4R7RA

Crystal structure of putative lipoprotein from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
122
Chain Sequence
AKPSLNYHTKNLSELVSNIKIRLLDMNIYSEVIVDNEDVRIIDDLLKSLKDSNFINEEALPNKPLYKIFIDLNSEKYVIDIYGDDLITLYPWDSDVRKDYLSLKDIPNSFKLEPFCQYVFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal Structure of Putative Lipoprotein from Clostridium perfringens
rcsb
source organism Clostridium perfringens atcc 13124
molecule tags Lipid binding protein
total genus 26
structure length 122
sequence length 124
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16224 DUF4883 DOmain of unknown function (DUF4883)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.410 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4r7rA00
4R7RA
chains in the Genus database with same CATH superfamily
3RUPA 4MTEA 4ED1A 1BXRA 4A3JG 3HB9A 1ZHSA 4JI8H 4A93G 4GC6A 3T5JA 3EPGA 5KG5A 5DGAA 4LF4H 4J0MA 3UQ8A 2HGSA 3KAKA 4C5CA 4DV7H 1RJRA 4Q44A 4UCTA 2UXCH 3GIDA 4O3OA 1ULZA 4EFBA 3MWMA 2R82A 2VPQA 4O2AF 2W70A 4I7HA 4B3MH 2B63G 3N40P 5CAEB 2QYZA 4JI0H 4I4TF 5KG7A 5KFDA 4TV8F 5DG8A 4DR5H 5KT3A 4X66H 4Q8EA 2CW8A 4Q8FA 3MJFA 2XCPA 5IP7G 4EBEA 3HOVG 3BQ1A 4MTDA 1Z2PX 2FP4B 1AN7A 5KFWA 2ZDHA 5IYCG 4RAZA 2WDTA 1WSCA 4O3QA 5KX5F 3U9SA 2YZMA 4A3CG 2R92A 4O3RA 4RB1A 5KFLA 1SEIA 1FVIA 3BAAA 2NU8B 5C5JA 4ED2A 2PVPA 1S03G 5KFNA 5BPFA 1GSOA 2W9AA 4F4XA 5FD5A 4A3IG 3AYHB 4XYMB 4YR3A 4R8UA 5KG3A 1M6VA 2DLNA 1O75A 4RB0A 2ALZA 3BQ0A 2R7MA 3Q8RB 1Z2NX 5DLGA 4A3DG 2YCHA 3UFXB 5LXTF 5KG4A 3PR5B 2UUBH 2E2IA 2FPGB 2HJWA 1KBLA 4DR3H 3GLKA 1KJ8A 4WBNF 2R7NA 4X64H 3LP8A 4RB3C 3T1YH 3V6KA 5T14A 3HXLA 4YY3H 4TV9F 2X0SA 3GV7B 3T1HH 2DPJA 4QWBA 5H80A 2JA7G 1E4GT 1DV2A 3MR3A 5KT2A 2E5LH 3GTMA 4JV2A 1N56A 4ZHQF 1IOWA 2GPSA 5D1OB 1N48A 3Q8SB 2J6SA 5CA0F 5FPOA 3KHLA 3ORQA 1AUXA 4DL6A 2YL2A 4IRDA 3JZIA 5KT5A 4A3EG 1I7LA 3HOWG 2DWCA 2XIGA 4QW8A 4HNUA 4DV3H 1HNZH 3J81W 2XC9A 2C35B 2FJZA 2VQDA 3C0FB 3R5XA 1RK5A 3H0GG 2ZDQA 2I8CA 1VAJA 2PN1A 2CKZB 4UFZA 2J6TA 1HR0H 3V4SA 3M9NB 2UVUA 3N8DA 2R85A 3RIZA 4RZRA 3NGDA 1IOVA 2R93A 1GO3E 4YB8B 4MA5A 2W6MA 4ECXA 2Q2UA 3K3VA 3TQTA 3JAMW 5L1LA 4R7RA 4JI5H 2W6NA 1XDNA 3K5HA 5HV6A 2C2EA 1L2ZA 3RB0A 1SYXB 4BY7G 4NXNH 1DGSA 4YJ3F 4GKJH 5KFQA 4LSXA 4DUZH 3EPIA 3R23A 2YRXA 2V58A 3T5LA 2VA3A 2NU7B 4O4IF 3N41B 1WH2A 5LMNH 1XNQH 4K0KH 4EEQA 5KFYA 3ORRA 5C44G 4A3FG 4JI6H 3HOYG 3BABA 2HVRA 3J7AK 4C2MA 2BQUA 3RGXA 1KJ9A 3QZ7A 3CVZA 2F4VH 4GC7A 1JKJB 1J5EH 3GTJA 4JV5H 5FJ8G 2W6PA 2JEJA 1ZHQA 5LL6b 2FK2A 3SE7A 4ME6A 2V4QA 2VUGA 3CQZA 4CC5A 3BA8A 4XZ3B 5F9NA 2W8LA 4IAJA 4ED6A 1Y1VA 2R7ZG 2V59A 2RF4A 4LFCH 2FPIB 1PK8A 2NUAB 2VUMG 4QWCA 2R8IA 4J9OA 3G6XA 4JV1A 3K3PA 4LH6A 1RJPA 1TA8A 1WR2A 2XGPA 5IP9G 2W71A 4A2AA 5GONF 5KFVA 2SCUB 3OUZA 3R5FA 3OUUA 2NVXA 4J9KA 2OLSA 2BQ3A 4J9MA 1VKZA 4LSAA 1WCMG 4X62H 3Q1KA 4DL2A 3FDSA 3BQ2A 3OSPA 2Y0SA 4I50F 4AYBA 1VBGA 2VQFH 4LFAH 4Y8VB 1A0IA 5IT9W 4MV9A 3E5NA 2R8HA 1KJJA 3QZ8A 4J9LA 4F4WA 4LF6H 1M0TA 5LA6F 2P0AA 2R7LA 5KG2A 3KTMA 3H4BA 3Q2OA 2VOBA 3KALA 3RV3A 5KFSA 2AGOA 4MV3A 4JI2H 3V4ZA 3MFIA 2W6QA 4F4YA 3TIIA 4ETSA 2UUAH 2R86A 3VMMA 3GV5B 2W7OA 5D1OA 2WYOA 2AGQA 1IBLH 1B04A 2PMZA 2UUCH 5L1JA 5IYZF 1M7JA 2R87A 3OSNA 2JA5A 3KAJA 3TINA 4B3RH 5KFKA 1JIHA 1GSHA 1C3OA 4MA0A 1W96A 5IYBG 4RAYA 5KFHA 3I12A 3MR6A 2FB9A 4DR7H 4M7EA 3F8NA 4FBUA 1K1QA 5A2QW 4YQWA 4LMYA 4I55F 5KFRA 4L1KA 3HOXG 4J9QA 3TQ1A 3GIQA 1BJTA 3IG0A 5C8YF 2YYAA 3RJ0A 4J9RA 4DV5H 3H3VH 2FE3A 4J9NA 1JX4A 1FJGH 4HQ6A 2VA2A 4EBCA 4QJFA 4FBTA 4EYHB 4IR9A 2WAQA 2CQYA 2W6OA 2XCAA 4FU0A 4YR2A 3I4MG 5L1KA 3R5HA 1UC9A 1MZBA 3KHHA 1N34H 1XMQH 4UCUA 4YBZB 2E2HA 3GIIA 1GLVA 3FKIA 1W93A 3WNZA 4EYIB 4O4HF 3GV8B 3RB6A 2R92G 2WE6A 3N6XA 1GGOA 4QIWA 2W9BB 1I50A 5KFGA 4DR2H 4DL3A 4MV8A 3MWDA 2Y0SE 4DR6H 2HVSA 1UNNC 5KFCA 1Z2OX 1Y1WG 2W9CB 1EUCB 2NVYA 3PO2G 2FKLA 2JA6A 2AU0A 3MR2A 4RNOA 5EWEA 2J6UA 5EZYF 5F9LA 1BNCA 4GLXA 3PVXA 4J9PA 4DV6H 4ED3A 3L4KA 4F4ZA 2FPPB 3RBDA 2AGPA 4UCRA 5KT4A 1CQJB 2V9WA 3L4JA 1K1SA 4A3BG 4BBSG 2W6ZA 3H4DA 4C5AA 1KEEA 5J2UF 2W57A 4OX9H 2ASDA 5L9XA 4TQSA 4IRCA 5DG7A 1T3NA 4ED8A 3ETHA 4ZI7F 1S0MA 1IBKH 3J80W 4FS2A 4ECVA 3RTXA 2CW7A 2FK1A 1I6UA 3FMAA 1VBHA 5BR8H 3PW7A 2YZNA 4RZQA 1B6SA 4DR1H 3M4IA 2R7ZA 2R84A 4PWQA 4MV7A 2ZM6H 1N32H 3HBLA 5KFMA 4O3NA 4J9SA 2UVRA 1VS0A 5L1IA 5CA1F 1I7NA 4FS1A 2C28A 1JDBB 2JEGA 2UVWA 3GTKA 1DV1A 3OHBA 4QWAA 1RYRA 5KFOA 2KSWA 3HOZG 4RU9A 1TWCA 4ECRA 2IMWP 5FD6A 3OTOH 4DL5A 1S0NA 4EG0A 1CE8A 2AQ4A 3IN5A 2IA6A 1EZ1A 1GSAA 4MV6A 2C2RA 2R8GA 2NU9B 2W8KA 3GTPA 1PX2A 3T5KA 2B63A 2WAQE 4HNVA 4YHHH 1TAEA 3G6YA 1S10A 2R8KA 1I3QA 1HNXH 2R93G 5DQHA 2M05A 4ED7A 3KHGA 5IYDG 1XNRH 5LYJF 1E4EB 2W7PA 3H20A 4ECUA 5EWFA 2GPWA 2VR1A 1IBMH 3JRXA 4JI3H 2JA8G 1B6RA 5KFEA 2QK4A 4ECSA 1DIKA 3PN1A 2C00A 4HR7A 1N33H 4MV1A 2VPSA 4A3GG 4KHPH 1N36H 3V6JA 4DV4H 3SI8A 2OWOA 4NLGA 1S68A 3GTGA 4FM9A 5C1OA 5CB4F 3QFFA 5KKNB 1JDEA 3PW4A 3WO0A 3Q8QB 4DV1H 4JI7H 3PW2A 2YW2A 5DQIA 3GIMA 4E4TA 5D8DA 3RV4A 5BMVF 1ZQ7A 2ZJTA 4XYLB 4UCVA 1S97A 4LH7A 3G8CA 4RB2C 1KJQA 3RB3A 4ZQIA 4X65H 2XGQA 2C2DA 4IR1A 4EBDA 2RGVA 5HBRB 2IP4A 5KFTA 3Q8PB 5EDWA 2I87A 4TUYF 5JUMA 2DIKA 1Y1VG 3K5IA 1KC7A 3T5HA 4QW9A 2V4RA 2HVQA 2DPIA 3RF2A 2RDIA 3RAXA 2GLTA 3GQCA 4DL4A 3RAQA 4LF8H 2DZDA 4M9UA 3HKZA 3HOUG 5KFPA 1KJIA 3JSLA 1UC8A 2XD4A 4BWSC 1C30A 2W9BA 4ECQA 2FK3A 3DF7A 2JA7A 4WD3A 3GIJA 4JYAH 4B3SH 2W9CA 3RB4A 3VPCA 4LF5H 1JLLB 4EGJA 4LF7H 4G3IA 5DGBA 3BJYA 4DUYH 5I47A 2UXBH 4DR4H 2R7KA 5KG1A 4XX0B 3ETJA 3MFHA 1Y14B 4HYKA 4Q0YA 4LFBH 2ZDGA 2NU6B 1B33N 3KHRA 1S9FA 5D1PA 3U9TA 3H0GA 1Y1WA 2FLPA 1V51A 3H40A 4QWDA 4DLKA 1I94H 2R6FA 1SFOA 5KFJA 5KFIA 5LOVF 4ECWA 3GTQA 4A3LG 2ASJA 3GIPA 2JEFA 3LMLA 2I80A 5EOYA 3TIGA 3M9MB 2BR0A 2J9GA 4DV2H 5KT6A 5LP6F 1EUDB 4ED0A 4JI4H 1V4YA 4YAKB 4O2BF 5DLFA 2FMAA 4UCOA 4RNNA 3GILA 5EWGA 1HNWH 4BY1G 4AYBE 2JA5G 1CS0A 4IRKA 3BA9A 5JQWA 4IZOA 4QWEA 2ATLA 1M0WA 4ECTA 5KG6A 5BPHA 3VPDA 4MV4A 1X9NA 1S0OA 4YAJB 4TQRA 5DG9A 4DL7A 4A2BA 5JH7F 4U7CA 1CQIB 2WB1A 3RGZA 2O03A 4C5BA 1RYSA 4YP3A 4O4LF 1P8LA 4O3PA 4JV0A 2ASLA 2YS7A 3MWEA 4R8UB 5KFBA 3LWBA 2FLNA 3KXYT 3PR4A 4YJ2F 5C1PA 2PMZE 1E4FT 3N43B 2R8JA 1E4EA 4EFEA 5KFUA 4AQYH 4ECZA 2YU9A 3GIKA 2XCLA 4LF9H 3HKZE 1ZETA 1TWGA 2IBKA 2JEIA 1TWAA 1OWTA 4JUZA 4HNTA 2RGRA 4NXMH 4IHJF 4BXXG 4PDBA 3JSNA 1T36A 5FLMG 3JRWA 3OHAA 2UVVA 2VUMA 5C3EG 2HHHH 3N44B 2CZGA 3GTLA 3EYYA 5K2MA 2WTFA 4GKKH 3RBEA 2C22A 1K83A 3FKIG 4RUCA 2FLLA 5JVDF 5KFFA 2MCTA 4IWYA 4UCSA 4MAMA 4F50A 2UXDH 3M9OB 5KT7A 5JVLA 5DQGA 5IWAH 2JA6G 2Q2TA 1SCUB 3BG5A 3V6HA 3GTOA 1WCMA 4Q43A 4RNMA 1EYZA 5LMUH 1JXLA 4B3TH 5C4XG 4BBRG 4A3MG 4DV0H 3MR5A 1RJQA 2RDJA 2UU9H 3PO3G 2PBZA 2YRWA 4A3KG 5J2TF 1EHIA 5KFZA 4APMA 4YR0A 3L2PA 3PW5A 4ZOLF 4EGQA 2VQEH 4Q45A 1V9PA 3G6VA 2BQRA 1FKAH 1T94A 4QIWE 3RFCA 4U6PA 2YZGA 5KFAA 2OH2A 1BGWA 1XMOH 3WO1A 4ECYA 1A9XA 1AUVA 1RK6A 3N42B 4IWXA 2YS6A 3PW0A 1R9TA 3I4NG 4EEYA 2V5AA 4CC6A 1TWHA 4O3SA 4JI1H 5KFXA 5FPRA 3PZPA 5KG0A 1TWFA 3VPBA 2WB1E 5FLXW 4RUAA 1GYFA
chains in the Genus database with same CATH topology
4MTEA 5LMNH 3N41B 1WH2A 2HVSA 1ZHSA 1Z2OX 4EEQA 4JI8H 1XNQH 4K0KH 4JI6H 3BABA 4LF4H 4Q0YA 2HVRA 3J7AK 4LFBH 4J0MA 3RGXA 3UQ8A 3CVZA 4GLXA 2HGSA 3KAKA 4DV6H 4DV7H 3L4KA 2F4VH 1J5EH 4UCTA 5D1PA 4UCRA 4JV5H 2UXCH 4EFBA 3MWMA 3L4JA 1ZHQA 1I94H 4I7HA 4B3MH 5LL6b 3N40P 2W57A 4OX9H 2VUGA 4JI0H 4CC5A 3BA8A 4IAJA 1IBKH 3LMLA 3J80W 4DR5H 5EOYA 3RTXA 2CW7A 4X66H 2CW8A 4LFCH 4DV2H 1I6UA 3FMAA 5BR8H 4JI4H 4MTDA 1Z2PX 1AN7A 4RZQA 4UCOA 4LH6A 4RAZA 4DR1H 3M4IA 2WDTA 1TA8A 1HNWH 4MV7A 2ZM6H 1N32H 1VS0A 3BA9A 4A2AA 1M0WA 4RB1A 1SEIA 1FVIA 3BAAA 1S03G 2KSWA 1X9NA 5FD5A 5FD6A 3OTOH 4LSAA 4X62H 4A2BA 3RGZA 2O03A 1O75A 4RB0A 2VQFH 1P8LA 4LFAH 1A0IA 1Z2NX 4MV9A 5IT9W 3KXYT 4DR6H 2YCHA 1E4FT 3N43B 4YHHH 1TAEA 1M0TA 4EFEA 4LF6H 4DR4H 2UUBH 4AQYH 1HNXH 4LF9H 4DR3H 1XNRH 2VOBA 3KALA 4X64H 4RB3C 3T1YH 3H20A 2RGRA 4JI2H 4NXMH 1IBMH 3HXLA 3JSNA 4PDBA 4YY3H 4JI3H 4ETSA 2UUAH 2HHHH 3N44B 3EYYA 3PN1A 3T1HH 1IBLH 5D1OA 2WYOA 2UUCH 4GKKH 1B04A 1N33H 1E4GT 2E5LH 3KAJA 4B3RH 2VPSA 2MCTA 4KHPH 4UCSA 1N36H 4DV4H 2OWOA 5D1OB 2UXDH 1S68A 4RAYA 4FM9A 5FPOA 4DR7H 5IWAH 2Q2TA 4M7EA 5LMUH 3F8NA 4DV1H 4B3TH 4JI7H 2XIGA 4DV3H 5A2QW 4LMYA 1HNZH 3J81W 4DV0H 3C0FB 2UU9H 2ZJTA 1BJTA 4UCVA 4LH7A 3IG0A 4RB2C 4X65H 4APMA 3L2PA 3RJ0A 4UFZA 2RGVA 4DV5H 2VQEH 2FE3A 1V9PA 1HR0H 3RIZA 1FJGH 1FKAH 2HVQA 1BGWA 1XMOH 2Q2UA 3K3VA 3JAMW 3RF2A 4R7RA 4JI5H 2UXBH 1XDNA 3N42B 4LF8H 1L2ZA 1MZBA 3JSLA 1N34H 4BWSC 1XMQH 1SYXB 4UCUA 3DF7A 4NXNH 4CC6A 1DGSA 4JI1H 4GKJH 4JYAH 4LSXA 4DUZH 4B3SH 5FPRA 2WE6A 3N6XA 5FLXW 4DR2H 4LF5H 4LF7H 4DUYH 1GYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7R A; 
#chains in the Genus database with same CATH topology
 3RUP A;  4MTE A;  4ED1 A;  1BXR A;  4A3J G;  3HB9 A;  1ZHS A;  4JI8 H;  4A93 G;  4GC6 A;  3T5J A;  3EPG A;  5KG5 A;  5DGA A;  4LF4 H;  4J0M A;  3UQ8 A;  2HGS A;  3KAK A;  4C5C A;  4DV7 H;  1RJR A;  4Q44 A;  4UCT A;  2UXC H;  3GID A;  4O3O A;  1ULZ A;  4EFB A;  3MWM A;  2R82 A;  2VPQ A;  4O2A F;  2W70 A;  4I7H A;  4B3M H;  2B63 G;  3N40 P;  5CAE B;  2QYZ A;  4JI0 H;  4I4T F;  5KG7 A;  5KFD A;  4TV8 F;  5DG8 A;  4DR5 H;  5KT3 A;  4X66 H;  4Q8E A;  2CW8 A;  4Q8F A;  3MJF A;  2XCP A;  5IP7 G;  4EBE A;  3HOV G;  3BQ1 A;  4MTD A;  1Z2P X;  2FP4 B;  1AN7 A;  5KFW A;  2ZDH A;  5IYC G;  4RAZ A;  2WDT A;  1WSC A;  4O3Q A;  5KX5 F;  3U9S A;  2YZM A;  4A3C G;  2R92 A;  4O3R A;  4RB1 A;  5KFL A;  1SEI A;  1FVI A;  3BAA A;  2NU8 B;  5C5J A;  4ED2 A;  2PVP A;  1S03 G;  5KFN A;  5BPF A;  1GSO A;  2W9A A;  4F4X A;  5FD5 A;  4A3I G;  3AYH B;  4XYM B;  4YR3 A;  4R8U A;  5KG3 A;  1M6V A;  2DLN A;  1O75 A;  4RB0 A;  2ALZ A;  3BQ0 A;  2R7M A;  3Q8R B;  1Z2N X;  5DLG A;  4A3D G;  2YCH A;  3UFX B;  5LXT F;  5KG4 A;  3PR5 B;  2UUB H;  2E2I A;  2FPG B;  2HJW A;  1KBL A;  4DR3 H;  3GLK A;  1KJ8 A;  4WBN F;  2R7N A;  4X64 H;  3LP8 A;  4RB3 C;  3T1Y H;  3V6K A;  5T14 A;  3HXL A;  4YY3 H;  4TV9 F;  2X0S A;  3GV7 B;  3T1H H;  2DPJ A;  4QWB A;  5H80 A;  2JA7 G;  1E4G T;  1DV2 A;  3MR3 A;  5KT2 A;  2E5L H;  3GTM A;  4JV2 A;  1N56 A;  4ZHQ F;  1IOW A;  2GPS A;  5D1O B;  1N48 A;  3Q8S B;  2J6S A;  5CA0 F;  5FPO A;  3KHL A;  3ORQ A;  1AUX A;  4DL6 A;  2YL2 A;  4IRD A;  3JZI A;  5KT5 A;  4A3E G;  1I7L A;  3HOW G;  2DWC A;  2XIG A;  4QW8 A;  4HNU A;  4DV3 H;  1HNZ H;  3J81 W;  2XC9 A;  2C35 B;  2FJZ A;  2VQD A;  3C0F B;  3R5X A;  1RK5 A;  3H0G G;  2ZDQ A;  2I8C A;  1VAJ A;  2PN1 A;  2CKZ B;  4UFZ A;  2J6T A;  1HR0 H;  3V4S A;  3M9N B;  2UVU A;  3N8D A;  2R85 A;  3RIZ A;  4RZR A;  3NGD A;  1IOV A;  2R93 A;  1GO3 E;  4YB8 B;  4MA5 A;  2W6M A;  4ECX A;  2Q2U A;  3K3V A;  3TQT A;  3JAM W;  5L1L A;  4R7R A;  4JI5 H;  2W6N A;  1XDN A;  3K5H A;  5HV6 A;  2C2E A;  1L2Z A;  3RB0 A;  1SYX B;  4BY7 G;  4NXN H;  1DGS A;  4YJ3 F;  4GKJ H;  5KFQ A;  4LSX A;  4DUZ H;  3EPI A;  3R23 A;  2YRX A;  2V58 A;  3T5L A;  2VA3 A;  2NU7 B;  4O4I F;  3N41 B;  1WH2 A;  5LMN H;  1XNQ H;  4K0K H;  4EEQ A;  5KFY A;  3ORR A;  5C44 G;  4A3F G;  4JI6 H;  3HOY G;  3BAB A;  2HVR A;  3J7A K;  4C2M A;  2BQU A;  3RGX A;  1KJ9 A;  3QZ7 A;  3CVZ A;  2F4V H;  4GC7 A;  1JKJ B;  1J5E H;  3GTJ A;  4JV5 H;  5FJ8 G;  2W6P A;  2JEJ A;  1ZHQ A;  5LL6 b;  2FK2 A;  3SE7 A;  4ME6 A;  2V4Q A;  2VUG A;  3CQZ A;  4CC5 A;  3BA8 A;  4XZ3 B;  5F9N A;  2W8L A;  4IAJ A;  4ED6 A;  1Y1V A;  2R7Z G;  2V59 A;  2RF4 A;  4LFC H;  2FPI B;  1PK8 A;  2NUA B;  2VUM G;  4QWC A;  2R8I A;  4J9O A;  3G6X A;  4JV1 A;  3K3P A;  4LH6 A;  1RJP A;  1TA8 A;  1WR2 A;  2XGP A;  5IP9 G;  2W71 A;  4A2A A;  5GON F;  5KFV A;  2SCU B;  3OUZ A;  3R5F A;  3OUU A;  2NVX A;  4J9K A;  2OLS A;  2BQ3 A;  4J9M A;  1VKZ A;  4LSA A;  1WCM G;  4X62 H;  3Q1K A;  4DL2 A;  3FDS A;  3BQ2 A;  3OSP A;  2Y0S A;  4I50 F;  4AYB A;  1VBG A;  2VQF H;  4LFA H;  4Y8V B;  1A0I A;  5IT9 W;  4MV9 A;  3E5N A;  2R8H A;  1KJJ A;  3QZ8 A;  4J9L A;  4F4W A;  4LF6 H;  1M0T A;  5LA6 F;  2P0A A;  2R7L A;  5KG2 A;  3KTM A;  3H4B A;  3Q2O A;  2VOB A;  3KAL A;  3RV3 A;  5KFS A;  2AGO A;  4MV3 A;  4JI2 H;  3V4Z A;  3MFI A;  2W6Q A;  4F4Y A;  3TII A;  4ETS A;  2UUA H;  2R86 A;  3VMM A;  3GV5 B;  2W7O A;  5D1O A;  2WYO A;  2AGQ A;  1IBL H;  1B04 A;  2PMZ A;  2UUC H;  5L1J A;  5IYZ F;  1M7J A;  2R87 A;  3OSN A;  2JA5 A;  3KAJ A;  3TIN A;  4B3R H;  5KFK A;  1JIH A;  1GSH A;  1C3O A;  4MA0 A;  1W96 A;  5IYB G;  4RAY A;  5KFH A;  3I12 A;  3MR6 A;  2FB9 A;  4DR7 H;  4M7E A;  3F8N A;  4FBU A;  1K1Q A;  5A2Q W;  4YQW A;  4LMY A;  4I55 F;  5KFR A;  4L1K A;  3HOX G;  4J9Q A;  3TQ1 A;  3GIQ A;  1BJT A;  3IG0 A;  5C8Y F;  2YYA A;  3RJ0 A;  4J9R A;  4DV5 H;  3H3V H;  2FE3 A;  4J9N A;  1JX4 A;  1FJG H;  4HQ6 A;  2VA2 A;  4EBC A;  4QJF A;  4FBT A;  4EYH B;  4IR9 A;  2WAQ A;  2CQY A;  2W6O A;  2XCA A;  4FU0 A;  4YR2 A;  3I4M G;  5L1K A;  3R5H A;  1UC9 A;  1MZB A;  3KHH A;  1N34 H;  1XMQ H;  4UCU A;  4YBZ B;  2E2H A;  3GII A;  1GLV A;  3FKI A;  1W93 A;  3WNZ A;  4EYI B;  4O4H F;  3GV8 B;  3RB6 A;  2R92 G;  2WE6 A;  3N6X A;  1GGO A;  4QIW A;  2W9B B;  1I50 A;  5KFG A;  4DR2 H;  4DL3 A;  4MV8 A;  3MWD A;  2Y0S E;  4DR6 H;  2HVS A;  1UNN C;  5KFC A;  1Z2O X;  1Y1W G;  2W9C B;  1EUC B;  2NVY A;  3PO2 G;  2FKL A;  2JA6 A;  2AU0 A;  3MR2 A;  4RNO A;  5EWE A;  2J6U A;  5EZY F;  5F9L A;  1BNC A;  4GLX A;  3PVX A;  4J9P A;  4DV6 H;  4ED3 A;  3L4K A;  4F4Z A;  2FPP B;  3RBD A;  2AGP A;  4UCR A;  5KT4 A;  1CQJ B;  2V9W A;  3L4J A;  1K1S A;  4A3B G;  4BBS G;  2W6Z A;  3H4D A;  4C5A A;  1KEE A;  5J2U F;  2W57 A;  4OX9 H;  2ASD A;  5L9X A;  4TQS A;  4IRC A;  5DG7 A;  1T3N A;  4ED8 A;  3ETH A;  4ZI7 F;  1S0M A;  1IBK H;  3J80 W;  4FS2 A;  4ECV A;  3RTX A;  2CW7 A;  2FK1 A;  1I6U A;  3FMA A;  1VBH A;  5BR8 H;  3PW7 A;  2YZN A;  4RZQ A;  1B6S A;  4DR1 H;  3M4I A;  2R7Z A;  2R84 A;  4PWQ A;  4MV7 A;  2ZM6 H;  1N32 H;  3HBL A;  5KFM A;  4O3N A;  4J9S A;  2UVR A;  1VS0 A;  5L1I A;  5CA1 F;  1I7N A;  4FS1 A;  2C28 A;  1JDB B;  2JEG A;  2UVW A;  3GTK A;  1DV1 A;  3OHB A;  4QWA A;  1RYR A;  5KFO A;  2KSW A;  3HOZ G;  4RU9 A;  1TWC A;  4ECR A;  2IMW P;  5FD6 A;  3OTO H;  4DL5 A;  1S0N A;  4EG0 A;  1CE8 A;  2AQ4 A;  3IN5 A;  2IA6 A;  1EZ1 A;  1GSA A;  4MV6 A;  2C2R A;  2R8G A;  2NU9 B;  2W8K A;  3GTP A;  1PX2 A;  3T5K A;  2B63 A;  2WAQ E;  4HNV A;  4YHH H;  1TAE A;  3G6Y A;  1S10 A;  2R8K A;  1I3Q A;  1HNX H;  2R93 G;  5DQH A;  2M05 A;  4ED7 A;  3KHG A;  5IYD G;  1XNR H;  5LYJ F;  1E4E B;  2W7P A;  3H20 A;  4ECU A;  5EWF A;  2GPW A;  2VR1 A;  1IBM H;  3JRX A;  4JI3 H;  2JA8 G;  1B6R A;  5KFE A;  2QK4 A;  4ECS A;  1DIK A;  3PN1 A;  2C00 A;  4HR7 A;  1N33 H;  4MV1 A;  2VPS A;  4A3G G;  4KHP H;  1N36 H;  3V6J A;  4DV4 H;  3SI8 A;  2OWO A;  4NLG A;  1S68 A;  3GTG A;  4FM9 A;  5C1O A;  5CB4 F;  3QFF A;  5KKN B;  1JDE A;  3PW4 A;  3WO0 A;  3Q8Q B;  4DV1 H;  4JI7 H;  3PW2 A;  2YW2 A;  5DQI A;  3GIM A;  4E4T A;  5D8D A;  3RV4 A;  5BMV F;  1ZQ7 A;  2ZJT A;  4XYL B;  4UCV A;  1S97 A;  4LH7 A;  3G8C A;  4RB2 C;  1KJQ A;  3RB3 A;  4ZQI A;  4X65 H;  2XGQ A;  2C2D A;  4IR1 A;  4EBD A;  2RGV A;  5HBR B;  2IP4 A;  5KFT A;  3Q8P B;  5EDW A;  2I87 A;  4TUY F;  5JUM A;  2DIK A;  1Y1V G;  3K5I A;  1KC7 A;  3T5H A;  4QW9 A;  2V4R A;  2HVQ A;  2DPI A;  3RF2 A;  2RDI A;  3RAX A;  2GLT A;  3GQC A;  4DL4 A;  3RAQ A;  4LF8 H;  2DZD A;  4M9U A;  3HKZ A;  3HOU G;  5KFP A;  1KJI A;  3JSL A;  1UC8 A;  2XD4 A;  4BWS C;  1C30 A;  2W9B A;  4ECQ A;  2FK3 A;  3DF7 A;  2JA7 A;  4WD3 A;  3GIJ A;  4JYA H;  4B3S H;  2W9C A;  3RB4 A;  3VPC A;  4LF5 H;  1JLL B;  4EGJ A;  4LF7 H;  4G3I A;  5DGB A;  3BJY A;  4DUY H;  5I47 A;  2UXB H;  4DR4 H;  2R7K A;  5KG1 A;  4XX0 B;  3ETJ A;  3MFH A;  1Y14 B;  4HYK A;  4Q0Y A;  4LFB H;  2ZDG A;  2NU6 B;  1B33 N;  3KHR A;  1S9F A;  5D1P A;  3U9T A;  3H0G A;  1Y1W A;  2FLP A;  1V51 A;  3H40 A;  4QWD A;  4DLK A;  1I94 H;  2R6F A;  1SFO A;  5KFJ A;  5KFI A;  5LOV F;  4ECW A;  3GTQ A;  4A3L G;  2ASJ A;  3GIP A;  2JEF A;  3LML A;  2I80 A;  5EOY A;  3TIG A;  3M9M B;  2BR0 A;  2J9G A;  4DV2 H;  5KT6 A;  5LP6 F;  1EUD B;  4ED0 A;  4JI4 H;  1V4Y A;  4YAK B;  4O2B F;  5DLF A;  2FMA A;  4UCO A;  4RNN A;  3GIL A;  5EWG A;  1HNW H;  4BY1 G;  4AYB E;  2JA5 G;  1CS0 A;  4IRK A;  3BA9 A;  5JQW A;  4IZO A;  4QWE A;  2ATL A;  1M0W A;  4ECT A;  5KG6 A;  5BPH A;  3VPD A;  4MV4 A;  1X9N A;  1S0O A;  4YAJ B;  4TQR A;  5DG9 A;  4DL7 A;  4A2B A;  5JH7 F;  4U7C A;  1CQI B;  2WB1 A;  3RGZ A;  2O03 A;  4C5B A;  1RYS A;  4YP3 A;  4O4L F;  1P8L A;  4O3P A;  4JV0 A;  2ASL A;  2YS7 A;  3MWE A;  4R8U B;  5KFB A;  3LWB A;  2FLN A;  3KXY T;  3PR4 A;  4YJ2 F;  5C1P A;  2PMZ E;  1E4F T;  3N43 B;  2R8J A;  1E4E A;  4EFE A;  5KFU A;  4AQY H;  4ECZ A;  2YU9 A;  3GIK A;  2XCL A;  4LF9 H;  3HKZ E;  1ZET A;  1TWG A;  2IBK A;  2JEI A;  1TWA A;  1OWT A;  4JUZ A;  4HNT A;  2RGR A;  4NXM H;  4IHJ F;  4BXX G;  4PDB A;  3JSN A;  1T36 A;  5FLM G;  3JRW A;  3OHA A;  2UVV A;  2VUM A;  5C3E G;  2HHH H;  3N44 B;  2CZG A;  3GTL A;  3EYY A;  5K2M A;  2WTF A;  4GKK H;  3RBE A;  2C22 A;  1K83 A;  3FKI G;  4RUC A;  2FLL A;  5JVD F;  5KFF A;  2MCT A;  4IWY A;  4UCS A;  4MAM A;  4F50 A;  2UXD H;  3M9O B;  5KT7 A;  5JVL A;  5DQG A;  5IWA H;  2JA6 G;  2Q2T A;  1SCU B;  3BG5 A;  3V6H A;  3GTO A;  1WCM A;  4Q43 A;  4RNM A;  1EYZ A;  5LMU H;  1JXL A;  4B3T H;  5C4X G;  4BBR G;  4A3M G;  4DV0 H;  3MR5 A;  1RJQ A;  2RDJ A;  2UU9 H;  3PO3 G;  2PBZ A;  2YRW A;  4A3K G;  5J2T F;  1EHI A;  5KFZ A;  4APM A;  4YR0 A;  3L2P A;  3PW5 A;  4ZOL F;  4EGQ A;  2VQE H;  4Q45 A;  1V9P A;  3G6V A;  2BQR A;  1FKA H;  1T94 A;  4QIW E;  3RFC A;  4U6P A;  2YZG A;  5KFA A;  2OH2 A;  1BGW A;  1XMO H;  3WO1 A;  4ECY A;  1A9X A;  1AUV A;  1RK6 A;  3N42 B;  4IWX A;  2YS6 A;  3PW0 A;  1R9T A;  3I4N G;  4EEY A;  2V5A A;  4CC6 A;  1TWH A;  4O3S A;  4JI1 H;  5KFX A;  5FPR A;  3PZP A;  5KG0 A;  1TWF A;  3VPB A;  2WB1 E;  5FLX W;  4RUA A;  1GYF A; 
#chains in the Genus database with same CATH homology
 4MTE A;  5LMN H;  3N41 B;  1WH2 A;  2HVS A;  1ZHS A;  1Z2O X;  4EEQ A;  4JI8 H;  1XNQ H;  4K0K H;  4JI6 H;  3BAB A;  4LF4 H;  4Q0Y A;  2HVR A;  3J7A K;  4LFB H;  4J0M A;  3RGX A;  3UQ8 A;  3CVZ A;  4GLX A;  2HGS A;  3KAK A;  4DV6 H;  4DV7 H;  3L4K A;  2F4V H;  1J5E H;  4UCT A;  5D1P A;  4UCR A;  4JV5 H;  2UXC H;  4EFB A;  3MWM A;  3L4J A;  1ZHQ A;  1I94 H;  4I7H A;  4B3M H;  5LL6 b;  3N40 P;  2W57 A;  4OX9 H;  2VUG A;  4JI0 H;  4CC5 A;  3BA8 A;  4IAJ A;  1IBK H;  3LML A;  3J80 W;  4DR5 H;  5EOY A;  3RTX A;  2CW7 A;  4X66 H;  2CW8 A;  4LFC H;  4DV2 H;  1I6U A;  3FMA A;  5BR8 H;  4JI4 H;  4MTD A;  1Z2P X;  1AN7 A;  4RZQ A;  4UCO A;  4LH6 A;  4RAZ A;  4DR1 H;  3M4I A;  2WDT A;  1TA8 A;  1HNW H;  4MV7 A;  2ZM6 H;  1N32 H;  1VS0 A;  3BA9 A;  4A2A A;  1M0W A;  4RB1 A;  1SEI A;  1FVI A;  3BAA A;  1S03 G;  2KSW A;  1X9N A;  5FD5 A;  5FD6 A;  3OTO H;  4LSA A;  4X62 H;  4A2B A;  3RGZ A;  2O03 A;  1O75 A;  4RB0 A;  2VQF H;  1P8L A;  4LFA H;  1A0I A;  1Z2N X;  4MV9 A;  5IT9 W;  3KXY T;  4DR6 H;  2YCH A;  1E4F T;  3N43 B;  4YHH H;  1TAE A;  1M0T A;  4EFE A;  4LF6 H;  4DR4 H;  2UUB H;  4AQY H;  1HNX H;  4LF9 H;  4DR3 H;  1XNR H;  2VOB A;  3KAL A;  4X64 H;  4RB3 C;  3T1Y H;  3H20 A;  2RGR A;  4JI2 H;  4NXM H;  1IBM H;  3HXL A;  3JSN A;  4PDB A;  4YY3 H;  4JI3 H;  4ETS A;  2UUA H;  2HHH H;  3N44 B;  3EYY A;  3PN1 A;  3T1H H;  1IBL H;  5D1O A;  2WYO A;  2UUC H;  4GKK H;  1B04 A;  1N33 H;  1E4G T;  2E5L H;  3KAJ A;  4B3R H;  2VPS A;  2MCT A;  4KHP H;  4UCS A;  1N36 H;  4DV4 H;  2OWO A;  5D1O B;  2UXD H;  1S68 A;  4RAY A;  4FM9 A;  5FPO A;  4DR7 H;  5IWA H;  2Q2T A;  4M7E A;  5LMU H;  3F8N A;  4DV1 H;  4B3T H;  4JI7 H;  2XIG A;  4DV3 H;  5A2Q W;  4LMY A;  1HNZ H;  3J81 W;  4DV0 H;  3C0F B;  2UU9 H;  2ZJT A;  1BJT A;  4UCV A;  4LH7 A;  3IG0 A;  4RB2 C;  4X65 H;  4APM A;  3L2P A;  3RJ0 A;  4UFZ A;  2RGV A;  4DV5 H;  2VQE H;  2FE3 A;  1V9P A;  1HR0 H;  3RIZ A;  1FJG H;  1FKA H;  2HVQ A;  1BGW A;  1XMO H;  2Q2U A;  3K3V A;  3JAM W;  3RF2 A;  4R7R A;  4JI5 H;  2UXB H;  1XDN A;  3N42 B;  4LF8 H;  1L2Z A;  1MZB A;  3JSL A;  1N34 H;  4BWS C;  1XMQ H;  1SYX B;  4UCU A;  3DF7 A;  4NXN H;  4CC6 A;  1DGS A;  4JI1 H;  4GKJ H;  4JYA H;  4LSX A;  4DUZ H;  4B3S H;  5FPR A;  2WE6 A;  3N6X A;  5FLX W;  4DR2 H;  4LF5 H;  4LF7 H;  4DUY H;  1GYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...