4R7NA

Fab c2e3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
218
Chain Sequence
QVQLQESGPGLVKPSDTLSLTCAVSGYPIRFGYSWHWIRQPPGKGLEWMGYIHYSGYTDFNPSLKTRITISRDTSKNQFSLKLSSVTAVDTAVYYCARKDSGNYFPYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Robust Antibody-Antigen Complexes Prediction Generated by Combining Sequence Analyses, Mutagenesis, In Vitro Evolution, X-ray Crystallography and In Silico Docking.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab C2E3 Heavy chain
total genus 37
structure length 218
sequence length 218
chains with identical sequence C, E, G, I, K, M, O, Q, S
ec nomenclature
pdb deposition date 2014-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r7nA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r7nA01
4Y4HA 5J1TC 4OCXL 3QIBA 4YBHA 5E6YA 3DO7A 1FFPB 1JN6B 1RJYA 3MLZL 1NCBH 4NHCH 1CGYA 1QSEE 3GBNH 5HI4D 4PRID 3L5WA 1I8MB 4F9PA 4AIXA 4XC3L 5BCAA 1AXTL 4JLRA 1JHLH 5JPNA 4TTGA 4P9HL 5JR1L 3LMJL 5DJXA 5SWSE 5FYJH 3SCMC 4JFQB 1ZAGA 1YJDL 3MRCA 4K7PH 4RX4D 4LLUB 4YHPA 3GJEB 4L9LA 1AR1C 3VXPA 1JZ5A 5DDHB 2GK2A 5C71A 4MJ5B 3TH2T 1Y6KR 1IAIH 2VLJA 3QFJA 3FT2A 5HPMA 3SCMB 1B88A 1FNSH 1NMAH 4LSQH 3N9GL 5H94B 3ET9F 1YY8A 5EUKB 3PQYD 3SDCD 4JFPA 5EO1B 1QTYT 3B2UC 1XF5B 3ZKSD 4XNQB 5KW9H 3B9EA 5CCKH 3O8XB 4FXKA 5CMAB 1ES0B 2W65A 1B9ZA 2G9HB 2YUXA 5F1NA 1ITCA 4ONHB 3LHPH 5FECB 3DVNA 5D2LB 2AJXL 3BWAB 1MIMH 4OLVH 3QYCA 1KIPB 2V2WA 2GHWB 4NN5C 4OCYH 2DQFB 5ELIA 1A4JA 2K1MA 5C0DA 2H6PA 1Q0YL 1HHJB 2OI9B 3GSXA 2XY1A 5L9DH 2IFGA 1JNJA 1KCRL 2NZ9D 5E99H 3P4MA 5IM7A 5KS9E 3TIEA 4BSVB 5GGSY 4PGDB 1IVLA 2D7MA 4WEBL 1AH1A 1KTDA 5C0CD 5DFWH 4MXWL 4N0YH 2VXSL 4M43H 1A7QL 1FVEB 5GS2D 2NNAA 1C12A 4WO4A 3UP1A 1HI6B 2WAHA 3QUKB 3E6FB 1T2JA 2R2EA 4RA3A 4E41B 1U8JA 1T5XB 3GBMH 1VGKA 4KMLB 2A73A 2XKNA 3NN8B 2K7QA 1P4LA 3DRTB 1D5IH 2NY4D 3EYOA 1QKZH 2FZ3A 4OM0L 1KPUA 4F37F 5GZNC 3VFWA 3VFSA 4HIEA 4LLMB 3KPPA 1NUFA 1MJ7H 4Y5VB 2XFXB 4GBXD 1C1EH 5JMOC 1YN6A 3MROA 3O81A 2IBZX 4LDOB 1QLFA 3VI4E 3O4LD 5CEXA 1MJ8H 1NAMB 5JW3H 4X5XA 4ZPVB 5ADOH 4ZD3H 4GAGH 4BZ1L 3NZ8A 3EJYC 2AV7A 2IJ0C 4R4FL 1BHGA 3RDTD 5IJKA 4M8QA 3SDDB 2EYRB 5KSAB 2OS7A 1SY6L 4OZIF 2FNBA 4HJJH 4P3DA 2NZIA 4BQCA 3T3ME 5IB2A 4TVPD 3G6AA 3CVHB 2BOBA 2UWEF 3RVVD 1FBIL 4LK4A 2UYLB 4GH7B 1PX3A 2X9YA 4BZ1H 1X4XA 4UIKL 1LDSA 2DWEB 3NH7H 5JW5A 1UB5B 1KT2B 3LKRA 2B5IC 4GAJL 1FORL 3EOAB 3KYMB 3OL2A 3V7AE 3FONA 1MFBH 1OAZH 2VLRD 3V6ZA 2R0WH 5IR1A 1AI1H 3S6CA 2JIXD 1YNKL 3RDTA 1NFDB 2R4RH 2XRAL 3LIZH 2D0HA 5DEZA 3ZLQC 2OJEA 2AEQH 3SDCC 2FO4B 1NCDL 5H8DA 4N0RA 1OAYL 4FZ8L 4HPYL 3ZKNC 5I71B 5LAXB 1FZJA 2X4QB 1UFUA 3L9RB 1ZV5A 3VFGH 3P11L 5IEHB 5CZKA 4RISL 4NO0D 2R4SL 12E8H 1RVFH 3D69B 5I1DB 4LRIA 4FA8A 2ZUSA 3BZFB 3VDCA 1UKSA 3FCTB 3VMNA 1DBBL 2Z4QA 2C7UA 3TVMB 1I1AD 4YHKL 1YMHA 3R06B 4NQEE 1QSED 3B4NA 1IAOB 4BSJA 4XNMB 3QHZH 4UDUB 4XI5D 4YDVB 3FRUA 3SHSA 4JQIH 3I2CH 2WINA 4F58H 3EOBA 3EYFB 3KNBB 5IB3B 2E9JA 1X5AA 2VSCA 3MACL 4N0UA 4Y5VC 4R90L 1XF1A 4X9HA 5E70A 5FGRA 3RAJH 1AD0B 3IF1B 4M5YL 1TZHA 1NGQH 4GMTH 2DQCH 1FHGA 2NXZC 5MEQA 4G9FD 1IAMA 2N4IA 2YC1B 3BEWB 2BSTA 4Z7VE 2R9HC 1P7HL 5DQ9A 4DK6A 4KVCH 3S5LB 1YYLH 3UTQB 3JTSA 3I02B 5D2NE 5LBSH 5EU3B 2OZ4H 4AG4H 2XQYK 5HJ3A 4U1LB 5L0QB 1UM5H 3CPLA 4FQLH 3ZHKA 3WL9B 3PWUA 4FHBD 2Q6WB 2J8UF 2HLFD 1R5VB 2W60B 1FVCA 3F62A 3OKYA 4I3RH 1JK8B 5DHYA 2GITA 2VDPL 1GC1C 3V8CA 1ZHBB 1RZ7H 4N9GA 2I26N 4QRSA 4YGAB 3SPVA 4O58H 4JN1L 2AK4A 5DS8B 1DEEB 1UCBL 3EUUA 5F89B 5IVZA 1VACB 2FX9H 1ZHNA 4P46B 1ZLWH 2YBRA 1LO2L 3BPNC 2ZCLH 1WCBB 4WEUD 3O6FB 4JDVB 5DK2A 2F53E 4DTGL 3GRWH 1CLZL 3QQ9D 1KC5L 4HUXA 4ELKA 3LCYA 2QTEA 1Q72H 2EDTA 3HI1B 2LVCA 3NA9H 1IGIH 4EQ2A 1UM6H 1UVQA 3RWJB 3V6OA 4BFIB 3QFDA 2H32B 1KCKA 2BSED 2PO6D 3U0PA 4OI7A 3PIQA 3P0YH 3MBXH 1EXUA 4MJ2A 4Y7MA 3MNVA 4PGBA 1Q9WA 2X1OA 1R3KB 1FIGH 3WS3A 3CC5A 3T0ED 4YHZL 1ONQA 1G7QB 4P57A 4PJEA 4NNXB 4ALAH 1DVFD 3OHXA 5I8CB 2GIYA 5A1AA 1QSEB 2A6JA 4X4ME 3S3PA 2NY2B 1AGFB 4Z7UF 4JQXC 3RX7A 1H15B 4RWYL 5I30H 1LP9E 2WIIA 1UM4L 5F96H 2ED9A 3UTPE 3HC0A 3NIGE 2HKFL 4OBSA 1NCWH 4JANB 3IFNH 3TA3B 4LHUD 4K3EH 4RAVA 4HGMA 1YPZA 4X5WB 3BIKA 4ERSH 1A02N 1M7IB 5E6IA 3KGRA 5CEZD 3EYVB 2CLVA 3SDXE 1X7QB 4NOFA 3AS0A 2BNQE 4XNYL 4BKLB 4DCQB 2ICCA 4DZBA 3BVNB 2G60H 3PWPA 3ZE2E 3UBXG 1BIIB 3U30B 1JZ7A 1T1ZB 3IKCA 2Q86B 3BRFA 4HH9A 5CKAA 4QT5A 5TH2A 3KLHC 1CL7L 3MXWL 5HYJA 1ACZA 3RNQB 3E1F1 1G6RA 4YE4L 2V2TA 2R8SH 2VITB 3QUMH 3L6FB 1Q9LB 3S5LG 1UH4A 3QCUL 4R26H 3SDDC 1CXLA 1EEYB 2FSEA 3IGAB 3HR6A 3VFPB 1T1WB 3DURA 1D6VL 3EHBD 1KCVH 3HPLB 5B38B 5CJQH 2DLGA 4TSCL 5FKAB 1X5XA 3BJ91 1CFVH 4U1SA 5T1KA 5FXCH 1PEZA 4O5LL 5F9OL 3T65A 3TYFA 2MTPA 1Z9OA 4XB7A 2OXGA 3HMWH 1XT5A 4WY7H 3EGSA 3TCLB 3TN0D 1EK3A 2VXTL 1ED3A 2X4UA 3KYNB 3QPQC 4I0KA 4O51B 3BDXA 4AQOA 3HZMA 4FTVD 1FRGL 3DVIA 4LEXL 2R29H 3REWA 4OF6A 5EA0L 3DIFB 1ZSDA 2AI0L 4NO2B 4L1DA 2L4OA 4YDJA 4NYLA 3UPAA 2YD5A 3MA7B 5CUSL 1CR9L 4CNIA 3L7EA 5ACMA 2Y36H 5JOEA 4Z6AT 5FO8B 3VXQB 1JF1B 2X4OA 1F3RB 1GL4B 2E3VA 4BH8A 1OP9A 5F7MC 2DL9A 4BFBD 1ZWIA 4H25A 3QDMB 4MGXA 1DVFC 5E9DA 3GSOA 3QEQD 4PLJD 1H8SA 2IH1B 4JY5H 4EDWH 1K4DA 5HVWA 5AZ2H 3UAJC 3ARVA 1MI5B 1KLUA 5DK0A 4M5ZH 4ENED 4O2EB 3ZT7A 3DVGA 5A16B 4NZUL 1QNZH 4NPYB 1QSFB 5D7LA 1FC1A 2JELL 4JFEB 2R1WB 3QDGD 3QIUA 5JHDE 5JW4N 1DQJB 1A7OH 3H7LA 1ZVSA 4OCRL 1OGAA 3P9LB 1JBJA 1D9KB 1YJDC 2BCKB 1NMBL 1LK2A 3RI5F 1KTKE 1LK3H 1J8HB 1C16B 3G5ZA 4UBDD 2P5EB 4DOHE 1TZGH 4K8RD 3IYLW 4GG8B 1WVZA 3L1OL 2H8PB 4OB5H 4MNQA 1N6UA 5IHUL 1MY5A 3MOAH 2HFGH 3SGKC 1EAPB 5ERWB 3G5XB 3V5KA 3AU1B 3W0WA 3DUSA 1XH3B 2VO5A 3WNMA 4UV7L 5D1QC 4ELMA 2ZCHL 4LSUL 3VMPA 4NWUL 5KSVA 5D1QA 2HFFB 2P5WE 4LLDA 5MENA 2DQUH 4QRPD 4R4ND 3IXAB 3GRWA 3CX2A 3DX7B 4JAMA 4AM0B 5L8JB 4HPOL 1A3LH 3PHSA 4NN6C 1PQZB 4D0DB 3W2DL 3B2UD 2P7TB 4WTXA 2AERT 5I1CL 2CLZB 3SKJH 1BD2A 1JHKL 3EO0B 5DUPL 3BHBB 3C5ZA 3IU3A 3MCKA 3EFFA 3LB6C 5J6GA 4IMKC 2HFEA 5HDBF 5TE6H 4I4WA 4G6JH 4QHNA 5IMKB 5KJRH 3CLEH 3D3VB 2X9XA 2X70A 3G6JE 1E27A 5IMOA 2CH8A 1BWMA 1VERA 2JCCF 4LLQB 3T2OA 3S3JA 5IF0B 3IJSA 5AYUL 5KSBF 1CD0A 3MCG1 2GTZA 2WBJA 2IPKA 3QH3B 2DMCA 1FO0A 3HRZA 4OIIH 1KPVA 1DUZB 2VMFA 3BPOB 4NN7B 1TJHH 4DVRH 2NY1C 5SX4H 5E4EC 2JJWA 3ZHDA 1C7TA 1KG0B 3WFCH 4TTDD 2D0FA 1P7QB 3RY6A 3ARGA 3LEYL 4D94A 3G6JF 3LS5H 2W9EL 4FFZL 5DJ0B 4JDTH 7FABL 3O9WA 4YDIL 4LKXB 5T1LA 2BVQB 4NQVB 4F7PA 5KSBE 3K74B 3A6CL 3HI6L 1ZMYA 4I48B 5EZOH 1DBKH 1CBVL 3ZHLA 4GRLA 3P73B 4QXGL 3MLSL 5C6TH 5JOPD 1OTSC 3RX8A 4Y19E 2Y4SA 2X7LA 2F74B 5E00B 2F53B 4I9WE 5IFAH 5IOPA 4PJ8D 3DECA 4KRPD 4ZS7H 2XTJB 4WW1A 1PYWA 2WWKT 1I8LC 3HE6B 3NAAH 1FG2A 1U8NA 4M7LT 4G8FB 4HIXH 1SBSL 3MLSH 1F2QA 5C6TL 2YPLA 3BP5B 1IGYB 5FYLH 1WCQA 3VFMB 3MV9B 3WDIA 1LP9B 1CQYA 1NGYA 2ZP0T 2EIDA 1MLBB 1NDGB 4L4TA 4NKOB 1JWMB 5EC1B 1HH6B 2OSLB 2JLLA 3WUZA 2G2RB 1BM3H 3ARYA 3QXDB 5I16A 5HI5D 1LHZA 4PD4J 1CFBA 3RP1A 1IARB 5JOPE 1UJTA 4FOMA 1IM3A 2UUDH 3IDUA 2X89A 1BVKB 3X12B 3P30L 2AAVA 5BQ7A 4MD0B 2BMKA 4QXWA 1QVOB 3EDKA 3GSNA 2FR4A 3K1DA 5F7EH 4TNWK 1U6AH 1JPFA 4JZJB 2FYYA 3NCCB 4M7LL 3D0LA 2HJKA 1H5BA 1HXMA 5HY9B 4LCIL 3GSWB 5BVPL 4PJXA 1YN7B 1RZGB 1MPAL 4PTUA 4RIRA 4ESKA 4YXKL 1OW0C 4JZJC 4Y88A 4OLEA 1T7XA 1Z2KA 5HHMD 5HPOA 5ICXA 1FQ9C 2IAMA 4OCLC 1DBBH 4S0SD 4KKBD 4Z5RA 4PJAA 5EBLB 4F3FB 4PRBA 3ULVL 4UNVA 1I9EA 2DTSA 3ILPB 4P2RB 4RFOL 4KV5F 1RZIB 2P8LB 4DW2H 1QFWI 1A14H 2FEDC 4UT9H 1G1YA 4PJIB 3C60B 4IRJB 2O5YL 4X4XA 4RAUA 4PJDB 1Z0NA 4Z7NE 2R0ZH 4K07A 4PJBE 4I5BA 5D2LE 3VH8A 3H7BB 2IH3B 4H20H 1KB5H 4OF3A 3OKEA 3BW9A 3V7AG 1BOGB 5ITBL 2ZWLT 2EDBA 3TNNB 4NUGL 4L9DA 4KKAC 4XP4H 1HXYA 3IRZA 1XIWD 4PS4H 3W9DB 2ESVE 2EXYC 2OZ4L 1KCVL 3DLQR 3M8OH 5E5UB 4AG4L 5GGSB 2BNQD 2VRAA 4HUWA 3U48A 4L4TD 2HLFC 3H9SA 4YLQT 5I19H 4L4JA 3N06B 4HJGA 3DWTA 3HPJA 4P2OC 3EFDL 3P3YA 4PGEB 3RUGB 1UYWH 1I3GL 3BZEB 5EFIA 5IEKA 2CO6B 1CYGA 1SYVA 2GKIA 4GQ9L 1A3RH 3SDDD 3RPIA 4JG0L 5D2NC 1HK6A 4G8EA 4RFEB 1BF2A 3TWCL 2FJFB 4ZFZA 1D5MA 3DYPA 3B3IA 1R5IA 3SJVD 1CFQA 4E0RA 3GGWB 3BPOC 4NN7C 3EFDH 1I1FA 1QZ1A 2EDYA 1ZXQA 4QHUB 3VD7A 3WNOA 1U8LA 2OJZH 3Q3GA 1SJEA 4JRXA 1LILA 1OAUH 3HE7D 1QFPA 2IG2L 4YPJA 3TN0C 3AMKA 2EDRA 2ATPA 5HGDB 1J86A 4U31A 1R3JB 5FCUH 2Q7YB 3F12A 3V6FA 5CJXA 2R1XB 1RK0B 2XQBL 5I9QB 3EAKA 1HILA 1CK0H 5EUOA 2OL3A 3WJJC 2C26A 3FKUS 3QG7H 3NA9L 4QNPF 1BX2B 5J1SC 3BAEL 5FGSA 2XN9E 3LN4B 5IESL 3QDGB 1VKXA 1OAKL 3MRMB 4C83A 5HVHC 5C9JA 1FNGA 1ZT4B 1M05B 5I2IB 1PVHA 4KPHH 1AE6H 4G42B 5K9QG 2F53D 2DM7A 1H3PH 2VLKB 4JFOA 4DUVA 4L9LC 4IDLA 3QEGH 4U3CA 2B1AH 3HE7A 3CNKA 4Y89A 2DMBA 5JXEC 2YUZA 2X9WA 5SWZD 3DSFH 5DRXB 2ADFL 2IANE 4XVUC 1MREH 3ZL4L 1NLDL 3MPCA 5DJDB 4H0IA 2DWDB 4ZAKB 2EIBA 5IHUH 2R0KL 2BVYA 3MBED 1MRCL 3C60D 4Z7WA 2VSDA 4MA7H 3JWDL 1G0XA 5E8EB 2O5ZH 5F71A 3QUXD 5IIEB 5E8PB 3MJ8A 4L3CB 1MFCH 3ABZA 2DIBA 5JUEH 4GT7A 5C8JA 1RZFL 4KRNA 3ZTNL 2E7CA 4GBXA 1QFWH 1T6WA 3BD3A 5KANG 1ZGLA 3K2UH 1DVFA 2D31B 1TZIB 2I07B 2I25N 5E1AB 4WFHE 3CU7A 4C56E 4OLZH 3OMZA 1VFAA 1KN2H 2JCCA 3EO1B 4MCYA 2IQAA 4NUJA 5AD0B 3QUYC 4P2QB 1JGDA 1BJ1J 5IV2A 3ECBA 2DTML 3OB8A 3T04D 2AJSL 1NAML 1JI1A 4ERSL 5ILTH 2CDEA 5I1HL 1N6QH 5C7XL 4HT1H 1CLOL 2F19L 4ZMAT 5D7IE 1YDPA 1SJVA 3OKDA 2FCBA 2H9GB 4ZFFA 2D4DA 3MODL 1U8OA 2PN5A 1OGAD 5DC9B 4LVOB 5F7UA 5FGCE 1FAIH 1PBYA 4LBEA 2EH7L 3VD3A 4DN3H 1M7DB 4Y19B 3B9KA 3OPZL 3MV8B 3INUL 2X4NB 2NY6B 1CGSL 2XICA 5EZIH 1ZLUH 1AR1D 2DIJA 4A6YH 2MPAL 3IFPB 2HLAB 4LLVB 1E6JH 5JPMB 3Q2CA 4OIBA 5C09B 4EEEA 3CD4A 4WU5A 3UTTA 4U1KB 1S5HA 5ESVB 5FOBA 4FFZH 4D0CA 1WISA 1FL3A 2VXTH 3PGCB 4JFDA 2N1KA 4OGXH 1KTRL 3BMVA 3MLYL 3B43A 4WUUE 2P5ED 4ONOA 1CGSH 3SE9L 1BJ1H 3GHEH 5D1ZC 5CJQL 5D1ZA 1J87A 2JKXA 2XTJE 2NW2B 1KBGH 2RBLA 4R4BB 4NRYB 3RU8H 3TPUB 3WLWC 2O26U 2BSSA 4RGND 1H3GA 5IBLC 3U7YH 4YHIA 2BSRA 2GJ6E 3DRQA 3FZUD 3KJ6L 4B50A 4F33B 1GIGL 4PP1C 2A6KB 4I0PB 2G5BB 5FK9A 4MA3A 4O9HL 1HHHA 1ZT7B 3DROB 4XHJC 3MLRH 1FLTX 4L8SC 4LHJB 5DXWA 4N8CH 1V3JA 1IBGH 3BGFB 2DOCA 2M2DA 5AG9A 4QWWC 1XGQA 2YA1A 3T1FA 4KK6D 4KRPC 3DX8B 4DGIH 1WK0A 1RUAH 2IALA 4KY1L 2F54D 5F7DA 4AENB 4H1LH 3OAYH 2CR3A 3DXAA 1UQSB 3HE7C 4OZHE 4CKVX 4X80H 4Q2ZB 2PTVA 1S7UA 3G04A 2DQIL 4YBLB 3BX7C 3VXTB 4MJID 4NC1C 2XKUA 3R0NA 1J8HD 2Y1VA 1FV1A 3D85A 4J1UB 2NY5C 3V0VA 4U6HB 4P2RE 4K7FA 4RMUA 1LO4L 1S7SB 2B5IB 3ROLB 3F7PC 2QHRL 4PJCB 5BXFA 4QEGA 4CU6A 4MNGB 3HUJB 3RJDA 5BS0E 4ODBD 4OQTH 3TEUA 3MCLL 1W72A 1F3DJ 4OFYD 5F44A 4BFGA 1JV5B 1GH7A 3OB0H 5KSAC 5HGHB 4LHUG 1BVLA 3QNXB 2I5YH 5CIPA 2FD6L 1AO7A 4XMLL 5E2TL 1GOFA 3I6GA 4M7JL 3OGCA 5L7XL 4ZFOB 4GLRI 3FT3A 4PJBB 4M6NH 5F3BB 4HIIB 1HDMA 3NCFB 1CQKA 1NEZG 2YSSB 3WN5C 4HCRA 4JQIL 2XG5A 1CGTA 5BMFL 3F6LA 3O2DL 5A2LH 1A0QL 1HSBA 4NC2B 4JFFB 4HBCL 2UY7A 1CF8L 4M62H 2ZOLB 5HGBB 3QULB 4NM4H 4X8JA 5BRZE 4G9DB 3MV01 1TVBB 1N7MH 5DD1L 2QQQA 1V05A 3STBA 1T20A 4G9FB 5ESQA 4TNVK 5F72S 5J1AA 2EDKA 2VXVL 4Z7QF 4CADB 4JFDD 1F58L 2WQ8A 1TDQA 2Y5TB 3K4DA 4P46C 1T80A 4OZ4A 1M71A 2AEIT 1B2WL 2CDFA 2W59A 5D5MB 3SGJA 1FFNB 3GBML 2VABB 5FCSH 3IDMA 1TQBB 5B8CC 1JJUA 2VLJD 1I1AC 3QFJD 1V5JA 4LARH 1MI5D 3MRBA 4IHOB 5FYKH 4JDTL 1NUNB 4NRZA 5CKGA 5DSCA 3TO4C 2H45A 3VFTA 2VXSH 3U4BL 3B9DA 5IT2H 5DMGD 4HKZB 1HHKA 43C9B 3QDGE 3D87B 2XT1B 3FO2A 1NFIA 1MJJA 4LCWB 5F7HA 5C0BE 1XF4A 4J3VA 2GAZA 4PJFA 1BBJA 2X44D 5FGBA 4IRSB 2HN7A 3G5VA 1Y6MR 4NQUA 2WANA 4HKXA 2Z35B 1BAFL 4ETQA 1RIUL 4ZNCD 4KC3B 5E95B 3EDFA 5DYOB 3KLHD 4PJ9D 1MJUL 3LDBB 2EZ0D 2ATKA 4PGZA 2O5XL 2QADB 3RY5A 3D3VD 2EDFA 1UCTA 4J3OC 4ZUSA 4M48H 5K9JL 5J6HA 2RFXA 5LKNA 3WHXA 4PRIB 3LKSB 4HGWA 3QXTA 4YWGL 4GKOA 4DGVH 1X5FA 2DM4A 5J13B 4LGPB 2XKSA 5D93B 1KGCE 4OD1H 4BQBA 4PB0L 1CI5A 2VTFA 1S5IH 1HWHB 1E4WL 3VFGL 3FO1B 1FDLL 5KVEH 1B0GA 3O41A 2R2BB 4JDZB 3UBXA 3AVEA 1JWUA 12E8L 1RVFL 4HMCA 3R4DA 4W4OC 1TPXB 4KMQA 4P2QE 1MEXL 2ZCKL 4M7ZB 5HHNB 3O11B 1HQ4A 5FA4A 1V3LA 3V0WL 4APQD 4JCLA 2HWZL 3T8XA 1MPAH 5AYQA 1NC2D 4YHKH 1H0DA 3V5DA 2Q3AA 5FF6B 3ARFD 1LEIA 1AQDB 3GM8A 5GHWL 5DRZA 2P24A 2QQLH 4LLWA 3GSQA 3LKQB 4PJGA 3BDYH 1A6ZB 3BH9A 5DGRA 3PWLA 4X6BA 2CIKA 4F58L 2D0GA 4PJ9B 3EBAA 1IGJB 2JJVA 3NIDE 1D7FA 2OMNA 5T1LD 3NZHL 3IJHA 1XFPA 3PV6B 4NQXB 4IM8A 1I8IA 3MV8E 5FUOH 3IVKA 3QO1B 4Y5YA 5GGUB 2VXQL 4C4KT 1IAIM 3H42H 4GRLD 4JEGB 3E6HB 1RK1A 4P5KB 3ESUF 5HHMB 5HI3C 4C4KO 1JPSL 2OX5A 1R3LB 4WTZG 2IQ9L 4KQ4H 2GJZA 3V6OC 2DJSA 4P4KD 4GKZA 2APTA 4JPWL 2O5YH 5C09E 1CU4H 3NCJL 1S7WB 2H1PL 2FEEL 3I2CL 4QTHB 2VDNH 1SYSB 3MZGB 4XCFL 5E2UH 3QNZB 1DL7H 3NIDF 5ETUB 1P84J 1MFNA 3HA0A 4WW2F 5FUOL 5D8JL 5BVJB 4WJ5A 1GVIA 3CXHK 3C5SB 4LU5L 1T2QL 3EDJA 4PGCB 3PWPD 4ONGL 4P59L 2R8SL 2P46B 3CFKB 1OM3H 3M8OL 3KPRA 3TBTB 3FFDA 4FQ1H 5IFHH 4TQEL 2YA0A 2AVGA 3CVIH 1P2CB 4K8RC 4G7VH 5E8NA 1X4YA 3DGGB 3MR9B 4M6OL 2EIZB 1EHLL 5D8JH 3FQRB 5LQBH 4HIJA 3C5ZC 2ZJSL 1BECA 2QBWA 3G9VA 5DEGA 5T3ZH 3GB7A 5A2KH 3RVUC 5F7NC 4X99B 1T0NB 4U2YA 1S9WA 3HMWL 3EKCA 3OZ9H 5IFHL 2WW8A 1ZANH 1EBAA 2IADA 4I2XA 3HZYA 4NQSB 3IETA 1ERNA 3IDYB 1KBGL 1F6AA 2A6IA 2YUWA 5BJTB 3B5HA 2EXYD 4MDIB 2FATH 3TO4B 3BQUD 3SJVB 5F3HA 2DF3A 1WLHA 2ICEA 3MRQB 2PETA 5K9QI 1ZANL 2QQNH 1AY1L 4YHLL 4LSSL 4KI5C 3FQTB 2HJLA 2ZG2A 3W0WD 2CDGA 4NJ9H 3LRSA 1FL6A 1AHWB 2J1KA 1A7RH 1WAAE 4ACPA 4PR5B 1XR9A 3ZSTA 2GFBA 5I74B 1IAKA 2CR6A 1OGTB 5EN2A 3VFOB 4X83A 4RMQA 4QHKJ 4JKPL 1UGNA 5HYIA 3IFOB 5GRJH 4GW4A 4E5XA 2ZUQC 1D3CA 5D96B 3LAFA 1JPGB 2RJMA 4OIAA 2JIXB 3BDBA 4Y16C 4IS6B 3B8SA 3BN9C 4OCRH 2JK5A 1P4IH 4L29B 2NY7H 1X44A 1IQDB 3QUYA 3M17A 3MV9D 4MQ7A 4TN9A 1DDHB 3L95A 2A6DB 4GG6F 4K3JL 1X5KA 2LQRA 1MAMH 1Z9SA 1Y0LB 1L7TH 3IDXL 1A9BA 1A1NB 3K80A 4P2OD 2VIRB 4KJYB 4O02L 2E27H 5IQ7L 5IK3A 4C54A 3ZE2F 3SQOL 1E4XI 3OXSB 4FFWD 1RZJC 3SKMA 4CVXA 2P8PB 2YEZA 4TOYH 4OZFB 5DEFA 4LPVA 4FTVA 3KPNB 3RWIA 4CMMB 2W1NA 1I75A 5JR1H 4HDIB 4JFED 4LPUA 1KIRB 2PTTA 4GG6E 5D70L 5EU7C 5I1KH 3WFDL 3B8YA 3TJEL 35C8H 1TIUA 3GSRA 3H9HA 2NY4B 5IMLB 1F4XL 4HX1B 2D7OA 3FL7A 3KPRD 3ARFC 7CGTA 5D6DA 2B39A 4LSQL 2D03H 3AREA 5H35B 1JWSB 2WIMA 4LDLB 5IROC 2EC9T 4W6WB 2CKBL 1DLHA 1CICA 4V1DD 5E5MB 1FZOB 1Y18B 3GKWH 3HLAB 2XZZA 1F6FB 4HFWB 1R3HA 5K9KA 4R26L 3K8KA 5AYUH 3DV6B 1V7NL 4BUHA 1BQSA 2Z8WC 4IIQA 5HI3D 3OAUL 1YEEH 2APWA 1SEQH 4M6MH 2Q76A 2ADJA 4XXDA 4GKSB 4HT1L 1T1YB 3L3IB 4F9LC 3SDAA 5IJVB 3CAFA 3IU4H 5J7CC 4S2SA 4U1IB 3T4AB 4NQCB 2CUHA 4TSAH 5FHAL 4P23A 2BJML 2OR7A 2C4FU 2R69H 2PKDA 3ZDXE 2ZOKA 2B4CC 4JRXD 1F8TH 4ZO7A 2Q3ZA 4PRIE 3VXMD 4YHML 4JPKL 3CSYB 3SDYL 4N9OB 3UZEA 2ZPKH 1IILE 1K8IA 3LV3A 4RQQB 5DMKA 2NYYC 4ELMF 5EU6E 1ORQB 3JZ7A 5DRNB 1NAKL 1U3JA 2W0KA 1Z5LA 4LLYB 4U3XA 3OAZH 5EBWA 4YUEH 5F7YC 2X4SB 2C3GA 2X4RA 3H3KA 4XP5H 1VADB 5JLZA 3C8KA 3OKLA 2ZPKL 1A1OA 3MRRB 3L3HB 2QR0A 4WTZA 4CDGC 5ISZD 4D8PA 2AEPL 4TTDC 1U6AL 3B9VA 4CVZA 3MJ6A 1KENH 2J2ZA 3PUCA 4R7NA 2R2HA 4NGHH 1TPXC 1NBZA 4RNRB 3KPOA 3TA3C 5B3NA 3CFEA 3SE8L 1BZ7B 2NY0D 1NEZA 4XCNA 3EZ8A 2W91A 4QRPE 2OQJB 5T1DL 4POYA 3RY4A 2YKLL 1QBML 4YHYC 1FYTA 3RIFK 5F9DC 4MQTB 2RHEA 3EDDA 5A2IH 1RUPL 1G9MH 5CZVL 3JTTA 3KPMA 2NY0B 2GYSA 2AV1B 4R0LC 3CFJB 3U1SH 3U7WL 1FZKA 2X1XR 4UIMA 4DW2L 1OSPH 5B39G 3WIIL 3W0WE 4D3CH 1I4FB 2IF7A 5DD6A 3UTZA 3WFHB 4YFLF 1VCAA 4C56B 5DVMA 4JQXA 5B4MD 3T2NL 1KLGA 1I9RL 2ICWJ 1T7WA 1WJ3A 5HHPA 4HWBA 5CP7B 3LKOB 5DF0A 1OLLA 3K81A 5ISZE 1NFKA 1YPZF 4NKDA 2EXWD 4PJEF 2WMPA 1EEZA 5M7QA 4HD9A 2PW1A 2O61A 5IBLD 5FB8A 2JJSC 3MV7A 2B2XH 4HKBA 4PJ5D 1ZE3C 4KDTA 4KK8C 1GZQB 4X6EA 3F7QA 4OCYL 1IC1A 3W9EA 4DJMA 2YD4A 4GAYA 5INCA 5DC0A 1FLRL 5EU6D 5C70A 1F4AA 3HB3D 5F93C 3GMMB 4OUUB 5GSVA 4BSWA 1W0WB 2AABH 5B8CB 2QEJA 1RUKH 4WUUD 5KZCD 1NGQL 4K9EC 5CJOH 5DJZA 1K3ZA 2E9BA 3O4LB 3VXNA 2CK0L 5LXGL 5CHNA 4MMZC 3AUVA 3VI3E 1KTLB 4U1NB 1U93A 1HSAA 1IGIL 5HYEA 2FBOJ 4MYWB 4DUXA 3RZCA 1G7LB 1J8KA 3H9ZA 4K9EH 3WO4C 6FABH 3PWVA 3U7AA 3B5TA 1JHTB 3G5YB 1IQWL 3LKNA 4N5ED 2OTPA 1OP3K 4W6XB 4DZ8A 4JFHD 4XCYA 1R5WA 3C9NA 4WEBH 32C2B 1NGWA 4V1DB 5GISH 5GRUH 4UT6H 3ZYIA 1QD0A 4PJHE 1CL7I 1AIFB 2AJXH 2PXYA 4KHTL 4PD4K 5D7KE 3FQUA 5DJAB 3RTQD 4HUVA 1MCRA 3K7UA 3S98A 5EOTB 1GGBL 4MHHI 1YEKH 3MRDB 3JV4B 2ED7A 1YEIH 2H26A 3SO5A 5T3XD 5BV7H 2XRAH 3TH3T 5DMIH 5C0GB 4QYOA 5FCUL 1XGYL 3UO1L 1NSNL 1UEMA 2AQ3A 4OLXL 4PTTA 3MX0A 4ODWB 3AFLA 4S10A 2VISA 4EN3B 2NZ9C 3UYRH 3DSFL 2V7NA 3OKKA 5JW3L 4HKJB 4OZHB 3O3DB 5SWSA 4M93B 2XPGA 2HT2C 2XV6B 3HNTL 4ZTOL 4MX7A 3RQ3A 5C0CA 2E8YA 1RUMH 5D7JC 4EUPG 4CDHA 4FQHB 2E9IA 3BKYH 4PRHA 5JNYB 4Y4FA 5JDSB 1OL0A 4JGJA 3HG1B 1T22B 2Z31B 3FB7B 3L5JA 3QUZB 4MAYA 3ROOB 5D1XD 1FO0H 2F5AL 1S8DB 4PJCF 1PKOA 1MELA 2EKSB 4G8IA 4KJWC 4OZGB 1CE1L 4D9RE 5IVOA 5C6WH 2EDQA 4F57L 5IW6A 1KACB 3F7VB 3ELAT 1TTUA 5L8KB 5K59F 2R4RL 4Z7OE 1KXTB 4LAQL 5D7SH 1MCDA 1WZKA 1OT1A 1OPGL 2IPTL 4KRPB 4MNHB 1ADQA 3UTSA 5FA3A 1LEKA 4WW2C 1VHPA 3BGFC 3RUGF 1J8HE 1Q9OB 4GKNA 4OD2A 4ETYA 4H0GA 1HE7A 2N7AA 4YNYB 3GFUA 4MA8H 4WDIB 1T0PB 2YOCA 3MODH 3D1MC 1UXSA 2AGJL 5J13C 1W0VA 3UBXI 4G80A 2VERN 5TF0A 3GMRA 3TGXA 1HOCA 2HG5B 5HHXH 2CGRH 1QR1B 2NYYD 2MKWA 4LCCA 3FB5B 3MFGB 1T2XA 3FOMA 4NO0B 1KIUA 1EZVY 3P77A 5IB5B 3ARPA 3QEQB 1I7TB 2COQA 2ZUUA 3VW3H 3MRPB 4QOKD 3U4EB 4L5FL 5DJ2A 3WE6A 5I76B 5CEZL 1I9JH 2EZ0C 5CD5D 4U7SA 3AS1A 3QEHA 4DFHA 3LD8C 4RAHA 1DLFH 3RWEB 4GMTL 4OGXL 5E08L 3CFBA 1G6VK 2QL1A 3FFCD 2CRZA 1GSMA 1FGVL 3VE0A 1GGIL 3IFLL 1D9KD 3VU2A 2VLME 1QSFE 3GMQB 4J3XA 1NGZB 1N6VA 3HE6C 4HXBL 1CN4A 5EO9B 4BFEA 1IEBA 3MJ9H 4PV9A 3UYPA 1L6XA 5SV3A 4Z77A 4QXTB 3DUUB 1N8ZB 4NFBA 3PV7A 3WO3B 1TVHB 2EE6A 1B3JA 1MCJA 2WUBL 1HYSC 3PWJA 3FFCA 4CN1A 4PJ8B 4X98A 4U49A 2AJYH 3Q48A 3CX5K 5DGQA 1MOEA 4HWBH 4XC1H 3BZ4A 1T5WB 4URTB 3MOBH 2Y23A 4MLSA 1CD1A 3KWWA 1UKTA 4TUJA 4W81A 5DFVD 4NZUH 4AIZB 4PRPB 3VFRA 4QRPB 1YUHA 1INQB 3ZE1E 4OFKA 4OSUL 4LIQL 3RWDB 3QI9C 1U8IB 1L0YA 5CSBA 3WXVL 4Z78B 4KFZC 2BFVH 4XP5L 1U8HB 2DQIH 3CDFA 4N8VB 2DYPA 4XNXL 1INEL 2FB4L 1VESA 1FNSL 3PP4L 1MFAH 2PO6C 3LEXB 5E8DH 2JE8A 1QLRA 3WN5B 4CW1A 1CFNB 3ARDC 4MJ6B 5FM5M 3D9AL 3DX6A 1F6LL 1MCBA 4P4KA 1FNEA 4NO5B 3X14A 4YO0A 1ZT1A 1KCSL 1LO3L 2QV2A 3MTRA 3BKJL 2F8XC 1YA5A 2ZKHL 3SGEH 3EYQD 2EYSB 5A3ID 2OTUB 1A6VH 1G9EA 3RWHA 3QCVL 4LEOB 4FNLH 3MV9E 2A77L 3BO8B 4MS8D 1S7XA 3MJ9A 4EI5B 3CFDB 5KAQF 1FJ1B 1F3DH 1YMMA 3BXNB 3IDJB 4IOSD 5C08E 1CFSB 4QRTB 4HFUH 3PGDA 5I75B 4QRQB 1PD6A 1GAFH 3QUMB 3SOBL 4DWHA 3ZKMD 1D5XA 3IKKA 4Z7WE 3QO0B 1Q38A 1CFTB 3I6LE 3FQNA 4OQTL 3VRJA 2BC4B 2YPKA 4APQA 3U0TA 4HWZB 1RUQH 2C1OA 1NC4B 4WI3A 3QRGH 4U6VL 4Z7VA 1MSPA 2BVEA 1A6TA 5ISZB 1X5IA 5KVGH 1JHKH 5IVXA 1KCLA 4NFCA 4X9BA 1T6VN 4Q9QH 1PY9A 4BA8A 4P4RB 3T0EC 2AK1L 3L3OA 5DRWA 1K2DB 4K23L 3STZA 2CPCA 1GC1H 3TN0B 3WDJA 2I9TB 1WBZA 5FO7B 3L5XH 4WV1B 3BPLB 3HAEA 1NGXA 4NC1E 1RU9L 1ZEAH 3VD9A 3F6IA 4X0KA 3CUPA 4KKLC 1RZFH 4ZXBB 5IBUG 5HYQA 3W11C 1CS6A 4RGNB 3T4YB 4EI5D 2YD3A 1Q9KA 1Q94B 2X4PB 2NW3A 5ID1B 1F90L 3O3EA 3MUZ1 4PJHB 3VXUE 2EDOA 1AGBA 4OZFH 4JM2C 1A7BA 4O4YH 5KS9B 2NX5D 1ORSA 3AB0C 4OM0H 5I8OL 2GTWB 5CILL 4YAQA 3MYJA 4P9HC 5KSAD 2D7NA 3CK0H 5L88L 4ZD3L 5GGQH 5EOQL 3QNYA 3DJ9A 4LLAA 3CZFB 5IKCB 3NFNB 5E94B 2R1YA 3JWNC 3VFUA 1JFQL 3UTTE 2GK0B 1EERB 1F13A 3SY0A 4H5SA 1HH9B 2BJMH 4JFDE 3VGHA 1D5IL 5ACZB 3S96A 1KPRB 3V4VH 4P2OA 3P4NA 3VWKA 1UADC 1A2YB 1U91B 2ADIB 3U9PH 1OB1A 1CZ8L 5EA0H 1B4RA 1AGCB 4RISH 1F4WH 4UQ3B 5BV7L 2GJ6A 2LFGA 5EZLA 3K4AA 3MV7D 3HZVA 1B6UA 4Q9BA 5DJYA 1DE4A 4NDMA 5F9AC 4JM2B 3RGVB 1U3ZA 2DLFH 5ENWB 1NMBH 4LDEB 4X6CA 3S88H 4HBQA 4XTRD 5KSUB 2A83A 3PQYE 4OKVB 4YDLB 1T03L 2WSKA 2AJZA 1TJGL 1VB9A 5EUOF 4EOWL 2FJGB 3IAPA 2IWGA 2ARJQ 3IDNB 5HGAB 2ZZUT 1XCTB 3PNWB 1VFBB 4QOKA 1PKQA 1FE8L 2WUCL 1I3RA 2C3HA 5JOFA 3UTPD 2F5AH 4HH8A 4OAWB 3B83A 3LSOA 1IE5A 4G6AC 4UQ2B 1B0RA 4ODUA 4XGZB 4Y8AA 3KLSA 4L4VB 1MCCA 5DA0B 3OR6A 3RTQB 1TJGH 2AP2A 1KFAH 2V5SA 4XH2B 5DHVA 1TZGL 5F7EL 4R90H 2D4FA 4ZAKC 5GGTH 3O3AA 4LHUB 2XN9D 4FQQA 4Z18A 4AMKL 2VLKE 5BS0A 4YFLI 3T2QA 5JHDD 3ULVF 1D5BA 4Z7UB 1UZ8A 5E9DD 4XVSH 2FL5A 4Z76A 1A7OL 2Y07H 5D5MF 1FL5A 2PYEE 4MAUL 3C5JA 5GSRB 5BMFH 1XCQA 4ZNEA 4FP8H 5D1XA 5I1LB 5JZ7D 4HS3B 4DUWA 1MCEA 4M62L 4LCUA 5CGYD 3U2SB 4IOIB 2BVPB 3P11H 4WI7A 2FH6A 5FYLD 1U8KA 3MRKB 4KJQD 3I75A 4LCYB 4XCEB 3BMWA 3QEQE 5L7XH 2VXQH 5J3HC 2KUTA 4HEME 5C9KA 5CP3H 1P1ZA 1NCCL 2AJUH 5DJ6A 1GYAA 4J4PC 4M6NL 1BGXL 3ULVE 3CVIL 4AH2A 3LH2L 2P42B 1XGRB 1X3DA 3QEUA 2VDLH 2WM0A 4Z7QE 1DQLH 3MJGX 1IL1B 1L7IL 5I9QC 5I66B 1WWAX 3GMNB 3RPKA 1JMZA 4PP2B 4QTIH 5J57B 2R2CA 4QRRD 4UTBL 4IJ3C 3D18B 1BOYA 5GGVH 3MLXL 2PR4H 3TNMB 1KJ2B 2QSVA 3L7FB 1I8LA 5BRZA 5TE6L 1CG9A 3E8UL 5IJKC 3U4BH 4E9LA 3HZKA 2XQBH 4OCWL 1U42A 2FGWL 3VFVA 5DVKA 2XN9B 5J11C 5L2JB 4R9HA 4XBPB 1BQHB 1EZVX 2NY5L 2UY6A 2WK2A 4IJ3B 1EGJA 4DKDC 1N2RA 2P8MB 5IW1B 5KN5B 1AXSB 4R4FH 5C07D 4FZEL 5D7IB 1YEJH 1SY6H 4W70A 4WHYH 5MEND 5LCVH 1RIUH 3BEVA 3CGTA 3GNML 3PDOB 4YGVA 5TFSL 43CAA 2IMNA 3WLWD 4KZEL 2HYMA 2FHBA 3SBWC 4J6RL 1QKZL 1MVUA 2FWOA 1N5YL 4UAOC 3A0OA 5JHDA 4Q9RH 3NFPB 4NJ9L 3DBXB 2C4XA 1OGAE 3G9AB 5C0BA 4JKMA 1LD9A 1CBVH 4NKMA 1YQVH 1Q72L 3ALXA 4FQPA 1PY4A 3JSSA 4AEFA 3BQUB 1F11A 3MRGA 1AI1L 4M9PA 1KIQB 3X11A 4QF1B 4OV5B 4OD1L 1HQRB 1JF6A 2GW5A 2HJFA 3P9MB 3FQWB 5DQJB 1UJ3B 2VLLB 4JRYE 3QCTL 4NKIH 4NQED 5BZDB 5CFHA 1G7PB 1P9MA 5ITFB 1LE5B 1ND0B 3TYGH 4JR9L 4NQDE 4HS8H 2NXZB 3GMOA 4PV8A 5SX5K 5IWLC 1ZTXH 2HT4D 3SKNA 2MHAA 2BY0A 4YHOH 3RTQC 3TZVA 2AEWA 4Y2DB 4XAWH 5D1XC 4NSKB 3V4PL 3VG9B 4DAGH 3DV4A 4WRLA 1M1SA 3RIAK 4FABL 1FBIH 2AEQL 4RGMB 1FCGA 4F7MA 1QYGL 4Z95H 1IKNA 4XBEH 1ZTXL 3UDWA 4LIQE 3L3GA 4G43A 3M1BA 4R8WL 4GAJH 5F1IA 3LQZA 1DFBH 3ARDA 4G8GA 1A7PH 3X13B 1K3IA 3TBYB 3HNTH 4C58B 4AYFA 4O02H 3QUML 1I7RB 2IAMD 3G6JA 4R97B 2EE2A 2V7HA 3L3JA 1QBAA 2ICWA 1CU4L 4FQXA 1YEDA 2PW2A 5TDPB 4ZSOE 5F7FA 4R3SB 4L8SA 1XF3A 2XWTB 5ILTL 3CJJA 4KROD 2YD1A 2AK4D 3GMLA 3H0TA 4K3EL 1QG3A 2ICWI 2DJUA 4AT6A 1XF2B 3CSBA 4Y1AA 1XGTA 1J1PH 1SM3L 4JFXA 1DBJL 1UT9A 1AGDB 1Z3GL 4JN2A 5H2BB 1FN4A 1A6AB 5EORL 2VN7A 2VDOH 1EMTL 2CKBB 1D6EA 3VRIA 2V2XB 1H3UA 4N1HB 4LP5A 4RFOH 3NCEB 4RGNE 3ISWA 1WFTA 4JREC 3TP4A 1MH5A 3I6KB 4PRNB 1YYLL 2BOCA 5KSBA 3OBAA 1RMFL 4IDJH 1F45A 1XIWC 4JO3H 2Z8VC 2KZWA 4OZIA 1S7VB 2H2SC 2R56L 3NCMA 3TV3H 5DMYA 4KDWA 1S7RA 1XEDA 4PY7A 3GUTB 5T3XH 4HUUA 5ICZA 2AJVL 4NT6A 3P9WB 4GJTB 4XP6H 4WU7A 4OGAC 1KJVB 4F7EA 3MGOB 5IG7B 1L0XA 2K7PA 3VGAC 5LGKA 5IROA 3THMH 4NNYA 1XGPA 4MD4B 3ARBB 4JPIB 2VUYA 4TUOB 1QSVA 3NGBB 4DKAA 4LHQB 5EIVA 3HS0B 4TSCH 2HRLA 4JB9H 1DP0A 2F54A 3BPLC 4L4TE 5TGBB 3OX8A 3QXVA 1UZ6E 2XA8L 3OZ9L 1J0IA 3VJ6B 1KSRA 4G9FE 3PQYB 1SQ2N 3WDHA 4HEPG 4YHNA 4H26B 5DJCB 5MERB 4PJDF 4XXCA 1YNTA 3QWOB 5AZ2L 4X6FB 4JHWL 4QY8A 4ZQKB 2UV3A 4P0DA 3IDGB 1J88A 1SEBB 2HVJA 4ISVA 4JZOA 4U1JB 4HZLA 1KJ2H 1RZJL 4Q6IB 3MMEB 2CLRA 2VZ1A 3SGEI 2YPVH 1OWWA 5CWSB 4IMLA 2HVKA 5GS1B 2AJYL 3MLZH 5D1ZD 3FOLB 1UA6L 4DTGH 5T3XE 2M8XA 4UI2A 3UPRA 4I77H 2NXYB 2RAMA 3D9AH 3ALWA 2IPUK 3GMPB 1E28B 3PL6A 1DUYA 4Q0XH 1LEGB 2KL6A 2ZUVA 1BJ8A 4G6JL 3LRHA 3KYOB 1NKOA 5C3TA 3EOYG 3OKNB 1ZA3A 3D2UA 1NFDE 5EU4A 2N7BA 4MAYC 4WHCA 5A2JH 1KNOA 3FHQA 3S4SA 1T83A 3A6OA 4GW1A 5F96L 4CN4A 3MUJA 4IMKA 4JFFE 1RQ5A 1FZMB 1NAMH 1LE9A 1ZVHA 3KXFA 1JGVL 5IB1B 5FAAA 4BK5A 2AQ2A 1J0JA 3N1MC 3Q6FB 5C07B 1R24A 1CDCA 2ITCB 2NX5E 2FH8A 1Q1JL 4DVRL 4NWUH 1ROWA 3TBWA 3DARA 4P2CG 1MWAB 5C0AE 3VFNA 2PO6B 1ETZA 1ZHKA 1AE6L 5JXAH 1LQSR 1RJZA 3JBG7 3QCUH 3ULSB 2BRRH 3ZDXF 1YEGL 2AXJA 4DKEH 1JP5A 4NZRH 4XPFL 5GGRB 3BPNB 1A6WH 4P5MA 5DJ8B 5SV4A 5FDWB 1X5JA 4N90D 3MNWB 4XZUB 2VNCA 2I5YL 1WICA 3ZDYF 4G3YH 2VB5A 5JORB 5DO2C 3NAAL 2DQEH 4MNQD 1PG7L 3QG6B 3PHOB 5EBMB 4FMKA 1SHMA 3MV11 4GRWB 2F5BL 1T04A 3U0WL 3OJDA 5J4MA 4WWKC 2GUOA 3QJHB 1C5DB 6FABL 1KEGL 4JM4L 5HI4C 4LPTA 3GSVA 1XIWB 2CIIB 1KJMA 3ARDD 1WEJH 2ITDB 3U9UB 5IB4B 5I15L 1U92A 2FGWH 5CSZB 1PW3A 3AAZA 3MUGA 5J0BA 4OLZL 5SWQB 4PJ7B 1MHEA 5CBEA 4KJWD 2VOTA 4GXVH 3IDIB 4YR6B 1NJ9A 1RI8A 3MRIB 4ZS6C 4QXGH 5HGGS 2EDHA 1MFBL 3BGMB 3L5IA 5B22A 2EICA 15C8H 1FG9C 3VA2C 4JKLA 2ERJC 2WP3O 1SBBA 3SE4C 2R69L 3PDDA 4P46D 4Q9CA 2HP4A 4RGNC 1UEYA 3MLTA 5F8QC 4HQQH 4LSRH 1N5AB 1ZKAA 4RDQF 4WW2B 4JJHA 1AP2A 4I1NB 3WIHA 3MLWL 2Y36L 4M03A 4D9QE 2KZ1B 3VXOB 3GJFB 4EJ1C 1WBYB 3MRLA 4K71C 2FRGP 3T0EB 1IFHH 4NO3B 3HR5B 2DKUA 2OBGA 2OYPA 4P9MH 2DAVA 4G6MH 4GRMA 3G6DH 4X6DE 2Z93A 4UU9A 5E03A 4LNRB 2EECA 3N0PB 5HSFA 4U33A 1RUAL 3L3DA 3OKMA 4M5ZL 1AJ7L 5DWUH 3TO2B 2DQCL 1G7HA 1H5BC 1JNHA 4M9OA 2A9NH 2HFGL 5C08B 3WEXA 3GSUA 5I17A 5ESAA 4X80L 4JPWH 2JCCE 3A67L 3LIZL 4M93C 1A14L 1ZA6A 1T03H 1U8PA 3DX9B 1UYWL 3EZJB 5ANMA 3KDMB 2NMSA 3TBSA 2EDXA 1KJ3H 2GSIB 2BNQB 3ES6B 3RA7H 5DR5L 4L3EB 2KDGA 2X10A 2P43B 5FM8A 2D3VA 4X9GA 3C6SB 4PJHF 5GHWH 1KYOK 2Z92A 2OK0L 4UT9L 4XHQA 4AY0A 1SMOA 4KKBC 1RIHH 1I9RH 2AABL 4CGTA 3PHQB 4E42B 3LRGA 2AGJH 1NBQA 1P7KB 4K3DH 2CMRL 1RJLA 3E3QC 1HHIB 5HDOA 4RGOL 2QSTA 1FFQA 1RHHB 3QI9B 1A4KB 3I6LD 4P3CL 2Y07L 1D5ZA 4MWFB 4HC1L 1MCNA 3WKNA 4PBWD 5C0JA 1DBML 4WUUA 1JNNH 5F88A 3H9YA 4YPGB 1F42A 4L5FH 1AD9B 1CT8B 1FLRH 2JB6B 1RZ7L 2WLYA 4GG6B 1P53A 3HCVA 1FH5L 3FT4A 3NMEA 4XP6L 1G7JB 4XT1C 3WUWB 2XYCA 2D2OA 4NN5B 2XZQL 1A9EB 1DBMH 3BPCB 1LO2H 2GT9B 4M1DL 3EDEA 4HIHA 2UWEB 4LPXA 1SBSH 1OTTC 4ZO6A 1IM9B 1CLZH 1DJSA 1EO7A 5TDNA 1NDMB 3KR3H 2BX5A 2WWKO 2Q8AL 4HS6B 3VXRB 4KZEH 4MVBC 4FXGA 2X4TA 1RZKH 4A2LA 3UC0H 1GGCH 2WWMD 4KQ3H 4XNXH 1TNMA 3MREA 1HHGA 5L0QC 4B5EA 1G7MA 1WBXA 1XMWA 4IRJD 5T1KD 1VFMA 3LS4H 3RKDD 1T3FA 5ADOL 3ZL4H 3MRFA 4WGWB 1YEKL 1IEAA 5GXBB 5D9SB 3MRJB 3I3EA 4R2GD 1TJIL 3Q6GH 3V79C 2XNAB 3QQ3A 1MIEH 3VWJA 3LN5A 3CCHA 4X4YA 1K4CB 1UXWB 4QHLB 4N1EA 2J6EA 1DQDL 4UT6L 8FABB 1INEH 1V7MH 1IGFL 1BFVL 2VDKL 1EFXD 4R0LB 1U8MB 1JVKA 2NY0C 5FYLL 3VD5A 1TETL 3DMMA 2P5EE 4HWUA 4DOHB 3P4OB 4MLIA 3BAEH 4NCC1 2IAND 3TESA 2HWZH 4ODXB 5EO0B 2I9LA 4L4VE 1CXKA 3D39B 3BKYL 4QCIA 3T0DA 3LQMA 1OF2B 3W39A 5L2KB 3SKOB 3FO9B 3INUH 1J1XH 3NBNA 5C0IA 2H3NB 1JNLH 4KHXL 1S9XB 3K1KC 3TYGL 2LVEA 2R0LH 3BE1H 4ODVH 2MSPA 3OR7B 5IGXH 1I1YB 3QPXL 1N3NB 2CRMA 1JE6A 1EX0A 5ALBH 3VXMA 2GI7A 4N0FB 3WYRA 3KPQB 4XP1H 2OXHA 1YMMD 3QIBC 4WHTB 5MHSD 5GQBA 5GIRB 1GHFH 5LGJA 3IJYB 4Z0XA 1SMAA 1J05B 4Y4KA 2QJDA 4C55A 2EIEA 2YD2A 1OAXL 2HRPL 3MGTA 1QRNA 4NHUB 3QHZL 4ZUVA 2GSGA 2ZJSH 3SDAD 1K8DB 2YMXH 3BUTA 4WNQB 2PXYD 2UZIH 2DM3A 4JY4A 2Y6SD 2CKBH 1PZ5B 4KGLA 1BZ9A 3QIWA 1U3HB 1MCWM 5E08H 1NLBH 4R96B 4ZTPH 8CGTA 1JPTH 4WIQA 4FQ1L 3W11D 3BP4A 1KB9J 1GZPB 4QHMA 1EVUA 3W82A 1JRHH 4EVNB 1CIDA 2VAAA 4IRZH 4QRRA 4F7TB 1S9VA 1NC2A 2BVOB 2DL2A 4WI2A 3ZYZA 4F2MB 3C87A 3ZDZF 4PY8I 5E8OB 4NCC2 1IRAY 4XCFH 3QDJB 3JWDC 4N68A 2ZUYA 4F15B 3LKPA 1BD2D 4U1MA 1XZ0B 1W72L 4UBDC 5I15H 1P7QD 5HHXL 4OCSL 2UZYB 1SY6A 2ESVD 5I8OH 4RZCA 4X7EC 1K5NA 2DQTH 1L4IA 3D25B 3V4VL 4DN4L 5HYSB 4ZPTB 1TCRB 3FQXB 1KC5H 3CDGA 3QJFB 3JV6B 2EXWC 5DUMH 3CH8A 2JB5H 1J1OH 4H1LB 3O45B 4F7CB 5D7IF 2ARJB 1X6NA 4QRUA 1U8QB 3O0RL 5K9OA 1BQUA 4JN1H 3ARFB 1VENA 5C1MB 4X6DB 2PUQT 4TVPL 4EQ3A 1OD7A 5F97E 3BUYB 4MD5B 5AUMA 3MLYH 3IFLH 5IFJA 4CMHC 4JHWH 1OP5K 3HC4H 4KMTL 2AXFB 2EEDA 1CGXA 1I9IL 5F1OB 5DO2D 3REVA 3B6SA 3E2HB 1CLYL 4UDTB 1FFOA 4QGYA 3I9GH 1KB5B 3U46B 1ZOXA 4NQDB 3O8XC 4XRCA 2DIAA 2CUIA 4PJGE 4GW5A 1MF2H 4XNUH 3ZO0A 2J8UB 1JGEA 2QKIA 5FYKU 1M6OA 1AXTH 1U95B 1NLDH 4PREB 5HHQA 4P9HH 4A6YA 3RRQA 1KJ2L 3HFMH 4ZUTB 1BFOA 1JMXA 1UB6A 2VE6B 2VQ1B 3DO7B 1MCPH 5DD3L 4JO1H 1FFPA 1JN6A 1RJYB 4OJFH 2G60L 4PJ5A 3KLAA 3L5WB 1S7TB 3BZDA 4RMRA 2HTKC 4U2ZA 4MHHG 3CXDL 1HIML 3H6JA 3TT3H 4JLRB 4L3EE 2VYRE 1VSCA 3B2VH 2XWBB 5CJ8A 1GAFL 3MRCB 5KS9F 1T1XA 3BP7B 4L9LB 1DSFH 4I0PD 4WI5A 5DDHA 3E2HC 4OGZA 1T89A 3EIFA 4AL8L 3KPSB 3RL1B 1V7NH 3KPRE 2VLJB 3QFJB 4MXWH 3FT2B 5HPMB 1VEPA 1G0DA 4W6YB 3U6RB 3VDBA 4PJIE 5H94A 2QSCH 5CGTA 4JO2H 3ARWA 1YY8B 3OG6B 2NR6C 2HH0L 1RD6A 4UTBH 4JFPB 5EO1A 5K33A 5MEOB 3RWGA 3SOBH 3I50H 3O8XA 1EAJA 3WFBH 1ES0A 2W65B 2C1PA 4Z9KB 5C2BH 2G9HA 3X3FH 1BGXH 5F1NB 4ONHA 4NOBA 3UPCA 5FECA 7FABH 5SWZA 3OWEA 3NABL 2A0LD 1KIPA 2V2WB 2AKRB 2C3WA 4LSTH 2AXGA 4XWGH 5INDB 5CEYB 1A4JB 1MCSA 3VXSA 2MPAH 3ULUE 3O2DH 1MLCA 3VG0H 1HHJA 2OR8A 2E6PA 5IM7B 3FB8B 4BSVA 3OXRA 4PGDA 4S1RH 4NRXB 1KTDB 5CJOL 5BV7C 4G5ZL 2WV3A 4JCMA 2V5TA 3T77B 4OT1L 1G9MC 1FVDA 4Y4KD 3FJTA 2NNAB 1C12B 4WO4B 3RVXD 3QUKA 5GS0C 2R2EB 4HF5H 4E41A 5HVFB 1WAAA 1A5FH 3A6BH 1JFQH 4KY1H 1NGPH 2IAMC 1B4JL 2G75B 1P4LB 5GS0L 3EYOB 1QQDB 1JZ8A 1HKFA 2FZ3B 1KPUB 4TNVF 4K2UH 3VFSB 4LLMA 3U83A 4KROC 3SEPA 2XFXA 3MROB 1NL0L 1QLFB 5CEXB 4PB9H 3RNKA 2YR3A 3DTXA 3DGCR 5JW4R 2AV7B 3NA4A 4M8QB 3SDDA 4KDVA 2YXMA 1Q0XL 3U7YL 4G8GD 4S11A 5IB2B 3GM0A 3GIVA 3G6AB 4I9WD 4PRDB 3T3PE 4LASL 2CUMA 3F65A 4YX2L 4XBEL 5D7LE 2A1WH 1CXIA 2DWEA 4LSRL 4KRLB 2IANB 4RBPH 5JW5B 4LRNL 1JYVA 1UB5A 3SDCA 4RBPK 1JHLL 3EOAA 1TFHA 4EI6B 3PJSA 3FONB 1JL8A 4XVJL 2Z91A 1J12A 5IR1B 4M1GL 4S0TD 4Z7VF 5EC2B 2MNUA 1OQXA 4OCMC 4QOKE 4MAUH 2CD0A 3VW3L 3BE1L 4U05A 3F7YA 3G6DL 4PB0H 1WIPA 1FZJB 3L9RA 4JHZA 2C3VB 2F8OA 1A8JH 1G9NH 4UV7H 5T3ZL 3OAYK 3LN9A 3D69A 1IGTB 1DN0B 3FCTA 3RL2B 2Z4QB 1GGIH 3R06A 2WUCH 4I3RL 4IRSC 4KQ4L 4POUB 4XNMA 5T1DH 4EBQH 4YDVA 4M6OH 1EHLH 2WINB 5T5NG 1UH3A 2J6EL 3KNBA 5CEZH 5IB3A 4Q58C 4Y8DC 2Z8SA 3BN3B 1CF8H 1UM5L 3R1GH 4FQ2L 3IF1A 1AD0A 1BP3B 1TZHB 3D39D 3FO0H 3NPSB 3QXAB 4MS8C 5EZJB 4YH6A 1H8OA 2V9RA 2YC1A 3BEWA 3C6LB 3ULUD 5DA4A 4EIGB 1C08B 3TWCH 1KLFA 4JVWA 3JTSB 4PRPE 5EU3A 3RGHA 5HJ3B 4U1LA 3NCJH 2VLMD 1AC6A 1I7UA 2P47B 2R56H 3VH8G 4JFZH 4XMKH 5C08D 3V0AC 3KXFD 4NKQB 3PWUB 2R23A 2Q6WA 3E8UH 5GRVL 2AJVH 2W60A 3UJTH 1FVCB 4FFYH 5M94B 1N7ML 5DHYB 1DQQB 1ZHBA 2AW2A 2V17L 5ADPH 1J11A 4ZO9A 1JYWA 4M48L 5K9JH 1NANH 3QRFM 3SPVB 2L7JA 1PAMA 5DS8A 1DEEA 1OAKH 2YRLA 1UM6L 1VACA 4JKWA 1UWEL 4P46A 5F9JA 1U2HA 4WFGD 5BZWA 2YBRB 3WXWL 3ETBF 3ARGC 1JIBA 4DVBB 4ZUWB 1P4IL 1EFQA 2CK0H 1H3TA 4ELKB 3V9FA 2EC8A 3TBVB 1I8KA 3V8OA 5FEBA 1YZZA 1EPFA 5D6CB 3HI1A 1HCFX 1TJIH 3FB6A 5CEZE 1YY9D 3FMGL 1UVQB 3RWJA 4L8BA 3SDXB 4P5TC 3QFDB 2H32A 2XWJA 4M4RA 5E2VH 2FLBT 2E27L 4ZG1A 2ZUWA 4BH7B 3U0PB 5I1IL 2BFVL 3PIQB 4ZUUA 5GISL 4JZNB 2APBA 2M26A 4PGBB 1MCWW 5CD3B 1LO5A 3P0GB 1CE6A 3CC5B 1INDH 1CDIA 4MCZA 1G7QA 4P57B 5CINH 5D71H 2CJUH 1YECH 1KN4H 1O7SA 3QQ9C 5I8CA 2E6QA 3MFFB 3T0XA 2A6JB 2VLJE 3QFJE 5I1KL 1IZKA 1FNAA 1AR2A 4MNGE 5TF1L 1X5ZA 2WIIB 4HHAB 3PGFH 5FKPA 2VR9A 3OF6D 4ZFOL 3BDYL 2PYFA 3VXUB 1YPZB 4X5WA 4JE4B 1J5OL 3BIKB 4WCYL 4JHAH 4MJIA 1EFXA 1HN1A 5LWYL 1M7IA 2ADGB 1MHHA 5E6IB 3SGDH 4XPHH 3AGVA 3EYVA 2CLVB 1Z3GH 3CMOH 4LKCB 1E6JL 1X7QA 3KPSD 4G8GE 4UILH 5DD5H 5FOJA 2DM2A 1G7IB 2MOVA 4BKLA 4HLZG 3MNZA 3WJJA 3BVNA 2VZOA 1I7ZA 3PWPB 4IBLT 2A74A 2BRRL 2L0DA 4TQEH 2Q86A 2W9DH 4NZRL 3ARRA 4K55A 4XBGA 5DI8A 5HYJB 2NLJA 2YRPA 1K9TA 1CGUA 3RNQA 5C7XH 5C2BL 2KH2B 4ONGH 2V2TB 3QZWB 2VITA 1T4KA 2AXHA 4YK4C 5JO5B 2QHLA 3KPLB 4QXUH 2PCPA 2P1YA 2VZ3A 1ZS8A 1EEYA 3VFPA 1GPOL 1T1WA 3DURB 3HPLA 4LL9A 1X4ZA 5CD5C 2H1PH 5FKAA 5L6YL 3GIZH 2NY6C 4U1SB 5T1KB 4CL7A 5T3XL 2XA8H 3SDAC 2W07A 4P2RD 3L5HA 4LSDA 3KYKH 1QEWA 2FBJL 4JO4L 3MO1B 5IMMA 4NQCE 5CGYC 4PJ7F 2X4UB 3WKML 1I1AB 5B3JE 3HZMB 2JJUA 3CIQA 3REWB 1KXVC 3D48R 3DIFA 1ZSDB 2IFFL 1G9ML 5CZVH 3RWCA 4Y5XA 1KELH 2FECL 2F54E 3WIFA 4NYLB 5J12B 5JDJA 2VQTA 3L7EB 3OF6A 4UTAL 5FO8A 3VXQA 4ZXBC 3WXVH 1AKJB 2VLKD 1JF1A 4KUZL 3KJ4C 5EU7E 3OKOA 1TMCB 4KKCC 1ZWIB 1IFHL 4H25B 3ZYJA 5E9DB 1RPQA 3GSOB 4M61A 3S36H 2A77H 2IH1A 3MLRL 4OUOA 5JQ6L 2DQHH 4HUMB 3UXFA 4LVHC 4L8CB 2DICA 1MI5A 4PG2C 3WIHL 4Y2DC 1MREL 1IT9L 4OFVA 3DVGB 1AGEA 5A16A 2P5WB 1OD9A 4NPYA 3MBEB 3O6ML 2PYEB 1HKLL 2R1WA 4B7IA 1NFDF 3QIUB 5CBAA 1DQJA 5J9PB 5EH1A 4J3TA 4M1CD 1EO5A 1UM4H 4ZS6D 4KGJA 1OGAB 3P9LA 4LSSH 1D9KA 2BCKA 3UTSE 1LK2B 4Y19D 5TQ0H 1J8HA 3JV5A 5ALCH 3S36X 3O6MH 2HTKD 4EOWH 1F3JB 2H8PA 2FD6H 1CGWA 1UWGH 4NGHL 3EO9L 4FQCL 4LSPL 2WBJD 1EAPA 1F4YL 2I60L 3LH2H 5TPWL 3G5XA 3QRGL 4U6VH 3V5KB 2VDLL 3AU1A 3P0VH 3SQOH 3W0WB 3WIIH 3CH1B 1UA6H 4U6YB 2DN7A 3IXTB 3DUSB 2YS4A 1MFDH 1WZLA 4U1HA 5HVHB 4WFFE 4JRYD 2XG4A 5KSVB 1S78D 5D1QB 2A2QT 5I1CH 2HFFA 1CLOH 5C0AA 3QAZC 5MENB 3M45A 2ZSVB 3KHOA 4I18A 4EDXB 1MAML 3IDYC 3DX7A 5D2NA 5HHME 4XPTH 4AM0A 3SQBA 3LS5L 1F4XH 4OGYL 4UT7L 4J4PA 1HWGB 2P7TA 4GUPB 1SVZA 1VGEL 2CLZA 5F7WC 3V4UL 4LVEA 4OKDA 1PLGH 2Y7QA 3BHBA 3C5ZB 1QPXA 3IU3B 3EFFB 4LF3A 5SX4I 5J6GB 2HFEB 5TFSH 3QZWG 4QHNB 2YD7A 3KJ4B 1H3VA 1QBLL 3D3VA 5KVFL 1E27B 5DTFA 3BIBX 4RFNC 3WHE0 3ULUH 5E56A 3IJSB 4KKLD 4WY7L 4GOSA 1VGEH 1WT5A 5I8EA 2WBJB 2QSCL 1P6FA 2IPKB 1MJUH 1RZKC 3QH3A 4LSTL 4XWGL 3RY6C 2BVUA 1DCLA 1FO0B 3QA3A 1WC7A 3IS0X 3QWRD 3HRZB 1KEGH 4LPCA 1KPVB 1DUZA 1E4XH 4KK5C 2MQ0A 3C6LC 1HEZA 4JFYA 4H88L 2RCSL 1PSKL 3ULUL 3S9DB 2NPLX 1FPTH 4CVUA 4V1DE 3L5XL 5T1LB 4MSWB 4NQVA 3UYRL 2FJHA 2FIKB 3NCYP 2NY5H 2KBGA 2C5DC 1VA9A 5BO1H 1K6QL 1E4XL 1CVRA 2RIKA 3TF7C 3F5WA 2X7LB 5IQ9A 5TQ2H 3KS0J 2F74A 5IW3A 1OAQL 5I73B 5E00A 4WENB 5IOPB 5KG9A 2GEEA 4UINH 3PDGA 4WW1B 4TUKH 1WITA 2SEBB 5DMIL 1OARL 1FG2B 1U8NB 3VMOA 3GI8H 1G1CA 5KVDL 3NOIA 2JF1A 3PABA 1T21B 2VLRB 2GJ6D 3MRHA 1LWRA 3BP5A 1IGYA 4JR9H 3VFMA 3MV9A 4M7ZC 1JUFA 1LP9A 1YMME 1LK3L 1YYML 2ZNWA 2EYTB 1WF5A 4GFTB 2BXZA 1NDGA 4L4TB 4TPRL 1JWMA 1MIEL 4QWWD 4ZSOB 1HH6A 3K3QA 4NQCD 1YPZE 4OM1H 1TLKA 2B20A 3QXDA 4J23A 3NACL 3GI9L 3R0MA 1BVKA 3X12A 1QOKA 5BQ7B 3HC3L 3DXAE 3GSNB 1RHFA 3UROR 2FR4B 4OZGE 5I1EH 2XXMB 3OAZK 4G6AD 1BLNA 2BNUA 3IAGC 2Q20A 5EOCL 3G08A 1NPUA 2HJKB 3VG9C 4YHOL 3U30C 1N59B 5HY9A 4LFHG 1IAII 3LDBC 3GSWA 4PJXB 4P5TA 2XZCH 3QWRA 5HHOB 4PRAA 4UB0L 4HW6A 4RIRB 1MHCA 1J1XL 4NUGH 4D3CL 2VKWA 3HMXH 2ESVB 3D0VA 1RMFH 4IDJL 1RZ8B 2QQLL 2EDEA 1XGUB 4J8RA 2YMXL 1UJ3C 5FV1L 4M1CC 4YIQA 4XPGH 5ANME 3L3KB 4HBCH 1EEUA 4O2FB 1CWVA 5EWIL 2R0ZL 5ICXB 2IAMB 3TIDA 4Z5RB 2DDQL 1A3RL 1FP5A 3HMXL 3ILPA 4WFHD 5ICYB 5GRYA 2P8LA 1OT2A 4QHKI 4MA1B 4KKNA 4QO1A 3T0BA 3TH4T 4G7YH 4JG1L 2D7TL 3C60A 4JO3L 1G9NL 4C59B 4MAYD 4X4XB 5FHBH 2NTFA 3O3BB 4AK1A 5E1HB 4OIIL 3VH8B 2VDNL 1DL7L 4RGOH 4HK0B 4JY6A 3BW9B 2CXKA 1QA9A 2OTWA 2E7MA 3VDAA 4DN4H 5EIIB 2CXGA 3U4AA 3VGBA 3PP4H 1HXYB 2EE9A 4O00A 5JA8B 1OSZB 1CK0L 1L0QA 5A40E 1MY7A 4NP4H 3RUGA 4PGEA 4HG4K 3R1GL 3BZEA 5EFIB 5IEKB 1U58A 1SYVB 1CDBA 1S7QA 3C2AL 1KOAA 1VFOA 4XWOC 4RFEA 4NZTH 2J5LC 1D5MB 5ID0B 2DKMA 2PXYC 2VL5B 5EU5B 3B3IB 4ENEC 1R5IB 1MFAL 5E8DL 1JNNL 1WTLA 5IT2L 1CFQB 1LNUB 4P2YA 4U0RC 3GGWA 2EDWA 1UH2A 4XMPL 4QHUA 5HDQL 1HYSD 1NEUA 5EU6B 5GRZA 1T66D 2BZDA 1UCBH 3RGVD 5GRVK 5MEPB 2BNRB 1U8LB 3Q3GB 4JRXB 5IESH 3TCXA 3O0RH 4K9EL 1YEIL 1WWCA 5DUBA 1RJCA 5E2WL 1KUMA 3EJYD 4PJFE 1R3JA 1PX4A 1QO3A 2I27N 4WVRA 1RK0A 2NX5B 1FFRA 4KI5F 4KVNH 1MF2L 4XNUL 4XMPH 1F00I 5EUOB 4JJ5A 3KYAA 2FX7H 2ZSWA 4UUJA 4KAQL 4K8RH 5FV2A 3D6GA 1OCWH 1S9YA 1VKXB 1XR8B 1T0MB 4FZEH 2EEAA 3BOVA 3MRMA 5C9JB 1M05A 1MCPL 5F9WB 2VR5A 5I2IA 2EKJA 4JKPH 1L7TL 3IDXH 5AZEH 1T89C 3QUZD 4G42A 5T1MB 3ZE0F 5TDOA 2VLKA 4PJFF 4PYGA 4Y5XC 4M6AA 3HE7B 1QYGH 4Z95L 4Q9RL 4U6XB 1ZHLA 3BH8B 4Y16B 3STLB 3VCLA 3QCVH 1KN4L 5DRXA 4MQXC 2ZUQB 5IHZB 3Q0HA 4L8DA 1MUJA 5DJDA 1DANT 2VDML 4N1CA 3AM8A 3ZKND 3GKZA 3H2WA 4O4YL 2CK2A 4Z7WB 4BQ6A 4LQFL 5I0ZA 2B7DT 1AHWC 5FGCB 1A47A 1DQDH 5EPMB 3HRPA 1KYOJ 5E8PA 4BYHA 4D0BB 1OPGH 4M02A 5CS7A 3RFZC 5B39B 1ZEAL 3BT2L 1A1MA 3NFSH 4ZDHA 2AJ3A 3FTGB 4XHJD 4EUPA 3QPQD 4NQEA 4PLOB 5FO9A 4F57H 1DVFB 3BP6B 4HV8A 1TZIA 4YQXH 5E1AA 2NQCA 1JRHL 2JCCB 3EO1A 4MCYB 4ZYKB 2IQAB 5DD0L 1JGDB 2IPTH 4KWUA 5C0FA 1W2KT 3AXLB 1J5OH 4HUNB 5I6XB 4U0QB 2CDEB 1C5BL 3ZDZE 1NBYB 3V5HA 3ZT6A 5KTEH 3WNLA 1SJHB 2VR4A 3FN0L 3OKDB 4ZFFB 1NLBL 2A0LC 1NCUA 2ICES 4PG9A 1JTPA 1JGUL 1WFUA 4K23H 3EYUH 3WS6C 4MDJA 5CGMA 5I1AB 4J12A 4Y19A 3B9KB 4WUKL 2DI9A 4HWBL 4PJGF 3VXRD 4FFVC 3PWNB 4X7TB 2APXA 2Y06L 3BSZH 3QUXA 3MLVH 5C92A 4P2QD 4MB4A 3WLBA 3IFPA 1B4JH 2HLAA 3QQ4A 4LLVA 5JPMA 4POZD 4H88H 4WU5B 3UTTB 3UEZA 4R7DB 4D0CB 3MRNA 4ORGB 5FOBB 3MJ7A 3PGCA 4JFDB 2W0FA 3DOSA 1KGCD 3C09C 3LEVL 4WWKA 3U36A 3RWFA 5AG8A 4OT1H 1EUTA 2AK4E 2F9BT 5FHAH 4O2CB 5D7JA 3ZT5A 3THML 4JRYA 4Y4HD 4HAFA 2DMKA 2NW2A 2GCYB 4NRYA 2IEPA 1RUPH 1OAQH 3O4OC 4YHIB 2BSRB 2ILLA 1WT5C 2NY6D 4KUZH 4Y16D 3DRQB 5C0EA 4Y4HB 3QIBB 4AZ8A 1DQMH 2G5BA 1UKQA 5FK9B 1ZT7A 3QIWC 3QAZB 1I8MA 2VN4A 4JFHE 1XGQB 3T1FB 5JPNB 5IBUB 3EJZD 3FRPG 5DJXB 1NBVL 4WHYG 1QNZL 1TNNA 4KI5D 4JFQA 5GJSL 2IALB 2X40A 4LLUA 4YHPB 4AENA 3GJEA 5FDYA 3VXPB 3O2DA 4OSUH 4M7KL 2VDRL 3DXAB 4G6FD 1NCDH 4MA7L 3UJJH 4MJ5A 5CJ5A 2NY2C 1O0VA 4X4MA 4CJ0A 3SCMA 5D93C 1BVZA 1FV1B 4TNWF 5EUKA 5DURD 3D85B 4J1UA 1BBDH 1AQKL 4U6HA 2MCPL 4K7FB 1S7SA 2CSPA 1XF5A 1QFWL 3OTTA 4Y1AE 4XNQA 4OCXH 3ROLA 4FXKB 4PJCA 5CMAA 5BXFB 2R15A 5TPWH 4UB0H 3HUJA 1EV2E 4H1LG 4PJ5E 2J88L 2EDLA 3DVNB 5D2LA 3BWAA 4HUKB 2DJ4A 1JV5A 2RR3A 3TFKD 2A9MH 3RIFF 2DQFA 1FH5H 1NCAH 5JHLL 4OZIE 2J8HA 5C0DB 5CCKL 2H6PB 4Q9QL 1BVLB 3QNXA 4M4PA 5CIPB 3GSXB 2D7QA 4U7KA 2DDQH 2P48B 2UWEE 3MA9L 3X3FL 3I6GB 3P4MB 1YC8A 3TIEB 4AL8H 2VJXA 4KTDL 1FNLA 5BW7A 3VWKD 3ZKXC 4KVCL 5J12C 2FX8H 5F3BA 1HDMB 1FVEA 4POZC 3V4UH 1HIMH 4PG2A 1HI6A 3IAQA 1Q0YH 3E6FA 3VGAB 3ULUC 1P4BL 2P44B 1DBKL 1U8JB 1T5XA 3UZVB 1MQKH 2ZOLA 3WD5H 3ULUF 1VGKB 2A73B 2XKNB 3QULA 3NN8A 2CMRH 4X8JB 1CLCA 4G9DA 4ODSH 3RZCC 3DRTA 1EIBA 1URLA 1BPVA 3OJ2C 3T3PF 3VFWB 4G9FA 4HIEB 5ESQB 3KPPB 4HWEL 5J1AB 3BKCH 4Y5VA 1YN6B 1E6OL 5DC4B 1YEGH 1NAMA 4OZ4B 1M71B 3QIBD 4X5XB 4ZPVA 5E5RB 5J11B 3NZ8B 1FFNA 2APFA 2VABA 3IDMB 2EYRA 3Q6GL 5KSAA 4QKXB 1PSKH 5HBBA 2FX9L 3SN6N 4P3DB 5EUOE 1CDYA 4OLWL 5DSCB 3CVHA 2BOBB 3ZKQD 1Z9MA 3VFTB 1EH9A 5FUZL 1E6OH 4FRWA 2UYLA 4HKZA 1ADQH 3FO2B 5M95B 5GGTA 1O7VA 3VGDA 4KKAD 3ARGD 1XF4B 1KT2A 1JF5A 4E41E 1BBJB 3LKRB 3EYQC 5A3IC 1LO0H 5E9DE 5CLWA 4FFVD 4IRSA 3KYMA 3G5VB 5BOZG 5DWUL 4HKXB 4ETQB 4XAWL 3V6ZB 1MFEH 1UWEH 3AC0A 3V4PH 2HAZA 4PIRF 3RDTB 1NFDA 1WEJL 5EIQA 1FCCA 4UV4L 3UC0L 4YX2H 2OJEB 2VDQH 2FO4A 4Q7DA 1K6QH 1F97A 5LAXA 3LB6D 2X4QA 3EOTL 2P45B 5IEHA 3ZMRA 4ZUSB 5J6HB 2J8OA 4G6KL 3ILQC 1P6AB 3MLWH 3WHXB 5I1DA 4HGWB 2ARWA 3VGEA 2YUVA 3BZFA 2C7UB 3T3MF 2IBZY 1IZJA 3TVMA 1YMHB 1IAOA 1OTUD 3FO1A 4M00A 1DBAL 1B0GB 3MZTA 3O41B 3QDAA 2VDKH 2YXFA 4P9ML 3FRUB 4UDUA 2DS4A 5CIPH 3UBXB 1IKNC 1JWUB 4XPHL 1TITA 4DGYL 3EOBB 1YYMH 1QFWM 3EYFA 4P48A 2E7HA 4N0UB 4PBXA 3O4OB 5FM5O 5HHNA 3O11A 1HQ4B 4M1GH 5FA4B 5GGTL 3T8XB 4P3CH 2HKHL 1H0DB 5MEQB 1QFUH 3BQUC 1LEIB 1EJ6A 1AQDA 3C6LD 3RDTC 4HCRL 2BSTB 3QHTC 4KH2A 2P24B 3LKQA 3KVQA 5DQ9B 5ABDE 1A6ZA 3BH9B 3S5LA 3PWLB 4X6BB 4OLYH 3UTQA 4PJ9A 3I02A 3VXSD 3CDCA 1RIHL 2V9TA 4RMVA 1RSFA 3I84A 2NXYD 3CPLB 3CMOL 5T5FL 4Y2OA 4XP9L 3IJHB 4NQXA 5HDLA 3WL9A 4EKXA 2MFNA 1I8IB 3O6KH 3QO1A 2KPNA 3IVKB 4Y5YB 5GGUA 1R5VA 1IGCL 1RK1B 5CZXD 1TTGA 1R3LA 1JK8A 2R39A 4QGTA 2GJZB 2GITB 2DB8A 5CP3A 3LPWA 1DQLL 2NXZD 2V6HA 1RFDH 3K8MA 4QTHA 4P49A 4N9GB 1NCNA 2K9UA 1A21A 4QRSB 5DQDH 3F58H 3SJVE 4WJ5B 2YA2A 3C5SA 5FYJU 1W72H 1IQWH 2AK4B 3GBLA 5F89A 5IVZB 2YPVL 1J1PL 1SM3H 1ZHNB 2ED8A 4F9LA 4AEHL 3CFKA 1T7ZA 3CMGA 4WUKH 4WI8A 3KPRB 3TBTA 1WCBA 5DK2B 3O6FA 4JDVA 3T2PA 5D72H 5BW7C 2OI9C 1X5HA 4R2GC 2FECI 4HUXB 3HKFA 2HMIC 5E8NB 4GS7B 3DGGA 3MR9A 3QDJD 2EIZA 1EGJL 4BZ2L 4HIJB 2O93L 5DEGB 5FM4A 5LCVL 4ODTH 1BQHG 2WBJC 4BFIA 5FGBC 4X99A 4X7FC 3AS3A 3ARTA 1S9WB 2DBLL 4OF8A 2J8UE 4M1DH 3ZKXB 1EXUB 2IADB 3MNVB 4NQSA 1Q9WB 1R3KA 4DFIA 2VQUA 3TT1H 1TETH 3WS3B 1UC6A 1ONQB 4MDIA 4PJEB 4PLKD 4MXVF 4NNXA 3Q5TA 4Q0XL 3OHXB 2LTQC 5F3HB 1QSEA 3MOBL 2OP4H 3MRQA 5FYLE 3Q1SH 1AGFA 1FSKB 4ZOCA 1H15A 3JVGA 3VD4A 3GBNL 5GRJL 3BJLA 3AY4A 1FYTD 4XCCL 5I8KH 4WI4A 3HC0B 3NIGF 2HJLB 4JANA 5IGXL 3TA3A 1EHAA 4RAVB 4FNLL 1MFCL 1FSKC 2OMBA 4PR5A 3S35H 2GFBB 5ALCL 3SO3B 2OP4L 4KZDH 5C0RH 1OGTA 5EN2B 3VFOA 1I9IH 3MC0A 4KPHL 3HFML 3IFOA 2AK1H 1MEXH 2ZCKH 4JPVH 4GW4B 3QHFL 3RIAF 4E5XB 4DCQA 1D9KC 2DBJA 4DZBB 2JIXA 2DD8L 4KJQC 1BIIA 4OZFG 3V52H 1T1ZA 3IKCB 1NMAL 4HH9B 4YHYB 1AO7E 1IQDA 2OL3L 4QT5B 3MUY1 5TH2B 5E7BA 5C0CE 4KZDL 3CLFH 2MWCA 1N64L 3J8F7 2YPLD 4D9QD 4DQOL 1DDHA 4I0CC 2ZG3A 2V5YA 3O8XD 1G6RB 1KEMH 2F19H 3HNVH 4GS7C 2VIRA 3EO9H 4OFYA 1S78C 4KJYA 2DQEL 4Z7UE 2XXCB 5LGHL 3L6FA 1Q9LA 5IK3B 2J5LB 4NQTA 3SKMB 2FSEB 3IGAA 2YEZB 2A9ML 1OAXH 5DEFB 5B38A 1NCAL 3KPNA 2CJUL 3RWIB 3OAUH 1GGTA 4KTEL 1TVDA 2MQCA 5HHVL 1JGLH 5E4IA 3QUXC 3LZFL 1QBLH 3CFIC 4LQFH 1KN2L 3RJQB 1JPTL 5IVNA 5JW4Q 3T65B 3TYFB 1C5CH 3H9HB 5IMLA 1UZ6F 5HYFA 3JV0A 4XX1G 4HX1A 3EGSB 1RURL 3TCLA 1ED3B 3KYNA 4O51A 4GRWE 1FIEA 4KTEH 1QSFD 1E4JA 4HC1A 2HRPH 3GHEL 4LMQI 3EYSL 4HXAL 2BDNL 1ULVA 3LZFH 4J4PD 4NO2A 5TE7L 1OHQA 2DKSA 4YDJB 3QUYD 3MA7A 1CICB 4Y1AD 4CNIB 4YQXL 2Q1EA 5KVFH 3DVFA 2X4OB 3OPZH 4HFWA 4BH8B 4QXUL 3QDMA 4PJ7E 5JIIA 4IIQB 2OM5A 5TE7H 2F15A 1K4DB 2Q76B 3U9PL 1T1YA 4GKSA 4HF5L 2B0SL 1KLUB 9CGTA 4JPKH 5DK0B 4E41D 4O2EA 1N0LA 1J0ZA 1F5WA 3HNSL 1QSFA 4FQXD 3T4AA 5D7LB 2CQVA 1OARH 4JFEA 2ID5A 4NQCA 1MCQA 2Y6SC 5B4MC 1ZVSB 5HD8D 1JZ4A 1E4KA 2ZOKB 4LEXH 4CUCA 3LQAH 4IRZL 4YC2C 3CSYA 3KPTA 1QBMH 1K8IB 2J4WH 3LV3B 4RQQA 5DMKB 3QISA 1C16A 3G5ZB 3CSPA 2P5EA 1G6RH 1N0XL 4GG8A 2EH8H 4HG4J 1AJ7H 4R97C 4MNQB 1CTNA 4UV4H 15C8L 5ERWA 2X4RB 4JVPA 5F70A 3V2AR 3C8KB 4EI5C 1JGVH 3RVVC 3OKLB 3UJIH 5JQ6H 3MRRA 1A1OB 2YWZA 1XH3A 3L3HA 1W8OA 2QR0B 4APQC 4ELMB 4D8PB 1K85A 5EULV 1MI5E 4CVZB 2ZG1A 2EH8L