;  4BK6 A;  4PSB A;  3GTS A;  1XN5 A;  4C9I A;  2GKD A;  3HVR A;  4IH0 A;  1BV1 A;  3GGN A;  1BTV A;  2N4A A;  3OTL A;  2Q3Q A;  4BTZ A;  4QDF B;  3RD6 A;  2QIM A;  3H3Q A;  3NEF A;  2E3R A;  4A88 A;  3K90 A;  4N41 A;  2KTE A;  2LPX A;  3GTE A;  3PU2 A;  1TW0 A;  1FSK A;  3H3S A;  2RER A;  2WQL A;  2NS9 A;  2Z9Z A;  2RES A;  3WG8 A;  3IE5 A;  4DSB A;  3NQN A;  1Z94 A;  2BK0 A;  2E3Q A;  3UJL A;  2L8O A;  4XRW A;  1EM2 A;  2YH6 A;  5C9Y A;  3DLB A;  4JDA A;  3CNW A;  2LUZ A;  3W9K A;  3HXM A;  4GY9 A;  2K7H A;  3KL1 A;  4Z3L A;  3TFZ A;  2D4R A;  2REZ A;  2LDK A;  2MOU A;  5BRL A;  4R7K A;  3ZVU A;  2KEW A;  2LEQ A;  2PSO A;  3TL1 A;  3GL0 A;  4NCB A;  5JO2 A;  4IGY A;  3RT0 C;  2K5G A;  3KB0 A;  4QCK A;  5AMW A;  4A85 A;  2R55 A;  4BKD A;  5I8F A;  4Q0K A;  3PUT A;  2E3P A;  4Y31 A;  3KDH A;  2PCS A;  1QMR A;  4KPY A;  1T17 A;  3GL2 A;  3W9R A;  2IL5 A;  2LGH A;  3KAY A;  4QDD A;  4A80 A;  1FM4 A;  3HJF A;  3NMH A;  4A87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...