4R7NA

Fab c2e3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
218
Chain Sequence
b'QVQLQESGPGLVKPSDTLSLTCAVSGYPIRFGYSWHWIRQPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDSGNYFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab C2E3 Heavy chain
publication title Robust Antibody-Antigen Complexes Prediction Generated by Combining Sequence Analyses, Mutagenesis, In Vitro Evolution, X-ray Crystallography and In Silico Docking.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 218
sequence length 218
chains with identical sequence C, E, G, I, K, M, O, Q, S
ec nomenclature
pdb deposition date 2014-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r7nA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r7nA01
2Y72A 1JNHB 2IAMA 3DSFH 1RIVL 2YPKA 5F9DC 3QFJD 4GW1B 1AO7D 5I75B 3C5ZD 1IEBB 4OCRH 2A83B 4GRMA 3QWQB 3IDNA 4LRIC 4UT6H 3WFDL 2BNUA 1MEXL 4QLRA 4M7JL 3I3EA 5DYOA 1D5XB 1T04B 2XZCH 1GGYA 4QHMB 4EVNA 3A6BH 4QRTA 5C7XH 3GUTB 3L3DA 1P6FA 3C9NB 3LN9A 2HFGL 2ED8A 4PRDB 4XCEB 3P4MB 5FDYA 5EU6B 1T2XA 3PF2A 2YS4A 4S0SD 4GXVH 3WLWC 3L95B 8FABA 1IILE 5F7DA 1HZHH 3ROOB 3B9KD 2AK1L 3BN3B 1YMHA 3WIHH 1F6AB 4PJEE 2JJUA 5JO5A 4OZHF 1Q1JL 1CFVL 3W2DH 3KJ4C 3ECBA 1MI5A 2CLVB 4YK4C 3TFKC 4M5YH 2VXSH 2AXGA 1MPAL 2FJFB 2IQ9L 1J8HD 4UDUA 3BP7A 3EFFB 2VERN 3VD9A 1FE8H 1MCHA 4RWYH 2H26A 1INQB 3ZT6A 4QOKB 3VXTB 5TF1L 3DV6B 1T2QH 3GO1L 4JFOA 3U2SA 4RMWA 2C26A 4X7TA 3DV4B 2Q6WA 2R0LL 4XNQB 2XQYK 2PETA 3TJHC 1KXVC 1Q9LA 1WITA 5CIPH 4ODXA 3INUH 3CK0L 3TN0C 5KVDH 3VW3H 1NFIA 4G6JL 2ADIA 1I1FB 1RMFH 3D25A 2KDGA 3IETB 1E6OL 3OKOA 1LVEA 4LQFH 3LH2L 4XVUC 3OGCB 4GG6F 2JB6B 3X12A 4P46D 4AH2A 1NGXA 2B0SL 4NQEA 4XBGB 4D9RE 1BM3H 2ZP0T 4G8FA 5E2JA 3L9RB 2A74B 2AEQL 3WHXA 1DZBA 1J1PH 3HC3L 2BNRB 1NMBL 2NXYC 4GBXC 3QXDB 1AGCA 2I26N 4KKBC 3BZEA 3ARGA 2EO9A 4M6OH 5EN2A 3TT3L 1J1OL 3DGGB 2Y7QB 4PJDE 1SYVA 3GK8L 1R24A 1YNLH 4NNXA 4G8EB 1OVZA 2EIDA 5C07A 1S7QA 3U7WL 1DBKL 4P2CG 1YPZB 3CLEH 1SVZA 2ITCB 3OV6A 3QPQD 2JB5L 4K23L 4ZPVA 4IIQA 2ZJSL 1XF2A 1JGLH 1ZA3B 2OI9B 2H8PB 4JDTH 1TLKA 3BPCA 1KJ2H 4E41D 3D1MC 3QUKA 4OLWH 1SJEB 2P7TA 3T0AA 1MRFH 3L3IB 1WK0A 4FQJH 5DD1L 4U1GC 5CKGA 1RVFL 4ZOBA 43CAB 1KB5A 1GIGL 3O45B 4ZAKB 1BECA 3SN6N 1D9KA 4X9GA 2FLBT 1M7IB 5KVGH 2KH2B 5H35A 4PB9H 4F3FA 4X4YA 3MRQB 4Z0BH 4RFOH 1C7SA 5F1NA 3S37X 4CBPA 1P7KB 3K4DA 2DI9A 3MV9D 5EOCH 3TPUB 1UXWB 3OWEA 5DMKB 1T03L 5HGHB 4X8JA 4O2CB 3MMEA 4B7IA 1MHHB 4WHTA 5DD5L 5CD5C 4XB8A 5E4EB 1S78D 4EOWL 2CUIA 3RNKB 4PJBF 3BZ4A 1EEZB 5DFTA 3FFDA 4MNHB 5MI0B 2EXYD 4GRLB 1IGJB 4PBXA 4RAUB 5A40E 3QDAA 1BBJA 1NC4D 5TH2A 3LS4L 2P42B 3LY6A 3QUYD 4Q97A 2E7MA 3QXAB 3HC0B 4YDKL 2A1WL 5KN5B 3C2AH 3BWAB 1LEIB 3MRKA 4Y4KC 3TNNB 4KDVA 1UWGH 5D6CA 2GY7B 4LPUA 3WIHA 5KANG 1INDL 1Z9OA 3RDTA 3QIBB 3LEVH 2Y07L 4L4TE 5F6HI 1I4FA 2ORBL 3RKDC 1QNZL 5TF0A 5JXAL 2VLMD 2HKFL 4NRZB 1UCBH 4HMCA 5DJ6A 3SQBA 5I1CL 5I73C 5J89A 1XZ0A 3ARDC 4JDVB 4LLWB 5EBLA 5IG7A 3NABL 3QIUC 3IS1X 3TBYA 4Y4HA 2J5LB 4UIMB 3DX8B 1FNAA 3KLHD 1NGWB 4OCXL 2XWTB 3GB7B 4KKLD 5KAQF 4WWKD 2X44D 2V2TA 2FO4A 3MRGB 3RDTC 4M6AA 2WWKO 3HMXL 4JKPH 4D3CL 1KXQE 3V9FA 3QEUB 3GSQB 3KPTA 5D71H 5I30H 3EUUA 1ZT7B 2HJFA 5T5NF 3QI9C 4HJGA 2N7AA 2CMRH 4LLYB 2CKBA 2E3VA 1DUZA 3QRFM 4K7PX 1UZ8A 3QEQE 4XNUH 3WNPA 2HYMA 2R29L 4M43H 4NQDB 4BSWB 1JWMB 2H9GB 1X7QA 2BVPB 2I5YL 4HT1H 3KDMB 3KXFB 5TPWH 2EDWA 1BQHG 4RNRB 1QEWA 2YEZB 5GRWA 4OUUA 4LLVB 2WQRA 1LP9F 4YHKL 1E28A 1NC2B 5JNYA 1HSAA 3RA7H 1RFDH 3LPGA 1HHHA 2A38A 3GJFH 4P5KA 3RX7A 5E9DB 4A6YH 3VFSB 4JG1H 3GHEH 2D03L 3HUJE 4F9LC 5HPMB 5L9DL 4OCYL 5TDPB 5CEXA 5D7JB 1QBBA 4XWGH 1H3GA 4OFDA 4FQXD 2AV7A 2NY6D 3EIFA 5C0FA 4JM2A 1FNGA 2FEDC 1C5CL 2X4OB 4PJFB 3U79A 4JHBA 4F7MB 5EBMA 5KW9H 1U8KB 3WFHA 3OPZH 1C8PA 3ARFA 3TO4C 4APQA 3QUZB 3U9UB 4K71C 4J8RA 4K8RD 4M48H 1UXSA 1CIDA 1NMCC 3O2DA 4UBDD 4PRHB 4EDXA 4P2RA 3WBDA 1QSVA 3TA3D 1DSFL 4DQOL 3MTRA 4KTYA 1Q9OB 4JFZL 1YECL 5J3HC 4EDWL 1S5HA 1X5AA 4KAQL 4G42A 1KJVA 4HX1A 4B53A 4X99A 3WN5B 3B6SB 5JMRA 2RFXB 2VN7A 4GW4A 5D7KE 4PRIE 1CDHA 4JFEA 2WIIA 1HEZB 4LPCA 3G6AA 1EX0A 3IT8D 5IP4A 3STZA 1YEJH 5CFHA 3LIZL 2AJXH 4JPVL 3REVA 2W60B 3DMMC 5FYKL 2P49B 1VKXB 1CG9B 3IDXH 1ZGLM 3NPSC 2VLKB 1TJGL 2C1OB 4IRJD 2XTLA 5LJYH 5CEZH 1F97A 4R0LA 5F21B 1H0DA 3V2AR 2ZG2A 2B1HH 1OGTB 3G9VA 3RL2B 4ZUVB 2KPNA 4JQXC 5EO9B 4QRUA 4M5ZH 2HKHL 2IBGA 4G8GB 1JGVH 3QBTB 5KSVB 2ZNXA 5HGDB 4JN2A 1ZVSA 3PGFL 1L4IA 1B0GB 4M9OA 2YXMA 1I9EA 4PYHA 3OJ2C 4JJ5B 4KROB 3V5HA 1FBIL 3FO0H 5K9KA 3AAZB 3SDXA 1OGAA 4ELMA 2GSGA 2HRLA 2P8PB 5SWSA 3QHFH 4Z7QF 3BEVA 4WJ5B 2F9BT 4DK3A 4E0RB 3B8YA 4H20L 5SWQB 4YAQA 2LQRA 2YPLB 4YPGA 4U7KA 4JO3H 1AXSB 1NDMA 1A3LL 3N06B 1X5JA 4KVCH 4XZUA 5AG8A 5T3XH 4JGUA 2ESVA 1KB5L 4KUCD 1UYWL 3T0EE 2GYSA 3DUUA 1XH3B 3DVNA 2GT9B 3IFPB 4KVNH 5FYLD 2RGSA 4ZFFA 1FVDB 4E42B 1FGVH 2MHAA 2G5RA 3FO1A 2OR9L 4QRQA 2O5YL 3DSFL 3RWHA 5EOTA 3MLPA 1FQ9C 1A0QH 1MI5D 3PHOA 3DROA 1UWEH 2E9BA 3TYFA 4PYGA 4OCRL 4FS0A 3NMEA 3HE6B 4UT6L 1XF4B 3VFWA 1U8JB 5M7QA 4YDVA 2XZCL 5F88B 1AFVH 3G5YB 5C0BD 2YUVA 3UROR 4QWWC 5C7XL 2EZ0C 2NY7H 4Q6IA 3UPCA 3RWEA 5KS9A 3BW9A 1U8NA 3BKYL 4TULL 1T0NA 2HLAA 4GXVL 3ZDYE 4ZQKA 3MOAH 3IFOB 3DO7B 4X4XA 1HZHL 5E6IB 4YE4H 4JREB 4NQED 1UEYA 3WIHL 2XYCA 4HKXA 3TV3H 3IYLW 3W2DL 1MCNA 1X5HA 2E8YA 3PXJA 2V5MA 3CVHA 3OKDA 1JE6A 4M5YL 3ARGD 2C3WA 2VXSL 3FHQA 5I15L 4DJMA 2PTVA 2A0LD 4U7SA 3HPJA 3O3UN 1FE8L 3ILQD 4RWYL 3IXAB 4NGHH 5F3BB 1FNHA 5GGSB 4S0TD 1CLYL 1T2QL 4NN5B 1G7LB 1A3QA 2C4FU 2F53B 4JFQB 5C07D 2FZ3B 4FQ2H 5IR1A 3INUL 3JV5A 3VW3L 4PTTB 1GC1C 2XA3A 1RMFL 3SHSA 4X6EA 3LZFL 2M26A 4LQFL 2PYEE 2ZUWA 4ZDHA 2Z0BA 2DS4A 1JPTH 5CEYB 5KG9B 1MIMH 1RU9L 3KHOA 1J1PL 2G2RB 4N9GB 2E7BA 1D9KD 2VYRE 3EOYG 4G9FA 2NXZB 4M6OL 3LV3A 5DK2B 4YR6B 1SJHB 4NJAH 5DJYB 3ARVA 3H7BB 4YFDB 1J05B 2AJZA 4X7CC 1CF8L 1YNLL 4RMUA 3KXFE 1YC7A 1OF2A 1T1ZB 5IHUH 5CJXC 4I0PD 1WUNT 4Z7WA 1AGEA 2P43B 1LK2B 1UWXH 2FX7H 3H3KA 2CKNA 2CIKA 1LO2H 3E6FB 1JGLL 4BM7A 3M17B 2CK0H 4N0UE 1F4HA 4XH2B 2FGWH 1U91B 1X5YA 2XFXB 1WV7T 1KJ2L 3RUGE 4NZDA 3SDCB 3SGJA 1ZLUK 4OLWL 2HT3D 1MRFL 3UTTE 5DFVD 3WL9A 3HAEB 1RUQH 1NBZB 4HZLA 2BVOB 2COQA 2NW3A 1KACB 4PRNB 5E4IA 1WAAE 3QNXB 4JRYB 4QRPD 5KVGL 1JZ2A 4OZ4A 4PB9L 5I8EA 4Z0BL 2YD6A 4B50A 5EU5A 4ZFZA 2BVTA 1OAKH 3FO2A 2UWEF 4ZOCA 4Y4FD 3T0EC 2JIXA 3LKRA 4XTRC 3GJEB 3TVMA 1IT9L 2NY5C 5JORB 2QSVA 5AZEL 1RIUH 3QIWA 3GSNH 1JHTB 3O3EB 2EC9T 4PP1C 3SE3C 1BX2B 5HHME 1HOCA 4WI4A 4MHHG 5JOPD 4LHJB 3ZTJG 1FHGA 4WW2C 4LBEB 2D2OA 3BH9B 4I18A 4ETYA 5FB8B 4W81A 2BERA 4XCYB 1UWGL 2I27N 4M1GH 3PP3K 4W6WB 4N5ED 4U49A 5IMOB 2B1AH 3VDAA 4NHUB 1YPZF 5D96C 5AD0B 3VXQB 3UBXB 1TZHB 3QR2A 4MNQA 2VDKL 5DC9B 4YZFE 4P4RA 1UCBL 1UCTA 5GGVY 1CS6A 3MCKA 3HFML 5B38A 4OIIL 2DJUA 2ITDA 1RHHB 5H94A 4OD3H 2IANB 5DEFA 3HZMA 1F4WH 3CUPB 2CLRB 4ZG1A 4D0BB 4MQ7A 4HDIA 4P57B 3PDOA 2VDLL 1KCSH 4KQ4H 3I84A 4JKPL 4QCIA 3QSKB 3VXRA 4L3EB 4ORGB 2ARJB 5I30L 1EXUB 3QPXL 3BDBA 4NDMA 1QLFB 4X7SH 1RJZB 3I3DA 1CDCA 3QDGE 2ZUUA 3P77B 4XNUL 4M1CC 2R1WA 5INDA 3L5XH 4M43L 4F7PA 3GKZA 1I3RB 3MFGB 2R56H 3FQXA 3OZ9H 3SKJL 4AENA 5BZDB 4HT1L 4ODBD 4JM2D 4FFZH 4OGAD 5TPWL 4HIHA 5EC2B 1WJ3A 2BY0A 4CMMA 3RHWK 3WFZA 1T1YA 1HYRC 3AVEA 2HJLA 5J1AB 3ARFD 5CZXC 4APQD 5IOPB 4N0RA 4PJAB 1VCAA 4IRZL 5DZNA 4PJGE 1YEHH 4P4KB 4PJ8C 4HJ0C 1RFDL 3RA7L 4P2RD 4A6YL 3W0WA 3SY0B 1S5IH 2CLZA 1WVZA 4JG1L 1BZ9A 3GHEL 4LCCC 4U0RC 2GUOA 4LNRB 3BO8B 1ORQA 1XF3A 4NKDB 4Y5XC 3RVXC 5JHDA 4QY8B 1Q38A 3S5LB 4XWGL 2A9MH 2WLYA 5F7WC 4JFED 2XG4A 3CPLB 5T1KB 5EDXA 2FB4H 1R3LB 2Z4QA 3BZDA 3QUMH 4UT9L 1N8ZA 1EVUA 3GSNA 5KW9L 4U6HA 3NCFB 2B39A 5IMKB 4MD0A 3TBTA 1DQLH 1RZ7H 5FM8A 3MRDA 4M48L 3BKJL 2ADFH 5A1AA 5HYEA 3IDYC 3KPPA 1H3PH 5D1XA 3MLWH 1R5IA 4MLIA 3B4NA 3DX9B 2ED7A 4WVRA 5FO7B 1GC1L 1FYTB 4KK9C 5IF0B 3C6LB 3L3JB 4X6DB 3DGCR 4PR5A 2R8SH 1T66D 1YDPA 2Z91A 5KVEH 2WUCH 2RR3A 5IWLC 3MYJB 3MRJB 4PRPE 2ZZUT 2AJXL 4ZSOB 2YWZA 4RAVA 3H2WA 5IB3A 3O0RH 4JPIB 3RVUC 2NX5B 4LCYA 4ODVH 3QQ4B 4MQSB 4L8DA 2GJ6E 1UB5A 1RZIB 5HVHB 1I7TA 1UACH 1OGAD 4Y8DC 5IVXF 5CEZL 4LCWB 4I2XB 3UTSE 3QG6B 4PLNC 2QQNH 5ILTH 4X6CE 5SWSD 4BK4A 3SPVA 2WUBL 3LOWA 1PW3A 3MJ7B 2NLJA 5JZ7D 4HKBB 4YUEH 1U41A 3VRIA 4U1SA 1KV3A 1P1ZB 4M5ZL 3SEPA 1QYGH 3U36B 2ESVD 1JGVL 5KSAC 1QSEB 1I8LA 5E5UB 3LKQB 5DGQA 3AREA 2M8XA 1BREA 3N1PC 4YHPA 3MGTA 2AK4A 5GIRA 5FK9A 4XCNB 5TQ0H 1RZJC 1CE6A 4FZEH 5C0AB 5D5MB 1OP5H 1K6QL 7CGTA 2X9XA 1T1WB 1MRDH 3BT2L 1S8DB 1DBJH 1I1RA 2C3XA 4LLMB 2VZUA 3EGSB 5A2FA 3CFIC 5E7FA 3SDAB 1G7HA 4ETQB 3QHFL 2YUWA 2OLDA 3OMZA 1FORL 3RBGA 3ZE2F 4GG8B 4JO3L 5ID0B 4LF3A 1FYHB 3ILPA 4KVCL 5T3XL 5IT2H 5EOQH 5F9WC 3FMGH 2J8UF 4I77L 4TUOA 5FKAB 2EYSA 3IDIA 4KVNL 2H2SC 3CH1B 2P8LB 3F7VA 1FGVL 3C2SA 1I7ZA 5DURB 3QUMA 3L3GB 4UIKH 3AB0B 3IKKA 2EDEA 3O6ML 5LAXA 5C8JB 3VXMA 5JIIA 2GI7A 1UWEL 1P4BL 1WF5A 3L5IA 4ZXBA 3R8BB 1DE4A 2EKSA 1FL3B 1ZS8B 5FYJH 5FO9B 3Q6FA 3C5ZB 4YEFA 2WV3A 1YN6B 1T5WA 5C0ND 4M7ZB 1AFVL 2D0HA 4Y2DC 1ZTXH 4JHAH 2NY7L 5I1HH 3WXWH 5F7EH 1JL8A 2BY1A 3LD8B 3PJSB 1NUFA 3HE7A 3VXPA 1IEAA 2BVEA 4GW5B 4UINH 1DBMH 4K3JH 3MOAL 1IAIL 3ISWA 3T2PA 4YE4L 1V3KA 1A6ZB 4H8WH 4DCQA 2JCCB 3DVGA 3ULUF 1CICA 3I02B 4NP4L 1NCDL 4MA8L 1D5ZB 1XGUA 3RJQB 1DFBH 2OJZH 4FABH 4G9FD 4J1UA 5FDWB 4L4VB 4MS8D 4NGHL 1N7MH 4JY6B 3GSOA 3OKYA 4YHIB 5DWUL 5ADPH 3F6LA 4YXLH 1I8MB 1FPTH 4LLDB 1SY6L 5DMGC 4FQ2L 3VD3A 5BS0E 3CCHB 4AY0A 4CVWA 3B3IB 1IM9A 1HQ4B 3KPMB 4MCYB 5DF0A 3W81A 1MAKA 4ZUUA 5J6HA 4RISH 1TETL 4NC2B 1ULVA 1NLBH 2OM5A 2DQTH 3S35H 2FECI 5FO8A 2FHFA 5KVMC 1U93B 1IGIL 1JPTL 4YC2C 1UJ3C 4FXKA 4OZIB 1MIML 3L3OB 1IRAY 1WTGT 1QKZL 1IKNC 2G60L 3QDMB 3OX8B 4AEEA 3QO1A 4N90D 5L7XL 1MJ8H 2BHZA 3K7UA 1UH3A 3JTTA 4ZUTA 3AGVA 1CK0H 5EU3A 1YQVH 5IROC 5C1MB 4P2QA 4KJWD 4NJAL 1YNTA 4C56B 4C55A 5HHXH 1VHPA 1F00I 2E8ZA 1S7WA 2B5IB 3C5SA 1N5AA 2XKNB 2HJKA 1C1EH 4OZGF 1FJ1A 2EYTB 3NCYS 1A6PA 4P23A 2FX7L 2I07B 2JIXD 3CSPA 4FQHB 4MB4A 5I16B 3TVMD 3G9AB 5SX5K 2CK0L 3F7RA 5F7HA 2FGWL 1A6TB 1A47A 3QIWD 3MUGA 4CUCA 1FZKA 3EHBD 4N0YH 3HNVH 4H5SA 3V6ZB 1MH5B 1RUQL 4FFYH 3O3AB 5DUMH 4E41B 4GRWH 3BEWA 2KQNA 2X4QB 3B5TA 4XVSH 2DQFA 3MRCB 1DBAH 3H9SE 3GSUA 3LN5B 4OI7A 4MQXC 2YSSB 3O6FA 4PJCB 3Q2CA 2DYPD 1OAKL 1Q0XH 1XGRB 2P5EE 4U6YA 3RWFB 3V5KA 3IRZA 4KHTH 4GJTB 2Y1VA 3D0VB 4OZHA 3PL6A 2Y6SC 4MNQD 1CXHA 1H5BB 2VDQH 3HI1A 5GRVK 4EZMA 3GSNL 4PY7B 1IE5A 5DQJB 4J23A 1NSNH 3LKPB 2CRMA 3EO9H 1HHGA 3T8XB 5DO2D 2J88H 1P4LA 4PLKD 4CJ0A 2LE9A 5IK3A 3G6JF 4CN1A 1JHLH 3ZHKA 4DKFH 4M1GL 3OR6A 4MJ4A 1G9NH 1IM3A 5D7LE 3QQ3A 5GGRA 3VXRD 4GG6A 1PFCA 5HYSA 3IDJB 4JFHD 2A77L 3ROLA 4U6TA 2ADJB 1KGCD 4V1DB 3RGVA 5BOPA 5EU4A 5BXFA 5E00B 2ZG3A 3QCUH 4X6FB 2NY0D 3NZ8A 2W59A 1FVCB 3EYQD 3WJJA 1MY7A 4OD3L 5GHWH 4Y5VB 4LCWE 4BH8B 1F4WL 3HZVA 2R2BA 3D85A 1RZJL 1KCSL 1CL7H 5B39A 1BBDL 4KQ4L 4HFWB 2DD8H 2W91A 2D7OA 4JFXB 5I19L 5E8DH 4NCC2 2JJSC 4KK5D 3ZYZA 2DRUA 5MERA 3I2CL 4HF5L 3PG2A 3RL1B 3W0WD 1WC7A 2KUTA 3U0WL 4X7SL 5MHSE 4Q2ZB 1AD9A 3L5XL 1Y0LB 4E9LA 1B0RA 3TC9A 1BQHB 2R56L 3OZ9L 1MWAB 2QADB 1YY9C 2X4SB 3OKKA 1LP9E 2VE6A 3P0GB 5E5RB 3LEYH 1OY3B 3T1FA 3EYFB 5C70A 2W9EH 1BOGB 3PWPE 5EUOB 3UPAA 5DJXA 4WEBH 3IB4A 4LQ1A 5ITFB 4HXBH 5JLZA 3Q0HA 1F5WA 1INEH 3P4OB 4P3CH 1PBYA 4PJBA 2VLJA 5DHVA 2B2XH 5EUKA 2AXFA 2FCBA 4G8IB 4HUWA 4G6FD 2YBRB 4L9LA 5IJVB 4EKXA 1LNUA 2R1XB 2IFGA 2FDBP 3Q3GB 5MEQA 1ZLVK 4ISVA 4MSWB 4XX1E 4ZO6A 1VGKB 4ZS6C 3FN0H 4HLZG 1WIOA 4PRBB 1MRCH 3QDJA 2UV3A 1Y6NR 2A9ML 4KZEH 1TQBB 1QTYT 4R7DA 3S36X 5IM7A 2UY6A 2FB4L 3QUML 4R9HA 5B22A 3H0TA 5CJOH 4D9QD 1MY5A 2OS7A 4L1HA 3FQRB 3O4LD 3RI5F 3GMQA 4B0MM 1RZ7L 4LFHG 4Z7UB 3KYNA 1TVHA 1CXFA 4CJ1A 3GMMA 4Z76A 1DCLA 1H3PL 3JV6B 1FFPA 2VAJA 3MLWL 3KLSA 5HGAB 3TA3B 3ZDZE 4TTGA 1C5BL 1A6AB 4GAJH 4HPYH 4LGRB 3N1MC 5SWZA 5JOFB 2R8SL 2LTQC 5BQ7B 4OI8A 1HDMA 3K81A 5KVEL 5IEHB 2FR4B 4KMQA 5J12C 2WLZA 4ZO8A 3ARED 4J3WA 4OKVB 2IMMA 4RZCB 1EGJH 1XIWB 2X4RA 3O0RL 2AK4D 1FO0B 3MLUH 5EO0B 3ME0A 4Y16B 2QSCH 4TQEH 3MRHB 3P4NB 5TGBA 4HGWA 2HT2C 4LVOB 5E5MA 3C60D 1MQKH 3SGEH 4Z0XA 4YHNB 2J4WH 3O81A 5DVOA 2QQNL 3P9LA 3KPSE 5ILTL 5BRZE 1CZ8H 3NCCB 1LP9A 4LHQB 4XI5D 4YUEL 4QHNA 2APTA 5D2LB 5E0QA 4ACPA 2WANA 4QO1A 3MBEA 5GGUA 4PJ5E 4OFKA 1KPVB 3S34L 4TPRL 4WWID 2BZDA 1LEKB 1RZGA 1BAFL 5T33L 3NA4A 4U1IA 1YMME 5TQ0L 4L5FH 1Q9KB 4HK3N 4Z7QE 4FZEL 4H1LH 2D0FA 1WGOA 1F2QA 4U1HA 3VXMD 1DQJA 1DBJL 5I1LA 1EO5A 4PGDB 5INCA 5TQ2H 2FWOA 5J56B 3JWOH 3GMOA 4I9WD 4BZ2H 2NY3C 3QAZC 2NY1C 1KXTB 2LFGA 5C0DB 5L6YH 2YN3A 3OXSB 1ZLWK 3TH4T 4ZFGH 2PXYA 2YMXH 4Z7VF 5EOQL 5L2KE 2VKXA 4L29A 4EI5A 3HR5A 5C0IA 4N1HB 3HE7D 3O3DB 4JZJA 1PSKH 1KEGH 1ED3B 4CADA 2Q87A 1E4JA 5IMMB 5BCAA 2JF1A 5EZJA 2F58H 1AY1H 5DRNA 4JQIH 4NM8L 4UIKL 5F1IA 1PKOA 3V0AC 1TZGL 3T1WA 3VXSB 3EOBA 3BIKA 2P4AB 2DIJA 2QR0A 4X9HA 4OLYH 5FYJL 1IAIM 2DQUH 5GGVL 4YBLB 3K46A 4JRXA 5J13C 1N4XH 5I74B 1ZTXL 4JHAL 4OF3A 5EORH 3K8KA 4M03A 3VMPA 2VDMH 4XNMB 5BVPH 3O2WH 3WXWL 1IM9D 2XWBA 5F7EL 3SE8L 4XPBL 4X9FA 4N8VA 5C09A 3VG9B 5FHAH 1U95A 1DBML 4K3JL 4K3HA 5IW3A 4NQCA 1V7NH 3KWWA 1QFWM 5I1JH 3L5JA 4H8WL 2K1MA 3VWJA 4NHCH 3WSQH 3OXRA 3IDMA 5C08E 1CGYA 1E4XL 3K74B 1A4KA 1DFBL 2OJZL 1VACA 2EDHA 3CZFA 5FGSA 4F7EB 4UQ3A 4P2QD 2O61A 2GCYA 1N7ML 4F8TA 1HXMA 2YC1B 3MLSL 4UAOB 3BQUA 5ADPL 3TIDA 4YXLL 4HS6A 3V7AE 1FPTL 4P23D 5J1TC 4PJ5A 5I8CA 3OAZH 1U36A 2E7HA 1T20B 2BY3A 4NUJB 4RISL 4NQXA 1YEDB 1NLBL 2UZIH 1E4KA 5HDBF 2DQTL 3S35L 2VLLA 3FFCA 1KPUB 4ZUWB 2YD2A 2NZ9D 1G7IB 4HS3B 3MV8A 1HH9B 5DK0A 4LEOA 4NSKA 5TE4L 4WI5A 1A7NH 1ODAA 4JFFB 5GGQH 1MJ8L 4R97C 1MFNA 2DWDB 1YQVL 4PJHA 1VFUA 4DOHB 3VGEA 5HHXL 3U0PB 2OCFD 1AC0A 3O6FD 3SKNA 4MAYC 5T1MA 4H1LA 4EEEA 3WEXB 1TTUA 5L2KA 4YDJB 1MNUH 1OAXL 3PL6D 2P44B 3LHPH 4NO2A 2PTTB 3VWKD 4PJIB 3MOBH 4I0PB 3T3MF 4NQVB 1JPFA 4MJ5B 1A1OA 2Z92A 4N0YL 3HNVL 3I85A 5I1KH 3TIEA 3VG0H 4UV4L 5JIHA 3LB6C 4CNIB 3BXNB 5DUML 5DHYA 1I1YA 1QFHA 3W11C 4MZ3A 1HINH 5FOBA 2UWEE 1DBAL 5DLML 1IEHA 3S96B 4QRPB 4NM4H 1JTOA 15C8L 1FZOA 2KQMA 1BFOB 1IQWH 4PJ9B 5E6YA 3TO2B 2D31A 4KHTL 3BPOB 1ROWA 3F5WB 2VDQL 2HFFA 1I7UB 3RGVD 3BZFA 2WBWB 5ERWA 2SEBB 2XZZA 4CDHA 1FFOB 3TBSB 5IEKA 1NSNL 3L1OH 1EEYA 1JRHH 2N7BA 4NZRL 3BGFC 1S9XB 4HZAA 3A6CH 4JZOB 2CSPA 3ZZ1A 3FQTB 1GZQB 5HDLA 3I9GH 5D70H 1ZE3C 1I9IH 3MLTA 3VD5A 1JHLL 2HLFC 4DKFL 4Z95H 3FZUC 1HI6B 4EN3B 1RQ5A 4J12A 4HUVB 4UTAH 2EO1A 4PJXA 4UQ2A 4QKXB 2CUMA 2X5PA 3QHTC 1IMHC 2B7DT 1U3JA 1QRNE 3TPKA 1DUYB 2DLFH 1JNHA 2Q20A 4LLUA 5HYIA 3PABB 4JAMB 4GW1A 3DHJA 3FQUA 5F9JB 4Q6YA 1IEBA 2A83A 3C5JB 3QCUL 1MJ7H 3RVTD 3QNZB 4XXDB 3TF7C 1D5XA 1T04A 1AQKL 1REIA 2RB8A 3D48R 5GHWL 4QHMA 2AJVH 3LQZB 3GUTA 1J0JA 2BNQE 3C9NA 3DX7B 4XCEA 5H37G 4PRDA 3P4MA 3LQAH 4Z5RB 2R0KL 5EU6A 4BZ1H 4YHOH 2APWA 4J3TA 4L9DA 3L95A 4PJCF 2DD8L 4KY1H 3ROOA 5E8DL 2VLJD 1DLFH 5D7IB 2Z35B 4OFYA 5HSFA 4FFVD 4RGMB 2CLVA 4MDJA 2VR4A 3H9HB 3DSNA 1A6UH 3EFFA 4PGCB 3SDDC 1INQA 3BUYB 4QOKA 2W9DH 3VXTA 4V2BA 2XTJE 3QDJD 1YEGL 5CD3A 3MJ9L 2VJXA 1QBML 1EDQA 3DV4A 4OAWB 3LEYL 4XNQA 2UWEA 5CUSH 4KGLA 2W9EL 3JWDH 1IGML 1TFHA 1TVDA 2M2DA 5HTSA 1I1FA 4WEBL 3HI6H 4IRSC 1BD2B 5KSBF 4HWUA 3IETA 1A2YA 4HXBL 4EUPG 5K9OA 2Q76B 3OGCA 3AC0A 2JB6A 3WDIA 2NY2C 2VN4A 4P3CL 1MREL 3CX5J 4XBGA 2B2XL 5GISH 3L9RA 3D3VD 2A74A 4NT6B 3RRQA 2CDFB 2BNRA 3QXDA 2BSTB 4XAWL 2V7HB 4G6KH 4LPWA 2WINB 4HULB 4BSVB 3F7PC 3QWRA 3FN0L 3DGGA 2Y7QA 4R7NA 2GHWB 2XOTA 1MRCL 4KZEL 5LXGH 2K9UA 4GH7B 4G8EA 2NY4D 1YPZA 4NQSA 3OHXB 1N0XH 3QUXC 3L6FB 2R15A 3I6LD 5CJOL 3KPRB 4IOFD 3DETD 1OAQH 1XMWA 2MQ3A 2H8PA 2D9CA 1HK6A 4F57L 1SJEA 2VO5A 3VFOB 3L3IA 2VXQH 3UC0H 4OLXH 2LVEA 4P2OB 4LKCB 5HXMA 3SCMB 1JHKH 43CAA 4K3DH 5CBEB 1AD0B 3O45A 4S1QH 3QZWG 4ZAKA 5ANMB 1JVKA 4LL9A 3RBSA 5IB1B 3RTQB 1KLFA 1M7IA 3HR6A 4GAJL 1KOAA 1MCFA 3MRQA 2VLRE 2HMIC 1P7KA 3S3SA 1KC5H 4S1DD 1OM3H 1U8IA 1UXWA 3ARDD 3TPUA 3TYGH 3MBED 5DMKA 3O8XC 5EUOF 3M8OL 5HGHA 4O2CA 4HUUB 1MHHA 2DB8A 2HG5B 5IVXE 1EGJL 1NFDB 1JNLH 3MLUL 4PJ7F 3RNKA 1EEZA 2OP4H 5D2NE 2AP2A 4MNHA 3S3PA 2ICCA 2QSCL 4GRLA 4TQEL 1IGJA 4RAUA 1HYSC 5DQ9B 4NKIH 1MQKL 3QXAA 3HC0A 3HI5H 5IJKA 5KN5A 3BWAA 1LEIA 4GSDH 4NBZB 3TNNA 1CZ8L 1FSKC 3QIBA 5HJ3B 1ADQH 1A7QH 2RBLA 3VFPB 4DZBB 4HAFA 1I8KB 3ULSB 5F7UA 4EI5D 1I3GL 1WWBX 4POZC 3T0XA 2QEJA 3QYCA 4FQQB 4IJ3B 1WBZB 2DQEH 1RURL 1W0VB 4JDVA 4LLWA 3WS3A 4R4NC 4UIMA 3LQAC 3DX8A 1M1SA 4RGND 3OAYK 3ZE2E 2R69L 1NGWA 4P48A 2R9HC 1OT2A 2V5SA 3UYPA 1RUPL 2XWTA 3GB7A 1Y18B 4U2YA 5TQ2L 4JANB 2WWMD 2XTJC 2X9WA 2J8UE 4WO4C 2QQKL 4QHKI 3T77B 4JRXD 2X4NB 3QEUA 1OAYH 4NO0B 5KSUB 2YMXL 2JK5A 3GSQA 1DQDH 4H26B 1EFXB 1ZT7A 1WZ1L 3EAKA 2OL3B 4LLYA 4RMSA 5C09D 3IAPA 4ODWA 1PSKL 1EHXA 2MMXA 4X0KB 5F9OH 4K7PY 3V6BR 5CCKH 4MDIB 1HIMH 1JJUA 4NQDA 4BSWA 3UTPD 1F90H 1TJIH 3VWJD 1JWMA 2F58L 3JWDC 2BVPA 5HVWA 3V6OA 4D9LH 5FUZL 3KDMA 5DTFB 4MJIE 3ULUH 4RNRA 5HDQH 2X40A 1IZJA 2MPAH 2YEZA 4OLYL 4JVUA 2DQUL 4LLVA 4Y19B 5JXED 1CDUA 2GEEA 3BQUD 4HIIB 2FIKA 5KTEH 4ZYKB 1NC2A 1T1XB 5EORL 4WFGD 2VDML 4M6NL 3REWB 5E9DA 3O2WL 3FQWB 1FZJA 5BVPL 3KPNB 4KKAC 3GBNL 1LK3H 1FLTX 3VFSA 4HWBA 5HPMA 4I1NB 3FFCD 5C6PB 5CJ8A 5TDPA 1V7NL 4PRAB 4S1RH 5I1JL 5MEOB 2XRAH 5D7JA 1IAII 1NKOA 4XT1C 3RJDA 3MV8D 4NHCL 3WSQL 1KJMB 1KIRA 3VGHA 1WZKA 3MUZ1 5GZND 4KKCC 3ARBB 1GYAA 3EYSH 1QR1B 2X4OA 2B8OT 4PJFA 5E1AA 4F7MA 1U8KA 3DPBA 4L8BB 3QUZA 3U9UA 5DJCA 3V8OA 3LDBC 4UNVA 1QFWI 4U1KB 2ZCHH 4PRHA 2EDXA 5E8OB 1QSFB 3U7AA 1NCUA 1E6JH 4GAFB 1Q9OA 2UZIL 3HG1B 1YUHB 4KUCF 4KRPB 5D2NC 3MLRL 3FT3A 3GRWA 4Q0XH 4Z77B 1MCLA 2QQLH 4P5TC 3U7YL 2F54E 3MLXL 4K2UH 3B6SA 2RFXA 5EBWB 3NFNB 4NCDA 1HEZA 1A7NL 4KJPC 1MHCB 4CU7A 5GGQL 2XPGB 4OZGE 1G7MB 5C0CE 3E2HC 2PW2A 1ZXQA 2W60A 5ACMA 1X5KA 1EAJA 1VKXA 3S4SG 1CG9A 3UX9B 4WUUE 2NZIA 2VLKA 3QEQD 1L7TH 1LE5B 2C1OA 5JW4R 1MNUL 1JGUH 3MNZB 4X4MA 3MBXH 5D1QB 3MOBL 4OD1H 4GS7C 5LGJA 2Q86B 4Y1AE 5K9JH 1MCWW 5GRJL 4NKQB 4F7TB 4O2EA 5E08H 5JHLL 3AS0A 4WFFE 3VG0L 1OGTA 3RL2A 4PP2A 4N9OB 1RJLB 3OSKA 5EO9A 3MNVB 4OQ1A 4MVBC 3FOLB 4G8GA 5EZIH 1GXEA 5KSVA 5HGDA 3CFKB 1FNSH 2GK2A 1I85A 4NM4L 1CT8B 2LU3A 1JYVA 1B0GA 5TE7H 1IQWL 2X1WL 3T0BA 5MENE 2AI0H 3WNOA 3NIFF 3N85H 4JJ5A 3S37H 2RIKA 2EC9U 3AAZA 1VFOA 2DMCA 5C2UB 3UJIH 3G6JE 2P8PA 1A5FH 5GZOD 2EZ0D 2YA0A 1EUUA 4LAQH 4E0RA 1JRHL 2YZ1A 5SWQA 5F9AC 5FGCE 2YPLA 1MAMH 1AXSA 3A6CL 1R3JB 3I9GL 5D70L 1GZPB 3RY4A 1I9IL 1YJDH 5EU6D 4Z95L 1I85C 3DTXB 4AG4H 3OB0H 2V2WB 3PQYB 3SQOL 1XH3A 1NCAL 4MXVE 1QFPA 1NJ9B 3IFPA 3SO3C 3NZHH 4G7VH 5D93C 4LOUD 3ULUC 1UH2A 4E42A 3QG7H 4OFYD 2XN9E 4O02H 4PJIF 3B9DA 5CS7A 1CQYA 4RGOH 2HVJB 5GS1C 3P11L 3BPLB 1XF4A 1MJ7L 1U8JA 3UAJC 5BV7H 5I66B 2MTPA 4QOKD 3FCTB 5D1ZA 3AY4A 5F88A 3G5YA 4F80A 2AJVL 2AEPL 4PIRF 3ZYJA 5CINL 1K2DB 4HIXH 2XXCB 5IGXH 4G6AC 1MFCH 3R1GH 2NCMA 3LQAL 2DJ4A 3BP5A 4M7LH 5K9QG 3KPQB 4N8PA 2W1NA 4YHOL 4BZ1L 2ERJC 4KRMB 3IFOA 1IL1B 3DO7A 4KY1L 4QRRB 5E6IA 5HVGB 2IH3B 5DGRA 2YHGA 1KELH 3L7FA 4F33A 4XGZB 1H3UA 2BNRD 1KTLB 1KENL 3TT1H 4LVNB 5IBLD 1TPXC 1MJUH 1A6UL 5I1EH 3NH7L 2AV1B 2ARJQ 4Z78B 3QWRD 5F3BA 5D1ZC 5GGSA 4Q9QH 4RDQG 5IESH 2W9DL 4K7PH 1G7LA 3ZT7A 4M1DL 2F53A 4FQ1H 5CUSL 2FZ3A 5ISZB 4HH9B 4LIQH 2PO6C 3WKML 3JWDL 2ZWLT 25C8H 5C0JB 4PTTA 1ZGLB 1MQ8A 1YY8A 2ZPKH 3W9EB 1XR9B 3HI6L 1PEWA 4ODUB 4LDEB 3X14B 1CE1H 3MLZH 5HHOE 1U92B 2AVGA 5GISL 5KG9A 3KR3L 2K3TA 4J4PC 4RRPA 4LIQE 1EJOL 4DKEH 2JJTA 1L7IL 2G2RA 4ZAKD 4N9GA 4G6KL 3WNNA 4YBQD 1KIUA 5DK2A 4YR6A 1SJHA 5DJYA 3H7BA 1J05A 1KLGB 3OR7B 4ZTOH 1I9RH 4NC1E 3CSGA 1A8JH 1LK2A 1KLUB 1C08B 1N0XL 5HYJB 4RFNB 5BMFH 5ICXB 3BGMB 3E6FA 1BJ1H 3HPLB 1OAQL 3M17A 4J3VA 2R2HB 12E8H 4X4ZA 4XH2A 1F58H 1U91A 1DVFC 2XFXA 3SDCA 1S7RB 3O4LB 2VXQL 3UC0L 3HAEA 1NBZA 2EKJA 4GRLD 3PIQB 1AP2B 4ZODA 3VGFA 1JHKL 2BVOA 4K3DL 5L0QB 4LLAA 1DEDA 5ENWA 4S1QL 4PRNA 3RVVC 1OTUC 3OKLB 1HSBB 3QNXA 4JRYA 2EH8L 2H2PD 1LO5B 1KYOJ 4XRCB 3QIBD 5GS2D 3GIVB 4X8XA 4WRLA 1KC5L 5J6GA 1NFKA 1OM3L 3TYGL 3ZYIA 4JM2F 3U30B 2VUOA 4POYA 2Z31B 3GJEA 3BN9C 2VL4A 5JORA 2BY2A 4BFEA 2EH7H 4ERSH 3IVKB 1JNLL 2P24B 2XNAB 3O3EA 2OXGA 1UEMA 3HZKB 2OP4L 4TNWK 1U3HC 4XVTL 1BX2A 2M1KA 1AGBB 2WBKA 1LO0H 3OBAA 4RBPH 4OF5A 4LBEA 4GQ9L 1UADC 4CW1B 3HI5L 1MFBH 2E9JA 5FM5O 3MRNB 4XCYA 1FIGH 1NL0H 2FYYB 4GSDL 3C60B 2ATKB 3DRTB 5J57B 4S1SH 3RZWA 1X3DA 1ADQL 1A7QL 4OB5H 2PYED 5GSVA 4NHUA 1OP3K 3SBWA 3EYOB 5AD0A 2H32B 3VXQA 3PDDA 4XWOD 2EDNA 5M95B 1TZHA 2WBJB 5BV7C 3KAAA 4ZFOL 2DQEL 2V5RA 2EE6A 5EZLB 3DVFA 3MC0A 4NQDD 5SX4I 2W92A 1RHHA 1U8LA 2IANA 5DJAB 1UM5H 4X5LA 1WWWX 4I4WB 3KXFD 3CUPA 3MR9B 5SV3A 2CLRA 4Z7VE 4D0BA 2EDJA 4CVXB 4P57A 4QT5B 3Q5TA 4ZOAA 3A0OA 1OAYL 3HS0B 3SE4A 2BOCB 4L3EA 2ARJA 5D72H 3VMNA 2GFBA 5E9DD 1EXUA 3RVXD 1QLFA 1V05A 1LWRA 4P9HH 2X6MA 1CFNB 2ATPB 3P77A 4HPOH 1Q0YH 2DI7A 5F7FA 5F9OL 3GSWB 4YFLI 5CCKL 5D7JD 1E0OB 4R96A 1HIML 4YHLH 5E2TH 1UB6B 1OTSD 2KZ1B 2P45B 1I3RA 5BZDA 1TDQA 2O93L 1Y6MR 1OAZH 1W0WB 3E3QE 2FEEI 5EC2A 1KYOK 3CU7A 3ULUL 5HDQL 4WV1B 3SDXF 3EOTH 4HAGA 32C2B 2MPAL 4X6BB 2W9LA 5IOPA 1PZ5B 4ELMF 1NDGB 1U8QB 4PJAA 3SDYH 3QUZD 2V7NA 3RAJH 2IGFH 5CZKA 4NC1C 1FP5A 2DQHH 4P4KA 5KTEL 1R3HB 1HHKB 3VE0B 3UBXI 2PW1B 4HV8B 4PRHD 3U48A 5E24E 3HCVB 1FC2D 3SY0A 1LK3L 3NPZB 1CVSC 1B90A 1S7SB 3AMLA 3QQ9D 4LNRA 2MKWA 3BO8A 4WY7L 4MA7H 1IGTA 4S1RL 4NKDA 2VQTA 2XRAL 4QY8A 3S5LA 1HILB 4ZS7L 4JFDE 4XCCH 5DRWB 5K33A 3DYMA 5GQBA 1KN2H 2DLGA 3CPLA 3VGAB 4NO3B 5T1KA 1EH9A 1E4XI 1R3LA 1U0QA 4F37K 5C6TH 1I3VA 2DF3A 5IMKA 2A6IB 3QXUA 1MHPH 3DARA 1TQCC 5HDBE 1NMAH 2VLKD 4B5EA 3BX7C 2ZCHL 3QDHA 5E2VH 5FCUH 5KVFH 1E6JL 4QEGA 2ZKHH 5DD3L 3SJVB 2HTKC 1FAKT 3LN4B 3TZVB 3DX9A 5FO7A 1IBGH 2DN7A 1FYTA 4Q0XL 5HGBB 5IF0A 3C6LA 2OJEB 1YA5A 3QFJE 4M62H 2QQLL 4R6UA 1AO7E 1W72H 3L3JA 4U1JB 4BUGA 1J0KA 4X6DA 4YXKL 1TIUA 1KCKA 4K94H 3RWCB 3BHBB 1UC6A 1ZVYA 5CAYB 1D6VH 3MYJA 3MRJA 4G8GD 3ZKXB 2DMBA 4C54A 4GAYB 1I9JH 1EEUA 4ZSOA 4OJFH 3RZCC 4JPIA 1L7TL 3LS5H 3MV7B 2NX5A 5J4MA 3OKEB 1JZ7A 3PUCA 3QQ4A 3UMTA 1PY9A 1JGUL 1RZIA 4KROD 2IG2L 3QXTA 2VL5B 3MBXL 3D39E 4JY4B 5D6DC 3DWTA 4LPTA 3HRZA 1ZLSL 1CD0A 3QG6A 5LVEA 2IADB 5K9JL 4L8SC 3QNYB 1XCTB 5I76B 2YPLD 3FRPA 3MJ7A 1J8HE 4HKBA 1OB1B 4NZTL 1RD6A 1PKQE 5HPOA 1P1ZA 3U36A 1BVLB 4ZNEA 1SBSH 5EZIL 3VGGA 1QSEA 4BYHA 1KB9J 3LKQA 5I9QB 1RULH 4K7FB 4IHOB 4HXAH 4JFYB 4R2GC 5HYQB 2AI0L 3N1FC 4XCNA 4LSVH 3N85L 1KG0B 4NWTH 1ZWIB 5C0AA 1QHOA 4R3SB 1EVTC 4Z7WF 5FEBA 2QL1A 4TNVK 1J7VR 1T1WA 1S8DA 4LLMA 3EGSA 4NKOB 3SDAA 3HE6D 4UI2A 4ETQA 5ADOH 1A5FL 4IDLA 1KCRH 4LSUH 3CFCH 4XP5H 4GG8A 1MAML 3E3QC 4TVPE 5H8DA 1F2XK 1QFOA 3DXAB 2VSCA 4F7CB 1BQLL 4GMSH 4KDTC 1U3YA 4B41A 3BD4A 4JCLA 4IMLB 2W0FB 3BFOA 35C8H 4AG4L 3BP6B 3BDXA 5FKAA 3ALWA 4WHCA 5E6ID 4J3OC 2V2XA 3CH1A 2P8LA 4XCFH 4G7VL 1F6LL 4JN1H 3VD4A 4HC1L 3KJ4B 3QG7L 3L3GA 4YK4B 4O02L 3JV4B 5DEZA 5C8JA 4JPWH 2RHEA 1GHFH 4XP1H 4YO0B 5BV7L 3VH8G 1FL3A 1ZS8A 5FO9A 4FQPA 3ZT5A 3C5ZA 1YN6A 1JPSH 3W39A 4GQPH 2CJUL 2CXGA 2F53D 4LGSB 5JTWA 3TN0B 5JDSB 2DIAA 3BE1H 5EBGA 5IGXL 3R1GL 4M93C 3PJSA 3MV9E 3Q5YA 4GW5A 1TVBB 2CIIB 4QXUH 5JUEH 3Q6GL 2H45A 2WK2A 4HWEH 3UTSD 5GRUL 1A6ZA 3GJFK 2JCCA 3WS6A 1MCCA 4YBHA 2NXYB 4GBXB 3I02A 1NCCH 1HNGA 1QUNA 3TT1L 5ABDE 1I7RB 1KFAL 1MJUL 2NXZD 1HCVA 2ICWJ 1UZ6F 3WDHA 4L4VA 4G80A 4WW1A 4Q9QL 5IESL 1J12A 4JY6A 4YHIA 5KSBE 4K7PL 1L6ZA 5HGGS 4DAGH 1PKQA 1KB9K 1Z2KA 4JY5H 4LLDA 4FQ1L 5I2IB 5FECB 1MFEH 4LIQL 5FFLA 2P5WB 3CCHA 3T0DA 4EUPB 3B3IA 25C8L 3DBXB 4MCYA 3KPMA 4RFEB 2ZPKL 4OCMC 4WHYG 4R8WH 3ET9F 3PHSA 5A2LH 2YXFA 4K94C 3SDCD 1P4IH 2YR3A 2OTWB 5LGKA 2P48B 3WS6C 2MCPH 1U93A 4U1GB 4D0CB 1CE1L 4OZIA 3FO9B 1IJ9A 2ZSWA 3B9KC 5MP6H 3L3OA 3JUZA 3T04D 3PE9A 1U8OB 4P46A 2FJGA 4DKEL 4DZ8B 3VXUB 3Q48A 3OX8A 4KKNA 4GMTH 4FTVB 1X9QA 4JEGB 1S9YB 3NCYP 5FV1L 1KF9B 2XKNA 4ZTOL 4HBCH 1I9RL 1BVZA 1G7JB 1J0IA 2EYTA 2X1XR 1F42A 1CTNA 4Y5YA 1MWAH 2I07A 3TCXA 2WZPD 5BMFL 4FQHA 5I16A 1A6TA 5ICYB 2D0GA 3SOBH 3CFBA 1FNFA 2FBJL 3G5ZB 3V6ZA 3QZWB 1MH5A 1KB5B 3O3AA 4P46C 3BWUC 2F5BH 4E41A 3H9YA 2X4QA 4NUGL 2GK0A 1WFUA 3MRCA 4CN6A 4Q7DA 4Y4KB 1JP5A 4X4YB 3VDBA 5I17B 1A4JB 2YSSA 4PJCA 3D9AH 2R2EB 1XGRA 4DTGL 4LKXA 4PJ7E 5F89B 1KEMH 4Y5YC 3RWFA 3UP1A 1G9MH 2XG5A 1N2RB 3D0VA 1H5BA 5I73B 5IHBA 5CJBA 3ARDB 2ZG1A 4PJEB 3FFDB 4FG6D 3QIUB 4PY7A 1JYXA 5DQJA 1A7PL 4HMDA 3LKPA 3RKPA 3G04B 3KPOB 4FQIH 2VZOA 3T8XA 1PD6A 3WFBH 1T5XB 1N0LA 1MFBL 3LRHA 1YEIH 1II4E 1NL0L 1ZK9A 5TDNB 5FA3B 3RDTB 3P0YL 1HH6B 2X4UB 1J0ZA 4S1SL 1FGNH 4OB5L 1FAIL 1SM3H 3K1DA 3IU4L 4L3ED 1GGBL 3IDJA 2P8MB 3QI9B 1A7RH 1OPGL 1XZ0B 3GHBH 2ADJA 3WUWA 4V1DA 5FHBH 4RWHA 2QSQA 1MIEH 2MKLC 5E00A 5CIPB 2D7QA 1A9EB 3PNWB 2BSRB 3GBML 1FVCA 3I50H 1FO0H 1MCPL 2EXYC 4WNQB 1UM5L 4Y5VA 1UVQA 3PGCB 5DD6A 4BH8A 6FABH 4NJ9H 3U4AA 1NCNA 4XXCA 4PJDB 3QUYC 5I1GL 2MNUA 4XHJD 3GIZH 4JE4B 2YA1A 3L5WB 4HFWA 4NRYB 5HHNA 5LQBH 4P4KD 5FM5M 4JFXA 3P3YA 3QJHB 4U1NA 1DDHB 3VU2A 4O9HH 2DM2A 5D72L 2I25N 3MRLB 3RIAK 1PDKA 3RL1A 4ODTL 4ZS6D 1JN6B 4MWFB 1JBJA 4XNZC 2VDRH 4HPOL 4Q2ZA 4HCRA 3EZJB 1Y0LA 4RX4A 4YHLL 3JZ7A 4P3DB 5E2TL 4NFDA 5FAAA 1BQHA 4XPHL 1MWAA 2X4SA 5C0EB 1OAZL 5KANI 3ZE0F 1KJ2B 5T1KD 1CU4H 3EYFA 3KLHC 1F8TH 3T2OA 3VFGH 1BOGA 3TO4B 3EOTL 5EUOA 1ZHKA 4K71B 4KKLC 4WWKC 3SDYL 3RAJL 2BJMH 5ITFA 2IGFL 1NMCB 2DQHL 2ZSVB 1PJ9A 2R4RH 2R1YB 1LILA 5B3JF 3CFDB 3CXHJ 3CMGA 4MLSA 3UTZB 5DK3A 1CD1B 2GJJA 3BRGC 4OV5A 4YLQT 4DKAA 2YBRA 4AQOA 5IJVA 1CDGA 2R1XA 4MA7L 3O6LH 3Q3GA 1FYTD 2AV7B 4QGYA 5FKPB 3RIFK 3C6LD 1NAKL 1QO3B 1VGKA 4PRBA 1JV5B 2YD1A 4XCCL 5DD0H 2V17L 5JW4M 1KTDB 1NAMB 5EBMB 5FYLH 3BMVA 5C6TL 4OCSH 3DMMB 4L4TB 5FUOH 2IBBA 3FQRA 3NPSB 5F8QC 1JZ3A 1YC8A 1BFSA 1MHPL 4Z7UA 4KI5D 2NX5D 2DLTA 5FCUL 4AIZB 3CXDH 4DN3H 1N59B 2FRGP 2NYYD 2IBZX 5KVFL 1UWXK 2OZ4L 5DJ0A 4FA8A 2PYFB 2ZKHL 5FYLE 2EDRA 4R90H 3JV6A 3S88L 4LCWD 5HGAA 2Q8AL 3TA3A 2EE9A 5FV2A 4DN4H 1MI5E 5F7YC 4M62L 1W72L 3C87A 3BKCH 4K94L 3G6AB 4U1LB 5JOFA 1AGDB 5DJDA 3JVGA 3SKUD 5EZOH 4FQXC 5BQ7A 2NY6C 4RIRA 5I1DB 3RGHA 5IEHA 1D6VL 2FR4A 1A3RH 1I1AC 2W0LA 1R5VA 3BPNC 3RWJB 4Q74A 3S4SB 1QSED 5C0BE 1I9JL 4RQQB 1Z9LA 1Z6JT 4OJFL 4L3AA 4OKVA 4RZCA 2CR3A 1XIWA 2YKLH 1FO0A 5CSZB 4NBXB 2KBGA 3LS5L 5EO0A 4PREB 2Y23A 4Y16A 1ZGLP 1JF1B 4K8RC 1QPPA 1SVCP 3EO0A 3MRHA 4UBDC 5C0AD 3P4NA 3QEQB 43C9B 5B8CC 4NQEE 5CLWA 3TA3C 4OFVA 3GMNB 2EDDA 4YHNA 4S10A 3SDAD 3FTGB 5CZVH 4JO1H 1B88A 2J2ZA 3QEGH 4JPKL 1Z3GL 1JGEB 3LSOB 1MJJA 5D2LA 5E99H 4ZMAT 1X5FA 1SBSL 3NIFE 1BGXL 1KPVA 3WIFB 5C07E 5HI4D 3CXHK 5FF6A 1RULL 1LEKA 1A7BA 4HXAL 6CGTA 3HUJB 4LSVL 5DURD 4NWTL 2CR6A 3NFSL 2VC2H 4IRJC 4M8VA 4HGKC 1FCCA 4LEXH 4V2CB 3GJFB 3BAEH 5ADOL 1KCRL 2E27H 4XX1G 3H42H 2A73B 2VZVA 4LSUL 2R4SH 4A6YB 4XP5L 4W70A 3OXSA 3FT4B 1AHWC 1CBVL 4NWUH 4OT1H 5T5FH 35C8L 1XFPA 4MA3B 3OAUH 2CQVA 3RY6C 1CXLA 2QV2A 3QHZH 4XCFL 5DDHB 1ED3A 1H8SA 4O58H 5EOTB 5IMMA 1BFTA 4JN1L 5K59F 3CFEB 1JF6A 3FONB 3OJDB 2IAMC 1FIEA 1C12B 4JPWL 3VXSA 1GHFL 4C4KT 1YEEH 4WCYH 3SGDI 4YDVB 4E5XB 5F7LB 4PRIB 4L4VD 3X13B 5DRXB 1JPSL 3ZTJH 4Y7MA 4YWGH 5F6IC 3P2TA 3R0MA 4UB0L 1ITBB 4XNMA 2HLAB 3BE1L 5C0BA 3BH8B 4MMXC 4WTWA 1N3NB 1O5DT 4HKXB 5JUEL 1BJ8A 4HWEL 4M9PA 1JWSB 3MPCA 4JLRB 4R26H 3E0GA 1AE6L 3BUTA 2I9LB 3OKDB 2JJVA 2BP3A 4YH6A 3NFPB 1NCCL 4JHZA 3QDMD 3ZKSD 3E6HB 5JOPE 3F12B 4UDTA 1MFDH 4F7EA 1VFBB 2BOBB 3C09C 4OLUH 4C56D 2YC1A 2OBGA 5J9PB 3DOSA 4DAGL 2CKBH 4L4JA 2BFVL 1MFEL 2XZQH 5C3LD 4X6EB 4HQQH 1BQUA 4MD4B 1T20A 4NUJA 5HHVH 4R8WL 1YEDA 3HNTH 1KPUA 1TZIB 4ZUWA 4AL8H 4H25B 5T3ZH 4CMHC 1PX4A 5J11C 1G7IA 4HS3A 3W9DB 1HH9A 1PY4A 3VFVB 4X98B 1S9VB 5ITBH 1UKTA 4XNXL 1ONQB 4GMTL 1CFTB 2DWDA 3ARGC 3IDUA 3W82A 2ICWB 1ZKAA 2A0LC 4I48B 3U0PA 5BOZG 3ILQC 1VPOH 4BELD 4HBCL 4FXGB 1BVKB 3WEXA 3T0EB 3V52H 4YDJA 2VWEE 1MWAL 5LG1A 3GMLB 2PTTA 4PJIA 4HK3J 4I0PA 2IMNA 3AFLA 4KTDL 4IIQC 3K8LA 3S36H 4O2FA 1P69B 1RZKH 4MJ5A 3SOBL 1IC4H 1WBYB 2NW3B 4EXKA 2C1PB 4GRWF 3BXNA 2F5BL 4WW2B 5F1KC 2Z93B 4XMPH 1WT5A 4WFHE 4AEFA 1CYGA 4NFCA 4TUJB 5BJTB 2ICEB 4Q9BA 3O2DH 5I8EB 2HAZA 3S96A 1D9KC 5EU5B 3WO4C 2XICA 5A43C 3G6DH 3QULB 5ESQA 4QRPA 1I1CA 1IAMA 4EQ2A 5KZCB 1G6RL 5D96B 3TO2A 1KEML 3EYVB 4DVBB 3HLAB 4Y4FA 1SJXA 1I7UA 4V1DD 5LWYL 4OF0A 4P2RE 2SEBA 3JV0A 1FFOA 3TBSA 3QJFB 1PAMA 1VADA 2VZTA 4UOW0 2VITA 4U7MA 4X80H 3PWNB 2HT3C 1V3LA 4FQIL 4KXZH 5DFVC 2HA1A 4JZOA 3WFBL 3BSZH 1QG3A 1B4JH 3FQTA 1GZQA 4YQXH 3D6GA 4K8RL 1YEIL 1D6EB 4OI9A 4JFEE 3TLRA 1ND0A 1SBBA 1HI6A 4LHUG 4EN3A 3NIDF 3WD5H 4HUVA 5CILL 1SM3L 2R0ZL 1VFAB 3DUSB 3MV11 3V7AG 1UKSA 1SMAA 3SO5A 1T83A 1KCLA 1DUYA 1A7RL 1MHEB 5EPMB 3MJ8B 2NTSP 4Y4FC 2PYEB 3GHBL 3PABA 4JAMA 3LKNB 5FHBL 5GJTH 3R06B 3JTSB 5F9JA 1ACZA 1D5IL 1MIEL 1R0AL 2IPTH 3C5JA 4RX4D 5FCSH 4PV8B 5CWSB 3QNZA 4XXDA 1MCDA 3I50L 2QADD 4UUJB 4Y4HC 4PUBH 3LQZA 1KSRA 4PBVC 3DX7A 3ZMRA 4Z5RA 3GIZL 4QCIB 3SGKA 4OLVH 4PJ8B 5LQBL 5ESVB 3WDJA 1LE9B 2Z8WC 3GMPB 4N5EC 4PGBB 4O9HL 4N0UB 5D7IA 1OWRM 4OGYH 2Z35A 1A1MB 4LCCB 1UGNA 3IJHB 3RUGB 5IKCB 4U0RB 2R1WB 2FH8A 4MHHI 4GXUN 3UTTB 2DQJH 2VDRL 4Y5XB 3H9HA 3FQXB 4B7LA 3SDXE 1YYMH 4DUXA 1OGAE 3BUYA 4MNGA 4ELME 1S3KH 2Z8RA 5SWSE 4OAWA 4U31A 5E95B 1T1YB 1CU4L 1B4RA 5I71C 1F8TL 1OSPL 3VFGL 5L8LB 3QXWA 2BJML 5E03A 1JWUB 2ESVE 2Q76A 5FA4B 2R4RL 2VWEC 2BSED 2XT1B 4ZUSB 5FUCE 3IDYB 4NT6A 1IVLA 2CDFA 1CGSH 3WLBB 2BSTA 1KBGH 2V7HA 5I6XC 4YDLC 5HHMB 2CO6B 2WINA 3DRQB 3O6LL 4BSVA 2OL3H 5GRYA 2O5ZH 5DD0L 3O8XD 4XPTL 2NW2B 1N8ZB 3K8MA 2HRPH 4U6HB 4KQ3H 4JM2C 5FYLL 1RZKC 4OGAC 3B2UC 3OHXA 4OCSL 1JNNL 3L6FA 3RVWD 3KPRA 3B8SA 4K3EH 5F1OB 5FUOL 2UUDK 2PNDA 4U4BA 4CVZB 1JTTA 1CGUA 3FB5B 3QXVA 2CGRH 1OT1A 1SMOA 1XIWD 3ARFC 4APQC 5KS9E 5IFJB 3CVHH 4U0QB 2QTEA 3VFOA 2ZUSA 4Y16D 3CXDL 4DN3L 4OF8A 4P2OA 3FT2B 4LKCA 2DM7A 3SKMB 1BZ7B 1KULA 5CBEA 5ANMA 5IB1A 1DBBH 2EDFA 1BP3B 3RTQA 4Y2OA 4PR5B 2VDNL 1T6WA 1SEBB 2LAGB 2VZSA 3VFTB 4Q9RH 3BKCL 1JCKA 3MRIB 5EZOL 2X10A 3F62A 2XY1A 5KSAB 3SE9L 1BMGA 1A3RL 4C83B 5AAWA 4HUUA 4PG2A 2HG5A 1T7ZA 5CEZE 2YKLL 1NFDA 2EICA 3V0VB 3NIGF 3QDGB 1T22B 2Z8SA 2XZAL 2PF6A 1MF2H 4H0HB 3MXVL 5DQ9A 5D9SB 4WO4D 4YHYC 4XVJH 5CZVL 1CD8A 1GJIA 2NLJB 2Q3AA 4R0LC 3ESUF 3QEGL 2FJHB 5HJ3A 1CFQB 2Y06H 4G9FE 1QFUH 2FO1A 3VFPA 4DZBA 2BVUA 5EIQA 5E99L 1I8KA 3ULSA 5F9WB 3L3KB 1T66C 4PJGB 3DYOA 2GIYA 2JELH 3DX6B 1WBZA 4Z7WE 4KXZI 3IF1B 1W0VA 4PJHF 3QEHB 2IQAB 3V0WH 1OAUH 3U4BH 4TSBH 4IOIA 3GKWH 4ENED 2VC2L 1AC6A 3VXSD 4YX2H 2CRYA 4FZ8H 4YHMH 2QSTA 4LEXL 1K9TA 3D2UB 1Y18A 4HUKB 3BAEL 1TCRB 4TRPH 4TTDD 3O4OC 5T3XE 4JANA 3H42L 4N90E 3T77A 4ONGH 4TNVF 4Y2DB 2X4NA 4K55A 4HWZB 1LEGB 3O3BA 4OV6F 4NO0A 5KSUA 3MA9H 1FZMB 5JZ7C 1HE7A 4JFPA 4LASH 1EFXA 4NWUL 4UU9A 3A6BL 4OT1L 5JA8B 5T5FL 9CGTA 2OL3A 3IDIB 3FL7A 4D8PB 5FUCC 3OAUL 4XPGH 4PS4H 4X0KA 4KKCD 3QHZL 4MDIA 2BRQA 4O58L 1F4XH 2YD4A 4FOMA 4LSQH 1P7QB 5T1DH 2VUYA 3KLDA 3IAGC 3DUHA 5DTFA 3VH8B 3PWJB 4YHZH 5JW3H 2OXHA 1YEEL 3OJVC 3QCVH 3PP4H 2GTWB 2MSPA 4Y19A 1MUJB 4HIIA 4PRPB 1BEYH 4ZYKA 1T1XA 5DC0A 4LSTH 4CN4A 3REWA 5I0ZA 3FQWA 3V4PH 1A1NB 3KPNA 4Q6IC 3BKMH 4ZPTB 1OCWH 5AWNH 2XKUA 3BMWA 2W07A 5KVDL 4OTXH 2GJ6B 4MNQE 1UJ3B 4YC2B 5MEOA 4BFGA 1G7QB 3B9VA 4HW6A 4PJXF 1X4YA 1KJMA 3UTSB 1VERA 1BM3L 4X6CB 3ARBA 3GSVB 4JFFD 1JPGB 1QR1A 2B20A 4XAKD 5ALCH 1MFDL 2IJ0C 3WIIH 4OLUL 2CKBL 2K7PA 5C0NC 1FV1B 3MXWH 5E8OA 2XZQL 1QSFA 4HQQL 3VXRE 5HHVL 3CLEL 4JFHE 3HG1A 1YUHA 3MRBB 4AL8L 2YRZA 1WCQA 4Z77A 4KFZC 4JDTL 1KGCE 3IFLH 2AXHA 3OB8A 1OW0A 1OQOA 3FOMB 5EBWA 2GSIB 4FQJL 1RPQA 3NFNA 1MHCA 1DL7H 2XPGA 4AM0A 1YNTB 1G7MA 2MQCA 3CJJA 1GAFH 2DWEB 2HJKB 1VPOL 2H3NB 3KLAB 1LE5A 4PJ9D 4P5MA 3O9WD 3ZHDA 4RFOL 3MO1B 1RI8A 1R6VA 1XR8B 3MNZA 4DFHA 3FKUS 3T2NH 5D1QA 5EOCL 3WJLA 3M1BB 1K3ZA 2L0DA 3S36L 1EO7A 1RZKL 3W0WE 3SGJC 1L9MA 4XMPL 1RJLA 5JHDE 1GCFA 2BXYA 1XGQB 3X3FH 3GSUB 5E7BA 3DURA 1EHNA 3FOLA 3O2DL 1NANI 3CFKA 4IMKA 4EN3D 3C2AL 2OTUB 4KJWC 1MSPA 2J6EH 1CT8A 1X6LA 2MQ0A 1QLRB 3LEVL 4QTIH 2DYPA 4M7LT 3TVMC 2EDOA 3MLYH 1T80A 2XV6B 3QIWC 1KT2B 1P9MA 4X80L 3EHBC 4LMQE 4Z7OF 2BDNH 3BSZL 1B4JL 1F4YH 3MRFB 4YQXL 3RU8H 3CH8A 1GZPA 3G5VB 4I18C 4KU1A 3X3GH 5C86A 1IM3B 5JIPA 1RSFA 2MCG1 3DTXA 3V5DB 4GG6B 3N9GH 5T3ZD 5BS0B 2V2WA 3PQYA 1OQXA 4BQCA 3AMKA 1NJ9A 4D9QE 2HT4D 4HKJB 1RIVH 3V7MA 5GGRY 2F54D 1TXKA 5D71L 4OSUH 2XKSA 2HVJA 5GS0D 1A7OH 4D0DB 3U83A 2CMRL 1P9MC 5JMOC 3TJEH 5I66A 3FCTA 4WW2F 5D7SH 5GGTA 4NRXA 4OLEA 1XCQB 3D85B 3TESA 1A14H 3UYOD 1JIBA 5DO2C 1WEJH 1RZFH 4PLKC 5HHQA 3KPQA 4PGEB 1BD2D 4FXLA 1HKLH 3T4YB 1KUMA 1IL1A 2IALB 4QRRA 2DQIH 2NPLX 8CGTA 2EXWD 1IC5H 4OGYL 5ACZB 2AK4E 2GY5A 2VABB 1KTLA 2G9HB 2DQJL 2H32H 1K3IA 3ZE0E 4DFIA 2AV1A 3GO1H 4Z78A 1YYML 3OKKB 3ULVD 3EJYD 2R0LH 2UZYB 2NY0C 1S3KL 3STLB 3H9SB 4BH7B 3EYQC 1KIPB 5DUPH 5ISZA 1X5GA 5B3JE 2NR6D 3THMH 3KPRD 5C0JA 5JLZB 1ZGLA 3LH2H 1XR9A 4ODUA 4OGXH 2P5EB 4PJBB 2B0SH 3OPZL 3P0VH 1NLDH 4F2MA 1KPRB 2AEQH 3X14A 1OTUD 1U92A 1ES0A 4P2OD 1NMBH 1AR1D 1QSZA 4KK5C 3SCMD 3OAZK 3F58H 2E5EA 1CGSL 4MX7B 3KGRA 3TT3H 4GKNB 3RTQD 2J6EA 2OL3L 3VJ6B 3VXME 2O5ZL 4QHLB 2LTQB 3OR7A 3P40A 2EC8A 3H7LA 1AJ7H 2HRPL 3MOQA 2JB5H 4R4FH 4K23H 1RAMA 2ZJSH 1NEZG 4I9WE 5J12B 3NGBC 1KLUA 1C08A 2EEAA 5HYJA 5D7LB 3BGMA 5ICXA 3LVEA 3HPLA 3KNBB 1JZ6A 2XN9D 4K3EL 2R2HA 1IGYB 2CGRL 1YEJL 2PUQT 5DD1H 3CVHL 1S7RA 1RVFH 3O4LA 2ZUVA 4KK6D 1GIGH 3IDXL 3PIQA 1AP2A 2Q3ZA 3ARYA 4GKOA 5IW1A 4WTZG 5E8EB 3OKLA 1HSBA 1FDLH 3LKSB 5D1XC 5DA4A 1GOHA 1LO5A 4PLJD 2W65B 3LKOB 4Q9RL 4XRCA 4HLJA 3GIVA 1JZ4A 5DHXB 3MUJA 2B1HL 1FG2B 2HTLD 2QJDA 1WQVT 2UVFA 3V4UH 4W4OA 2Z31A 3PGDB 4PJFF 4LVHC 4MB5A 4DEPC 3K4ZA 3IVKA 2P24A 2XNAA 3HZKA 4HGWB 1AGBA 1MF2L 4YDKH 1CXKA 4FFWD 2HN7B 4CW1A 4L1DA 1QHPA 2D7TH 1KN4H 2W0PA 3FO0L 3MRNA 5ELIA 2FYYA 1INDH 1ZT1B 2ATKA 3C60A 2C3GA 1LP9B 2NY3B 3DRTA 3IJSB 3QAZB 2NY1B 2BVQB 2Y06L 1O0VA 1QNZH 3PWPB 4P2QE 4NO0D 4PY8J 1C7TA 3EYOA 5FYJU 1GGIH 2H32A 1EFXD 2X4PB 3LRSB 1PLGH 1T21B 2WBJA 3IGAB 4XMKH 2JELL 3NABH 1I8LC 5EZLA 1MCWM 2EDLA 3AREC 3ETBF 4XNYH 3V0WL 4YZFF 1NCTA 4Y0GA 5JPMB 1OAUL 3U4BL 4M7KH 2DLIA 3GKWL 1HHIB 4ZD3H 5DJAA 5I1LB 4I4WA 3EKCA 1RUMH 4YX2L 3KS0H 4YHML 2FWOB 4ONFH 3C60C 4TRPL 1A0QL 4CVXA 4D3CH 3OKMB 3ARSA 2WP3T 1WBXB 4QT5A 1U2HA 4ONGL 4Y19D 2IH1B 5J13B 3NBNA 2VKWA 1VEMA 4HHAB 1OTTD 3HS0A 4JDZB 1W2KT 4L29B 2DKUA 2BOCA 2VH5H 4LASL 4XI5C 1EERB 4TYUA 4BKLB 2FIRT 1CFNA 2ATPA 4OZHE 4XPGL 3GSWA 2I5YH 2HVKB 3DI2B 4JQVA 1UB6A 4I5BB 5FYJE 4LSQL 5T1DL 1WWCA 2PR4H 3ARBD 3TV3L 1W0WA 5E70A 2LABA 3FB6B 5JW3L 5L8JB 4WV1A 2ZUQC 3QCVL 4X6BA 32C2A 2C3VB 3MJ6A 3PP4L 4YHKH 4PTUB 4ZXBC 1PZ5A 4OLZH 1NDGA 1U8QA 2R2CA 2Y9RT 4QXWA 1BEYL 1R3HA 1HHKA 3VE0A 3EW3B 2PW1A 4HV8A 4TN9A 1SYSB 4LSTL 3HCVA 1QSFD 1KIQB 4JGMA 4GG6E 1OCWL 2DDQH 3DVIA 1DQQA 1S7SA 3HG1D 4FMFA 4KRPD 5C9JB 3MCLH 3HE7C 4OTXL 4GLRI 4L8CB 1ZVHA 3P9MB 4DK6A 1G7PB 2EEDA 5D8JH 3CZFB 1CICC 3KPSB 5BRZB 4NO3A 4R97B 2H1PH 1XT5A 1FL6B 5ALCL 5K93A 4OZFG 3B5GA 3OL2A 4RCAA 5T1LB 4MAYB 4ONOA 2A6IA 1EUTA 3QCTH 5BVJB 4PJ5B 5IB5B 4DQOH 3EO1B 3MXWL 4I8DA 4JFZH 4EDWH 5IHUL 5D1QD 3A6OA 3SJVA 1YMMB 1LO2L 3LN4A 3TZVA 1JF5A 5AZ2H 4ZO7A 4MXWH 1K4DA 1T3FB 5HGBA 2OJEA 1F3DH 3MJGX 3IFLL 4U1JA 3T08A 2BX5A 3CC5B 3N0PB 1B9ZA 3RWCA 1S7VB 1NPUA 3BHBA 2JTDA 1CFSB 3L3HA 5DMYA 3UDWA 1DL7L 3LIZH 4JPVH 4MD5B 5FYKH 5DXWA 5DHVH 1Q94B 1BLNB 1CIUA 2ZOLA 3BP4A 4NKMA 5L2KB 2DL9A 2FBOJ 3MV7A 3OKEA 3NCJH 4HJJH 2ZCKH 4GRWE 3UZEA 2J7LA 4KC3B 4P23C 3T2NL 2VL5A 3HMXA 4JY4A 4PJBE 1A1OB 2VLJE 1AIFB 2Z92B 3BESR 1TMCB 4EUPH 5TFSH 3RWGB 2X1QA 3VWKA 2IADA 2RCSH 4H88H 2Q7NA 4LNVA 1RIUL 3BGFB 3QNYA 1XCTA 2RJMA 5I76A 3BD3A 2NZ9C 1OB1A 3X3FL 4NZJA 4NN7C 1BVLA 3QDJE 2ZOKA 5CSGA 1RUAH 3PGFH 4OGZA 2AJUH 3J7HA 2DQGH 2D4FA 3PQYD 1MCRA 1JPST 4XBEH 4K7FA 2J6EL 3O6FC 2DLEA 1XGTB 4IHOA 1IQDB 4JFYA 5HYQA 1FBIH 2HFFB 2IWGA 1KG0A 2B1AL 1ZWIA 1U2CA 4R3SA 2FH6A 3PL6C 3VFRB 4YDIH 3VWKC 5IQ9B 4NKOA 4LRIA 5DZOA 3MLYL 2FL5A 3GMRB 4H20H 1ITCA 4YNYB 5C08B 4WGVB 1A3LH 1OP3H 4UV7H 3NIDE 1P2CB 5ID1B 1F11A 2BDNL 3DXAA 5HI3D 5DVKA 1F4YL 4ODHH 4F7CA 1UYWH 4LHUB 1DR9A 5SWZE 4IMLA 2W0FA 3N9GL 5HI5D 1MCSA 3BP6A 1ZT4B 2VXUH 1Q9WB 4QHUB 1U42A 3I6LE 4H8WC 2OR9H 4NCC1 4QRRD 4WFED 4F8QA 2O5YH 4LLUB 2GW5A 3D69B 3N1GC 3FQUB 3KYMB 1N6QH 2DTMH 3ARRA 3JV4A 4OSUL 1ZA6B 3KG5A 5B4MD 3FQNB 3WE6B 2VIRB 4HKZA 1A7OL 3EBAA 4Y8AA 4YO0A 3RGVC 3SDDB 1EPFA 3CDGB 4LLQB 3TJEL 5DEGB 4F15C 1DTUA 2UVEA 1JZ5A 5D7SL 1H3XA 4YFLF 3WJJC 3BKYH 1A14L 4JVPA 4TULH 5ISZD 4JR9H 3TN0A 5JDSA 3I6GB 1WEJL 3D18B 1RZFL 4FFZL 4IRSB 2NNAB 3TBWB 1HKLL 3D39D 1CGVA 1TVBA 2NY2B 1GSMA 2CIIA 3PV7A 5E1HB 4G9DA 2DQIL 2OX5A 1IC5L 1YEHL 3TH3T 4MDJB 5I15H 4GBXA 1JK8B 1I7RA 4JHWH 1S7XB 3DNKA 5F72S 1S5IL 1CLYH 5CD3B 5EG6C 2UWEB 3RVTC 4ZNCD 4EIZC 5I2IA 4N0CD 3OKNB 5DUPL 5FECA 3QUXB 1J18A 2P5WA 1A22B 4NN6C 4EUPA 4LFHD 5HYJD 1A2YB 2FECL 3DBXA 4RFEA 3LZFH 3THML 4AIXA 5K9OB 5I1IH 4S2SB 3A67H 1ZHBA 4OGXL 1N6UA 4MXQD 1EHLH 2UYLB 1CN4A 3KVQA 3F7YB 3P0VL 1RU9H 1NLDL 2OTWA 4D0CA 1DQLL 3EYUH 3FO9A 3KYAA 2F15A 2Y5TB 2VXVH 1U8OA 1X5LA 3F58L 2XQBH 2Y25A 2ADFL 4TVPD 3VXUA 4DZ8A 4WDIB 3D3VA 4FFVC 4L9LC 4LPYA 4FTVA 4R7NB 4RGNE 1S9YA 3MA7B 1CF8H 2CUHA 1IAOB 2H6PB 4D2NA 3ZKMD 1RK0A 4NQSB 3KJ6H 1AJ7L 5ACLA 3VRLF 1N26A 4R4FL 1G7JA 1H15B 2VQUA 3O8XB 4QXTA 4JRXE 5A3ID 4CAGA 2AXJA 2Z31D 1RIHH 3KHQA 2WUCL 3KYOA 5LBSH 3ZSSA 5ICYA 4HIJB 5IB4B 1QRNB 2D4DA 4PJAF 1MLBB 1QVOB 3G5ZA 1NBQA 2XWJB 3K2UH 5C09E 3D0LB 1M6OA 3QZWA 3ZO0A 1GL4B 5DJ2B 5CHNB 4NQCE 4ODVL 5IW6B 3UTPE 2AERT 1FDLL 5F70A 4Y4KA 2I9TB 4KJQC 1UACL 5I17A 2E7LA 1G9NC 1FSKB 3HB3D 3HKFA 1A4JA 1HNFA 1U8IB 2BNQB 2R2EA 4IS6B 1FFNB 5F89A 2ZUXA 4X5XA 4Y89A 1K8IB 1IT9H 1N2RA 3NIGE 3V4UL 5AZEH 2NY4C 1NAMH 2WBJD 1ORSB 1UT9A 1QYGL 4WFGE 3SKOB 3ARDA 1CDIA 4IOFC 4PJEA 3DETC 1RZ8A 3QIUA 4M61B 5IB2B 3DYPA 4U1MB 3IRPX 3FFCE 2WW8A 5E94B 4GAGH 3G04A 3KPOA 1C16B 4ZOEA 1T5XA 5ECJE 3MV8E 2D7TL 1KN4L 2E7LC 2XTJB 2R0WH 5TDNA 4WO4B 5FA3A 1MRDL 5ESAB 1T89A 3S9DB 1HH6A 2X4UA 4L3CB 3GI9H 3HZYB 5I0DA 1D5MB 2D3VA 5DSCA 2EEBA 3MZGB 4I3SH 4KZDH 4PJHE 3BDYH 4X6DF 2VDKH 2YWYA 3C8DA 5EH1A 1GGIL 2P8MA 3QI9A 4ESKA 4S1DC 2BMKA 1PLGL 4XMKL 5AG9A 2LV4A 3MBEC 5IT2L 3RP1A 3OB0K 1AXTH 5AYUH 3WUWG 3FMGL 3HFMH 2F74A 3RWDB 3WS3B 5DT1H 4OIIH 4XNYL 5CIPA 1JMZA 4U6XB 1A9EA 3PNWA 2BSRA 1BJ1J 3RX5A 4M7KL 3U82B 4KI5F 2AGJH 1QPXA 4WNQA 4ZD3L 2FHBA 3PGCA 5ICZB 1RUML 4U33A 2VDLH 3DHMA 4ONFL 4PJDA 1T0MA 1T89C 3VFUA 3MUY1 2CXKA 5DFWH 3FJTA 3CX2A 2LU4A 3L5WA 4LVEA 1NUGA 2JK5B 4NRYA 3QPXH 4U6VH 3QJHA 1DDHA 2VH5L 1BJMA 3MRLA 3P73B 2DTSA 2PXYC 1S7TB 5B3NA 4ODWB 2EE2A 1K4CA 4F9LA 3D5OF 5I1HL 1JN6A 5IBUG 4EI5C 3ZKND 4MWFA 3GZKA 3AUVA 1NGZB 4JZJC 4FNLH 3F65A 3UTQB 3SKJH 5CGTA 4P3DA 4UINL 1BIIB 2C7UB 1FCGA 2F8OA 3VI4F 2AKRB 2PR4L 5C0EA 1KJ2A 2AJ3B 2FSEB 4RGNC 1NGPH 4F9PA 5D5MF 4BQ6A 3BIAX 2VLRB 2YA2A 4IRZH 3TO4A 1T4KB 2FIKB 4OLZL 3LDBB 4FABL 1LDPH 1HQRB 2WWMC 2ZSVA 1FZJB 5EWIH 2R1YA 1J1XH 5JXEA 1QBAA 1R3IH 2VQ1B 3CFDA 4PJXE 3T4AB 3UTZA 2HFEB 5IVXB 2YN5A 1CD1A 1ZAGA 2DDQL 2YRLA 1B3JA 2C4XA 2DOCA 3SJVD 1OL0A 4KPHH 5D2NB 3RWIB 4BQ9A 3TZVD 4KGJA 3MCLL 4P5TB 5FKPA 1D5BB 1KIRB 2VTFA 1QO3A 3O41A 2OQJB 3RI5K 1I1AD 1JV5A 1G1CA 1GRWA 3I75B 5D8JL 3PWVB 1KTDA 4HH8A 5E1AB 3VWJC 4UT9H 1E4WH 1NAMA 4F9PC 4AEHH 1VEOA 1YQ2A 2H1PL 4CRPA 4ZTPH 3E2HB 1G6VK 5DJCB 3DMMA 2G5BB 4L4TA 2DIBA 3MFFB 3NACH 4FMKA 4LSRH 1CK0L 1G1YA 3BKJH 3DIFB 3QCTL 4URTB 1R5WB 4WENB 1A02N 3MV7D 5EU6E 5JXEC 3AU1B 4G3YH 3BQUC 3OG4B 4AIZA 4CKVX 1N59A 2PCPB 4LCUB 1MCKA 1C1EL 5EFIB 2PYFA 2IBZY 3GNMH 4GS7B 3FT3B 1GC1H 2X89A 1PVHA 2AS5M 5AZ2L 4RA0C 1E4KC 5GS3A 4MXWL 4GKZA 3RX8A 1QLEH 4JQXA 1K5NA 1DJSA 3CVIH 4U1LA 3ZDZF 1JGDB 1AGDA 2FLRT 4ZFOB 3MSPA 1XGPB 2JCCF 4FFYL 4GT7A 4MJ2A 5I1DA 4QOKE 2J8UB 4MB3A 2PW2B 5GZNC 1EBAA 4PBWD 3RWJA 3S4SA 4XVSL 5JR1H 1Y6KR 3WKNA 4RQQA 3WCYA 3LRGA 4HUXB 5CSZA 4PREA 3NCJL 1JF1A 4HJJL 2ZCKL 4HSQA 1Q0XL 3QEQA 5LGJB 43C9A 3HRPA 3O9WB 1CDYA 3IKCB 2ILLA 5HY9B 1YEFH 3GMNA 4O2EB 5I8OH 5TFSL 2WUBH 3VGBA 4M3JA 1Z9SA 3EDFA 3FTGA 2RCSL 3JWOC 4H88L 4NBYB 4PP2B 4JM4H 2BNRE 4MJIB 2AJSH 2MFNA 1DLHB 1JGEA 4RBPK 4OM0H 3LSOA 3LPFA 4ELKB 3DXAD 4OZIF 3MX0A 3EO9L 4JCMA 3VXNB 4Q9CA 2J88L 3WIFA 1JUFA 1M71B 1RUAL 3WLWD 2AJUL 2MJWA 3G08B 5C9KA 1DN2A 1G0XA 2DQGL 1YPZE 4XBEL 3SO3B 1ZHNB 4MA1C 2LU7A 5D93B 2IAMD 3MNWA 1G9NL 2ID5A 3T0VA 1K6QH 3HUJA 1Q72H 3LPWA 4UMGA 1JYWA 3BT2H 4BUHA 3TFKD 1DQTA 1AKJB 1WSST 4Z7OE 4OKDA 2CH8A 5GS1B 4YDIL 1X4XA 2NY5H 3GJFA 1FORH 5L2JB 2E6PA 4P99A 4A6YA 2A73A 3NAAH 1ZMYA 4UV7L 1L9NA 3TJHD 3FT4A 3VFMB 4ODHL 3TN0D 4I77H 2VAAB 1SQ2N 2C3HA 2WMPA 4O51B 3IU3B 2VSDA 4KH2A 1IFHH 2ERJB 4DWHA 3U46B 1XF5B 4XVUD 4KJYB 2VXUL 3QB7C 4MA3A 1F3JB 1W0YT 1PG7X 1QP1A 1CL7L 5DDHA 4Z7NF 1RV6X 5J8OA 3MREB 3O6MH 3CFEA 1OSZB 1U8PB 2NXYD 4GBXD 5JIKA 1KJ3H 4KKBD 5FYKD 1N6QL 1P4BH 2DTML 3FONA 3I6KB 1F6AA 1XAUA 3OJDA 4CDGC 5GS2H 2EIEA 1TPXB 4P2YA 1C12A 2F54B 4E5XA 5I75C 5D1ZB 4PRIA 1T6VN 2IPUG 3X13A 2FJFA 5DRXA 1PGRB 4OZGB 5GZOC 3WO3B 2PKDA 5C0CB 3EDKA 3PV6B 2PO6B 3BP5B 3DV6A 4JR9L 2P5WD 4XBPB 2CK2A 3BH8A 4Z9KB 4WUUB 4J3XA 4LGPB 3BJ91 2B4CH 1IAIH 3L7FB 4I0KA 4F33B 1N3NA 1X5XA 1JWSA 4JLRA 5IFHH 1MLCB 2I9LA 3U0TB 4NP4H 1NCDH 4MA8H 1LD9B 5DI8B 1INEL 5CP7B 4LOUC 3RHWF 4Y1AB 3NFPA 3VXUD 3E6HA 4JHWL 4FTVD 1WLHA 3F12A 4WI8A 2DQCH