4R7RA

Crystal structure of putative lipoprotein from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
122
Chain Sequence
AKPSLNYHTKNLSELVSNIKIRLLDMNIYSEVIVDNEDVRIIDDLLKSLKDSNFINEEALPNKPLYKIFIDLNSEKYVIDIYGDDLITLYPWDSDVRKDYLSLKDIPNSFKLEPFCQYVFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal Structure of Putative Lipoprotein from Clostridium perfringens
rcsb
source organism Clostridium perfringens atcc 13124
molecule tags Lipid binding protein
total genus 26
structure length 122
sequence length 124
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16224 DUF4883 DOmain of unknown function (DUF4883)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.410 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4r7rA00
4R7RA
chains in the Genus database with same CATH superfamily
5BMVF 1OWTA 5LOVF 2V58A 3H0GA 1Y14B 5J2UF 1E4EA 1XMQH 1GYFA 5IYCG 1WCMG 1S0OA 4Q8FA 2WE6A 1Y1VG 3MR5A 2AGQA 3MFHA 5KG0A 4B3SH 2NUAB 3J81W 4MA5A 4OX9H 4JI1H 3MWEA 5EDWA 1GO3E 4XX0B 4WBNF 5EWEA 1FVIA 2VA3A 2SCUB 4IZOA 3V4SA 5LYJF 4IR1A 1HNWH 3J7AK 1M0TA 5EOYA 4BBSG 3BJYA 3GTJA 4EBCA 5BPHA 4RUCA 4JYAH 2W70A 2CKZB 3Q1KA 4YY3H 5L1KA 1JKJB 4GKKH 1UNNC 5CAEB 2W9AA 1S0MA 1KJJA 1RK6A 1EHIA 4O3PA 1I50A 4X65H 2HVQA 2V5AA 2W6PA 4LSXA 2DPIA 3GV7B 3GIJA 2FPIB 3TIIA 2FB9A 4J9LA 2VA2A 1ZHSA 2NVYA 1TA8A 1DGSA 4O3QA 4RU9A 1AUVA 3TINA 2W7PA 3T5HA 3JAMW 3H40A 3GQCA 4TQSA 1RJPA 2YS6A 2E2IA 5KFIA 4LF8H 1V51A 1FJGH 1T94A 4LMYA 2FK1A 4YB8B 5KFGA 5L1JA 4DLKA 5KG6A 2FPGB 4RAYA 5IWAH 1ZETA 1HNXH 2ATLA 3CQZA 1N32H 4DL3A 1WCMA 5DLGA 1B33N 2W8LA 2C22A 2R7NA 4GLXA 3HOYG 4JI0H 1E4GT 5FPRA 5IP9G 5JVLA 1BNCA 3RB6A 4LF4H 2MCTA 3ORQA 1VBGA 5L1IA 3MR2A 1N56A 5KFMA 4LF7H 4A3LG 3NGDA 3LMLA 5DG7A 4KHPH 2JA7A 5KFZA 2JA5G 1UC8A 5LXTF 3HOZG 4EEYA 1T36A 4YBZB 2Y0SA 4HNVA 2IBKA 2PN1A 4O3OA 2YZNA 3GIMA 4F4YA 1X9NA 4DR7H 3JSLA 5CB4F 4A3IG 2JEFA 3HOUG 4RAZA 2C2DA 2YS7A 2C2EA 1KEEA 2XCPA 1VAJA 2FKLA 5IYBG 1RJRA 4LFCH 2XCLA 3JZIA 2RF4A 1B6RA 5F9NA 3HOXG 4DR2H 2J6SA 5DG9A 3UFXB 5KG1A 2I87A 3Q8PB 2YZMA 1Y1WG 2R87A 4A3EG 4A3JG 2WYOA 3QZ8A 3GTPA 4JV0A 3N43B 3L4KA 3WO1A 3IG0A 4U6PA 2VQDA 5A2QW 4DR4H 2V59A 4O3SA 2UUBH 2VQEH 2FK2A 4YJ3F 1FKAH 3GILA 5L1LA 2JA8G 3R5HA 1CE8A 3PR5B 5H80A 4YAJB 4MA0A 3UQ8A 4DL4A 2ASLA 4JI5H 3PW7A 2XIGA 4I50F 5KG3A 3RBDA 3OHAA 4O4LF 2PMZE 2XGPA 4EYIB 4RNMA 1BXRA 4I4TF 3GIDA 1C30A 3RBEA 2VR1A 4A3DG 1S0NA 4B3TH 3I4NG 3RF2A 4J9OA 4DL7A 1S10A 3T1HH 4RNNA 2B63A 1VBHA 1WSCA 2WDTA 2UVWA 1ZQ7A 2BQUA 2JEGA 4J9MA 3KHRA 2WAQE 3IN5A 2UVVA 1CQJB 4UCVA 4ECRA 1IBLH 3MR6A 2CQYA 1DV1A 1TWCA 2W9BB 3OHBA 3BQ2A 4QWBA 1SYXB 4ECXA 1O75A 5EWGA 4ED2A 2E5LH 1S03G 3GTLA 2CW8A 2WB1E 4ZHQF 3FKIG 4EG0A 2R7LA 5K2MA 2FP4B 4BXXG 5KFTA 3MWDA 3JSNA 4A3BG 5DQHA 4I7HA 5LMNH 2FLLA 4A3GG 4HR7A 4BBRG 3U9TA 3KALA 5C44G 4FM9A 5KFHA 4MAMA 3KTMA 4LF5H 2NU6B 2YYAA 2ALZA 1K1QA 1E4EB 2YCHA 3WO0A 1B6SA 1XNQH 4C5CA 1WH2A 5LMUH 1IBKH 2J9GA 1XNRH 5KFXA 3OUUA 2FLNA 2FK3A 2R92G 5FD5A 3BA8A 4XZ3B 1DIKA 5IP7G 4O4IF 4IR9A 3PW5A 1VKZA 2W8KA 3BA9A 3LWBA 4HQ6A 4PDBA 2DLNA 2HVSA 1Z2PX 1S97A 5KT2A 4QIWE 3H4BA 1TWGA 4C5BA 1TWHA 4F4ZA 4U7CA 1AN7A 4LH6A 1HR0H 4LFAH 3PO3G 1V9PA 4RZRA 1R9TA 4ED7A 2UVRA 4LH7A 2R93G 4L1KA 4QWEA 2YL2A 5FPOA 2JA7G 3BABA 2W7OA 1HNZH 2UXDH 4IWYA 5C4XG 3TIGA 1IOWA 4Y8VB 5KFBA 1N34H 4GC7A 4LSAA 5BPFA 3GTMA 3FKIA 2DIKA 2IA6A 1EZ1A 4AYBE 5KFFA 2V9WA 5BR8H 4QWCA 2W9CA 5KT7A 4JV1A 3I4MG 2QK4A 3Q8SB 1L2ZA 5CA0F 5KFVA 5FJ8G 2R7ZA 4DR6H 4GKJH 3N40P 2HGSA 5KFLA 1W96A 4RB2C 3OSNA 4DL6A 1I7NA 4HYKA 1KJ9A 4CC5A 4ED3A 1M0WA 1A9XA 2AGOA 2R92A 3MR3A 1T3NA 1N33H 4YP3A 3L4JA 2AU0A 3KAKA 2C35B 1B04A 4RZQA 5IYDG 3EPGA 3RGXA 1WR2A 5IT9W 4JI3H 3QZ7A 4DUYH 1JDEA 5C3EG 3RUPA 4ECSA 3T5KA 5KFOA 1I6UA 3OUZA 2R93A 2RDIA 1N36H 5KT6A 1A0IA 4QW8A 1GSHA 3GIPA 5KFJA 3RB3A 3BQ0A 4M7EA 2B63G 2BQRA 5KG5A 4EBEA 4F50A 4ED0A 3M9MB 2HJWA 3JRXA 3RB4A 2XGQA 4XYLB 4UCOA 2R8KA 2RGVA 2UXBH 2R7MA 3RFCA 2GPWA 5D1OB 5DGAA 4APMA 4DL5A 5KFKA 2VUGA 2R8HA 4A2BA 3HKZE 4YAKB 2R84A 4X66H 3RV4A 2XCAA 1RYRA 5KFQA 4B3RH 5L9XA 3G6VA 2J6TA 1M6VA 2I8CA 3PZPA 4EGQA 3OSPA 3N6XA 5FLMG 4JI6H 3N44B 3HXLA 4O4HF 3DF7A 5KT5A 2W71A 3V6JA 3Q2OA 1JXLA 2P0AA 3CVZA 2X0SA 1AUXA 5DQIA 3GTKA 3T5LA 5KFRA 1GLVA 1XMOH 1VS0A 2AGPA 4G3IA 4R7RA 5JQWA 3J80W 3EPIA 4ZOLF 4Q8EA 1GGOA 1TWAA 4TV8F 5KFUA 4DUZH 4BY7G 3ETHA 3HBLA 3RV3A 5KFAA 2OWOA 2R8IA 1IBMH 4BWSC 4ECTA 2FJZA 4E4TA 2UUAH 4NLGA 1SFOA 4Q44A 1Z2NX 3RAXA 3KHGA 3FMAA 4YQWA 2W6MA 4DV2H 2DPJA 4J0MA 3PW0A 3C0FB 4YJ2F 3QFFA 4DR3H 4XYMB 2ZDGA 2W6NA 4A3KG 2XC9A 3PVXA 2IMWP 2R8GA 4MV1A 3V6KA 3BAAA 1EUCB 4A93G 4DV5H 4A2AA 3AYHB 2ZM6H 3HOVG 5KT4A 3VPBA 2PVPA 1BJTA 1Z2OX 1TAEA 4R8UB 2OLSA 2J6UA 3KAJA 2FPPB 3MWMA 2JA6A 4Q45A 5KFSA 2NU7B 1MZBA 4JI2H 3H3VH 4JUZA 2VUMA 4A3CG 4DR5H 4ZQIA 4EBDA 5KFNA 1TWFA 2Q2TA 5D1PA 5CA1F 2R7ZG 4JV5H 4MV9A 2RDJA 4X62H 4M9UA 2V4RA 4AQYH 4ED1A 2M05A 2PMZA 3VPCA 4RUAA 4ECZA 4O3NA 2NU9B 3F8NA 2C2RA 4MV3A 4ED6A 3RJ0A 2JEJA 4FBTA 4UFZA 5EWFA 4A3MG 3VMMA 2WAQA 2GPSA 4UCUA 4EFEA 3HB9A 1M7JA 4HNUA 1N48A 4TQRA 3KHHA 4BY1G 5KX5F 1KC7A 3PW4A 2IP4A 1JDBB 2CZGA 4IWXA 3H4DA 2WB1A 5KFEA 5T14A 3GIKA 5LA6F 2W9CB 4JV2A 4DV7H 1KJQA 4QW9A 2VOBA 3K3PA 4IRCA 3K5HA 5DLFA 5EZYF 1CQIB 3GTGA 5IYZF 1GSAA 2W57A 4HNTA 1JX4A 2UU9H 5KG7A 5GONF 2FE3A 3TQ1A 4MTEA 2I80A 4QWAA 3H20A 4I55F 2VQFH 2Q2UA 1RK5A 3TQTA 2HHHH 1CS0A 4JI7H 4NXMH 2YZGA 2DWCA 3RGZA 1E4FT 5DGBA 4MV7A 3G6YA 4ECYA 1RYSA 1W93A 3OTOH 4J9PA 2FMAA 2C28A 2BQ3A 2YW2A 4UCTA 4J9QA 3GV5B 4JI8H 5LL6b 2E2HA 4QIWA 1KJ8A 5KG4A 2Y0SE 4IRDA 4YHHH 5KFYA 4GC6A 1S68A 1KJIA 3RIZA 2ZDHA 4FS1A 4EEQA 3I12A 5JVDF 5I47A 5C5JA 4TUYF 3Q8QB 2R86A 3GIIA 2NVXA 4CC6A 4JI4H 3RAQA 3T5JA 4QJFA 1EYZA 2C00A 3ETJA 2AQ4A 4MV8A 4FBUA 4LFBH 3WNZA 5FLXW 4YR2A 4AYBA 3K5IA 5C1PA 5KFWA 3SI8A 2HVRA 4DV3H 2GLTA 1K83A 2FLPA 3RTXA 4X64H 4Q43A 2W6QA 4IAJA 3G6XA 1Y1VA 2BR0A 2O03A 5J2TF 3M4IA 2JA6G 4QWDA 5KT3A 3BQ1A 2KSWA 5DQGA 2XD4A 3KHLA 4J9KA 4DV6H 4ED8A 4LF9H 2VUMG 5KG2A 2V4QA 1ULZA 3GV8B 2JEIA 1J5EH 2R82A 4RB3C 4TV9F 1JLLB 2CW7A 4O2BF 4EGJA 2UVUA 4B3MH 4ME6A 3ORRA 3T1YH 1XDNA 1RJQA 3HOWG 4MV6A 3M9OB 1I94H 4PWQA 4ECUA 4MTDA 1BGWA 1V4YA 4J9NA 3R23A 2VPQA 3EYYA 3N42B 2NU8B 5JH7F 4A3FG 2OH2A 4K0KH 2UXCH 4C5AA 3JRWA 4F4WA 4ZI7F 2R85A 4ECVA 3K3VA 4RNOA 3L2PA 1PK8A 4RB1A 3MJFA 3PR4A 5D1OA 1JIHA 2PBZA 4EFBA 4J9RA 2UUCH 4DL2A 1K1SA 4O2AF 2QYZA 3GTQA 1I3QA 3GTOA 4UCSA 5HV6A 2F4VH 4ECQA 3E5NA 1C3OA 4FU0A 2YRWA 4DV4H 3VPDA 3HKZA 1I7LA 4WD3A 2ZJTA 1SEIA 3V6HA 2ASJA 3H0GG 1P8LA 4IHJF 4J9SA 2WTFA 5DG8A 3GLKA 5LP6F 1UC9A 5KFCA 5FD6A 2W6ZA 4O3RA 1S9FA 3V4ZA 2ASDA 1IOVA 4DV1H 5D8DA 5C1OA 3RB0A 3N41B 1ZHQA 4NXNH 2YU9A 3G8CA 3PO2G 1DV2A 3PN1A 2ZDQA 2JA5A 4F4XA 3KXYT 4YR0A 3PW2A 1GSOA 3N8DA 3Q8RB 2W6OA 4DR1H 5JUMA 4RB0A 3SE7A 1PX2A 3LP8A 3U9SA 3R5XA 2YRXA 3FDSA 2R8JA 3GIQA 2R7KA 2R6FA 5KFPA 5C8YF 2W9BA 4ECWA 4LF6H 1Y1WA 5HBRB 2RGRA 4ETSA 1EUDB 4R8UA 5KFDA 4YR3A 3MFIA 4MV4A 2VPSA 4DV0H 4FS2A 3BG5A 1KBLA 4IRKA 4Q0YA 3R5FA 4C2MA 5KKNB 1SCUB 3M9NB 5F9LA 2DZDA 4UCRA 4EYHB
chains in the Genus database with same CATH topology
4YHHH 3T1HH 4JI6H 2WDTA 1S68A 3N6XA 3RIZA 3N44B 4EEQA 3HXLA 1XMQH 1GYFA 4UCVA 1IBLH 3DF7A 2WE6A 4B3SH 1SYXB 3J81W 4CC6A 4JI4H 4OX9H 1O75A 3CVZA 4JI1H 2E5LH 1S03G 2CW8A 1XMOH 1VS0A 1FVIA 4R7RA 3J80W 4LFBH 3JSNA 5FLXW 5LMNH 4I7HA 4DUZH 1HNWH 2HVRA 3KALA 4DV3H 1M0TA 5EOYA 3J7AK 4FM9A 2OWOA 3RTXA 1IBMH 4BWSC 4X64H 4IAJA 2UUAH 4JYAH 4LF5H 2O03A 1Z2NX 3M4IA 4YY3H 2YCHA 4GKKH 1XNQH 4DV6H 2KSWA 3FMAA 1WH2A 5LMUH 4DV2H 1IBKH 4LF9H 4J0MA 3C0FB 4X65H 1XNRH 2HVQA 4LSXA 4DR3H 1J5EH 4RB3C 2CW7A 5FD5A 3BA8A 4B3MH 1ZHSA 1TA8A 1DGSA 3BAAA 4DV5H 3BA9A 3JAMW 3T1YH 4A2AA 2ZM6H 1XDNA 2HVSA 4PDBA 1Z2PX 1I94H 1BJTA 1Z2OX 1TAEA 3KAJA 3MWMA 4LF8H 1FJGH 4MTDA 1BGWA 1MZBA 1AN7A 4JI2H 4LH6A 4LMYA 1HR0H 4LFAH 1V9PA 4DR5H 3EYYA 4LH7A 3N42B 4RAYA 5FPOA 5IWAH 1HNXH 3BABA 4K0KH 1N32H 2UXCH 1HNZH 3K3VA 2Q2TA 2UXDH 5D1PA 3L2PA 4GLXA 4RB1A 4MV9A 4JI0H 4JV5H 1E4GT 5FPRA 5D1OA 4X62H 4EFBA 1N34H 2UUCH 4LSAA 4AQYH 4LF4H 2MCTA 4UCSA 5BR8H 4LF7H 3F8NA 2F4VH 3LMLA 4KHPH 4DV4H 1L2ZA 2ZJTA 1SEIA 3RJ0A 4DR6H 4GKJH 3N40P 1P8LA 4UFZA 2HGSA 1X9NA 4DR7H 3JSLA 4RB2C 4RAZA 4UCUA 4EFEA 5FD6A 4CC5A 4DV1H 4LFCH 1M0WA 3N41B 1N33H 1ZHQA 3L4JA 4NXNH 4DR2H 3KAKA 3PN1A 1B04A 4RZQA 3KXYT 3RGXA 4DV7H 5IT9W 4JI3H 2VOBA 2WYOA 4DUYH 3N43B 3L4KA 4DR1H 3IG0A 1I6UA 4RB0A 2W57A 5A2QW 4DR4H 2UU9H 2VQEH 2UUBH 1FKAH 1N36H 1A0IA 2FE3A 4MTEA 4M7EA 3H20A 4B3RH 3UQ8A 2VQFH 2Q2UA 4JI5H 2HHHH 4LF6H 2XIGA 2RGRA 4JI7H 4ETSA 4NXMH 3RGZA 1E4FT 4UCOA 4MV7A 4DV0H 2VPSA 2RGVA 3OTOH 2UXBH 4Q0YA 5D1OB 4UCTA 4APMA 2VUGA 4JI8H 4A2BA 4UCRA 5LL6b 4B3TH 4X66H 3RF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7R A; 
#chains in the Genus database with same CATH topology
 5BMV F;  1OWT A;  5LOV F;  2V58 A;  3H0G A;  1Y14 B;  5J2U F;  1E4E A;  1XMQ H;  1GYF A;  5IYC G;  1WCM G;  1S0O A;  4Q8F A;  2WE6 A;  1Y1V G;  3MR5 A;  2AGQ A;  3MFH A;  5KG0 A;  4B3S H;  2NUA B;  3J81 W;  4MA5 A;  4OX9 H;  4JI1 H;  3MWE A;  5EDW A;  1GO3 E;  4XX0 B;  4WBN F;  5EWE A;  1FVI A;  2VA3 A;  2SCU B;  4IZO A;  3V4S A;  5LYJ F;  4IR1 A;  1HNW H;  3J7A K;  1M0T A;  5EOY A;  4BBS G;  3BJY A;  3GTJ A;  4EBC A;  5BPH A;  4RUC A;  4JYA H;  2W70 A;  2CKZ B;  3Q1K A;  4YY3 H;  5L1K A;  1JKJ B;  4GKK H;  1UNN C;  5CAE B;  2W9A A;  1S0M A;  1KJJ A;  1RK6 A;  1EHI A;  4O3P A;  1I50 A;  4X65 H;  2HVQ A;  2V5A A;  2W6P A;  4LSX A;  2DPI A;  3GV7 B;  3GIJ A;  2FPI B;  3TII A;  2FB9 A;  4J9L A;  2VA2 A;  1ZHS A;  2NVY A;  1TA8 A;  1DGS A;  4O3Q A;  4RU9 A;  1AUV A;  3TIN A;  2W7P A;  3T5H A;  3JAM W;  3H40 A;  3GQC A;  4TQS A;  1RJP A;  2YS6 A;  2E2I A;  5KFI A;  4LF8 H;  1V51 A;  1FJG H;  1T94 A;  4LMY A;  2FK1 A;  4YB8 B;  5KFG A;  5L1J A;  4DLK A;  5KG6 A;  2FPG B;  4RAY A;  5IWA H;  1ZET A;  1HNX H;  2ATL A;  3CQZ A;  1N32 H;  4DL3 A;  1WCM A;  5DLG A;  1B33 N;  2W8L A;  2C22 A;  2R7N A;  4GLX A;  3HOY G;  4JI0 H;  1E4G T;  5FPR A;  5IP9 G;  5JVL A;  1BNC A;  3RB6 A;  4LF4 H;  2MCT A;  3ORQ A;  1VBG A;  5L1I A;  3MR2 A;  1N56 A;  5KFM A;  4LF7 H;  4A3L G;  3NGD A;  3LML A;  5DG7 A;  4KHP H;  2JA7 A;  5KFZ A;  2JA5 G;  1UC8 A;  5LXT F;  3HOZ G;  4EEY A;  1T36 A;  4YBZ B;  2Y0S A;  4HNV A;  2IBK A;  2PN1 A;  4O3O A;  2YZN A;  3GIM A;  4F4Y A;  1X9N A;  4DR7 H;  3JSL A;  5CB4 F;  4A3I G;  2JEF A;  3HOU G;  4RAZ A;  2C2D A;  2YS7 A;  2C2E A;  1KEE A;  2XCP A;  1VAJ A;  2FKL A;  5IYB G;  1RJR A;  4LFC H;  2XCL A;  3JZI A;  2RF4 A;  1B6R A;  5F9N A;  3HOX G;  4DR2 H;  2J6S A;  5DG9 A;  3UFX B;  5KG1 A;  2I87 A;  3Q8P B;  2YZM A;  1Y1W G;  2R87 A;  4A3E G;  4A3J G;  2WYO A;  3QZ8 A;  3GTP A;  4JV0 A;  3N43 B;  3L4K A;  3WO1 A;  3IG0 A;  4U6P A;  2VQD A;  5A2Q W;  4DR4 H;  2V59 A;  4O3S A;  2UUB H;  2VQE H;  2FK2 A;  4YJ3 F;  1FKA H;  3GIL A;  5L1L A;  2JA8 G;  3R5H A;  1CE8 A;  3PR5 B;  5H80 A;  4YAJ B;  4MA0 A;  3UQ8 A;  4DL4 A;  2ASL A;  4JI5 H;  3PW7 A;  2XIG A;  4I50 F;  5KG3 A;  3RBD A;  3OHA A;  4O4L F;  2PMZ E;  2XGP A;  4EYI B;  4RNM A;  1BXR A;  4I4T F;  3GID A;  1C30 A;  3RBE A;  2VR1 A;  4A3D G;  1S0N A;  4B3T H;  3I4N G;  3RF2 A;  4J9O A;  4DL7 A;  1S10 A;  3T1H H;  4RNN A;  2B63 A;  1VBH A;  1WSC A;  2WDT A;  2UVW A;  1ZQ7 A;  2BQU A;  2JEG A;  4J9M A;  3KHR A;  2WAQ E;  3IN5 A;  2UVV A;  1CQJ B;  4UCV A;  4ECR A;  1IBL H;  3MR6 A;  2CQY A;  1DV1 A;  1TWC A;  2W9B B;  3OHB A;  3BQ2 A;  4QWB A;  1SYX B;  4ECX A;  1O75 A;  5EWG A;  4ED2 A;  2E5L H;  1S03 G;  3GTL A;  2CW8 A;  2WB1 E;  4ZHQ F;  3FKI G;  4EG0 A;  2R7L A;  5K2M A;  2FP4 B;  4BXX G;  5KFT A;  3MWD A;  3JSN A;  4A3B G;  5DQH A;  4I7H A;  5LMN H;  2FLL A;  4A3G G;  4HR7 A;  4BBR G;  3U9T A;  3KAL A;  5C44 G;  4FM9 A;  5KFH A;  4MAM A;  3KTM A;  4LF5 H;  2NU6 B;  2YYA A;  2ALZ A;  1K1Q A;  1E4E B;  2YCH A;  3WO0 A;  1B6S A;  1XNQ H;  4C5C A;  1WH2 A;  5LMU H;  1IBK H;  2J9G A;  1XNR H;  5KFX A;  3OUU A;  2FLN A;  2FK3 A;  2R92 G;  5FD5 A;  3BA8 A;  4XZ3 B;  1DIK A;  5IP7 G;  4O4I F;  4IR9 A;  3PW5 A;  1VKZ A;  2W8K A;  3BA9 A;  3LWB A;  4HQ6 A;  4PDB A;  2DLN A;  2HVS A;  1Z2P X;  1S97 A;  5KT2 A;  4QIW E;  3H4B A;  1TWG A;  4C5B A;  1TWH A;  4F4Z A;  4U7C A;  1AN7 A;  4LH6 A;  1HR0 H;  4LFA H;  3PO3 G;  1V9P A;  4RZR A;  1R9T A;  4ED7 A;  2UVR A;  4LH7 A;  2R93 G;  4L1K A;  4QWE A;  2YL2 A;  5FPO A;  2JA7 G;  3BAB A;  2W7O A;  1HNZ H;  2UXD H;  4IWY A;  5C4X G;  3TIG A;  1IOW A;  4Y8V B;  5KFB A;  1N34 H;  4GC7 A;  4LSA A;  5BPF A;  3GTM A;  3FKI A;  2DIK A;  2IA6 A;  1EZ1 A;  4AYB E;  5KFF A;  2V9W A;  5BR8 H;  4QWC A;  2W9C A;  5KT7 A;  4JV1 A;  3I4M G;  2QK4 A;  3Q8S B;  1L2Z A;  5CA0 F;  5KFV A;  5FJ8 G;  2R7Z A;  4DR6 H;  4GKJ H;  3N40 P;  2HGS A;  5KFL A;  1W96 A;  4RB2 C;  3OSN A;  4DL6 A;  1I7N A;  4HYK A;  1KJ9 A;  4CC5 A;  4ED3 A;  1M0W A;  1A9X A;  2AGO A;  2R92 A;  3MR3 A;  1T3N A;  1N33 H;  4YP3 A;  3L4J A;  2AU0 A;  3KAK A;  2C35 B;  1B04 A;  4RZQ A;  5IYD G;  3EPG A;  3RGX A;  1WR2 A;  5IT9 W;  4JI3 H;  3QZ7 A;  4DUY H;  1JDE A;  5C3E G;  3RUP A;  4ECS A;  3T5K A;  5KFO A;  1I6U A;  3OUZ A;  2R93 A;  2RDI A;  1N36 H;  5KT6 A;  1A0I A;  4QW8 A;  1GSH A;  3GIP A;  5KFJ A;  3RB3 A;  3BQ0 A;  4M7E A;  2B63 G;  2BQR A;  5KG5 A;  4EBE A;  4F50 A;  4ED0 A;  3M9M B;  2HJW A;  3JRX A;  3RB4 A;  2XGQ A;  4XYL B;  4UCO A;  2R8K A;  2RGV A;  2UXB H;  2R7M A;  3RFC A;  2GPW A;  5D1O B;  5DGA A;  4APM A;  4DL5 A;  5KFK A;  2VUG A;  2R8H A;  4A2B A;  3HKZ E;  4YAK B;  2R84 A;  4X66 H;  3RV4 A;  2XCA A;  1RYR A;  5KFQ A;  4B3R H;  5L9X A;  3G6V A;  2J6T A;  1M6V A;  2I8C A;  3PZP A;  4EGQ A;  3OSP A;  3N6X A;  5FLM G;  4JI6 H;  3N44 B;  3HXL A;  4O4H F;  3DF7 A;  5KT5 A;  2W71 A;  3V6J A;  3Q2O A;  1JXL A;  2P0A A;  3CVZ A;  2X0S A;  1AUX A;  5DQI A;  3GTK A;  3T5L A;  5KFR A;  1GLV A;  1XMO H;  1VS0 A;  2AGP A;  4G3I A;  4R7R A;  5JQW A;  3J80 W;  3EPI A;  4ZOL F;  4Q8E A;  1GGO A;  1TWA A;  4TV8 F;  5KFU A;  4DUZ H;  4BY7 G;  3ETH A;  3HBL A;  3RV3 A;  5KFA A;  2OWO A;  2R8I A;  1IBM H;  4BWS C;  4ECT A;  2FJZ A;  4E4T A;  2UUA H;  4NLG A;  1SFO A;  4Q44 A;  1Z2N X;  3RAX A;  3KHG A;  3FMA A;  4YQW A;  2W6M A;  4DV2 H;  2DPJ A;  4J0M A;  3PW0 A;  3C0F B;  4YJ2 F;  3QFF A;  4DR3 H;  4XYM B;  2ZDG A;  2W6N A;  4A3K G;  2XC9 A;  3PVX A;  2IMW P;  2R8G A;  4MV1 A;  3V6K A;  3BAA A;  1EUC B;  4A93 G;  4DV5 H;  4A2A A;  3AYH B;  2ZM6 H;  3HOV G;  5KT4 A;  3VPB A;  2PVP A;  1BJT A;  1Z2O X;  1TAE A;  4R8U B;  2OLS A;  2J6U A;  3KAJ A;  2FPP B;  3MWM A;  2JA6 A;  4Q45 A;  5KFS A;  2NU7 B;  1MZB A;  4JI2 H;  3H3V H;  4JUZ A;  2VUM A;  4A3C G;  4DR5 H;  4ZQI A;  4EBD A;  5KFN A;  1TWF A;  2Q2T A;  5D1P A;  5CA1 F;  2R7Z G;  4JV5 H;  4MV9 A;  2RDJ A;  4X62 H;  4M9U A;  2V4R A;  4AQY H;  4ED1 A;  2M05 A;  2PMZ A;  3VPC A;  4RUA A;  4ECZ A;  4O3N A;  2NU9 B;  3F8N A;  2C2R A;  4MV3 A;  4ED6 A;  3RJ0 A;  2JEJ A;  4FBT A;  4UFZ A;  5EWF A;  4A3M G;  3VMM A;  2WAQ A;  2GPS A;  4UCU A;  4EFE A;  3HB9 A;  1M7J A;  4HNU A;  1N48 A;  4TQR A;  3KHH A;  4BY1 G;  5KX5 F;  1KC7 A;  3PW4 A;  2IP4 A;  1JDB B;  2CZG A;  4IWX A;  3H4D A;  2WB1 A;  5KFE A;  5T14 A;  3GIK A;  5LA6 F;  2W9C B;  4JV2 A;  4DV7 H;  1KJQ A;  4QW9 A;  2VOB A;  3K3P A;  4IRC A;  3K5H A;  5DLF A;  5EZY F;  1CQI B;  3GTG A;  5IYZ F;  1GSA A;  2W57 A;  4HNT A;  1JX4 A;  2UU9 H;  5KG7 A;  5GON F;  2FE3 A;  3TQ1 A;  4MTE A;  2I80 A;  4QWA A;  3H20 A;  4I55 F;  2VQF H;  2Q2U A;  1RK5 A;  3TQT A;  2HHH H;  1CS0 A;  4JI7 H;  4NXM H;  2YZG A;  2DWC A;  3RGZ A;  1E4F T;  5DGB A;  4MV7 A;  3G6Y A;  4ECY A;  1RYS A;  1W93 A;  3OTO H;  4J9P A;  2FMA A;  2C28 A;  2BQ3 A;  2YW2 A;  4UCT A;  4J9Q A;  3GV5 B;  4JI8 H;  5LL6 b;  2E2H A;  4QIW A;  1KJ8 A;  5KG4 A;  2Y0S E;  4IRD A;  4YHH H;  5KFY A;  4GC6 A;  1S68 A;  1KJI A;  3RIZ A;  2ZDH A;  4FS1 A;  4EEQ A;  3I12 A;  5JVD F;  5I47 A;  5C5J A;  4TUY F;  3Q8Q B;  2R86 A;  3GII A;  2NVX A;  4CC6 A;  4JI4 H;  3RAQ A;  3T5J A;  4QJF A;  1EYZ A;  2C00 A;  3ETJ A;  2AQ4 A;  4MV8 A;  4FBU A;  4LFB H;  3WNZ A;  5FLX W;  4YR2 A;  4AYB A;  3K5I A;  5C1P A;  5KFW A;  3SI8 A;  2HVR A;  4DV3 H;  2GLT A;  1K83 A;  2FLP A;  3RTX A;  4X64 H;  4Q43 A;  2W6Q A;  4IAJ A;  3G6X A;  1Y1V A;  2BR0 A;  2O03 A;  5J2T F;  3M4I A;  2JA6 G;  4QWD A;  5KT3 A;  3BQ1 A;  2KSW A;  5DQG A;  2XD4 A;  3KHL A;  4J9K A;  4DV6 H;  4ED8 A;  4LF9 H;  2VUM G;  5KG2 A;  2V4Q A;  1ULZ A;  3GV8 B;  2JEI A;  1J5E H;  2R82 A;  4RB3 C;  4TV9 F;  1JLL B;  2CW7 A;  4O2B F;  4EGJ A;  2UVU A;  4B3M H;  4ME6 A;  3ORR A;  3T1Y H;  1XDN A;  1RJQ A;  3HOW G;  4MV6 A;  3M9O B;  1I94 H;  4PWQ A;  4ECU A;  4MTD A;  1BGW A;  1V4Y A;  4J9N A;  3R23 A;  2VPQ A;  3EYY A;  3N42 B;  2NU8 B;  5JH7 F;  4A3F G;  2OH2 A;  4K0K H;  2UXC H;  4C5A A;  3JRW A;  4F4W A;  4ZI7 F;  2R85 A;  4ECV A;  3K3V A;  4RNO A;  3L2P A;  1PK8 A;  4RB1 A;  3MJF A;  3PR4 A;  5D1O A;  1JIH A;  2PBZ A;  4EFB A;  4J9R A;  2UUC H;  4DL2 A;  1K1S A;  4O2A F;  2QYZ A;  3GTQ A;  1I3Q A;  3GTO A;  4UCS A;  5HV6 A;  2F4V H;  4ECQ A;  3E5N A;  1C3O A;  4FU0 A;  2YRW A;  4DV4 H;  3VPD A;  3HKZ A;  1I7L A;  4WD3 A;  2ZJT A;  1SEI A;  3V6H A;  2ASJ A;  3H0G G;  1P8L A;  4IHJ F;  4J9S A;  2WTF A;  5DG8 A;  3GLK A;  5LP6 F;  1UC9 A;  5KFC A;  5FD6 A;  2W6Z A;  4O3R A;  1S9F A;  3V4Z A;  2ASD A;  1IOV A;  4DV1 H;  5D8D A;  5C1O A;  3RB0 A;  3N41 B;  1ZHQ A;  4NXN H;  2YU9 A;  3G8C A;  3PO2 G;  1DV2 A;  3PN1 A;  2ZDQ A;  2JA5 A;  4F4X A;  3KXY T;  4YR0 A;  3PW2 A;  1GSO A;  3N8D A;  3Q8R B;  2W6O A;  4DR1 H;  5JUM A;  4RB0 A;  3SE7 A;  1PX2 A;  3LP8 A;  3U9S A;  3R5X A;  2YRX A;  3FDS A;  2R8J A;  3GIQ A;  2R7K A;  2R6F A;  5KFP A;  5C8Y F;  2W9B A;  4ECW A;  4LF6 H;  1Y1W A;  5HBR B;  2RGR A;  4ETS A;  1EUD B;  4R8U A;  5KFD A;  4YR3 A;  3MFI A;  4MV4 A;  2VPS A;  4DV0 H;  4FS2 A;  3BG5 A;  1KBL A;  4IRK A;  4Q0Y A;  3R5F A;  4C2M A;  5KKN B;  1SCU B;  3M9N B;  5F9L A;  2DZD A;  4UCR A;  4EYH B; 
#chains in the Genus database with same CATH homology
 4YHH H;  3T1H H;  4JI6 H;  2WDT A;  1S68 A;  3N6X A;  3RIZ A;  3N44 B;  4EEQ A;  3HXL A;  1XMQ H;  1GYF A;  4UCV A;  1IBL H;  3DF7 A;  2WE6 A;  4B3S H;  1SYX B;  3J81 W;  4CC6 A;  4JI4 H;  4OX9 H;  1O75 A;  3CVZ A;  4JI1 H;  2E5L H;  1S03 G;  2CW8 A;  1XMO H;  1VS0 A;  1FVI A;  4R7R A;  3J80 W;  4LFB H;  3JSN A;  5FLX W;  5LMN H;  4I7H A;  4DUZ H;  1HNW H;  2HVR A;  3KAL A;  4DV3 H;  1M0T A;  5EOY A;  3J7A K;  4FM9 A;  2OWO A;  3RTX A;  1IBM H;  4BWS C;  4X64 H;  4IAJ A;  2UUA H;  4JYA H;  4LF5 H;  2O03 A;  1Z2N X;  3M4I A;  4YY3 H;  2YCH A;  4GKK H;  1XNQ H;  4DV6 H;  2KSW A;  3FMA A;  1WH2 A;  5LMU H;  4DV2 H;  1IBK H;  4LF9 H;  4J0M A;  3C0F B;  4X65 H;  1XNR H;  2HVQ A;  4LSX A;  4DR3 H;  1J5E H;  4RB3 C;  2CW7 A;  5FD5 A;  3BA8 A;  4B3M H;  1ZHS A;  1TA8 A;  1DGS A;  3BAA A;  4DV5 H;  3BA9 A;  3JAM W;  3T1Y H;  4A2A A;  2ZM6 H;  1XDN A;  2HVS A;  4PDB A;  1Z2P X;  1I94 H;  1BJT A;  1Z2O X;  1TAE A;  3KAJ A;  3MWM A;  4LF8 H;  1FJG H;  4MTD A;  1BGW A;  1MZB A;  1AN7 A;  4JI2 H;  4LH6 A;  4LMY A;  1HR0 H;  4LFA H;  1V9P A;  4DR5 H;  3EYY A;  4LH7 A;  3N42 B;  4RAY A;  5FPO A;  5IWA H;  1HNX H;  3BAB A;  4K0K H;  1N32 H;  2UXC H;  1HNZ H;  3K3V A;  2Q2T A;  2UXD H;  5D1P A;  3L2P A;  4GLX A;  4RB1 A;  4MV9 A;  4JI0 H;  4JV5 H;  1E4G T;  5FPR A;  5D1O A;  4X62 H;  4EFB A;  1N34 H;  2UUC H;  4LSA A;  4AQY H;  4LF4 H;  2MCT A;  4UCS A;  5BR8 H;  4LF7 H;  3F8N A;  2F4V H;  3LML A;  4KHP H;  4DV4 H;  1L2Z A;  2ZJT A;  1SEI A;  3RJ0 A;  4DR6 H;  4GKJ H;  3N40 P;  1P8L A;  4UFZ A;  2HGS A;  1X9N A;  4DR7 H;  3JSL A;  4RB2 C;  4RAZ A;  4UCU A;  4EFE A;  5FD6 A;  4CC5 A;  4DV1 H;  4LFC H;  1M0W A;  3N41 B;  1N33 H;  1ZHQ A;  3L4J A;  4NXN H;  4DR2 H;  3KAK A;  3PN1 A;  1B04 A;  4RZQ A;  3KXY T;  3RGX A;  4DV7 H;  5IT9 W;  4JI3 H;  2VOB A;  2WYO A;  4DUY H;  3N43 B;  3L4K A;  4DR1 H;  3IG0 A;  1I6U A;  4RB0 A;  2W57 A;  5A2Q W;  4DR4 H;  2UU9 H;  2VQE H;  2UUB H;  1FKA H;  1N36 H;  1A0I A;  2FE3 A;  4MTE A;  4M7E A;  3H20 A;  4B3R H;  3UQ8 A;  2VQF H;  2Q2U A;  4JI5 H;  2HHH H;  4LF6 H;  2XIG A;  2RGR A;  4JI7 H;  4ETS A;  4NXM H;  3RGZ A;  1E4F T;  4UCO A;  4MV7 A;  4DV0 H;  2VPS A;  2RGV A;  3OTO H;  2UXB H;  4Q0Y A;  5D1O B;  4UCT A;  4APM A;  2VUG A;  4JI8 H;  4A2B A;  4UCR A;  5LL6 b;  4B3T H;  4X66 H;  3RF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...