4R7RA

Crystal structure of putative lipoprotein from clostridium perfringens
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
122
Chain Sequence
b'AKPSLNYHTKNLSELVSNIKIRLLDMNIYSEVIVDNEDVRIIDDLLKSLKDSNFINEEALPNKPLYKIFIDLNSEKYVIDIYGDDLITLYPWDSDVRKDYLSLKDIPNSFKLEPFCQYVFNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal Structure of Putative Lipoprotein from Clostridium perfringens
rcsb
source organism Clostridium perfringens atcc 13124
molecule tags Lipid binding protein
total genus 26
structure length 122
sequence length 124
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16224 DUF4883 DOmain of unknown function (DUF4883)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.410 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4r7rA00
4R7RA
chains in the Genus database with same CATH superfamily
2YZMA 1SYXB 4MV3A 3TIGA 4C2MA 2FPPB 4R7RA 2VQEH 3RBEA 3WO1A 5C5JA 4QWCA 1JXLA 2FK1A 1I94H 4IRDA 3HOZG 4U7CA 5DGBA 2GPSA 5L1JA 2W7PA 4J9MA 5BPFA 4TV9F 2J6UA 2YRWA 2FLPA 4RUCA 4IWYA 4ZHQF 3J81W 4K0KH 1WR2A 4DL6A 3L4JA 1I7LA 4BBSG 2ZM6H 3HBLA 2VQFH 2FPIB 1KBLA 3Q8SB 2ASDA 5JUMA 1L2ZA 4F4WA 4HNUA 4BBRG 4JI4H 4EFEA 2FLNA 2V9WA 5IYZF 1TA8A 1DIKA 4JI2H 3N42B 1V9PA 5IT9W 1MZBA 3RFCA 2J6TA 4Q8EA 3TINA 2UUAH 3MR3A 3GTQA 3M4IA 4G3IA 5LMNH 3VPCA 4A3EG 1TWFA 4X62H 5KFCA 3PZPA 4AYBE 5KG7A 3DF7A 4DUZH 4ECXA 4F4XA 4DV3H 3TIIA 2NU6B 5KFUA 3PW0A 1S0NA 4APMA 4ETSA 4X64H 4I50F 1O75A 1KEEA 1M0TA 5KFGA 3JRWA 4C5AA 4O4LF 5FD6A 5LOVF 4MV6A 4QWDA 5EWFA 1N48A 2JA5G 2VPSA 3LP8A 5KFAA 2R7LA 5KFLA 4B3TH 4LH6A 2JEJA 4A3CG 3FDSA 1KJJA 4MAMA 1X9NA 2UXCH 5D8DA 3PW7A 1HNWH 2R7ZA 3EPIA 4DV0H 1IOWA 3FKIG 4JUZA 2W9BA 4J9RA 4B3SH 4DR4H 2C28A 1RYRA 3G6VA 4RZQA 2BQUA 5KT3A 1PK8A 4ZQIA 4HNTA 4RUAA 4A3MG 5CB4F 4DR5H 2VPQA 2XCLA 5KFNA 4Q0YA 4YBZB 4EYHB 3HOXG 1KJQA 4F50A 1N36H 3VPBA 1R9TA 4J9OA 3U9SA 4ED0A 1RJRA 2QK4A 3OHBA 1WH2A 4DL4A 3HB9A 2C2EA 5FD5A 1S10A 2E2HA 3RB6A 2XCPA 5HV6A 1DV2A 3JZIA 3L2PA 2ZDGA 3HOWG 4A3DG 4O2AF 2W57A 3NGDA 2XCAA 3BQ0A 4Q8FA 4J9KA 3ORRA 2DZDA 4DV4H 2W8LA 2V58A 2PBZA 2AU0A 2FK3A 5HBRB 4HQ6A 1JDBB 1T36A 2R87A 3VPDA 4YR3A 4HYKA 3CVZA 2BQ3A 4O3PA 2J9GA 2ZDQA 2WTFA 3Q8QB 3JSLA 4YJ3F 2ZJTA 2E2IA 5A2QW 5KFBA 3HOYG 5KG4A 1J5EH 1BXRA 1RJQA 5EZYF 4J9PA 3PR4A 1VS0A 2R7MA 2R8JA 2RDIA 2W6QA 1WSCA 4QW9A 2YS6A 2ZDHA 5L1KA 1E4EA 2JA5A 5LP6F 4ECTA 1CS0A 4Q43A 4LFCH 1I50A 3RBDA 2HGSA 1GLVA 2NU8B 5I47A 5C8YF 3TQ1A 1M0WA 4ECQA 2XIGA 3OSPA 1K1SA 3KAKA 2JA8G 2HVQA 3FKIA 5DQGA 4YR0A 1RYSA 3KAJA 4QIWA 3CQZA 3KXYT 4TQRA 3WO0A 1HNZH 4EGQA 2P0AA 3GIIA 5C1PA 2B63A 5KG0A 5BPHA 3QFFA 1KJIA 2O03A 4ZOLF 1RJPA 5L1IA 2R7ZG 1JIHA 4JI5H 1E4EB 5DG7A 2Q2UA 4LH7A 3GIDA 1BJTA 4UCTA 5FPRA 3UFXB 1E4FT 5KFPA 4QWAA 3H4DA 1GYFA 1TAEA 1Z2PX 3H20A 5KFWA 4RU9A 4RB1A 2AGOA 1K1QA 4DV1H 5KT4A 4GC7A 1W93A 5C4XG 2C35B 3H40A 2IMWP 4UCSA 2W71A 4QIWE 4EGJA 4OX9H 1FJGH 4GKJH 2R92G 3RB4A 2AQ4A 4QWBA 3QZ7A 4MTDA 3PO3G 4PWQA 3F8NA 4JV0A 4ECZA 3PW4A 3MR5A 4NXNH 3RGXA 1M6VA 4DR3H 5C1OA 3G6YA 1S03G 5EWGA 3KHLA 5K2MA 1S0MA 2NVXA 2R86A 2YL2A 1C30A 3N6XA 3BJYA 3T5HA 2R8KA 3T5LA 4IR1A 4A2AA 3GTLA 4YAJB 1UC8A 4I4TF 3GV5B 3H0GA 2VQDA 1SEIA 2DLNA 3PVXA 2UVWA 4J0MA 1AUXA 4EBEA 4O4HF 4IWXA 4DV7H 5LL6b 2PVPA 1GSOA 5KFXA 5KG6A 2FPGB 3N40P 2VUGA 2BQRA 3OUUA 3Q8RB 4RB3C 4M9UA 4CC5A 4MV8A 3KHGA 1Z2OX 4O3SA 4GC6A 2HVSA 2I87A 5KFKA 4RB2C 2FB9A 2ASJA 3I4MG 3QZ8A 4YHHH 5CAEB 4JV1A 4ED1A 3LMLA 4ECRA 4A3JG 4IR9A 4EEYA 1VKZA 2UXDH 1UNNC 3J7AK 2R8GA 4LF4H 2W9AA 3PO2G 2YYAA 5JVLA 5KG3A 4LFBH 2W70A 3GQCA 4O3QA 5J2UF 3M9NB 2DPJA 5LXTF 2WB1A 4GLXA 4JI6H 2W7OA 4LF9H 2AGQA 2BR0A 3JAMW 3AYHB 5KFYA 4MTEA 4JV5H 4Q44A 4JI3H 1XDNA 1EZ1A 2FP4B 5KT5A 5DLFA 1IOVA 3VMMA 1GSHA 2R82A 2I80A 1N32H 4YJ2F 3N8DA 3GIQA 3RGZA 4IRCA 4DLKA 2R92A 2B63G 3GTPA 5CA0F 1RK5A 1UC9A 1B6RA 2CZGA 4LF5H 4BWSC 5KT2A 1ZHQA 2KSWA 2W9CA 5KG1A 2I8CA 5IP7G 2IA6A 3T5JA 4ED2A 4JI7H 4DL5A 4TV8F 5D1OA 2FE3A 4IAJA 4C5CA 2RF4A 4A2BA 1XNQH 1TWCA 1KJ9A 5KFEA 1V51A 5J2TF 5KFVA 3OHAA 3RAXA 2UVUA 3BA8A 1ZQ7A 1EUDB 3J80W 5T14A 4XZ3B 3RJ0A 2X0SA 2OLSA 4YP3A 4DR2H 2UUCH 2Y0SA 2JA6A 4JI1H 4F4YA 2XGPA 3ETJA 4QJFA 2YZNA 3TQTA 4ED7A 3EYYA 3H0GG 2DWCA 4O2BF 3MWEA 3BA9A 2W9CB 3KTMA 2FK2A 2C22A 4IHJF 5D1OB 1SCUB 4TUYF 2WYOA 4M7EA 5KX5F 3K3PA 1SFOA 2HHHH 5LA6F 1T94A 3KHRA 3GIPA 2J6SA 5BR8H 3PR5B 1BGWA 2JEFA 2Y0SE 1I6UA 2RGRA 2FMAA 5DLGA 3HOUG 3JSNA 2JEGA 1TWGA 1Y1WA 1I7NA 1GSAA 2YCHA 5DG8A 5C3EG 4ECYA 2R7KA 1CE8A 4X65H 4L1KA 5EDWA 5FPOA 5KFMA 3FMAA 4DR1H 5KFJA 3V6KA 1M7JA 1EUCB 4BY1G 4WBNF 3V6HA 4JI0H 4MV4A 2YRXA 4DL3A 1XMOH 2CKZB 1CQIB 4EFBA 4KHPH 1A9XA 3GTJA 2VR1A 3GTMA 4XYMB 5DG9A 3H4BA 4LSXA 1WCMA 4RNMA 4UCVA 1Y1VA 4RNOA 3SE7A 2C2RA 3SI8A 2W6NA 1GGOA 3N41B 4J9LA 4XYLB 4ME6A 2NVYA 3PW2A 3ORQA 5BMVF 4DL2A 2UUBH 3GTOA 5D1PA 2YW2A 5F9LA 3LWBA 2FLLA 3PN1A 4LF6H 5IYBG 1DGSA 5H80A 3G6XA 2PMZA 2VUMG 1IBMH 2WDTA 3MR6A 3RV3A 1JX4A 2R84A 2WAQA 3RUPA 5KFQA 1B04A 5IYCG 2W6ZA 4ECSA 4ECUA 5C44G 2YZGA 5KG5A 3GIMA 4ED8A 3T1HH 4A3FG 2CQYA 1Z2NX 2M05A 4UFZA 5KFOA 1N34H 4DR7H 4MV1A 1S0OA 4JI8H 3R23A 2FJZA 5KFDA 3K3VA 4YB8B 1ULZA 1C3OA 2VOBA 1EHIA 1JKJB 1AN7A 2UVRA 2RGVA 4AQYH 1K83A 2JA6G 2MCTA 3G8CA 4B3MH 3HXLA 4F4ZA 2PN1A 2YU9A 5KFRA 3GILA 2R7NA 2PMZE 5DQIA 2HVRA 4FBUA 2WAQE 2F4VH 3Q2OA 4EBDA 5DQHA 2GPWA 4UCOA 3V4SA 4AYBA 4DV5H 2OWOA 4ZI7F 3Q1KA 2FKLA 2W6PA 3KHHA 1IBLH 2W6OA 3BABA 5F9NA 4U6PA 4UCRA 4RZRA 2V4RA 3I12A 4XX0B 3OTOH 2NUAB 2VA2A 4DL7A 1GO3E 5LYJF 1T3NA 3GTKA 4QWEA 1Y1WG 3R5XA 3ETHA 2IP4A 3R5HA 2GLTA 2R6FA 3RB0A 3U9TA 3L4KA 2VA3A 3T1YH 4MV7A 2RDJA 1W96A 3RAQA 3BQ1A 2W6MA 1P8LA 1N56A 2XD4A 5KKNB 4A3BG 2NU9B 1S68A 1XMQH 2JA7G 2R93A 5KFIA 3V6JA 4DUYH 2ASLA 4BY7G 5JVDF 2XGQA 2XC9A 5EWEA 3MWDA 3GLKA 4O3OA 1XNRH 1B6SA 2DPIA 2WB1E 3K5HA 3K5IA 3I4NG 4GKKH 1WCMG 3GIKA 1Y1VG 5L1LA 2UVVA 1JDEA 5CA1F 4O3NA 2ATLA 2VUMA 5IYDG 4RNNA 1AUVA 4A3IG 3RV4A 3GTGA 4IZOA 3R5FA 5KT6A 3V4ZA 3N43B 3MWMA 3E5NA 3UQ8A 4ED3A 2UU9H 4YR2A 3BG5A 1HNXH 3M9OB 2QYZA 4J9SA 4YAKB 2Q2TA 3H3VH 4JYAH 3BQ2A 4B3RH 4LF8H 3MFIA 2CW8A 5KFZA 5LMUH 4HR7A 1ZHSA 1N33H 4YQWA 4NLGA 5IWAH 4UCUA 5KFSA 4O3RA 3RB3A 1OWTA 4YY3H 3BAAA 4Y8VB 1EYZA 1RK6A 2W8KA 4EBCA 1HR0H 4BXXG 3HOVG 4LF7H 1S97A 5DGAA 2W9BB 2V59A 3MJFA 2V5AA 1KC7A 3OSNA 1VAJA 4ED6A 4ECVA 3MFHA 1Y14B 4FBTA 1A0IA 3RF2A 4A93G 4C5BA 5KG2A 4MA5A 4RAZA 4RAYA 3IN5A 5JQWA 4I7HA 4FS2A 5FLXW 1CQJB 1V4YA 4R8UA 4O4IF 2NU7B 1PX2A 2YS7A 3WNZA 5FLMG 1TWHA 1FKAH 2E5LH 4ECWA 1S9FA 4CC6A 5EOYA 3M9MB 2AGPA 1ZETA 1JLLB 3GIJA 3GV8B 3JRXA 2JA7A 4X66H 5IP9G 4FM9A 4A3LG 4A3KG 2IBKA 4Q45A 2R85A 3OUZA 4QW8A 4IRKA 1DV1A 4NXMH 5GONF 3RIZA 1B33N 3GV7B 2ALZA 1E4GT 5KFTA 4PDBA 2DIKA 2HJWA 3RTXA 4JV2A 2CW7A 4LMYA 4HNVA 5JH7F 2R8IA 4TQSA 4LSAA 3PW5A 4DV6H 1VBGA 2R93G 2SCUB 1IBKH 4R8UB 4EYIB 4A3GG 4MV9A 4I55F 4DV2H 4FS1A 4DR6H 3HKZA 1FVIA 2R8HA 4J9QA 4J9NA 3Q8PB 2WE6A 5KT7A 2V4QA 3EPGA 1I3QA 3IG0A 1VBHA 5KFFA 3KALA 4MA0A 2C00A 4EG0A 5KFHA 5L9XA 1BNCA 5FJ8G 2UXBH 4FU0A 4WD3A 3T5KA 4E4TA 3C0FB 3N44B 3MR2A 2C2DA 1KJ8A 4LFAH 4RB0A 2OH2A 1TWAA 4EEQA 2JEIA 3HKZE
chains in the Genus database with same CATH topology
4MV7A 1SYXB 2HVQA 4R7RA 3J80W 2VQEH 3RJ0A 1I94H 1P8LA 4DR2H 2UUCH 1S68A 3KAJA 1XMQH 4JI1H 3KXYT 4DUYH 1HNZH 3J81W 3EYYA 4K0KH 3L4JA 2O03A 2ZM6H 2VQFH 1XNRH 3BA9A 4JI5H 1L2ZA 4GKKH 2Q2UA 4JI4H 4LH7A 4UCTA 1BJTA 5D1OB 5FPRA 4EFEA 1E4FT 1GYFA 2HHHH 1TAEA 1TA8A 1Z2PX 2WYOA 3H20A 4JI2H 4M7EA 3N42B 4RB1A 4DV1H 3T1YH 1V9PA 5BR8H 1BGWA 1I6UA 5IT9W 1MZBA 4UCSA 2RGRA 4OX9H 3N43B 2UUAH 3MWMA 3JSNA 1FJGH 4GKJH 3M4IA 3UQ8A 2UU9H 5LMNH 1HNXH 4MTDA 4X62H 3DF7A 2YCHA 3F8NA 4DUZH 2Q2TA 4DV3H 4JYAH 4B3RH 4APMA 4ETSA 4X64H 4LF8H 4X65H 3RGXA 4NXNH 2CW8A 5LMUH 1O75A 5FPOA 1ZHSA 1M0TA 4DR3H 1N33H 1S03G 5FD6A 5IWAH 4UCUA 3FMAA 4DR1H 2VPSA 4YY3H 3N6XA 4B3TH 4LH6A 4JI0H 3BAAA 4A2AA 1XMOH 4EFBA 1X9NA 4KHPH 1HR0H 2UXCH 1HNWH 4LF7H 1SEIA 4LSXA 4J0MA 4UCVA 4DV0H 4DV7H 1A0IA 5LL6b 3RF2A 4B3SH 4DR4H 4RZQA 3N40P 2VUGA 4RAZA 3N41B 4RAYA 4RB3C 4I7HA 4DR5H 5FLXW 4CC5A 4Q0YA 1Z2OX 2UUBH 1FKAH 2HVSA 5D1PA 4RB2C 2E5LH 1N36H 4CC6A 4YHHH 3PN1A 4LF6H 3LMLA 5EOYA 1DGSA 1WH2A 1IBMH 2WDTA 5FD5A 2UXDH 3J7AK 4X66H 4LF4H 3L2PA 1B04A 4LFBH 4FM9A 2W57A 3T1HH 1Z2NX 4NXMH 4UFZA 4DR7H 1N34H 4GLXA 3RIZA 4JI6H 4JI8H 4DV4H 4LF9H 1E4GT 3K3VA 3JAMW 4MTEA 2VOBA 4PDBA 4JV5H 3RTXA 4JI3H 1XDNA 1AN7A 2RGVA 2CW7A 4LMYA 3CVZA 4AQYH 2MCTA 4LSAA 4DV6H 3HXLA 4B3MH 1IBKH 1N32H 3RGZA 2HVRA 4MV9A 2F4VH 3JSLA 4DV2H 4DR6H 2ZJTA 1FVIA 5A2QW 2OWOA 4UCOA 4DV5H 2WE6A 1J5EH 4LF5H 1IBLH 3BABA 3IG0A 4BWSC 1VS0A 1ZHQA 3KALA 4UCRA 2KSWA 3OTOH 4JI7H 2UXBH 5D1OA 4LFCH 2FE3A 3C0FB 4IAJA 2HGSA 3N44B 4A2BA 1XNQH 4LFAH 4RB0A 1M0WA 4EEQA 2XIGA 3L4KA 3BA8A 3KAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7R A; 
#chains in the Genus database with same CATH topology
 2YZM A;  1SYX B;  4MV3 A;  3TIG A;  4C2M A;  2FPP B;  4R7R A;  2VQE H;  3RBE A;  3WO1 A;  5C5J A;  4QWC A;  1JXL A;  2FK1 A;  1I94 H;  4IRD A;  3HOZ G;  4U7C A;  5DGB A;  2GPS A;  5L1J A;  2W7P A;  4J9M A;  5BPF A;  4TV9 F;  2J6U A;  2YRW A;  2FLP A;  4RUC A;  4IWY A;  4ZHQ F;  3J81 W;  4K0K H;  1WR2 A;  4DL6 A;  3L4J A;  1I7L A;  4BBS G;  2ZM6 H;  3HBL A;  2VQF H;  2FPI B;  1KBL A;  3Q8S B;  2ASD A;  5JUM A;  1L2Z A;  4F4W A;  4HNU A;  4BBR G;  4JI4 H;  4EFE A;  2FLN A;  2V9W A;  5IYZ F;  1TA8 A;  1DIK A;  4JI2 H;  3N42 B;  1V9P A;  5IT9 W;  1MZB A;  3RFC A;  2J6T A;  4Q8E A;  3TIN A;  2UUA H;  3MR3 A;  3GTQ A;  3M4I A;  4G3I A;  5LMN H;  3VPC A;  4A3E G;  1TWF A;  4X62 H;  5KFC A;  3PZP A;  4AYB E;  5KG7 A;  3DF7 A;  4DUZ H;  4ECX A;  4F4X A;  4DV3 H;  3TII A;  2NU6 B;  5KFU A;  3PW0 A;  1S0N A;  4APM A;  4ETS A;  4X64 H;  4I50 F;  1O75 A;  1KEE A;  1M0T A;  5KFG A;  3JRW A;  4C5A A;  4O4L F;  5FD6 A;  5LOV F;  4MV6 A;  4QWD A;  5EWF A;  1N48 A;  2JA5 G;  2VPS A;  3LP8 A;  5KFA A;  2R7L A;  5KFL A;  4B3T H;  4LH6 A;  2JEJ A;  4A3C G;  3FDS A;  1KJJ A;  4MAM A;  1X9N A;  2UXC H;  5D8D A;  3PW7 A;  1HNW H;  2R7Z A;  3EPI A;  4DV0 H;  1IOW A;  3FKI G;  4JUZ A;  2W9B A;  4J9R A;  4B3S H;  4DR4 H;  2C28 A;  1RYR A;  3G6V A;  4RZQ A;  2BQU A;  5KT3 A;  1PK8 A;  4ZQI A;  4HNT A;  4RUA A;  4A3M G;  5CB4 F;  4DR5 H;  2VPQ A;  2XCL A;  5KFN A;  4Q0Y A;  4YBZ B;  4EYH B;  3HOX G;  1KJQ A;  4F50 A;  1N36 H;  3VPB A;  1R9T A;  4J9O A;  3U9S A;  4ED0 A;  1RJR A;  2QK4 A;  3OHB A;  1WH2 A;  4DL4 A;  3HB9 A;  2C2E A;  5FD5 A;  1S10 A;  2E2H A;  3RB6 A;  2XCP A;  5HV6 A;  1DV2 A;  3JZI A;  3L2P A;  2ZDG A;  3HOW G;  4A3D G;  4O2A F;  2W57 A;  3NGD A;  2XCA A;  3BQ0 A;  4Q8F A;  4J9K A;  3ORR A;  2DZD A;  4DV4 H;  2W8L A;  2V58 A;  2PBZ A;  2AU0 A;  2FK3 A;  5HBR B;  4HQ6 A;  1JDB B;  1T36 A;  2R87 A;  3VPD A;  4YR3 A;  4HYK A;  3CVZ A;  2BQ3 A;  4O3P A;  2J9G A;  2ZDQ A;  2WTF A;  3Q8Q B;  3JSL A;  4YJ3 F;  2ZJT A;  2E2I A;  5A2Q W;  5KFB A;  3HOY G;  5KG4 A;  1J5E H;  1BXR A;  1RJQ A;  5EZY F;  4J9P A;  3PR4 A;  1VS0 A;  2R7M A;  2R8J A;  2RDI A;  2W6Q A;  1WSC A;  4QW9 A;  2YS6 A;  2ZDH A;  5L1K A;  1E4E A;  2JA5 A;  5LP6 F;  4ECT A;  1CS0 A;  4Q43 A;  4LFC H;  1I50 A;  3RBD A;  2HGS A;  1GLV A;  2NU8 B;  5I47 A;  5C8Y F;  3TQ1 A;  1M0W A;  4ECQ A;  2XIG A;  3OSP A;  1K1S A;  3KAK A;  2JA8 G;  2HVQ A;  3FKI A;  5DQG A;  4YR0 A;  1RYS A;  3KAJ A;  4QIW A;  3CQZ A;  3KXY T;  4TQR A;  3WO0 A;  1HNZ H;  4EGQ A;  2P0A A;  3GII A;  5C1P A;  2B63 A;  5KG0 A;  5BPH A;  3QFF A;  1KJI A;  2O03 A;  4ZOL F;  1RJP A;  5L1I A;  2R7Z G;  1JIH A;  4JI5 H;  1E4E B;  5DG7 A;  2Q2U A;  4LH7 A;  3GID A;  1BJT A;  4UCT A;  5FPR A;  3UFX B;  1E4F T;  5KFP A;  4QWA A;  3H4D A;  1GYF A;  1TAE A;  1Z2P X;  3H20 A;  5KFW A;  4RU9 A;  4RB1 A;  2AGO A;  1K1Q A;  4DV1 H;  5KT4 A;  4GC7 A;  1W93 A;  5C4X G;  2C35 B;  3H40 A;  2IMW P;  4UCS A;  2W71 A;  4QIW E;  4EGJ A;  4OX9 H;  1FJG H;  4GKJ H;  2R92 G;  3RB4 A;  2AQ4 A;  4QWB A;  3QZ7 A;  4MTD A;  3PO3 G;  4PWQ A;  3F8N A;  4JV0 A;  4ECZ A;  3PW4 A;  3MR5 A;  4NXN H;  3RGX A;  1M6V A;  4DR3 H;  5C1O A;  3G6Y A;  1S03 G;  5EWG A;  3KHL A;  5K2M A;  1S0M A;  2NVX A;  2R86 A;  2YL2 A;  1C30 A;  3N6X A;  3BJY A;  3T5H A;  2R8K A;  3T5L A;  4IR1 A;  4A2A A;  3GTL A;  4YAJ B;  1UC8 A;  4I4T F;  3GV5 B;  3H0G A;  2VQD A;  1SEI A;  2DLN A;  3PVX A;  2UVW A;  4J0M A;  1AUX A;  4EBE A;  4O4H F;  4IWX A;  4DV7 H;  5LL6 b;  2PVP A;  1GSO A;  5KFX A;  5KG6 A;  2FPG B;  3N40 P;  2VUG A;  2BQR A;  3OUU A;  3Q8R B;  4RB3 C;  4M9U A;  4CC5 A;  4MV8 A;  3KHG A;  1Z2O X;  4O3S A;  4GC6 A;  2HVS A;  2I87 A;  5KFK A;  4RB2 C;  2FB9 A;  2ASJ A;  3I4M G;  3QZ8 A;  4YHH H;  5CAE B;  4JV1 A;  4ED1 A;  3LML A;  4ECR A;  4A3J G;  4IR9 A;  4EEY A;  1VKZ A;  2UXD H;  1UNN C;  3J7A K;  2R8G A;  4LF4 H;  2W9A A;  3PO2 G;  2YYA A;  5JVL A;  5KG3 A;  4LFB H;  2W70 A;  3GQC A;  4O3Q A;  5J2U F;  3M9N B;  2DPJ A;  5LXT F;  2WB1 A;  4GLX A;  4JI6 H;  2W7O A;  4LF9 H;  2AGQ A;  2BR0 A;  3JAM W;  3AYH B;  5KFY A;  4MTE A;  4JV5 H;  4Q44 A;  4JI3 H;  1XDN A;  1EZ1 A;  2FP4 B;  5KT5 A;  5DLF A;  1IOV A;  3VMM A;  1GSH A;  2R82 A;  2I80 A;  1N32 H;  4YJ2 F;  3N8D A;  3GIQ A;  3RGZ A;  4IRC A;  4DLK A;  2R92 A;  2B63 G;  3GTP A;  5CA0 F;  1RK5 A;  1UC9 A;  1B6R A;  2CZG A;  4LF5 H;  4BWS C;  5KT2 A;  1ZHQ A;  2KSW A;  2W9C A;  5KG1 A;  2I8C A;  5IP7 G;  2IA6 A;  3T5J A;  4ED2 A;  4JI7 H;  4DL5 A;  4TV8 F;  5D1O A;  2FE3 A;  4IAJ A;  4C5C A;  2RF4 A;  4A2B A;  1XNQ H;  1TWC A;  1KJ9 A;  5KFE A;  1V51 A;  5J2T F;  5KFV A;  3OHA A;  3RAX A;  2UVU A;  3BA8 A;  1ZQ7 A;  1EUD B;  3J80 W;  5T14 A;  4XZ3 B;  3RJ0 A;  2X0S A;  2OLS A;  4YP3 A;  4DR2 H;  2UUC H;  2Y0S A;  2JA6 A;  4JI1 H;  4F4Y A;  2XGP A;  3ETJ A;  4QJF A;  2YZN A;  3TQT A;  4ED7 A;  3EYY A;  3H0G G;  2DWC A;  4O2B F;  3MWE A;  3BA9 A;  2W9C B;  3KTM A;  2FK2 A;  2C22 A;  4IHJ F;  5D1O B;  1SCU B;  4TUY F;  2WYO A;  4M7E A;  5KX5 F;  3K3P A;  1SFO A;  2HHH H;  5LA6 F;  1T94 A;  3KHR A;  3GIP A;  2J6S A;  5BR8 H;  3PR5 B;  1BGW A;  2JEF A;  2Y0S E;  1I6U A;  2RGR A;  2FMA A;  5DLG A;  3HOU G;  3JSN A;  2JEG A;  1TWG A;  1Y1W A;  1I7N A;  1GSA A;  2YCH A;  5DG8 A;  5C3E G;  4ECY A;  2R7K A;  1CE8 A;  4X65 H;  4L1K A;  5EDW A;  5FPO A;  5KFM A;  3FMA A;  4DR1 H;  5KFJ A;  3V6K A;  1M7J A;  1EUC B;  4BY1 G;  4WBN F;  3V6H A;  4JI0 H;  4MV4 A;  2YRX A;  4DL3 A;  1XMO H;  2CKZ B;  1CQI B;  4EFB A;  4KHP H;  1A9X A;  3GTJ A;  2VR1 A;  3GTM A;  4XYM B;  5DG9 A;  3H4B A;  4LSX A;  1WCM A;  4RNM A;  4UCV A;  1Y1V A;  4RNO A;  3SE7 A;  2C2R A;  3SI8 A;  2W6N A;  1GGO A;  3N41 B;  4J9L A;  4XYL B;  4ME6 A;  2NVY A;  3PW2 A;  3ORQ A;  5BMV F;  4DL2 A;  2UUB H;  3GTO A;  5D1P A;  2YW2 A;  5F9L A;  3LWB A;  2FLL A;  3PN1 A;  4LF6 H;  5IYB G;  1DGS A;  5H80 A;  3G6X A;  2PMZ A;  2VUM G;  1IBM H;  2WDT A;  3MR6 A;  3RV3 A;  1JX4 A;  2R84 A;  2WAQ A;  3RUP A;  5KFQ A;  1B04 A;  5IYC G;  2W6Z A;  4ECS A;  4ECU A;  5C44 G;  2YZG A;  5KG5 A;  3GIM A;  4ED8 A;  3T1H H;  4A3F G;  2CQY A;  1Z2N X;  2M05 A;  4UFZ A;  5KFO A;  1N34 H;  4DR7 H;  4MV1 A;  1S0O A;  4JI8 H;  3R23 A;  2FJZ A;  5KFD A;  3K3V A;  4YB8 B;  1ULZ A;  1C3O A;  2VOB A;  1EHI A;  1JKJ B;  1AN7 A;  2UVR A;  2RGV A;  4AQY H;  1K83 A;  2JA6 G;  2MCT A;  3G8C A;  4B3M H;  3HXL A;  4F4Z A;  2PN1 A;  2YU9 A;  5KFR A;  3GIL A;  2R7N A;  2PMZ E;  5DQI A;  2HVR A;  4FBU A;  2WAQ E;  2F4V H;  3Q2O A;  4EBD A;  5DQH A;  2GPW A;  4UCO A;  3V4S A;  4AYB A;  4DV5 H;  2OWO A;  4ZI7 F;  3Q1K A;  2FKL A;  2W6P A;  3KHH A;  1IBL H;  2W6O A;  3BAB A;  5F9N A;  4U6P A;  4UCR A;  4RZR A;  2V4R A;  3I12 A;  4XX0 B;  3OTO H;  2NUA B;  2VA2 A;  4DL7 A;  1GO3 E;  5LYJ F;  1T3N A;  3GTK A;  4QWE A;  1Y1W G;  3R5X A;  3ETH A;  2IP4 A;  3R5H A;  2GLT A;  2R6F A;  3RB0 A;  3U9T A;  3L4K A;  2VA3 A;  3T1Y H;  4MV7 A;  2RDJ A;  1W96 A;  3RAQ A;  3BQ1 A;  2W6M A;  1P8L A;  1N56 A;  2XD4 A;  5KKN B;  4A3B G;  2NU9 B;  1S68 A;  1XMQ H;  2JA7 G;  2R93 A;  5KFI A;  3V6J A;  4DUY H;  2ASL A;  4BY7 G;  5JVD F;  2XGQ A;  2XC9 A;  5EWE A;  3MWD A;  3GLK A;  4O3O A;  1XNR H;  1B6S A;  2DPI A;  2WB1 E;  3K5H A;  3K5I A;  3I4N G;  4GKK H;  1WCM G;  3GIK A;  1Y1V G;  5L1L A;  2UVV A;  1JDE A;  5CA1 F;  4O3N A;  2ATL A;  2VUM A;  5IYD G;  4RNN A;  1AUV A;  4A3I G;  3RV4 A;  3GTG A;  4IZO A;  3R5F A;  5KT6 A;  3V4Z A;  3N43 B;  3MWM A;  3E5N A;  3UQ8 A;  4ED3 A;  2UU9 H;  4YR2 A;  3BG5 A;  1HNX H;  3M9O B;  2QYZ A;  4J9S A;  4YAK B;  2Q2T A;  3H3V H;  4JYA H;  3BQ2 A;  4B3R H;  4LF8 H;  3MFI A;  2CW8 A;  5KFZ A;  5LMU H;  4HR7 A;  1ZHS A;  1N33 H;  4YQW A;  4NLG A;  5IWA H;  4UCU A;  5KFS A;  4O3R A;  3RB3 A;  1OWT A;  4YY3 H;  3BAA A;  4Y8V B;  1EYZ A;  1RK6 A;  2W8K A;  4EBC A;  1HR0 H;  4BXX G;  3HOV G;  4LF7 H;  1S97 A;  5DGA A;  2W9B B;  2V59 A;  3MJF A;  2V5A A;  1KC7 A;  3OSN A;  1VAJ A;  4ED6 A;  4ECV A;  3MFH A;  1Y14 B;  4FBT A;  1A0I A;  3RF2 A;  4A93 G;  4C5B A;  5KG2 A;  4MA5 A;  4RAZ A;  4RAY A;  3IN5 A;  5JQW A;  4I7H A;  4FS2 A;  5FLX W;  1CQJ B;  1V4Y A;  4R8U A;  4O4I F;  2NU7 B;  1PX2 A;  2YS7 A;  3WNZ A;  5FLM G;  1TWH A;  1FKA H;  2E5L H;  4ECW A;  1S9F A;  4CC6 A;  5EOY A;  3M9M B;  2AGP A;  1ZET A;  1JLL B;  3GIJ A;  3GV8 B;  3JRX A;  2JA7 A;  4X66 H;  5IP9 G;  4FM9 A;  4A3L G;  4A3K G;  2IBK A;  4Q45 A;  2R85 A;  3OUZ A;  4QW8 A;  4IRK A;  1DV1 A;  4NXM H;  5GON F;  3RIZ A;  1B33 N;  3GV7 B;  2ALZ A;  1E4G T;  5KFT A;  4PDB A;  2DIK A;  2HJW A;  3RTX A;  4JV2 A;  2CW7 A;  4LMY A;  4HNV A;  5JH7 F;  2R8I A;  4TQS A;  4LSA A;  3PW5 A;  4DV6 H;  1VBG A;  2R93 G;  2SCU B;  1IBK H;  4R8U B;  4EYI B;  4A3G G;  4MV9 A;  4I55 F;  4DV2 H;  4FS1 A;  4DR6 H;  3HKZ A;  1FVI A;  2R8H A;  4J9Q A;  4J9N A;  3Q8P B;  2WE6 A;  5KT7 A;  2V4Q A;  3EPG A;  1I3Q A;  3IG0 A;  1VBH A;  5KFF A;  3KAL A;  4MA0 A;  2C00 A;  4EG0 A;  5KFH A;  5L9X A;  1BNC A;  5FJ8 G;  2UXB H;  4FU0 A;  4WD3 A;  3T5K A;  4E4T A;  3C0F B;  3N44 B;  3MR2 A;  2C2D A;  1KJ8 A;  4LFA H;  4RB0 A;  2OH2 A;  1TWA A;  4EEQ A;  2JEI A;  3HKZ E; 
#chains in the Genus database with same CATH homology
 4MV7 A;  1SYX B;  2HVQ A;  4R7R A;  3J80 W;  2VQE H;  3RJ0 A;  1I94 H;  1P8L A;  4DR2 H;  2UUC H;  1S68 A;  3KAJ A;  1XMQ H;  4JI1 H;  3KXY T;  4DUY H;  1HNZ H;  3J81 W;  3EYY A;  4K0K H;  3L4J A;  2O03 A;  2ZM6 H;  2VQF H;  1XNR H;  3BA9 A;  4JI5 H;  1L2Z A;  4GKK H;  2Q2U A;  4JI4 H;  4LH7 A;  4UCT A;  1BJT A;  5D1O B;  5FPR A;  4EFE A;  1E4F T;  1GYF A;  2HHH H;  1TAE A;  1TA8 A;  1Z2P X;  2WYO A;  3H20 A;  4JI2 H;  4M7E A;  3N42 B;  4RB1 A;  4DV1 H;  3T1Y H;  1V9P A;  5BR8 H;  1BGW A;  1I6U A;  5IT9 W;  1MZB A;  4UCS A;  2RGR A;  4OX9 H;  3N43 B;  2UUA H;  3MWM A;  3JSN A;  1FJG H;  4GKJ H;  3M4I A;  3UQ8 A;  2UU9 H;  5LMN H;  1HNX H;  4MTD A;  4X62 H;  3DF7 A;  2YCH A;  3F8N A;  4DUZ H;  2Q2T A;  4DV3 H;  4JYA H;  4B3R H;  4APM A;  4ETS A;  4X64 H;  4LF8 H;  4X65 H;  3RGX A;  4NXN H;  2CW8 A;  5LMU H;  1O75 A;  5FPO A;  1ZHS A;  1M0T A;  4DR3 H;  1N33 H;  1S03 G;  5FD6 A;  5IWA H;  4UCU A;  3FMA A;  4DR1 H;  2VPS A;  4YY3 H;  3N6X A;  4B3T H;  4LH6 A;  4JI0 H;  3BAA A;  4A2A A;  1XMO H;  4EFB A;  1X9N A;  4KHP H;  1HR0 H;  2UXC H;  1HNW H;  4LF7 H;  1SEI A;  4LSX A;  4J0M A;  4UCV A;  4DV0 H;  4DV7 H;  1A0I A;  5LL6 b;  3RF2 A;  4B3S H;  4DR4 H;  4RZQ A;  3N40 P;  2VUG A;  4RAZ A;  3N41 B;  4RAY A;  4RB3 C;  4I7H A;  4DR5 H;  5FLX W;  4CC5 A;  4Q0Y A;  1Z2O X;  2UUB H;  1FKA H;  2HVS A;  5D1P A;  4RB2 C;  2E5L H;  1N36 H;  4CC6 A;  4YHH H;  3PN1 A;  4LF6 H;  3LML A;  5EOY A;  1DGS A;  1WH2 A;  1IBM H;  2WDT A;  5FD5 A;  2UXD H;  3J7A K;  4X66 H;  4LF4 H;  3L2P A;  1B04 A;  4LFB H;  4FM9 A;  2W57 A;  3T1H H;  1Z2N X;  4NXM H;  4UFZ A;  4DR7 H;  1N34 H;  4GLX A;  3RIZ A;  4JI6 H;  4JI8 H;  4DV4 H;  4LF9 H;  1E4G T;  3K3V A;  3JAM W;  4MTE A;  2VOB A;  4PDB A;  4JV5 H;  3RTX A;  4JI3 H;  1XDN A;  1AN7 A;  2RGV A;  2CW7 A;  4LMY A;  3CVZ A;  4AQY H;  2MCT A;  4LSA A;  4DV6 H;  3HXL A;  4B3M H;  1IBK H;  1N32 H;  3RGZ A;  2HVR A;  4MV9 A;  2F4V H;  3JSL A;  4DV2 H;  4DR6 H;  2ZJT A;  1FVI A;  5A2Q W;  2OWO A;  4UCO A;  4DV5 H;  2WE6 A;  1J5E H;  4LF5 H;  1IBL H;  3BAB A;  3IG0 A;  4BWS C;  1VS0 A;  1ZHQ A;  3KAL A;  4UCR A;  2KSW A;  3OTO H;  4JI7 H;  2UXB H;  5D1O A;  4LFC H;  2FE3 A;  3C0F B;  4IAJ A;  2HGS A;  3N44 B;  4A2B A;  1XNQ H;  4LFA H;  4RB0 A;  1M0W A;  4EEQ A;  2XIG A;  3L4K A;  3BA8 A;  3KAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...