4R7RA

Crystal structure of putative lipoprotein from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
122
Chain Sequence
AKPSLNYHTKNLSELVSNIKIRLLDMNIYSEVIVDNEDVRIIDDLLKSLKDSNFINEEALPNKPLYKIFIDLNSEKYVIDIYGDDLITLYPWDSDVRKDYLSLKDIPNSFKLEPFCQYVFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Lipoprotein from Clostridium perfringens
rcsb
source organism Clostridium perfringens atcc 13124
molecule tags Lipid binding protein
molecule keywords Putative lipoprotein
total genus 26
structure length 122
sequence length 124
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16224 DUF4883 DOmain of unknown function (DUF4883)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.410 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4r7rA00
4R7RA
chains in the Genus database with same CATH superfamily
4PDBA 5LMUH 4XX0B 4QWCA 4NXMH 1XNQH 4ZOLF 4J9OA 5FD5A 1UNNC 5KFIA 3I12A 3FKIA 5D8DA 5IYZF 3Q8QB 4GLXA 5IT9W 2ASDA 2V4RA 3CQZA 5C5JA 2PBZA 3MR2A 3TQ1A 5D1PA 3VMMA 3K3PA 2DPJA 4MV8A 5CA0F 2XGQA 2R7KA 1AUVA 2R7ZA 3SE7A 3EPIA 1C3OA 3GTKA 1XDNA 2O03A 3TINA 4ECQA 4DV7H 3I4MG 3MR6A 5KFHA 4J9MA 5K2MA 4RNOA 2BQRA 1DIKA 1DGSA 2ATLA 4A3DG 1E4EB 3RFCA 4B3RH 1I7LA 4KHPH 2DZDA 3MWDA 2XC9A 4YAKB 3T5JA 4UCOA 4RB3C 5EDWA 3OHAA 3RGZA 2VQEH 4ED2A 2ALZA 2W6ZA 3PZPA 4ED7A 1O75A 4EYHB 5KFLA 1AN7A 1V4YA 2FLLA 5HBRB 1K1QA 4O4IF 5I47A 2OWOA 3JRWA 1FKAH 1BJTA 5HV6A 5KFBA 1E4FT 4ECUA 2PMZA 2JA5A 5C4XG 4A3LG 1B6RA 1DV1A 4EBDA 3PR4A 1EUDB 5CB4F 4RZRA 3E5NA 4ZQIA 5IWAH 2VOBA 1S03G 5KG0A 5GONF 2WB1E 2WAQA 1FJGH 5F9LA 4XYLB 4YR0A 5KT5A 4ED1A 1N48A 5KT7A 2JA7G 5L9XA 3JSLA 1SFOA 3PW7A 1V9PA 4F4WA 3K3VA 3KXYT 1IBKH 4BBSG 3R5FA 5C1PA 4LF8H 1IBLH 4QIWA 4J9KA 2AU0A 2AQ4A 4AYBE 2W6OA 1KJIA 1ZQ7A 5LOVF 1Z2OX 5D1OB 5FD6A 2R87A 2NU9B 1N34H 4O2AF 2W6MA 4GKJH 3BQ1A 1GGOA 3V4SA 4I55F 3TQTA 4FBTA 3J80W 4HQ6A 2R7MA 5KG6A 2ASJA 2R8KA 5FLMG 4MV6A 4RB2C 3GV5B 5L1KA 4HNTA 1JLLB 1RJPA 4GKKH 1S10A 4DLKA 5LMNH 2RGRA 3HOZG 2JA7A 2RGVA 2UVUA 4LFBH 3M9MB 4M7EA 2W70A 1FVIA 2C22A 1DV2A 4C5BA 1TWCA 3WNZA 4QWAA 5DLFA 2HGSA 2PN1A 5KKNB 1ULZA 2YRWA 2VPSA 3N40P 5KT2A 4QWEA 2AGQA 1UC8A 4DL6A 2VA3A 4FBUA 1IOWA 2YRXA 2ASLA 4QW9A 2BQ3A 1JXLA 2FB9A 4JI2H 5KFGA 3LP8A 3K5IA 2YZMA 4FU0A 2YS7A 2M05A 5CAEB 4CC5A 2W7OA 4LF7H 1S9FA 4J9NA 2VR1A 4A93G 4NLGA 3H20A 4TV8F 3J81W 2GPWA 2YU9A 3RGXA 5KT3A 4LSXA 4DR2H 5T14A 3PW5A 2R93A 5KG4A 3PW2A 2J6SA 2IBKA 3ETHA 2R82A 4O4HF 5IYCG 5J2TF 4I4TF 3HOYG 1EHIA 4ECXA 5L1IA 4UCUA 5IYBG 5KFSA 4DL2A 5KFDA 2ZM6H 2I8CA 4QWDA 5FLXW 3T1YH 5DG7A 1CQIB 1SCUB 4EEQA 4LF9H 3T5HA 2XGPA 4YR2A 5FPRA 4B3TH 4FS2A 4ED6A 3FKIG 5DQHA 4MV9A 4AYBA 4YY3H 1GLVA 3KALA 4TV9F 3TIIA 4DR1H 3HB9A 2V5AA 1KJQA 5DGBA 4F4ZA 4DV6H 4ECZA 2DWCA 2R84A 1E4GT 2WDTA 2W7PA 2FPPB 2FMAA 4I7HA 4ED3A 4YJ2F 4GC6A 5D1OA 4RUCA 1M7JA 3BA9A 4EBCA 3H4BA 4MV4A 2DIKA 2V4QA 5BPHA 5DG9A 4TUYF 3OSNA 3GIQA 2WAQE 2WB1A 5EWEA 2FLPA 5EOYA 3JRXA 1BGWA 1B04A 3L4KA 4ED0A 2IA6A 1VBGA 3RUPA 2R85A 3H40A 3R23A 4DL3A 3I4NG 4ECYA 4WBNF 4ECSA 1I50A 4BWSC 1KBLA 3RB0A 5L1LA 1HNWH 1XMQH 3HOVG 3GIDA 2AGPA 2W6QA 4O3QA 2VPQA 3L2PA 2NU8B 4IWYA 1I94H 4BBRG 3VPDA 4AQYH 3DF7A 4UCTA 1SEIA 3RB6A 4DR5H 4IR9A 4O4LF 1K83A 2RDIA 4HNVA 3GTLA 1S0OA 3VPBA 4MTDA 1WCMG 3QFFA 3RV4A 2YYAA 2R93G 4L1KA 4M9UA 1GYFA 3M4IA 2R92G 3OUUA 4UCVA 1EUCB 1T36A 3HXLA 4IHJF 2B63G 3GIPA 4UCRA 2WYOA 4RB0A 4WD3A 4I50F 2JEJA 4QW8A 4DV0H 2PVPA 2HHHH 3GTGA 3RAQA 4J9QA 4A3MG 4Q44A 4Q45A 3BG5A 5IP9G 5KFEA 3MWEA 3BJYA 5DGAA 4OX9H 2DPIA 3KAJA 1P8LA 4QIWE 2UU9H 5FPOA 1N32H 4MA5A 1KJJA 5LP6F 3ETJA 4LMYA 3OHBA 4RZQA 3MR3A 5JVLA 3ORRA 3R5XA 1VKZA 4EG0A 3KHGA 3V6HA 3AYHB 4APMA 3RAXA 2W6NA 5DG8A 4F4YA 3GTMA 2RF4A 4DR3H 2XIGA 5EWFA 3GIKA 4A3EG 2C28A 2R7ZG 1X9NA 2XCAA 2FJZA 3NGDA 3H0GG 3BQ2A 4YBZB 2J6UA 2B63A 3RBEA 1I7NA 3R5HA 2CKZB 4XYMB 5C44G 4DV2H 2NVYA 1WCMA 1TWGA 3PO3G 1TA8A 1CS0A 5IP7G 5EWGA 3MJFA 2R86A 4YQWA 2I87A 1WH2A 4RNMA 2C35B 2VA2A 1BNCA 2HJWA 3PW0A 3N6XA 3RTXA 4ED8A 3GIIA 1WSCA 4NXNH 1JKJB 3JZIA 1J5EH 1BXRA 2W57A 3U9TA 4DUYH 1M6VA 2E2IA 4EEYA 3FDSA 4TQSA 3V6JA 4LF4H 4O2BF 5KFAA 2UUAH 2HVQA 4O3OA 1I3QA 2V59A 4A3GG 3N43B 4ME6A 2JA5G 2R7NA 3H3VH 2YW2A 1Y1VG 1KEEA 3HKZE 3GQCA 4MV3A 5KG2A 4JV1A 2Y0SE 4JV5H 2FP4B 1GSAA 3JSNA 5JQWA 5C3EG 4C2MA 5KFKA 2UVVA 1Y1WA 1IBMH 4LF6H 3IG0A 3LMLA 2X0SA 1Z2PX 5KT4A 3RB3A 4JI1H 4RNNA 3BAAA 5KG1A 4EFEA 3PR5B 5EZYF 2F4VH 4ZI7F 2XCPA 2VQDA 3IN5A 5KFZA 2UVRA 1RK5A 1GSOA 4JV0A 2R92A 5JH7F 2ZDQA 4DR7H 1XMOH 2JA6A 1E4EA 1EZ1A 3M9OB 3UFXB 3SI8A 4MTEA 5C8YF 4Q8FA 3T5LA 4O3RA 4YHHH 2UXBH 4YJ3F 3RIZA 4UFZA 3HOXG 1JDBB 3TIGA 5H80A 2UVWA 1K1SA 2C2EA 4DL7A 4XZ3B 1PX2A 5A2QW 4G3IA 4JI5H 3H0GA 1SYXB 4EGJA 4YAJB 4ZHQF 3OUZA 2JEIA 1VBHA 2IMWP 4DV4H 1W96A 4FM9A 1N56A 5LXTF 1S0NA 4F4XA 1HNXH 2OLSA 4IWXA 1ZETA 1B33N 1PK8A 5KFVA 2HVRA 3KTMA 2ZJTA 4O3SA 2FK2A 4TQRA 1UC9A 3CVZA 2C2RA 3U9SA 4PWQA 3M9NB 1RYRA 1W93A 3RF2A 4ECVA 4A3FG 2VUMA 4Q8EA 4LSAA 5JUMA 2ZDHA 3N41B 3MFHA 3EPGA 4JYAH 4A2AA 2R8GA 2ZDGA 4IZOA 3MFIA 3H4DA 1CE8A 3PW4A 4JI4H 1TWAA 5KFFA 4Y8VB 3V6KA 2R8JA 4U6PA 2V58A 4EFBA 4RAYA 4J9LA 5KFRA 4J9SA 4C5AA 3GIJA 2J6TA 4A3BG 2CW7A 2FPIB 5KFXA 4C5CA 3KAKA 4UCSA 2P0AA 3L4JA 1S68A 2NU6B 4X62H 1Y1WG 2YZGA 1EYZA 3HKZA 5CA1F 4A3IG 2Q2UA 4JI7H 1JDEA 3PN1A 2R6FA 3GLKA 3RB4A 1C30A 3Q2OA 3Q8SB 2JEGA 2CZGA 4BY7G 2YZNA 5KFNA 4DR4H 1VAJA 2YL2A 3GV7B 5L1JA 2MCTA 3WO1A 4YP3A 3N44B 4HYKA 4JV2A 1S97A 4LFCH 2W71A 2NU7B 3Q8PB 2UXCH 1Z2NX 3WO0A 2V9WA 3PO2G 1L2ZA 2E2HA 3QZ7A 3GV8B 3RJ0A 2R8IA 4LH6A 4RB1A 1ZHQA 5C1OA 1N33H 4J9RA 3G8CA 2JA8G 3HOUG 1GO3E 3F8NA 1N36H 3FMAA 4X65H 4LF5H 3G6VA 2QYZA 4QWBA 2BQUA 1IOVA 1S0MA 2KSWA 4MA0A 3VPCA 5KFTA 5LA6F 3QZ8A 3MR5A 2FKLA 2JEFA 4R8UB 3KHHA 4CC6A 3HOWG 1KJ9A 2R7LA 4ETSA 2C2DA 3T1HH 5KFQA 3GTOA 4GC7A 2Y0SA 3Q8RB 4B3SH 2W9BA 4JI0H 5J2UF 1RJQA 1XNRH 3PVXA 4J9PA 2UUCH 3N8DA 3C0FB 2FK1A 2GLTA 5KG3A 5BR8H 4JI6H 3JAMW 1M0TA 3BQ0A 1T94A 4IAJA 4MAMA 5KG7A 4X66H 1RYSA 4DR6H 2UXDH 2AGOA 2NVXA 4F50A 4Q0YA 5BMVF 3RBDA 1VS0A 5LYJF 5LL6b 2YCHA 3G6XA 4DL4A 4LFAH 4R7RA 3GTQA 2RDJA 5KFCA 5KFWA 4IRDA 4EYIB 1GSHA 1Y1VA 4DUZH 4JUZA 1JIHA 4DV3H 3KHRA 3OSPA 4IRKA 2C00A 4Q43A 4JI3H 5KFOA 4YR3A 2BR0A 4MV1A 4A3JG 5DQGA 3V4ZA 5DQIA 1MZBA 4RAZA 4E4TA 4MV7A 5F9NA 1JX4A 5IYDG 1RJRA 4YB8B 3LWBA 2W9BB 5KFMA 4QJFA 2XCLA 3BA8A 3N42B 1M0WA 5BPFA 2VQFH 1OWTA 3GTPA 2GPSA 3UQ8A 3OTOH 1B6SA 4O3NA 2DLNA 5KFPA 3GILA 4R8UA 4O3PA 2W9AA 2W9CA 1HR0H 4RUAA 2OH2A 4FS1A 2CQYA 4HNUA 4ECRA 1RK6A 4JI8H 2FE3A 1T3NA 4B3MH 2JA6G 2WE6A 2NUAB 1HNZH 4ECWA 5KFUA 5KG5A 1V51A 5JVDF 2J9GA 3T5KA 4A3CG 2HVSA 1I6UA 5FJ8G 4EGQA 4BY1G 2PMZE 2W9CB 1R9TA 1CQJB 3K5HA 5KFJA 4DL5A 2FK3A 3MWMA 1KJ8A 2FPGB 2SCUB 4DV5H 2Q2TA 2I80A 2UUBH 2QK4A 4IRCA 5KX5F 3Q1KA 3HBLA 2IP4A 3GTJA 2VUGA 2W8LA 4DV1H 4IR1A 1TWHA 1WR2A 5KFYA 2FLNA 2XD4A 4K0KH 4U7CA 4LH7A 3EYYA 1KC7A 2VUMG 3BABA 3J7AK 4BXXG 1A0IA 1A9XA 3GIMA 2W6PA 4HR7A 4EBEA 4A3KG 4J0MA 2E5LH 3ORQA 3RV3A 4RU9A 1TWFA 1ZHSA 1TAEA 3KHLA 4A2BA 4ECTA 1Y14B 2YS6A 1AUXA 4X64H 2R8HA 2WTFA 2W8KA 5KT6A 2CW8A 3G6YA 5DLGA
chains in the Genus database with same CATH topology
4PDBA 4LF7H 5LMUH 3RJ0A 4LH6A 4RB1A 1ZHQA 4NXMH 3H20A 3J81W 4DV2H 3RGXA 1XNQH 1N33H 4LSXA 1TA8A 5FD5A 4DR2H 4GLXA 5IT9W 3F8NA 1N36H 1WH2A 3FMAA 4X65H 4LF5H 5D1PA 2KSWA 3N6XA 3RTXA 4NXNH 4UCUA 1J5EH 2W57A 4DUYH 1XDNA 2O03A 4CC6A 2ZM6H 4DV7H 5FLXW 4LF4H 3T1YH 2UUAH 4ETSA 2HVQA 4EEQA 4LF9H 1DGSA 3T1HH 3N43B 5FPRA 4B3TH 4B3RH 4B3SH 4LFBH 4JI0H 4MV9A 1XNRH 4KHPH 2UUCH 4YY3H 4DR1H 3KALA 3C0FB 4JI6H 5BR8H 3JAMW 1M0TA 4IAJA 4UCOA 4RB3C 4DV6H 2VQEH 3JSNA 3RGZA 4X66H 1E4GT 4DR6H 4JV5H 2UXDH 2WDTA 4Q0YA 1O75A 4I7HA 1IBMH 3IG0A 1AN7A 3LMLA 5D1OA 4LF6H 1VS0A 5LL6b 2YCHA 1Z2PX 4JI1H 3BA9A 2OWOA 3BAAA 4EFEA 1FKAH 1BJTA 4LFAH 4R7RA 1E4FT 2F4VH 4DR7H 4DUZH 1XMOH 4DV3H 5EOYA 1BGWA 1B04A 3L4KA 4JI3H 5IWAH 2VOBA 4MTEA 1S03G 1MZBA 4RAZA 1FJGH 4YHHH 2UXBH 4MV7A 3RIZA 4UFZA 1N32H 3JSLA 5A2QW 4JI5H 3BA8A 3N42B 1M0WA 4BWSC 1SYXB 2VQFH 1V9PA 3K3VA 3KXYT 1IBKH 3UQ8A 3OTOH 1HNWH 1XMQH 4DV4H 4FM9A 1HR0H 4LF8H 3L2PA 1IBLH 1I94H 1HNXH 4AQYH 3DF7A 4UCTA 1SEIA 4DR5H 4JI8H 2FE3A 4B3MH 2WE6A 1HNZH 1Z2OX 5D1OB 2HVRA 2ZJTA 5FD6A 4MTDA 3CVZA 1N34H 3RF2A 2HVSA 3M4IA 1GYFA 4LSAA 4GKJH 3N41B 1I6UA 4UCVA 4JYAH 3HXLA 4A2AA 3J80W 4UCRA 2WYOA 4RB0A 3MWMA 4JI4H 2HHHH 4DV0H 4DV5H 2Q2TA 2UUBH 4RB2C 4EFBA 4RAYA 4GKKH 2CW7A 2VUGA 4DV1H 3KAKA 4UCSA 3L4JA 5LMNH 2RGRA 1S68A 4X62H 4OX9H 2RGVA 1P8LA 3KAJA 4K0KH 2UU9H 2Q2UA 4LH7A 5FPOA 1FVIA 3EYYA 3PN1A 3BABA 4M7EA 4JI7H 3J7AK 1A0IA 4LMYA 4RZQA 2HGSA 4J0MA 2E5LH 4APMA 4DR4H 2VPSA 3N40P 4DR3H 2XIGA 1ZHSA 1TAEA 2MCTA 4A2BA 3N44B 1X9NA 4LFCH 4X64H 2UXCH 1Z2NX 4JI2H 1L2ZA 2CW8A 4CC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7R A; 
#chains in the Genus database with same CATH topology
 4PDB A;  5LMU H;  4XX0 B;  4QWC A;  4NXM H;  1XNQ H;  4ZOL F;  4J9O A;  5FD5 A;  1UNN C;  5KFI A;  3I12 A;  3FKI A;  5D8D A;  5IYZ F;  3Q8Q B;  4GLX A;  5IT9 W;  2ASD A;  2V4R A;  3CQZ A;  5C5J A;  2PBZ A;  3MR2 A;  3TQ1 A;  5D1P A;  3VMM A;  3K3P A;  2DPJ A;  4MV8 A;  5CA0 F;  2XGQ A;  2R7K A;  1AUV A;  2R7Z A;  3SE7 A;  3EPI A;  1C3O A;  3GTK A;  1XDN A;  2O03 A;  3TIN A;  4ECQ A;  4DV7 H;  3I4M G;  3MR6 A;  5KFH A;  4J9M A;  5K2M A;  4RNO A;  2BQR A;  1DIK A;  1DGS A;  2ATL A;  4A3D G;  1E4E B;  3RFC A;  4B3R H;  1I7L A;  4KHP H;  2DZD A;  3MWD A;  2XC9 A;  4YAK B;  3T5J A;  4UCO A;  4RB3 C;  5EDW A;  3OHA A;  3RGZ A;  2VQE H;  4ED2 A;  2ALZ A;  2W6Z A;  3PZP A;  4ED7 A;  1O75 A;  4EYH B;  5KFL A;  1AN7 A;  1V4Y A;  2FLL A;  5HBR B;  1K1Q A;  4O4I F;  5I47 A;  2OWO A;  3JRW A;  1FKA H;  1BJT A;  5HV6 A;  5KFB A;  1E4F T;  4ECU A;  2PMZ A;  2JA5 A;  5C4X G;  4A3L G;  1B6R A;  1DV1 A;  4EBD A;  3PR4 A;  1EUD B;  5CB4 F;  4RZR A;  3E5N A;  4ZQI A;  5IWA H;  2VOB A;  1S03 G;  5KG0 A;  5GON F;  2WB1 E;  2WAQ A;  1FJG H;  5F9L A;  4XYL B;  4YR0 A;  5KT5 A;  4ED1 A;  1N48 A;  5KT7 A;  2JA7 G;  5L9X A;  3JSL A;  1SFO A;  3PW7 A;  1V9P A;  4F4W A;  3K3V A;  3KXY T;  1IBK H;  4BBS G;  3R5F A;  5C1P A;  4LF8 H;  1IBL H;  4QIW A;  4J9K A;  2AU0 A;  2AQ4 A;  4AYB E;  2W6O A;  1KJI A;  1ZQ7 A;  5LOV F;  1Z2O X;  5D1O B;  5FD6 A;  2R87 A;  2NU9 B;  1N34 H;  4O2A F;  2W6M A;  4GKJ H;  3BQ1 A;  1GGO A;  3V4S A;  4I55 F;  3TQT A;  4FBT A;  3J80 W;  4HQ6 A;  2R7M A;  5KG6 A;  2ASJ A;  2R8K A;  5FLM G;  4MV6 A;  4RB2 C;  3GV5 B;  5L1K A;  4HNT A;  1JLL B;  1RJP A;  4GKK H;  1S10 A;  4DLK A;  5LMN H;  2RGR A;  3HOZ G;  2JA7 A;  2RGV A;  2UVU A;  4LFB H;  3M9M B;  4M7E A;  2W70 A;  1FVI A;  2C22 A;  1DV2 A;  4C5B A;  1TWC A;  3WNZ A;  4QWA A;  5DLF A;  2HGS A;  2PN1 A;  5KKN B;  1ULZ A;  2YRW A;  2VPS A;  3N40 P;  5KT2 A;  4QWE A;  2AGQ A;  1UC8 A;  4DL6 A;  2VA3 A;  4FBU A;  1IOW A;  2YRX A;  2ASL A;  4QW9 A;  2BQ3 A;  1JXL A;  2FB9 A;  4JI2 H;  5KFG A;  3LP8 A;  3K5I A;  2YZM A;  4FU0 A;  2YS7 A;  2M05 A;  5CAE B;  4CC5 A;  2W7O A;  4LF7 H;  1S9F A;  4J9N A;  2VR1 A;  4A93 G;  4NLG A;  3H20 A;  4TV8 F;  3J81 W;  2GPW A;  2YU9 A;  3RGX A;  5KT3 A;  4LSX A;  4DR2 H;  5T14 A;  3PW5 A;  2R93 A;  5KG4 A;  3PW2 A;  2J6S A;  2IBK A;  3ETH A;  2R82 A;  4O4H F;  5IYC G;  5J2T F;  4I4T F;  3HOY G;  1EHI A;  4ECX A;  5L1I A;  4UCU A;  5IYB G;  5KFS A;  4DL2 A;  5KFD A;  2ZM6 H;  2I8C A;  4QWD A;  5FLX W;  3T1Y H;  5DG7 A;  1CQI B;  1SCU B;  4EEQ A;  4LF9 H;  3T5H A;  2XGP A;  4YR2 A;  5FPR A;  4B3T H;  4FS2 A;  4ED6 A;  3FKI G;  5DQH A;  4MV9 A;  4AYB A;  4YY3 H;  1GLV A;  3KAL A;  4TV9 F;  3TII A;  4DR1 H;  3HB9 A;  2V5A A;  1KJQ A;  5DGB A;  4F4Z A;  4DV6 H;  4ECZ A;  2DWC A;  2R84 A;  1E4G T;  2WDT A;  2W7P A;  2FPP B;  2FMA A;  4I7H A;  4ED3 A;  4YJ2 F;  4GC6 A;  5D1O A;  4RUC A;  1M7J A;  3BA9 A;  4EBC A;  3H4B A;  4MV4 A;  2DIK A;  2V4Q A;  5BPH A;  5DG9 A;  4TUY F;  3OSN A;  3GIQ A;  2WAQ E;  2WB1 A;  5EWE A;  2FLP A;  5EOY A;  3JRX A;  1BGW A;  1B04 A;  3L4K A;  4ED0 A;  2IA6 A;  1VBG A;  3RUP A;  2R85 A;  3H40 A;  3R23 A;  4DL3 A;  3I4N G;  4ECY A;  4WBN F;  4ECS A;  1I50 A;  4BWS C;  1KBL A;  3RB0 A;  5L1L A;  1HNW H;  1XMQ H;  3HOV G;  3GID A;  2AGP A;  2W6Q A;  4O3Q A;  2VPQ A;  3L2P A;  2NU8 B;  4IWY A;  1I94 H;  4BBR G;  3VPD A;  4AQY H;  3DF7 A;  4UCT A;  1SEI A;  3RB6 A;  4DR5 H;  4IR9 A;  4O4L F;  1K83 A;  2RDI A;  4HNV A;  3GTL A;  1S0O A;  3VPB A;  4MTD A;  1WCM G;  3QFF A;  3RV4 A;  2YYA A;  2R93 G;  4L1K A;  4M9U A;  1GYF A;  3M4I A;  2R92 G;  3OUU A;  4UCV A;  1EUC B;  1T36 A;  3HXL A;  4IHJ F;  2B63 G;  3GIP A;  4UCR A;  2WYO A;  4RB0 A;  4WD3 A;  4I50 F;  2JEJ A;  4QW8 A;  4DV0 H;  2PVP A;  2HHH H;  3GTG A;  3RAQ A;  4J9Q A;  4A3M G;  4Q44 A;  4Q45 A;  3BG5 A;  5IP9 G;  5KFE A;  3MWE A;  3BJY A;  5DGA A;  4OX9 H;  2DPI A;  3KAJ A;  1P8L A;  4QIW E;  2UU9 H;  5FPO A;  1N32 H;  4MA5 A;  1KJJ A;  5LP6 F;  3ETJ A;  4LMY A;  3OHB A;  4RZQ A;  3MR3 A;  5JVL A;  3ORR A;  3R5X A;  1VKZ A;  4EG0 A;  3KHG A;  3V6H A;  3AYH B;  4APM A;  3RAX A;  2W6N A;  5DG8 A;  4F4Y A;  3GTM A;  2RF4 A;  4DR3 H;  2XIG A;  5EWF A;  3GIK A;  4A3E G;  2C28 A;  2R7Z G;  1X9N A;  2XCA A;  2FJZ A;  3NGD A;  3H0G G;  3BQ2 A;  4YBZ B;  2J6U A;  2B63 A;  3RBE A;  1I7N A;  3R5H A;  2CKZ B;  4XYM B;  5C44 G;  4DV2 H;  2NVY A;  1WCM A;  1TWG A;  3PO3 G;  1TA8 A;  1CS0 A;  5IP7 G;  5EWG A;  3MJF A;  2R86 A;  4YQW A;  2I87 A;  1WH2 A;  4RNM A;  2C35 B;  2VA2 A;  1BNC A;  2HJW A;  3PW0 A;  3N6X A;  3RTX A;  4ED8 A;  3GII A;  1WSC A;  4NXN H;  1JKJ B;  3JZI A;  1J5E H;  1BXR A;  2W57 A;  3U9T A;  4DUY H;  1M6V A;  2E2I A;  4EEY A;  3FDS A;  4TQS A;  3V6J A;  4LF4 H;  4O2B F;  5KFA A;  2UUA H;  2HVQ A;  4O3O A;  1I3Q A;  2V59 A;  4A3G G;  3N43 B;  4ME6 A;  2JA5 G;  2R7N A;  3H3V H;  2YW2 A;  1Y1V G;  1KEE A;  3HKZ E;  3GQC A;  4MV3 A;  5KG2 A;  4JV1 A;  2Y0S E;  4JV5 H;  2FP4 B;  1GSA A;  3JSN A;  5JQW A;  5C3E G;  4C2M A;  5KFK A;  2UVV A;  1Y1W A;  1IBM H;  4LF6 H;  3IG0 A;  3LML A;  2X0S A;  1Z2P X;  5KT4 A;  3RB3 A;  4JI1 H;  4RNN A;  3BAA A;  5KG1 A;  4EFE A;  3PR5 B;  5EZY F;  2F4V H;  4ZI7 F;  2XCP A;  2VQD A;  3IN5 A;  5KFZ A;  2UVR A;  1RK5 A;  1GSO A;  4JV0 A;  2R92 A;  5JH7 F;  2ZDQ A;  4DR7 H;  1XMO H;  2JA6 A;  1E4E A;  1EZ1 A;  3M9O B;  3UFX B;  3SI8 A;  4MTE A;  5C8Y F;  4Q8F A;  3T5L A;  4O3R A;  4YHH H;  2UXB H;  4YJ3 F;  3RIZ A;  4UFZ A;  3HOX G;  1JDB B;  3TIG A;  5H80 A;  2UVW A;  1K1S A;  2C2E A;  4DL7 A;  4XZ3 B;  1PX2 A;  5A2Q W;  4G3I A;  4JI5 H;  3H0G A;  1SYX B;  4EGJ A;  4YAJ B;  4ZHQ F;  3OUZ A;  2JEI A;  1VBH A;  2IMW P;  4DV4 H;  1W96 A;  4FM9 A;  1N56 A;  5LXT F;  1S0N A;  4F4X A;  1HNX H;  2OLS A;  4IWX A;  1ZET A;  1B33 N;  1PK8 A;  5KFV A;  2HVR A;  3KTM A;  2ZJT A;  4O3S A;  2FK2 A;  4TQR A;  1UC9 A;  3CVZ A;  2C2R A;  3U9S A;  4PWQ A;  3M9N B;  1RYR A;  1W93 A;  3RF2 A;  4ECV A;  4A3F G;  2VUM A;  4Q8E A;  4LSA A;  5JUM A;  2ZDH A;  3N41 B;  3MFH A;  3EPG A;  4JYA H;  4A2A A;  2R8G A;  2ZDG A;  4IZO A;  3MFI A;  3H4D A;  1CE8 A;  3PW4 A;  4JI4 H;  1TWA A;  5KFF A;  4Y8V B;  3V6K A;  2R8J A;  4U6P A;  2V58 A;  4EFB A;  4RAY A;  4J9L A;  5KFR A;  4J9S A;  4C5A A;  3GIJ A;  2J6T A;  4A3B G;  2CW7 A;  2FPI B;  5KFX A;  4C5C A;  3KAK A;  4UCS A;  2P0A A;  3L4J A;  1S68 A;  2NU6 B;  4X62 H;  1Y1W G;  2YZG A;  1EYZ A;  3HKZ A;  5CA1 F;  4A3I G;  2Q2U A;  4JI7 H;  1JDE A;  3PN1 A;  2R6F A;  3GLK A;  3RB4 A;  1C30 A;  3Q2O A;  3Q8S B;  2JEG A;  2CZG A;  4BY7 G;  2YZN A;  5KFN A;  4DR4 H;  1VAJ A;  2YL2 A;  3GV7 B;  5L1J A;  2MCT A;  3WO1 A;  4YP3 A;  3N44 B;  4HYK A;  4JV2 A;  1S97 A;  4LFC H;  2W71 A;  2NU7 B;  3Q8P B;  2UXC H;  1Z2N X;  3WO0 A;  2V9W A;  3PO2 G;  1L2Z A;  2E2H A;  3QZ7 A;  3GV8 B;  3RJ0 A;  2R8I A;  4LH6 A;  4RB1 A;  1ZHQ A;  5C1O A;  1N33 H;  4J9R A;  3G8C A;  2JA8 G;  3HOU G;  1GO3 E;  3F8N A;  1N36 H;  3FMA A;  4X65 H;  4LF5 H;  3G6V A;  2QYZ A;  4QWB A;  2BQU A;  1IOV A;  1S0M A;  2KSW A;  4MA0 A;  3VPC A;  5KFT A;  5LA6 F;  3QZ8 A;  3MR5 A;  2FKL A;  2JEF A;  4R8U B;  3KHH A;  4CC6 A;  3HOW G;  1KJ9 A;  2R7L A;  4ETS A;  2C2D A;  3T1H H;  5KFQ A;  3GTO A;  4GC7 A;  2Y0S A;  3Q8R B;  4B3S H;  2W9B A;  4JI0 H;  5J2U F;  1RJQ A;  1XNR H;  3PVX A;  4J9P A;  2UUC H;  3N8D A;  3C0F B;  2FK1 A;  2GLT A;  5KG3 A;  5BR8 H;  4JI6 H;  3JAM W;  1M0T A;  3BQ0 A;  1T94 A;  4IAJ A;  4MAM A;  5KG7 A;  4X66 H;  1RYS A;  4DR6 H;  2UXD H;  2AGO A;  2NVX A;  4F50 A;  4Q0Y A;  5BMV F;  3RBD A;  1VS0 A;  5LYJ F;  5LL6 b;  2YCH A;  3G6X A;  4DL4 A;  4LFA H;  4R7R A;  3GTQ A;  2RDJ A;  5KFC A;  5KFW A;  4IRD A;  4EYI B;  1GSH A;  1Y1V A;  4DUZ H;  4JUZ A;  1JIH A;  4DV3 H;  3KHR A;  3OSP A;  4IRK A;  2C00 A;  4Q43 A;  4JI3 H;  5KFO A;  4YR3 A;  2BR0 A;  4MV1 A;  4A3J G;  5DQG A;  3V4Z A;  5DQI A;  1MZB A;  4RAZ A;  4E4T A;  4MV7 A;  5F9N A;  1JX4 A;  5IYD G;  1RJR A;  4YB8 B;  3LWB A;  2W9B B;  5KFM A;  4QJF A;  2XCL A;  3BA8 A;  3N42 B;  1M0W A;  5BPF A;  2VQF H;  1OWT A;  3GTP A;  2GPS A;  3UQ8 A;  3OTO H;  1B6S A;  4O3N A;  2DLN A;  5KFP A;  3GIL A;  4R8U A;  4O3P A;  2W9A A;  2W9C A;  1HR0 H;  4RUA A;  2OH2 A;  4FS1 A;  2CQY A;  4HNU A;  4ECR A;  1RK6 A;  4JI8 H;  2FE3 A;  1T3N A;  4B3M H;  2JA6 G;  2WE6 A;  2NUA B;  1HNZ H;  4ECW A;  5KFU A;  5KG5 A;  1V51 A;  5JVD F;  2J9G A;  3T5K A;  4A3C G;  2HVS A;  1I6U A;  5FJ8 G;  4EGQ A;  4BY1 G;  2PMZ E;  2W9C B;  1R9T A;  1CQJ B;  3K5H A;  5KFJ A;  4DL5 A;  2FK3 A;  3MWM A;  1KJ8 A;  2FPG B;  2SCU B;  4DV5 H;  2Q2T A;  2I80 A;  2UUB H;  2QK4 A;  4IRC A;  5KX5 F;  3Q1K A;  3HBL A;  2IP4 A;  3GTJ A;  2VUG A;  2W8L A;  4DV1 H;  4IR1 A;  1TWH A;  1WR2 A;  5KFY A;  2FLN A;  2XD4 A;  4K0K H;  4U7C A;  4LH7 A;  3EYY A;  1KC7 A;  2VUM G;  3BAB A;  3J7A K;  4BXX G;  1A0I A;  1A9X A;  3GIM A;  2W6P A;  4HR7 A;  4EBE A;  4A3K G;  4J0M A;  2E5L H;  3ORQ A;  3RV3 A;  4RU9 A;  1TWF A;  1ZHS A;  1TAE A;  3KHL A;  4A2B A;  4ECT A;  1Y14 B;  2YS6 A;  1AUX A;  4X64 H;  2R8H A;  2WTF A;  2W8K A;  5KT6 A;  2CW8 A;  3G6Y A;  5DLG A; 
#chains in the Genus database with same CATH homology
 4PDB A;  4LF7 H;  5LMU H;  3RJ0 A;  4LH6 A;  4RB1 A;  1ZHQ A;  4NXM H;  3H20 A;  3J81 W;  4DV2 H;  3RGX A;  1XNQ H;  1N33 H;  4LSX A;  1TA8 A;  5FD5 A;  4DR2 H;  4GLX A;  5IT9 W;  3F8N A;  1N36 H;  1WH2 A;  3FMA A;  4X65 H;  4LF5 H;  5D1P A;  2KSW A;  3N6X A;  3RTX A;  4NXN H;  4UCU A;  1J5E H;  2W57 A;  4DUY H;  1XDN A;  2O03 A;  4CC6 A;  2ZM6 H;  4DV7 H;  5FLX W;  4LF4 H;  3T1Y H;  2UUA H;  4ETS A;  2HVQ A;  4EEQ A;  4LF9 H;  1DGS A;  3T1H H;  3N43 B;  5FPR A;  4B3T H;  4B3R H;  4B3S H;  4LFB H;  4JI0 H;  4MV9 A;  1XNR H;  4KHP H;  2UUC H;  4YY3 H;  4DR1 H;  3KAL A;  3C0F B;  4JI6 H;  5BR8 H;  3JAM W;  1M0T A;  4IAJ A;  4UCO A;  4RB3 C;  4DV6 H;  2VQE H;  3JSN A;  3RGZ A;  4X66 H;  1E4G T;  4DR6 H;  4JV5 H;  2UXD H;  2WDT A;  4Q0Y A;  1O75 A;  4I7H A;  1IBM H;  3IG0 A;  1AN7 A;  3LML A;  5D1O A;  4LF6 H;  1VS0 A;  5LL6 b;  2YCH A;  1Z2P X;  4JI1 H;  3BA9 A;  2OWO A;  3BAA A;  4EFE A;  1FKA H;  1BJT A;  4LFA H;  4R7R A;  1E4F T;  2F4V H;  4DR7 H;  4DUZ H;  1XMO H;  4DV3 H;  5EOY A;  1BGW A;  1B04 A;  3L4K A;  4JI3 H;  5IWA H;  2VOB A;  4MTE A;  1S03 G;  1MZB A;  4RAZ A;  1FJG H;  4YHH H;  2UXB H;  4MV7 A;  3RIZ A;  4UFZ A;  1N32 H;  3JSL A;  5A2Q W;  4JI5 H;  3BA8 A;  3N42 B;  1M0W A;  4BWS C;  1SYX B;  2VQF H;  1V9P A;  3K3V A;  3KXY T;  1IBK H;  3UQ8 A;  3OTO H;  1HNW H;  1XMQ H;  4DV4 H;  4FM9 A;  1HR0 H;  4LF8 H;  3L2P A;  1IBL H;  1I94 H;  1HNX H;  4AQY H;  3DF7 A;  4UCT A;  1SEI A;  4DR5 H;  4JI8 H;  2FE3 A;  4B3M H;  2WE6 A;  1HNZ H;  1Z2O X;  5D1O B;  2HVR A;  2ZJT A;  5FD6 A;  4MTD A;  3CVZ A;  1N34 H;  3RF2 A;  2HVS A;  3M4I A;  1GYF A;  4LSA A;  4GKJ H;  3N41 B;  1I6U A;  4UCV A;  4JYA H;  3HXL A;  4A2A A;  3J80 W;  4UCR A;  2WYO A;  4RB0 A;  3MWM A;  4JI4 H;  2HHH H;  4DV0 H;  4DV5 H;  2Q2T A;  2UUB H;  4RB2 C;  4EFB A;  4RAY A;  4GKK H;  2CW7 A;  2VUG A;  4DV1 H;  3KAK A;  4UCS A;  3L4J A;  5LMN H;  2RGR A;  1S68 A;  4X62 H;  4OX9 H;  2RGV A;  1P8L A;  3KAJ A;  4K0K H;  2UU9 H;  2Q2U A;  4LH7 A;  5FPO A;  1FVI A;  3EYY A;  3PN1 A;  3BAB A;  4M7E A;  4JI7 H;  3J7A K;  1A0I A;  4LMY A;  4RZQ A;  2HGS A;  4J0M A;  2E5L H;  4APM A;  4DR4 H;  2VPS A;  3N40 P;  4DR3 H;  2XIG A;  1ZHS A;  1TAE A;  2MCT A;  4A2B A;  3N44 B;  1X9N A;  4LFC H;  4X64 H;  2UXC H;  1Z2N X;  4JI2 H;  1L2Z A;  2CW8 A;  4CC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...