4R7TA

Crystal structure of glucosamine-6-phosphate deaminase from vibrio cholerae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
b'MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLPTGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAADHPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAQEIMILVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCDEPSTQELKVKTVKYFTELEAKNIVGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine-6-phosphate deaminase
molecule tags Hydrolase
source organism Vibrio cholerae o1 biovar el tor str. n16961
publication title Crystal structure of glucosamine-6-phosphate deaminase from Vibrio cholerae
rcsb
total genus 93
structure length 266
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r7tA00
3ENVA 1LK7A 1UJ5A 1FSFA 1HORA 2F8MA 4L5IA 3E7FA 2W48A 4M8LA 2J0EA 1CD5A 3LWDA 3BXFA 3BXHA 2BKXA 2BKVA 3CH7A 4L4YA 3HN6A 4GMKA 4L50A 3IXQA 3U7JA 4L51A 2O0MA 3EB9A 1LKZA 1JT9A 3NWPA 3EFBA 1PBTA 1VL1A 4R7TA 1FQOA 3NZEA 1UJ4A 3BXGA 4NMLA 2R5FA 1HOTA 2RI0A 3E15A 4L4ZA 3UW1A 1KS2A 1FS6A 1NE7A 1LK5A 3ENWA 3OC6A 4GO1A 2WU1A 4R9NA 4TM8A 2OKGA 4X84A 5HJ5A 1DEAA 1M0SA 4OQPA 1Y89A 1UJ6A 3KV1A 1XTZA 1FRZA 3LHIA 4OQQA 4TM7A 3TX2A 1FS5A 1O8BA 2RI1A 2GNPA 3CSSA 3ICOA 3HHEA 3KWMA 3L7OA 4IO1A 3ENQA 4L5JA 3BXEA
chains in the Genus database with same CATH superfamily
1XCJA 4JC8A 4KV9A 3EGXA 1TGVA 2H08A 2Y1KA 1E6EA 2IA5A 1TKRA 4ND3A 2GLUA 3GN2A 4HFMA 3OTWA 1YZTA 1J22A 3L77A 3MOIA 4LOAA 3ECSA 4OQYA 1OFGA 1SFRA 1S0UA 4HLUC 4G9GA 1I2AA 4I1SA 1ZGCA 3KDSE 3GD5A 1P1IA 1EB8A 1OAOC 3HWSA 4NG4A 5H4GA 1CIVA 1RLIA 4KSCA 1O97C 2RGRA 1JWAB 1B00A 1X94A 3F9IA 3ER8A 1ID1A 2AMVA 3RTCA 5EKTA 5ADVA 3MJCA 1G3RA 4GVXA 1JSZA 1Y6RA 3VH1A 3X43A 3I34X 3K9FC 2PS9A 1UOOA 3UPUA 2WKQA 4IO1A 4M37A 4WH0A 5TY0A 4CMIA 5KHLB 1ZC4A 2QM3A 4WZAE 4V0KA 1N78A 4KMSA 3ZOKA 2ACKA 2J7KA 1JG4A 2UYGA 3DTVB 4NCNA 1RXIA 4MVJD 3X1KA 3A14A 1QO0D 3T95A 3WQHA 4HXFB 5EEGA 2PRSA 4I8IA 4HG2A 3OOEA 4C30A 3SP1A 2ZM5A 3TFOA 5CA1F 4B7CA 3ZU3A 1CHDA 1J0EA 3A2LA 4RZIA 1OYOA 4S0ZA 4D9CA 1QGDA 2GXQA 3L4BC 4MUGA 4IJMA 2JH9A 4AU1A 2BI8A 1Z6AA 1Q1EA 3MWJA 4CJXA 5AOVA 3ZWYA 4JX8A 4B3CA 4EHHA 5FTJA 4HYQA 9ABPA 4P7GA 2AKAB 1SWWA 3FOWA 4KR0A 3NHAA 1FTQA 1H1LA 1K5GA 4XZ3A 4E4TA 2O3UA 2WP0A 4HUQA 2H0QA 2BFEA 3G5LA 2XGOA 2BF4A 2XIQA 2NTEA 3D4NA 4OJQA 3Q1KA 4DJEC 5BN1A 4BO0A 3PIDA 3OMLA 3P2EA 4P53A 1Q57A 4MR9B 3U31A 3KLOA 2ZJ3A 3ITKA 5D5HA 2J32A 4RLQA 3LWZA 4UVIA 4RSMA 1R5NA 3A6JA 3T61A 4DW8A 4Y2GA 1L5NA 4DQKA 3QVVA 3B9BA 4HEHA 3FWPA 5CHYA 3JD0A 5EZYF 4II3A 4X6XA 2BHSA 3B9PA 1UFVA 3LIIA 3NWJA 3QBTA 1XZHA 4O33A 2QUBA 3SDZA 4U2EA 1Z6GA 4ARSA 5JEEA 1P3JA 1J8FA 1GA4A 3MELA 2JFZA 1MD9A 3FWNA 1DQZA 4RW0A 5E8RA 4AO8A 4B71A 1F4LA 3B8EA 5FYDA 1FPQA 1PT7A 2W2LA 1LV7A 4XM0A 2G5CA 4C2BA 2CC2A 2WUVA 1E59A 4CNBA 3PUWA 5TARA 3FNQA 1Y1TA 4FZRA 1IJBA 1E2GA 1Z9BA 4CT0A 3G5MA 3IQDB 3KJQA 2OFXA 3FBTA 2QJTA 4KIUA 4B46A 1Z2DA 3QUBA 5DNDA 3L0YA 2RK6A 1KXZA 5I7WA 1TRKA 1P4JA 1ZLXA 4O4LF 4S2EA 4C5CA 3AF5A 4IH1A 4ND8B 4F8YA 2A4MA 3V8QA 1D07A 4G25A 2V7VA 4GAEA 4XVCA 3BMOA 4JY7A 2P91A 1JZQA 1N7HA 3QRWA 3WXMA 2Z5VA 5GZ6A 4MQBA 2A1TS 1YQTA 1TW2A 2HRZA 3C3YA 3ITDA 1DZ3A 3QXHA 5IDQA 5C8YA 4TTTS 3KJGA 4IUYA 4POAA 5D1HA 4OJKA 3TOCA 1QHSA 1Z5WA 1KEVA 1NVUQ 1WMEA 1QVWA 2ZAGA 2ILTA 5FYQA 4KXXA 1FNNA 3QJ5A 3H3JA 2OXTA 3RSQA 1QVAA 1D9ZA 4OQNA 4U2FA 3SS8A 3TQOA 4LRWA 4RHFA 3O2NA 4I1RA 8AT1A 3JR3A 4GFDA 1YI1A 3H9GA 5CH8A 4RTJA 3VHQA 1QRRA 2ERCA 3LS2A 3QW4B 3B70A 1P9NA 3AR7A 5E9JA 4QPZA 3TRJA 4DQDA 4BP8A 4MI3A 2XBMA 1ODKA 2EC5A 4H0NA 3V2IA 1JAZA 1GPNA 1RZ3A 1TA0A 1XQ1A 4TM8A 3CCBA 1SHZA 3K71B 1Y5NA 2HY7A 3ETJA 3JD2A 2BT4A 4AN4A 4DJTA 2ZB8A 3L84A 3AEZA 3DM9B 1ZMOA 4N3BA 1F4PA 5KYWA 1T0IA 3GP3A 2JAOA 2IWRA 2XT0A 5IKEA 4H18A 1EVLA 1P33A 1OWOA 3K1JA 1WQ1R 1GTMA 1KC1A 3R7WB 3TXYA 2PNFA 4N8SA 2XMZA 4EPTA 5FOXA 3MD9A 3NBYC 4RVSA 1K2VN 2R8OA 1K8XB 1UDWA 4YRDA 4L08A 1SUBA 1XZQA 3GQVA 2FW6A 3I42A 2Y77A 2R1VB 3H5IA 4D7AA 3B38A 4DRYA 2IZ6A 1NQWA 2R9VA 2HFJA 1U90A 3E15A 2I7DA 3BJEA 1OPXA 4RK1A 4XVRA 4LMAA 1SUSA 3IDSA 3KEGA 1TI7A 2AFHA 1MDBA 3F49S 4FYHA 3GWZA 4INJA 4DLZA 3RYIA 1U6KA 1DZIA 3ZQUA 5SZKB 3K0KA 2PNJA 2OOSA 4YDQA 5LPNA 1GA6A 1S2LA 1V9CA 2Q1XA 2V6BA 3PE4A 2OLKA 1QO9A 4J0IA 4A82A 2PRIA 1GTZA 3AHDA 4P3NA 5FI3A 1V7CA 4I3HA 1NU6A 5BSRA 2JLWA 4CM8B 1AS0A 2A33A 5KYTA 1OYYA 1QR2A 2GK3A 3IBGA 4UTXA 4UFPA 5MFZA 4LIPD 4LYDA 1H9AA 2R751 2ADOA 2Q4DA 3KEFA 3UVEA 4H17A 4L9SA 3U49A 2OBYA 3SC4A 2Z95A 4INZA 4YAOA 1X6VA 3S40A 4OMFG 1RWOA 4M9RA 1N2OA 2XKBA 2HX1A 1R4NB 2GXUA 1H2RS 2NTVA 1QH9A 3TPCA 1QBGA 1MB2A 3G2JA 4LWOA 1B6RA 1RI5A 1SKYB 2JH8A 4XQCA 3KKEA 2NZXA 3G8AA 1R74A 4OQMA 3W5SA 1PCXA 5KYNA 3UJNA 1W5AA 1OMOA 1WO8A 2GXAA 2VOEA 1CUHA 1EG2A 3ADKA 3CINA 3DUFA 2RHCA 4YMWA 3RC9A 1XRPA 5F5LA 3IB6A 1N6LA 4NOKA 1G8YA 1SBCA 1VHTA 2F1OA 1G66A 3NNSA 3M34A 4E07A 4DR4B 5I8WA 3U39A 2O23A 2H2GA 2P9CA 2YNMA 5EQDA 3PDWA 1E92A 3AETB 4KPUA 2XCTB 2PUCA 3WMFA 1MVNA 4MQEB 1RQXA 4M88A 3H1TA 1OXBB 2J6HA 4U1RA 3VPBA 4N6OA 1LX7A 4MUEA 3TIIA 1B0AA 4YJ3A 1K06A 1J99A 2AN5A 2VYVA 4KO8A 4OKSA 5EMMA 3SLGA 2ZR0A 1NLZA 2OAP1 3WHPA 2K87A 5JSZB 3R3VA 4RVFA 3WWOA 4XI9A 4GEKA 3DS8A 2HI0A 3GZJA 3WYBA 2PUGA 1Y3AA 2ZI9A 3K4HA 1AMNA 2AVNA 5JS6A 1OR8A 1WPRA 5F9HA 5FHQA 5HF9A 2AK2A 3ANMA 4IDCA 3ZE1B 4B81A 3UH1A 3GUVA 2CF5A 4MRPA 2AEMA 3QOFA 4MCIA 4OXXA 4K7JA 4Y30A 5K0NA 3H11B 4A92A 3NALA 4RELA 3AXSA 1QDEA 3WGGA 3CJTA 3GQBA 3DZIA 3SSAA 3PDHA 1VLZA 2VP9A 1VCOA 3E82A 2AOTB 4FN4A 3R9WA 2DUUA 2XX3A 2YASA 1UBRS 2YWJA 5EMNA 3PPXA 3SZUA 3T1TA 2GNOA 4ZCQA 4ZP1A 2D2FA 3ZZNA 4LF6B 1RQ2A 2SECE 1O9GA 2XADA 2GT1A 1NX9A 4Q3OA 4TT3D 1E2FA 5DM4A 3N2IA 5GY7A 4DQUA 2VRCA 1VRWA 2VN8A 4JCCA 4OKIA 1JBKA 4OMUA 5BSGA 3RVLA 4D45A 1C7QA 3QEMA 2ZWIA 3SS7X 2Q8QA 1FQWA 1PL8A 1U5AA 5KKNB 1F5NA 1CQWA 5BUQA 2PUJA 1QGAA 2QENA 3PF9A 3ZI7A 5ICSA 3PT9A 4Q9NA 3EK2A 4G3XA 4TKLA 4NXNB 4UVHA 1PBNA 4N5DA 1V16B 3FN4A 3EIQA 4IFIA 4UMFA 5HCNA 4QTYA 3CVWA 3ZHTA 1M2WA 4YCSA 2B7CA 1R0KA 1XZKA 2P9TA 4HSGA 4KRGA 1VBNA 4BO6A 1J0AA 4FZJA 4Y7CA 2WTUA 3P32A 2YFYA 5COBA 5EJEA 3GPBA 1XTIA 2P40A 2XUOA 3GH3A 3QFSA 3U56A 2Y05A 4QT0A 2P2ZA 1NBOA 2WPNA 2YYYA 4PVCA 5LDGA 4CW7A 4M1ZA 2EJWA 1HEUA 4UHKA 5JR3A 5CYPA 1T6XA 4O0MA 1MAHA 2I71A 1E6LA 4KRYA 4PFKA 3ZQ4A 4PC1A 3O1IC 1N6OA 1YU9A 4A1OA 4PLYA 2ECOA 3HCEA 4Y9SA 3EXFA 3FGOA 3EZLA 4C4PA 5J2TB 2CNKA 3MTBA 4PS1A 1ZQ9A 4CVNA 1H0SA 1TAHA 1E1QA 4KH1A 1H6BA 2QG9A 1AUVA 2QTHA 4OHPA 1IBCA 2YS7A 3R3YA 1PQ4A 2Y3IA 4YAGA 1ZNWA 1T6ZA 3QKUA 1D1TA 3NS7A 4QFCA 4UW9A 4EB3A 5LDDC 1ISIA 4GWKA 4CLDA 1J2TA 4JBWA 3QI2A 2X13A 4MMXB 2GN6A 2O4UX 1WY7A 4CEHA 2A94A 3OI7A 1V1RA 3RVDA 2FXVA 4M53A 4KN8A 4D97A 3HZOA 3WGQA 1CF9A 1E2MA 1O97D 2QTLA 3LH5A 1TZJA 4HRVA 5JFTA 4C87A 2X0FA 1T0HB 2H7VA 2QD3A 2VA8A 3I9LA 5C7YA 4MP6A 1VG9B 3IO5A 3OTQA 4Y0AA 1CEYA 3ELUA 2HQ1A 1R8JA 3BFPA 4RS4A 1TU3A 5KVSA 2CMGA 5IXJA 1O08A 2P4UA 4TYPA 1JJAA 3ADOA 1UZLA 3EMVA 3QBDA 4CM6A 3H5VA 2VUSA 5GOTA 1N34B 4FYYA 4AY6A 4ZT2A 1YNSA 2P2GA 5BRAA 1UJ2A 4HMPA 4P54A 5E4YA 3WO0A 1Z3CA 2BEVB 1JILA 2NUTB 1GN8A 4LECA 3UAVA 3PYXA 2NVOA 3HN7A 1KY4A 4P2GA 1KERA 1ADCA 4YUAA 1XIVA 3H99A 3JZIA 5JWHA 4PNZA 2ZYHA 5HZKA 1BCRB 3RVMA 4ZAVA 4BAUA 2QQEA 1E1QD 1K66A 4YLEA 1QRAA 5EE0A 1S3IA 3WP0A 2ZYAA 4EQ6A 1NUQA 1DO0A 2A30A 2RFLA 3PB3A 4ANFA 1V39A 4NL4H 3PRHA 1RVDA 3CMCO 2BFDB 4RQTA 1Q16A 4WCFB 2EJTA 1C5KA 5LZ7A 5BOSA 3OEWA 4TLBA 4DSNA 4FK8A 4DF3A 3AM1A 5FIUA 3DAYA 4GRDA 1BRTA 5HWSA 3C45A 5CW2A 4IRMA 5K3CA 5IM4F 1YQXA 4X94A 1Y0BA 3OKFA 4KQFA 2ARKA 4GYJA 4MA5A 4F97A 5I8ZA 2EDCA 1IHXA 4J0GA 4PQYA 6REQB 5JNTA 4MUBA 3PUHA 3R7LA 1KZ7B 3KKLA 2XUQA 3F4LA 4DOMA 4EYGA 1PS8A 2GBLA 1NVDA 1T36A 1D6SA 3EC7A 3L0SA 1XRSB 4DKXA 5KU1A 3DL2A 1AIPA 2D3WA 3I30X 3I92A 5LOVA 2JGMA 1CIPA 2X8LA 3EXHA 1DKPA 3EXAA 2XLBA 3KXLA 1P5ZB 3KVYA 3MGKA 1RM5A 4FCCA 3QF7A 2PT9A 3AEKB 4LTDA 4AKSA 4YJHB 3ZV3A 5EIAA 2P77A 1LA2A 4BIIA 4EGJA 1I3MA 2QTZA 4JBYA 2P3LA 5FP0A 1VLVA 4UD2A 3UUGA 3DEIA 1F2UB 4ZALA 1YMVA 2P0AA 2W2OA 3N58A 4KCGA 3FF1A 2ZSJA 4YJ2A 5B2EA 2VZLA 2CKMA 4D41A 5JTTA 1GIAA 3IQFA 3SBDA 5AHXA 3PEFA 5C4GB 4C3OB 1T1EA 1Q44A 2DHQA 3ECCA 1R00A 5F51A 2NP6A 1P77A 4ZO4A 4Q7JB 4HATA 5EPOA 4QU9A 4DRXB 3ZYCA 1EK6A 4UUBA 1R37A 4AMUA 5FOQA 1DJMA 5A9RA 1EX1A 2XDAA 5HGJA 3WRVA 4Y67A 1JHXA 5A3SA 3CNQS 5DOZA 2QTMA 2IGTA 2ZEJA 1JKMA 2P5YA 1V2GA 5EKSA 5EY5B 3AXTA 1GG8A 4GR4A 1IXZA 1DIGA 3GPCA 4XEUA 2IHUA 2IKSA 3KXKA 4JK3A 2PZAA 4M0DA 5DDIP 1YJAA 2HB6A 3C1AA 2IYZA 3PWKA 3L0OA 2G70A 2HU8A 1DQRA 4KE8A 3A9VA 3OLYA 4JJ8A 4EECA 1EWKA 3H42B 3KXDA 2RGUA 1W96A 1E2PA 1NXSA 1IU9A 4XJVA 3K0HA 4OEHA 1QIHA 1VE5A 1XZIA 3IVMA 1J07A 3J7TA 4GSYA 1U8FO 3ZWWA 1OXUA 4G41A 2HK6A 3ZHBA 5TMPA 1UQTA 4IGKA 1KYTA 3D3QA 3L7NA 2HDNB 2KPOA 2Q2QA 3MIIA 3HZZA 4ENVA 4ABTA 1KQPA 1HQCA 3FJ1A 2RKBA 1EX9A 4UHFA 1BYIA 1W6RA 3DEZA 5K8CA 1U9IA 3R5JA 1R1DA 3GJ5A 3B1FA 1EDDA 1W49A 4LZPA 4HDKA 4MVJA 2QN6A 3KVNA 4S1WA 3TR6A 4CUKA 3GLFB 3DCJA 4E11A 3C7AA 2C7VA 2LXNA 4MGZR 2E18A 1SKYE 3FB4A 1XO1A 1OT3A 3FXAA 3R3HA 3PC8C 1KI4A 2V6GA 4G85A 3G8DA 5E7IA 4L5IA 2C5AA 1DAEA 4C05A 3KWLA 2PN1A 2ZSIA 4X3CA 1QCYA 3MCAA 1VFPA 5HJ2A 4CEJA 3A9WA 3PEVA 3VH2A 3GEPA 4XX1A 4EFMA 2AQHA 3DHVA 5E95A 4RK6A 5ESXA 2Z3ZA 4BFXA 1P4RA 1ZMBA 4F6RB 4XGKA 4E4RA 3ASYA 1PGPA 3PUJA 1K89A 3OO0A 1MN6A 1PFYA 2I22A 4YACA 5JMOA 2R47A 5AM5A 1A4IA 4NH4A 3ZY4A 1UP6A 3ZGZA 3LG2A 1LFDB 3ZU6A 4EFDA 1XMQB 3JRXA 3RRNA 4JS0A 5EC8A 1SUPA 2XUGA 1JHAA 1XD2B 3ERCA 2REQB 4QE3A 1RYYA 1Y8RA 3QTLA 1TPYA 2ZDGA 4GNKA 3BXEA 5C1DA 1DLIA 1EUCA 3D6NB 3JASB 5DSXA 4RJ2A 1ZJ4A 2G63A 2PJDA 4YMHA 1BX1A 4QXAA 2P1RA 4CEJB 3CRRA 3GXBA 3I0MA 4HNHA 3BULA 4AULA 1EGMB 1YBHA 4RAOA 3WJAA 1IMOA 2NIPA 3VI4B 5KU7A 3CLTD 4JC4A 3VOSA 1S3SA 5ALYA 4J7XA 3TW4A 1YNOA 4UNSA 2RE8A 1MJGM 3ZXXA 3GPDG 1EFPA 1DEAA 4B40A 4IWXA 4G5OA 2JVKA 3D7RA 1FRZA 3JARB 4MZXA 4P4SA 1X1TA 4KMOA 1CHNA 3E5RA 4MR8B 5H9VA 4D8XA 3BIXA 1C9KA 2ODTX 3QOXA 3D7NA 1V95A 3ZD6A 3H16A 1PZEA 1UEXC 2VP3A 2D5LA 3KUXA 1KZHA 4A4DA 5KHOC 4DV7B 2BR5A 1KEZA 3KUDA 3R4CA 2QZSA 2WHYA 2JCXA 4IZOA 4BZXA 4MTLA 4DUZB 1E5XA 3UYKA 4URFA 1T9AA 2ZQZA 2AYXA 2GYYA 5GOZA 3UK6A 2BL4A 4HDSA 2XUHA 2G6TA 3Q98A 3D59A 2O06A 4ZQEA 4O63O 3RRXA 5KQLA 2AGVA 4EUSA 1KQ3A 1YQDA 3ULKA 2C8VA 4C21A 2VJAA 2AT1A 5AOAA 4XWOA 1ZM3A 4LKOA 1L7AA 4NIMA 1DJNA 1TC2A 5IT5A 1IVYA 4XLLA 4H1TA 3NTOA 5AK5A 2HRQA 3QNWA 2CDAA 4AQDA 4LC0A 1OLUB 1RMQA 1M6NA 4K0RA 1C1YA 4BNYA 4EZBA 3RS0A 3BDIA 1TUBA 4RS3A 4XPZA 2H7YA 2MSDB 5LLTA 4P98A 3LXXA 1LBSA 1E1KA 5BSVA 5A4AA 2ZXUA 1D6MA 1YOVB 5CXUA 4FE7A 1LQTA 3CO5A 4F5WA 4N39A 2WMDA 5HQJA 1Q2XA 1ZP6A 2H1RA 1RMTA 3D4BA 3EC2A 2OPHA 3GRKA 3HUDA 5JJBA 3NBKA 5DWVA 4ZYWA 1XPOA 3RYTC 1ZS9A 1RWPA 4OM7A 4BB9A 3KTDA 4P31A 3WVNA 1PG2A 3RJ5A 1CE8A 4DBZA 4XM1A 4FM9A 2WIDA 1NC3A 2AJ8A 4W1PA 3A6ZA 3UV6A 4PYLA 2ZDQA 2B4KA 3A3KA 2RB5A 3FGZA 1L8XA 3RNOA 2WBLC 1FXWF 2B4QA 1DPGA 1M2EA 1GZ6A 1ZD2P 3N6XA 2H2IA 3PHIA 1EXVA 4WRRA 2X3FA 4XLTA 5H82A 4EJSA 3FNEA 1GPYA 1AQ6A 2PAAA 5H68A 5KTPA 4ZJUA 3A1WA 3L01A 4I8DA 1CS0B 4ZV4A 3K5WA 5CJPA 2YJ5A 4GL4A 2BN4A 4R8SA 5AI5A 2XW6A 2R6ZA 2V59A 3P27A 3M83A 5DBIA 5KJ1A 1BDHA 3F74A 3OC6A 3ETGA 7ABPA 1IPFA 1PO7A 3ZVMA 3H2GA 3MXTA 2VPQA 4GG1A 3D9QX 3F6RA 1ZH0A 5BW6B 4HDKB 4HVAA 3E1SA 4LDAA 3L8YA 3ICVA 1C4XA 3BSYA 3CBGA 1E1CA 4IDNA 4J6FA 5DBEX 4RVCA 3I12A 3LL4A 4IHKA 1LDBA 4FIZA 4WFKA 3BK1A 3IUMA 1BXRA 1SKUA 1LBQA 3NHBA 1L5OA 3HKBB 2PDAA 1M34B 2HCFA 3AR4A 3DL7A 1JQKA 1IN5A 2V0CA 3GX1A 2VPTA 3GJQA 4QODA 1B0PA 2WYWA 3OJFA 5BR8B 1GUZA 3OF3A 3DM5A 1U28C 1HE8B 1TVKB 5ALOA 2C5GA 3NTVA 3IVXA 3EXG2 1MIOB 5ALRA 1SUWA 3VNUA 1H2BA 1UMDB 5EFZA 5AHOA 2F9LA 2CSUA 3KOUA 2OGZA 1HETA 4F1WA 2OBNA 5CM9C 2X0IA 4NMHA 1KDYA 3RLFA 2C7RA 2PSHA 4M0KA 4X54A 3C1TA 4H1VA 2PMBA 2DQ4A 5ANRB 2RC6A 3Q9LA 1GXSB 2AOXA 3HGQA 3TIGA 4OHKA 1AOXA 1JE0A 5INTA 4G1VA 1H2XA 4DMHA 1DC4A 2QI9F 2A3NA 2HA0A 3RJMA 1BU5A 1X3SA 4H0FA 3ABRB 3CR7A 4PPQA 1YRBA 3OU6A 1ETHA 4DLUA 3RBAA 1IDOA 1V7ZA 5B4TA 1R27A 1WXIA 4WE3A 1W4AA 3PD0A 4Y9RA 4BO4A 1P45A 2FW7A 4JP5A 1NJ5A 4YRBA 3R7FA 2P5UA 3W3AD 1QU2A 4L74A 4LYJA 2PQMA 1BQ4A 4MAAA 1FDWA 2O5EA 1VGQA 1TZBA 4ZVSA 4UAJA 2PGAA 1JJ7A 3QY0A 4JQOA 3IQZA 4JBXA 1SB8A 2UYYA 1X1SA 1URPA 3KQYA 2HWUA 3CIFA 2ZAIA 3FLBA 3EFHA 1V45E 4OHUA 1EDEA 5DOVA 3LL7A 2GCNA 3V7NA 5SYAA 1Z4NA 2IYVA 1FFDA 4RQBA 4WGGA 2V97A 1Y9EA 3KOWA 3AHFA 4AROA 1BN7A 1SU8A 2TSYB 2UUPA 4Q7KA 5T57A 4QU8A 1JEEA 2A9RA 4JUBA 3W7BA 4EKIA 1VI5A 4MUIA 2E87A 3PZRA 4AWXA 2IYNA 1XNJA 3QFTA 4BRWA 4FHFA 3SBEA 2CHGA 3AOEC 3ZXYA 3C2QA 4CMHA 4I4TB 3T3HA 3DE7X 1M1NA 3DXZA 5JSFA 3LZ6A 1KMCA 1JXAA 1I8TA 2WPDD 2Q49A 3UJ8A 3W06A 5K8LA 1PD0A 1GU7A 1Z06A 3PFGA 2V7WA 4L0QA 4CFZA 1XB2A 1HUQA 1ULAA 3O84A 2VXYA 1U8YA 4HAWA 2WD7B 4EPYA 4ISBA 1WPQA 3NAQA 4S0XA 1JZTA 3EFOA 4C2AA 2UDPA 1W9HA 5LXTF 2OFFA 4DQLA 2BMFA 1FYFA 3JQEA 3R6GA 3A06A 3X1DA 3ZJYA 5IWAB 4OREX 5KEIA 3GZNB 2WA2A 4B6RA 2C5EA 3UAZA 1KKLA 1C7FA 1OC4A 3N74A 3NGXA 1CQZA 1FUYB 4LV6A 3OECA 1X7ZB 4NZMA 2CCKA 3K0FA 3K8YA 5I48A 3U44A 4AJJA 2TRSB 1A50B 2QU7A 1RR6A 4FE4A 1GRCA 5DLQC 2QP9X 4AF8A 4XFJA 2YDXA 2DE0X 1JIKA 4D5GA 5C1BA 3VJLA 3AJ8A 3KQPA 1T4DA 3QUSA 4OAQA 3BGIA 3RWOA 2Q1UA 1P18A 3C85A 3FTPA 2H11A 1U3WA 2WVHA 1EQ2A 1WL8A 5ARDA 4AXXA 3RADC 2WDPA 4RPCA 2AD1A 4E46A 4B6FA 3FRJA 1G20A 2GRAA 1WD5A 3SSOA 4EBFA 3ABZA 2D1TA 2I4MA 3GLHE 3DG9A 4AG5A 4BQIA 4JJ7A 1R0SA 4MS1B 3WMEA 1SVSA 5BSKA 1YS1X 3D4LA 3H5AA 3TCXB 4WOKA 2G9UA 2VL7A 4YQFA 2GBPA 4XGIA 4HGYA 4CNQA 1DTWA 2OE2A 2XRFA 3HM9A 1PR0A 3UC9A 3NV9A 1L8AA 1MOZA 2I33A 1VCNA 3FSJX 2LGJA 1TAGA 2ATVA 5KCMA 1LW6E 5DW0A 1Z2CA 3E9MA 1T1JA 2TYSB 1HYBA 1VMAA 2H6EA 2XMSA 5L3RA 2D5CA 4E6PA 5HMMA 3I01M 4WY2A 5A4JA 2D0DA 1NMZA 2YMPA 3GJ6A 1PQPA 3BJIC 3CX3A 3IELA 3OQIA 5GV8A 3OX3A 4JSRA 3CE9A 3IA7A 2VNJA 3IP8A 3M5WA 4ZVRA 1M0TA 4JEMA 3I9FA 2R00A 4HTFB 1GGNA 4NFHA 2PUEA 1KGDA 1NOJA 1PZFA 2GJKA 1FUUA 2HMWA 2I1VB 3W5AA 1GKYA 2JK0A 3I58A 1FQJA 2WILA 4I55B 1NNEA 3OZFA 4X1OA 1KJWA 4Q19A 4MRMA 3AFIA 4RIGA 4DV5B 1DX9A 2J07A 3EPRA 1NZJA 2BMWA 1E58A 3F73A 2P9BA 3PFCA 1FUIA 1TYDE 5A6SA 4I5EA 1L7NA 1I0IA 4GI2A 4WSOA 4XWGA 1BXGB 3T1QA 3I5XA 1JJBA 3N0WA 4QUJA 4YMLA 4B45A 3IEMA 1M7BA 3QQ5A 1JFFA 3K72B 1MX9A 1U3TA 1YB2A 2B2CA 4D0LB 1E7WA 2FOLA 2I4TA 3K6RA 5HEKA 2F7SA 1GAXA 4EAAA 1PKEA 2YUIA 3PWTA 4L6CA 4NJEA 1AM4D 3V4OA 1QQ7A 4M0LA 1SU7A 2FJUA 3CRMA 1WBBA 2NQ2C 4REOA 3BK7A 1XHLA 4BO7A 3EJWA 2Q4RA 4Z49A 1ISRA 3UK1A 2M98A 2LIVA 4RIFA 3D8UA 2BJHA 3EZYA 4D99A 4Y9UA 5B4VA 3QHQA 1VM6A 2FEPA 1RKVA 3EXEA 4YJGB 3UTCA 1JPNA 3ZWPA 2AFHE 1O2DA 2XPCA 4M36A 3BBLA 3I9KA 2EGGA 1S5PA 3CPHA 3UWKA 1VBFA 1X0XA 4B2YA 2FE4A 2BE7A 3HJAA 5T4BA 4DEVA 5IBCA 2V03A 2YHAA 5BUSA 1G8PA 2Q3EA 2FPPA 1A77A 1JVNA 1Y4SA 4LZZA 2Q46A 3FOAA 3OJLA 5G3YA 4EHLA 3B36A 3LQQA 2WFZA 2QYHA 5F21A 3T34A 3O38A 1FP1D 1W2GA 4MWTA 5KTRA 1EBUA 5CX4A 1BWRA 2CHUA 3CZPA 3VYVA 3H86A 1AHHA 3GRVA 3UAWA 2CFSA 2VH5R 1W36C 1HDOA 1JX6A 2XQGA 3F7TA 1K6IA 4I36A 3IEVA 4Z7NB 1DG9A 3KBBA 4DB2A 3MQ4A 3PDUA 1FY2A 3AQ4A 1YZUA 2ZJBA 4C04A 4NENA 4AYXA 4IUBS 3IJRA 4B43A 2X2OA 4YDSA 4BATA 1CC1S 3COZA 4CKBB 5KWIA 4M8LA 4HH0A 2NUAB 4UZSA 3F2VA 1QO0A 3LKBA 4KPUB 5DHQA 3ZJ4A 2FPIA 4G1MB 3PWSA 1G98A 3HO1A 4U0JA 3WGNA 2V8OA 3S7TA 1OZAA 1UXIA 5AKXA 3VZRA 5CIYA 4K46A 1Z0JA 2ZJ2A 2WSLA 4D25A 1HLDA 2DC1A 3BGVA 5JD6A 4AW9A 4EG4A 1NY5A 1CZRA 2G6BA 1TJ3A 1L6IA 1W0KA 3JALB 1P7CA 4H6XA 4ZCPA 5EHNA 3VJMA 5IASA 3TSOA 3NM5A 3MD0A 1CRQA 1WQ4A 2BDTA 3R76A 1IL0A 3QLVC 2YWFA 2XVMA 3Q5EA 3R44A 4O8CA 5CTAA 2GBGA 2W4MA 5EFOA 1XZPA 5EINA 4YN3A 1N32B 1R6BX 2J0UA 3FA2A 5BT9A 1PDVA 3OPYA 4NJOA 3GT4A 4MPRA 1WP9A 3UUWA 1Z4JA 2RK3A 4PGHA 1T0UA 3BHIA 3EBLA 3IAS1 2ET6A 3JYNA 4HZUB 3MWDB 1C4WA 4LMPA 3NHFA 3IOCA 4O2AB 4O4LA 5E9WA 4AJIA 4EBBA 3ZU2A 4GI7A 3NYRA 3IXQA 1M74A 1OLXB 1JZSA 1REQA 3GK3A 1SD1A 2Q1SA 4KQ1A 4YO8A 4G4SO 3SIWA 4NZ9A 5EGNA 2H52A 4KQGA 2K7ZA 1J8YF 1DC5A 1NVWQ 1P75A 2VJMB 1QX3A 4DLBA 5F3WB 2V9PA 5C8DA 3IBYA 1G2PA 2JD2A 1YVRA 4YP9A 1TA4A 1ZI9A 3WOVA 4G4SP 3P2KA 1OFUX 3RIHA 5I7SA 1TFRA 3TW8A 2DPXA 4Q7EA 2WWRA 2PX2A 1CUVA 1LBEA 1S2IA 4RE6A 3BFJA 5DK4A 2W2TA 3R2JA 3RS5A 3RS8A 4JXKA 2ZT8A 4YDRA 3JQFC 4QOIA 4RETA 1U2GC 4K6HA 1QE0A 1RACA 2XAAA 4TSRA 2ABWA 2VF8A 3GGOA 1LDGA 1MIHA 2B7LA 1WB4A 5ER9A 1F20A 1PE0A 4IUCS 3SJUA 2JCYA 4R2WA 2DAPA 1MX1A 3H1PA 3RIMA 3IDAA 2PEZA 3X44A 4B87A 2ZIXB 5HRUA 5A03A 1YT5A 4EPWA 1E9EA 5FUXA 1QTRA 3LC1O 4GKAA 4P86A 4RZ3A 3V8BA 2VFAA 5FPQA 4B7UA 3R0VA 4ZGBA 5KMGA 5ITVA 3B8HA 3U6KA 4PFQA 3RASA 1GPAA 2JHFA 2VNIA 1TE2A 2JA1A 3AKYA 1I14A 2QT9A 1OXVA 3F78A 1GCUA 3FYHA 3HXTA 2BMDA 4XVUA 5D8DA 1NJ1A 2RH9B 3I5MA 3ZHRA 6Q21A 3W05A 2HR1A 1V5IA 3PITA 4WADA 3GR6A 2P9FA 1XK6A 1ZM9A 1EJ6A 3JU3A 1U0TA 4QG7A 1R12A 1IHYA 2JI7A 4R9UC 4Z0PA 3UBMA 3MHPA 5BV7A 3P0EA 2TS1A 1JF8A 1R0YA 2IXTA 4QSMA 2XXBA 2C3UA 3DOUA 4Q4CA 3MOSA 4EL5A 4X00A 1O96B 3SYKA 3WTCA 4BFWA 3DDCA 1DUSA 1RTKA 2HWYA 4AMYA 2RGBA 5K0CA 3U1VA 2O0JA 2PZGA 3RNLA 5ES4B 2JFGA 3FLAA 3QKTA 1AQUA 3BX1A 4EUEA 1JI3A 1MX3A 1XDUA 2ZTSA 2WUEA 4O4HA 1EDOA 3PEEA 3IV6A 5FWAA 3WMGA 5ICGA 2A5YB 4DVGA 2VUHB 4W5WA 3FKSD 1F6DA 1TYCA 3FLMA 1MCZA 1SBNE 2DHRA 2QAGC 4YMSA 1FTGA 4HQFA 1L8QA 1PT9A 1Z4IA 2YQ4A 2HADA 2JJ1A 2ZYRA 1I4OA 3LKDA 4FE3A 4U7GA 3TXAA 3SI7A 2ATEA 5BN5B 1UWCA 3KZXA 2O2CA 3HLTA 3OLVA 2BWJA 2RHDA 3BZUA 4LZWA 3IVRA 1WSAA 5P8WA 2GAFA 2P9QA 4UBMA 4LXHA 4OI4A 4CM3A 2FZ4A 3OBBA 2G04A 1BH2A 2W2KA 5KYYB 3LX5A 3P9PA 1QK3A 2X0JA 3G23A 1TK2A 3PHLA 1AKNA 1P1HA 1U3DA 3BUSA 3AJEA 2X1HA 1QM5A 3VDXA 4EVSA 2I62A 2HA7A 3A6GA 3EVGA 1NQUA 1EXWA 3UG7A 3HZHA 3THWA 1X7YA 5KVAA 2EZ8A 5ENDA 4NK4A 4B4DA 2DECA 4NBSA 4X6LA 4BX0A 5JYEA 4QGBA 5BYJA 2H07A 1G6OA 5IJXA 2M9MA 4PIVA 1IM8A 3WYEA 3GLSA 3RS2A 3U3JA 3U4AA 3EIXA 2A0UA 2FSUA 2H31A 3BKWA 3HABA 3ADPA 4Q03A 2PRKA 2R44A 4GLBA 4IIDA 5U4XA 4ENQA 5J4LA 1F0YA 2K5UA 3OQIB 4QBIA 4COOA 2AXNA 4RK0A 3KSMA 4BPBA 4YLYA 2JGEA 2HWXA 3QMMA 1TK3A 1U7UA 2WOOA 3A4VA 5HF8A 2NVUB 4Q4LA 1KYYA 1NBMA 2G71A 3KZNA 5A3RA 1FMTA 1JDBB 1UMBB 4XAQA 4CFYA 2D54A 3OPXA 3PFNA 1PEYA 5I4CA 1M2VB 4NWIA 2ZJ4A 4BU0A 1MJHA 4REMA 2YVAA 4TWRA 2RAUA 5KIAA 2V6FA 4WK4B 2GEVA 3I09A 1VIMA 3WMWA 5JH7F 3MJ4A 3W8RA 1G20B 3DE5X 3B60A 1RQPA 2G76A 1GV0A 3LO8A 3LPMA 1TEVA 4QUDA 3WLTA 4C0LA 4OI0A 3D7MA 3O8LA 5CB6A 2D8AA 4HEA6 2BFPA 2QLNA 3MCVA 4XB6B 5CA0F 3Q6MA 4ZQBA 1TAQA 4UE6A 1J2RA 3OTGA 2Q9BA 1X7HA 2RI6A 4KQWA 3UAOA 3ZCUA 1ULHA 2JL1A 1JBEA 4HWOA 4O08A 3DTVA 4CV0A 1SIBE 2Y9PB 3LTEA 5BNIA 5L3SB 5GADl 4FD3A 1V47A 2WYVA 3C74A 1T2FA 4EFKA 1ADJA 4Q4HB 3OT1A 1UBNA 4YK7A 2NP7A 3DT6A 2H2WA 2NU6B 4BVJA 1SWVA 4DA8A 3AOGA 1HG1A 2H7XA 1R64A 2ZBGA 1DUVG 4OO3A 4XGQA 5LMUB 2GSWA 4J16A 2BW0A 2IU4A 5EMHA 2VTVA 3KLPX 2QVZX 1NRJB 5EUMA 3LCRA 2O2DA 4AZTA 3BH0A 3NTXA 3OD5A 1FP4B 4J03A 2B4RO 3GFVA 4RPLA 3VO2A 3PKIA 4C29A 4QM6A 4EIWA 4Z9YA 4D4LA 5D86A 4F96A 1DARA 4PHTA 4UU8A 1MNAA 1E2QA 4GOXA 3IDFA 1XZEA 2QN1A 2WD7A 3OEHA 3LDUA 4PSCA 1QFJA 4D98A 5KVVA 4TX1A 2E1PA 2JHAA 1NWHA 3LVFO 4CMBA 1FJGB 5LBIA 3S2UA 1SXJC 4FOSA 5KKAA 4GUDA 2H54A 4D4JA 3KOXA 5B4UA 3GZ4A 3L04A 4UREA 2Z57A 4IGEA 3OQHA 5KB3A 3AK4A 5EZSA 2W2MA 3BEDA 3EF0A 5CYGA 3BE6A 1EIZA 5DHRA 1PFWA 4G8JA 5G1PA 2XZPA 1T8WA 4J3FA 3PHBE 1KBOA 4BLQA 4WK2B 5EHXA 1TU4A 2WYHA 4NOMA 3OZIA 3VC3A 1YU6A 3I04A 2CVQA 1R5JA 4EYKA 5EIBC 4MS3B 3KSBC 4U7HA 1WLYA 4F5EA 4R3UC 2R48A 2O8VA 3HYRA 2ZTMA 3HCOA 4UUPA 2KJQA 2WM8A 4YCJA 2C1EA 1Z6QA 4BOYA 3AT1A 3G9TA 1MRZA 1A9YA 1NJ6A 2ERYA 2AC4A 4AM8A 1LBTA 1DCMA 2ESRA 3LF1A 4B3IA 2N3ZA 4X8HA 1GNVA 1E7MA 2GS9A 5C53B 2ZS9A 3VR5H 2PGOA 4N01A 4Y18A 1T9GR 2NO5A 5DNCA 4KPYA 1A4UA 3K6SA 3ZDXB 3SVTA 2GVNA 3QA3E 4KHZA 1BS1A 4Q3NA 1MMFB 4Y7DA 4DILA 5JD3A 1JDNA 3QSGA 4V0QA 4YGYA 4EABA 4TZ6A 1T5OA 3COSA 2VUUA 1T91A 3PCXA 4HK4A 3RHSA 4US2R 5B12A 1FS6A 6LDHA 3I2YX 3PQDA 4KH0A 2IYXA 1VSQA 1FW6A 1N5RA 2QQGA 1EWQA 2FR8A 3G2QA 3VSBA 1NNUA 1FYDA 4ERNA 1KU6A 3PUKA 3VSEA 1U1FA 3K6JA 1L3CA 2ZUVA 3DNMA 2NM0A 2BZGA 3HJTA 2YOGA 3QBEA 5FTMA 1EVEA 5DXAA 1SELA 1SNYA 4FZ3A 1ELOA 5IW8A 3VR2A 3UAYA 3Q8KA 2XWJI 1YR9A 3QF4B 5J23A 5BXQC 2I3BA 3ND8A 2IOFK 4RWEA 4MV5A 4K81B 3V4LA 1KH1A 2FLKA 3FTDA 4FFDA 1RZRA 1Y1KE 3VYUB 2X6RA 4ZMBA 1RLMA 5CCDA 3IAUA 3OT5A 3LBHA 5ES3A 5L7WA 1QORA 2A78A 4PFJA 1SHUX 4PYMA 1B14A 3ZHZA 4PHHA 3IBTA 4KDRA 4AZ0B 5CT6A 3FD8A 2FFQA 1N8SA 2H1CA 3FETA 3OOYA 4C4SA 4D8VA 3OH8A 1OBFO 2F67A 3IP1A 4GX5A 3EZ7A 4ZVVA 1J6UA 3BB3A 1M1YA 4YP1A 3JYPA 3SQXA 1DBQA 1NONA 1YR3A 4YXWD 2XAUA 4R40A 2FF7A 3D7KA 2CB0A 1DC8A 1XQYA 3PVZA 2OOKA 4YAUA 5LYYA 2NT4A 1C1HA 3V42A 3OZSA 4EZEA 1GZ7A 2HQOA 5BSUA 1ZJJA 2I4NA 1X8JA 3NWPA 4BV3A 2X15A 3DMRA 1YCGA 3H4MA 3FCOA 3MJTA 4LRXA 3TZCA 2YJ4A 3ND7A 1AE1A 1Z45A 1YJBA 3VDRA 5JNVA 2PUFA 3DB2A 2C9MA 1IHPA 3MWEB 2FX2A 2WV9A 2C7QA 4JXJA 2BD0A 2PL5A 2V9CA 1M2FA 5FJJA 4H7IA 4HDRA 2E7ZA 3CHYA 2OSBA 1E1NA 1NN0A 1RRMA 2C8JA 3TBKA 1EK5A 1Q7EA 5JRDS 3RPEA 4BQFA 1ACLA 1RYMA 2VAMA 2WKWA 3AF0A 4G5FA 3P19A 3PR2B 4QU5A 4RGQA 4D4IA 5ISMA 1UKZA 3LWBA 1FK8A 4LXGA 2NZ2A 3PUIA 1NYTA 2CLFB 1JQ3A 3H5WA 1DTWB 4FEEA 1AUQA 4OSOA 4A8JA 3ORRA 3LUPA 4AB1A 2PMWB 3QXJA 2ASVA 3TO5A 3D0OA 3IALA 5F64A 2R1UA 2J7PD 2P2YA 2TECE 3SNHA 3HH8A 3O4FA 1GLVA 4KU4A 2EX4A 3MINA 5K4GA 4MIEA 5AJXA 2DBZA 4MI9A 1NT4A 5F1OA 2IV7A 5BT8A 2GTPA 1E2IA 2N0SA 3DUFB 2HNBA 2NO1A 3H83A 1K08A 2OC9A 2YVLA 2ZT6A 1W4LA 1MGOA 2Z6VA 1EYZA 3ESYA 1NA5A 4L3WA 3X2FA 4JB2A 9LDBA 3INRA 1KFBB 2WIFA 1C8KA 3CEJA 3B3AA 4PIMA 4YV2A 3A26A 1K75A 4ZVTA 4AICA 4DA7A 4BQPA 2XB6A 3TWOA 4MUNA 4EYQA 3CF0A 3SJ7A 3MW8A 4MZDA 1F2DA 1KEWA 1Q2UA 2C5FA 2JAXA 2B6NA 2Z5LA 3CURA 1II8A 3L7AA 5TVGA 4O2AF 4BS9A 2IEYA 2SKEA 1J8MF 3VX3A 5FAXA 4KFCA 1R6XA 4TV8B 2E4AA 3QLVA 2HPZA 3SG0A 1JEQA 3DT9A 3CG4A 4ZOEA 5BQOA 3VBEA 1PJRA 4PC6A 1PYDA 1E6CA 3T7EA 2WKSA 3MEQA 4MLCA 4PTLA 4E7OA 4F60A 2YIVX 5EESA 3P71T 2PGJA 3PP8A 4CL8A 2D7JA 2KM1A 4Q3CA 3BHMA 4FEYA 4I9UA 5F4BA 1C3LA 3QGMA 1JXMA 5AJYA 3AEYA 1ND6A 4CDGA 1LUAA 1EVQA 3CSUA 1D0IA 1DLJA 5LXTB 1DT3A 3DKKA 1HPLA 1P7WA 1O5IA 2FP4A 3WADA 3U7FB 3PCRB 3R24A 5DMXA 1JG6A 4KPFC 1QG6A 2Q3JA 1Q84A 4B7XA 5K05A 2CNOA 1Y4ZA 4OQXA 4EHKA 1SXPA 2QRUA 2PKRA 3FSGD 2EU8A 3CTMA 1W47A 2AUTA 3FVRA 2E4XA 3QLJA 5BMVA 3KQLA 4OX9Y 3W6PA 4OV6B 1SG9A 4ZJZA 2ZIUB 3PNKA 4BIMA 5B3JA 3N76A 1QQ6A 3UGKA 2QN2A 2RDMA 1YQGA 3EXIA 3QX8A 1SA0B 3ORSA 3WWCA 1K6XA 2BMJA 3AFOA 3ROFA 1G7TA 2PM8A 4DV3B 1R16A 2XH8A 5EJAA 2OYRA 3A1VA 1OGIA 5I45A 4C78A 5I7RA 4UU1A 1VA4A 2YJ3A 4W8GA 4UMEA 3FF4A 4ZIRB 3GGPA 1DRJA 2ACEA 2HO5A 3L9WA 1JDBC 4GVLA 4YMUA 1YL6A 2CHFA 3K5HA 2CUTA 2DMRA 1Y5IA 2HFKA 4OBBA 5DRYA 3IFSA 3I45A 1WWKA 1TM1E 1BX3A 4MWEA 1QYIA 3HU5A 4KGVA 1EFPB 4NDAA 1WHSB 2WU1A 1MABA 4OD0A 2DSNA 4B2IA 3D4IA 1XNHA 5AVQA 2XGJA 1N2BA 3AUFA 2C2YA 2Q21A 4LBVA 3OJ0A 1LJLA 1CIJA 1DT5A 2YHSA 2A57A 1UT6A 3FZEA 3H3XA 1NXVA 1IY9A 1F2VA 5TV2A 2BY4A 3UHFA 1JS1X 5ALGA 5AVUA 5I9IA 2IF0A 2JDID 4EK9A 4XDHA 4V0SA 3M89A 4FI3F 4L9WA 1R8SA 3PNYA 4KSYA 4MGKR 2QPLA 4QGHA 2GPYA 2HGSA 2A9PA 2ZJ6A 3KYCA 4JJKA 4X85A 2W90A 4CKBA 4WZBE 5JPDA 5MN5A 1PNOA 1T8TA 4I6GA 1C2TA 4J75A 5GZ3A 3R1IA 2CUNA 1IEXA 1IDN1 4C6HA 1P19A 4J0FA 3HCDA 3UT5A 3DKRA 1YAHA 1D1QA 3B3FA 2F3RA 3JD3A 1ZJYA 2FQQA 2EHJA 2Q0QA 4IG4A 5B7NA 5FBWB 1X77A 2X1MA 4J90A 1DQNA 1WW8A 3ET5A 1LPAB 1N2ZA 2AJTA 4A2PA 4B35A 3VHXB 4QBKA 3FMGA 2ZI6A 3AGQA 1XEXB 5IH7A 1JG2A 3KE9A 2ZTVA 2A14A 3T3MB 4TMWA 3THYB 3PJRA 3WFJA 4WLUA 1MO3A 3U6BA 1NZFA 2G7ZA 2J5RA 1RJDA 2MMCA 1TM3E 3G2OA 3QV2A 1UK6A 1JGTA 2FETA 4G4IA 4DNFA 4DV2B 3HPRA 1LPMA 3ACDA 3FNIA 2B21A 1EQUA 3LKVA 3GLFA 1K8RA 4XR4A 2ZUDA 1WIWA 4QYIA 3RS7A 3EEFA 2C1ZA 3AEUA 5LJIA 5BWOA 2R4UA 1K5DA 2BTQA 4TYWA 2B34A 1HBJA 4GVPA 2Q3LA 4X6UA 3WJ1A 2JLZA 5KJ6A 1N0VC 1QTIA 1PW7A 1BFUA 2BAGA 2CZCA 2D0PB 2OD2A 1E63A 3COWA 4Q24A 2VT2A 5REQA 4EA9A 3O73A 4BVEA 4HAUA 4I2VA 5A9SA 5I8PA 1OFIA 5AKJA 3ZD9A 5IMBA 2NV2B 3ZE7A 1Z16A 4W1SA 3ZTYA 1Y9DA 3A70A 1DEHA 3DVRX 2ODEA 4RHCA 3IAXA 4JC0A 3UWPA 4BMCA 3W5CA 5B6JA 1CYDA 2P4EA 2B0CA 4NABA 2FEOA 3CEAA 3OJOA 4M22A 4ZHQF 2G09A 1T13A 1P1CA 3FKSA 3A0RB 3P9QA 5KNCH 3LA6A 1PU2A 2Z6UA 4FKBA 3LX4A 4N41A 1EFRD 4BGEA 1XA4A 1GQSA 3DLTA 5A4DA 1BMFD 1M6WA 5AXAA 4UM9B 3O2SB 3PUZA 1QP0A 4MW5A 2REBA 4WT7A 1NPTO 1Z35A 4AN0A 1S8NA 1RBQA 3LVRE 5KVQA 3AY0A 2GO1A 3BFVA 4IIJF 4DMRA 4EUKA 3K70D 1RHJA 5L4NA 4Y6QA 5LYJB 3MWGA 1BD3A 4FLFA 4R1PA 2FK8A 4YJ2F 1KA9H 2EDAA 1I2DA 5JE8A 2O2XA 2PS1A 2X4GA 1QCCA 2BCGY 3CM0A 3MTIA 1SXJA 1V6CA 2GQ0A 3FMOB 4Z1MD 3WZMA 4PX3A 3Q40A 3FPCA 3DO6A 4KG7A 4NBLA 3ZLTA 1X1BA 4N5LA 2FH5B 1B8OA 4P82A 1SQ6A 2Y27A 3HKDB 3ML1A 2XQJA 2OYCA 4A8HA 5LQKA 4ZZ3A 3RHZA 4ER5A 3F1KA 3M6LA 2CK3A 2OYSA 3IEXA 4IQ0A 2OXFA 1WM1A 2QEQA 1C7EA 2WLTA 3QVUA 1FMLA 3QVTA 4D8TA 3RRYA 5EIEA 1O58A 1K7YA 2WHEA 3EMBA 3LQ2A 3PL1A 3PNVA 3VAAA 2P11A 3GNQA 3L7KA 2V4ZA 4MX8A 5CX1A 4B74A 4B3FX 4QKQA 1PV2A 1JMYA 2EYUA 2PZEA 4XB2A 1AUOA 4F21A 3BTVA 2R5WA 3QMVA 1TPZA 5ELMA 2CDBA 4BO2A 5J58A 1XA3A 3RTDA 1GRVA 4Q7QA 1IWPB 2G1PA 1N2JA 3D8TA 4N4AA 1YZVA 4KKVA 4RJLA 5JW6A 4YXFA 2JGRA 1KAMA 2FW9A 3IAM6 6ADHA 2V0NA 3E8XA 3ANYB 3HKEB 3CO0S 3KCQA 4ID9A 3RS4A 4ALJA 5AW3A 5JSUA 3AUYA 4XQGA 1T9CA 3H2IA 1WPXA 2R3SA 2WHPA 3LLSA 3DA8A 4PANA 2H5IA 5KOHA 2LBPA 3HB7A 3O9ZA 1E96A 5A3QA 2I6QA 4YRPA 1Z88A 2LCFA 1JIQA 1M6HA 4WZAA 1EIWA 5SY9A 3E9EA 1JI0A 3O90A 4D3YA 3ST7A 1PLJA 3HY6A 4KOAA 1Z17A 4M49A 3VU0A 2DTEA 3R40A 4AIRA 4JVSB 3NUGA 1EFAA 4BMDA 5I5EA 1KDOA 4N3NA 3C7TA 2XZDA 5BWNA 3S44A 2B69A 1GADO 5K8JB 2EFGA 2YWGA 4DBLE 4OLAA 2C58A 2Q5EA 2ZBDA 2RGAA 3WIUA 4HJXA 3L7DA 3NLLA 4B3MB 3AGPA 3P0HA 1BEUB 4LXYA 1HWYA 3HB0A 4EW2A 3UA3A 1CFZA 5B7GA 2EWMA 2RHTA 3L02A 3NGLA 3FZQA 3E9QA 2OMKA 2A0YA 2FEAA 1HI9A 1UANA 5IF9A 4K40A 4BBPA 3FNGA 4W9RA 4LJSA 3V1NA 2HSJA 4MEAA 1RQLA 1G38A 3R3UA 1RYBA 3A1NA 1GZHB 1Q83A 3IJPA 5TX7A 3TOXA 4ZPXA 2ENWA 1RHMA 2EX1A 4RHXA 5JRJA 2JGNA 4KR2A 2B7BA 3I2HA 1D0VA 2BGMA 1OFUA 6PFKA 4MW4A 1EFDN 1VL2A 4B6PA 4OXKA 2ZTLA 1NXWA 1EVYA 1I3NA 1PUJA 1KSFX 2GUWA 3DMFA 1SOMA 3JZFA 3N75A 1C3XA 2XF8A 1SCAA 2RIPA 2ZXFA 2OQ2A 3CEHA 4XFKA 1H2HA 4QTUB 1ZCBA 3SMQA 3T3DA 3VH3A 2RHJA 3WQSB 4I81A 1TK9A 3O9MA 2B83A 4PU0A 3TPFA 3HBAA 2BI7A 2PAFA 1V26A 4IOMA 1N0WA 3TUIC 4JGBA 3QLUA 2W8ZA 1KFEB 3Q87B 1CS0A 1G1AA 2ZVPX 5I47A 4E03A 3OCYA 3OO1A 3A9TA 6NULA 3V8VA 1A96A 1E5TA 1A8UA 1JV2B 1PL0A 2CWDA 2NPFA 4CE6A 1KMHA 4YRCA 4OI2A 5GVRA 1DIRA 1SRQA 3VM6A 5JZOA 2I03A 1YJ8A 3RT1A 3L6DA 1E5VA 1FQOA 1HTTA 1WU8A 2R7MA 4F9EA 1CDZA 3N28A 1XNGA 5KSYA 3DOOA 1T6YA 2OZLB 2QE6A 4GGMX 1A8PA 4RLFA 1A4XA 4FCVA 2IFTA 1GCIA 4UNRA 5BW8A 4EOGA 1V16A 1T3GA 2BH9A 1P7ZA 2G9QA 4TKVA 2UVPB 2ZI4A 3TUJC 4XVHA 4MV3A 4JT4A 4N03A 3ELWA 4L5YA 5IKPA 4D2IA 5COAA 4TQAA 1I32A 5KOHB 2G4CA 3LIPA 5IABA 2ZPTX 2HTFA 3HCWA 1GSOA 1QMGA 3GFPA 4OQZA 4LSWA 4I6JA 4LOLA 1V48A 3D3WA 3DOHA 3IO3A 5LBTA 4YCMA 3L4BA 1KYVA 3Q3IA 521PA 3D4PA 4O2BA 3HKEA 3GYBA 1AKQA 2LUOA 5IT0A 1B73A 5JFGA 1TCBA 4A0GA 3X1XA 2JCBA 1AK1A 1TUBB 1ZQ1A 3IESA 4IXNA 3HGTA 1Y1RA 4K2HA 5H0IA 4WA8A 2C03A 2Z30A 4H0CA 4IOLA 4QYWA 5FBHA 4Q9IA 4AIIA 3L4KA 2QPAA 1L4FA 3A6FA 1RZUA 1Y48E 4UPDA 5KTSA 4D4MA 4OIMA 3UWOA 3MJDA 5CG2A 4B8WA 2Q41A 2VPWA 1ZD5A 3OM9A 5CNKA 5T3UA 2X0DA 1CQIB 1MG5A 1OAAA 3ZDQA 3DZDA 1HL3A 1TCAA 4KI0A 1EGAA 3FFWA 4BEBA 1H0HA 5KI6A 1VJ1A 5LLSA 3JS5A 4YT5A 1J20A 3JWJA 1XC7A 4KITB 3NR2A 4ZDIA 2O07A 3ZCVA 5JC8A 4DSUA 3AI3A 4WHMA 3KL2A 2C0QA 1A8HA 2I1WA 3VHRA 1NUPA 3JY6A 3LW7A 3WNVA 2V98A 4G5XA 1C29B 5LP6B 1SXJB 2F8TA 5CK5A 1M8PA 3QNUA 1I30A 2D2VA 2R2AA 3NDPA 2C0PA 4H59A 2I7XA 2OG2A 2ZB3A 2QL6A 4D80A 2O8BA 5KDDA 1N7JA 1PS0A 3FYTA 3AESA 3AJ9A 3ZI4A 2LZ0A 2R87A 3QIAA 4H6WA 4TLLB 5C3UA 3KYDA 4RF4A 3NWEA 3IPXA 3WK9A 1QC5B 1Z0ZA 4HQOA 2DKFA 4MAFA 1ZU5A 1YB5A 4NK5A 4MIYA 2GARA 1VGVA 3BM5A 1SCNE 5K45A 3ZIAA 2H5LA 1AQNA 2DJ5A 3P9XA 1T5LA 5EQTA 4GDFA 1NQXA 1RJFA 1QK4A 2GN4A 2VC2B 2WF5A 3L6RA 1P3Y1 1QJ4A 4BGUA 2ZCUA 1QKJA 5L7TA 2E48A 1AKVA 1ZO8A 5F3DA 4BFSA 4F3CA 4H2DA 2R8RA 4PZZA 3VDNB 4H27A 3RVPA 4HWPA 1KIMA 1Z7YA 3LF2A 1FFXA 1D7AA 3AP3A 4Q3EA 3O92A 1YJ5A 3G5UA 4UM7A 1YZFA 1DIBA 5E3JA 3ZBTA 3IT0A 4ML3A 1X86B 4OGFA 1HLFA 2C8LA 2HRBA 2XF2A 4C0AC 3OQBA 1NR7A 5TJ9A 3U7JA 3TG8A 1ZSYA 3A4NA 4BMOB 4EKGA 1CUUA 1SVKA 3HFGA 4PAOA 1GNRA 4NX2A 4S1OA 4Q5IA 2BBSA 1US8A 4L8WB 3U9LA 4I19A 5B1SA 5HIAA 1JHZA 1MV5A 3OPYI 2OHGA 4PHFA 1IZZA 2EBUA 4BTLA 2B6HA 4NPCA 2WPDA 3LP5A 4GP7A 2WF9A 1WDWB 3LQ4A 4G1CA 2OQVA 1E3WA 1JPJA 3EVCA 4OHMA 3ZIAD 1A2KC 5KVCA 3AW8A 3QYPA 2PVCA 5CBPA 1A9QA 3PPVA 4YJFB 4PPGA 2W48A 4URUR 5HFAA 1JHQA 2B78A 3PI6A 5EE9A 4OX9B 1PV1A 2G36A 2PHZA 2FPIB 2OGWA 1D3AA 1M54A 4X24A 1HYHA 3W2GA 2HA2A 4ZWNA 1WS6A 1IULA 1GITA 4P0TA 4EY7A 4HB4A 1MJ5A 3ANXA 1QFSA 1ZKDA 2HXYA 2F62A 1MIOA 3HO6A 2CDCA 1W8DA 2O57A 3HVHA 3L06A 3LDAA 2N1MA 1E62A 3F5MA 2ZB2A 3KPUA 2G8LA 3B12A 1UBGA 4MVJM 3UCXA 3GO4A 4DZTA 2WM9B 5LU8A 4I6EA 2PLWA 1KVUA 1QYWA 1FMJA 3A1EA 3P2IA 4XX0B 3WL8A 4KWHA 1LPPA 2JIQA 2XECA 2XWSA 5FA5A 5JCPA 5AJUA 4GR5A 4EHBA 4M89A 1ADGA 2BGIA 2XGMA 3QJGA 3ZGOA 1XAHA 1BSVA 3WBBA 1XLTA 1KH2A 4AS1A 2P9JA 1XX6A 2AF3C 5C32A 1V4BA 2X1LA 4M21A 1DU4A 3VGPA 4TTPA 2VJNA 3KLMX 3H2JA 1DWQA 2JH3A 2XY4A 4XRRA 3GLIB 2O0MA 3GELA 3KZ1E 4M8KA 5GJVC 2IUEA 2AXPA 2ZK7A 3ND9A 1WKBA 4ILKA 1Y7HA 3FKJA 1XTVA 4BB0A 4EWLA 1NXPA 2M2IA 2O48X 4HXEB 4Q4DA 4UAVA 2ZIZA 1HQKA 4U6QA 5A5DA 3EIEA 2Z9BA 2NTYC 3QXCA 3DQPA 4Q05A 3ZD8A 3ZK7A 4YCLA 5KC8A 1HDGO 3BDAA 3PNSA 4O6VA 1R10A 3KR0A 1R15A 2AC2A 1TKAA 4YRKA 5JNUA 2DT8A 2GA8A 4ZOLA 4DT1B 1TF7A 1KEEA 5DGDA 4I5FA 4L5JA 3X0DA 1VA5A 1SU4A 2ONZA 2P2LA 2CJWB 4OU5A 3RVKA 1JEAA 1KBZA 3IIEA 2PXHA 4I99A 1P5JA 4KQMA 4UVDA 4LV5B 3ZCPA 5JT1A 1RZVA 4GKBA 3W5JA 1CDOA 1HE2A 1L9KA 1X7GA 2F3TA 1HDXA 4IHJB 1ZW6A 3WLNA 1X39A 3IUPA 2TMGA 1QPGA 1OWLA 2PGIA 3K05A 4BZQA 4KREA 1U7DA 1OFTA 2ENUA 3LNTA 4G0QA 5DWDA 5EUCA 1H4TA 1T36B 4R2XA 3IQXA 1B76A 2Y1LA 3BMQB 4JLKA 4K9NA 4KVZA 3W4KA 4LJ8A 4BNJA 1ISGA 3IOEA 1XTRA 3LUCA 3K1YA 3PQ5A 4S2UA 4YYZA 2FDRA 4FPXA 1RDFA 4ICIA 1P1RA 4OSPA 3QVJA 1H4VB 1ZITA 4CIWA 3TI7A 3ENKA 4EI9A 4ZANA 1Q7GA 3D7LA 4P3YA 5BY2A 1QZ3A 3AB8A 4PFSA 3ILYA 1Z15A 3FDJA 4TWZA 1KHHA 4V0ME 3G9ZA 1ECPA 1PR1A 3ZCQA 1A2OA 1FEZA 5IAOA 3RS3A 4EG3A 1NSTA 2IKQA 3OEYA 3OTIA 2Q4OA 5HIJA 4RK4A 3ZZUA 3OPVA 1E5LA 5HTKA 1PZXA 4DUPA 2BRUC 2OC4A 2FSFA 4W63A 3QY9A 3F3KA 2DWPA 5IC5A 1KAEA 2VR1A 3OMXA 3GU3A 1OUMA 5AXBA 4A26A 2CLKB 1MW9X 3A58B 4C9BA 1KO7A 4DMFA 4OY3A 4MVWA 8ABPA 5U1PA 4GM1A 1KS2A 2W6ZA 3FJOA 4TMXA 2IEZA 3WNBA 3JYOA 3QKWA 4JJ4A 1QVVA 2GCOA 4BV9A 3HYCA 1PLKA 4GPZA 3OT1B 1RM3A 4BNIA 3IQHX 1ESEA 1W1UA 1RKBA 1SC3A 3FWYA 1SOVA 3I61A 5HS4A 3VO1A 1PF7E 1EGVB 3QTBA 1YSCA 5AI8A 5EAIA 4DCTA 3MS4A 1NVXQ 5EJ8A 3LQ1A 3R77A 1T5HX 3HZRA 5DI3B 4O5AA 2EJVA 3DFZA 1R5OA 3OCVA 3F96A 3ONEA 5BMOA 3AI7A 4PYQA 1QH8B 3PXEA 4S24A 3RHFA 1QC5A 1K9SA 2HN9A 3MQFA 4CR7A 1W1IA 3LDFA 4LXTA 3UJ7A 1PJAA 5K7SA 1O7JA 4JFRA 3L4JA 2C4TA 4NMLA 3V4VB 2C7OA 1C4OA 1ZONA 3AWIA 3G9XA 2XYVA 4N9QA 4O2BB 3RIEA 1SK8A 1VPTA 4DMLA 1XWIA 3QE4A 2X77A 4IMIB 2C9CA 3C8UA 4O29A 2AFIA 1U0NA 3JRNA 3LO5A 5FL7A 1SQ0A 2VDPB 4LY3A 5E4TA 4A91A 3JCZA 5CPBA 5DE3A 2ATXA 1ZRHA 1NF3A 3KYIB 3C39A 3DBHA 4N6GA 5HE8A 1KQFA 1VC2A 1ZNZA 3ENZA 2YNMC 5FA6A 1Y3HA 2POQX 4B73A 2VYNA 1GUFA 4HAIA 5BO5A 3G7NA 1SEPA 2XT9A 4PHCA 2X9LA 4FW8A 3WV4A 3DEJA 3T9BA 4Z3KA 3AVXA 1Q95A 3DOIA 3LBIA 1LPSA 3L8ZA 1X70A 3FAKA 4LDZA 1WCXA 1BOOA 4XOIA 1CQIA 5IJ0B 4CMGA 1IJEA 1TB4A 4I1YA 1NQTA 1IFXA 1ESDA 2V4MA 1KMHB 3OZRA 3Q0IA 4DLXA 3K0SA 3NUQA 4JP3A 4MQMA 1WVMA 1A5AB 1TMGE 3B6ZA 3GNLA 1DKRA 2PD6A 2PH3A 5EKUA 3BMQA 3ZV5A 4F6RA 4RTOA 3AF4A 3C3BA 1BAPA 3F6SA 4ZTZB 3PXBA 1P1JA 1I4LD 4XRGA 3N70A 4LJLA 3LC7O 1JDVA 5I9LA 5EZ5A 1G7CA 1ZH4A 3VPCA 2ZT5A 1IATA 1ZIDA 3FYSA 1V6AA 2JFNA 4N3CA 2H85A 1EK0A 1PJBA 1JA1A 2D4HA 2VWGA 1KK1A 3ESCA 5DNEA 3K35A 3N3AC 3TVYA 4BBAA 4BNDA 4E3ZA 5EIXA 1QKIA 1XXHB 2F3PA 2H92A 4I1PA 3OF2A 2YJ6A 3BIJA 3I05A 1X42A 1YZKA 2P3SA 5CK4A 3UG6A 2CNWA 2IHNA 1EUYA 3HC7A 5HVNA 3JQAB 4DC1A 3A27A 2HJWA 3F8WA 3QXXA 3PUXA 2GPBA 5FEMA 4P8RA 3BKXA 5BV8A 4PYOA 2PSEA 3U3XA 3GLHB 4V2UA 1B0ZA 1RIIA 4BAGA 2EKBA 1EA7A 4O4HB 3ISVA 3R41A 3NX4A 3U7QB 4UKDA 3W2EA 3FCSB 5HP4A 2B3DA 2QXTA 1HT3A 3EQ7A 4U02A 1PYOA 3QOYA 1GRRA 2GFQA 3M1IA 3SYTA 3C6YA 1RXWA 5BORA 2CJXA 4WLEA 4AF7A 3BGSA 1DJLA 2IOQA 3H6KA 3STVA 4AYWA 2AN1A 4NMMA 3FG9A 2HU2A 3TFQA 4QHSA 5A4FS 1KH3A 1VP3A 4IFBA 2PWZA 4F0JA 5JCZA 1MXFA 1WX1A 3HCRA 3R0JA 4KO1S 5IRCD 2YN2A 3CUEF 1YGYA 3DQZA 3WE7A 3DC2A 5SZHB 3ZN2A 3CW2A 4E5PA 4RACA 2Y99A 3FUUA 3KFLA 1LF0A 3L43A 3L6EA 3O21A 3DLIA 3QEKA 3MUEA 4ZI3A 1U0FA 4P3PA 5F7XA 3U09A 3ZXUB 3GLVA 4K6GA 4ZDWA 2IT1A 3WRXC 2IY9A 1W88B 3FFXA 3JQ9A 5LMNB 1SVNA 4F8JA 3F90A 1JR6A 2VHQA 3FDXA 2AXQA 4W4TA 4BMZA 1YDEA 1XPJA 4KBFA 3IILA 4M46A 3F2IA 2Z4SA 1RZRD 2QYSA 3PDCA 1YR7A 1F17A 1CR0A 1N92A 2GZ3A 1YKFA 1PEKE 1WXWA 5JXWA 2JKVA 2Z4TA 3SFVA 3ZWAA 1G8GA 1L2TA 1U2EA 3VC1A 1CB0A 4MLPA 5KWVA 4IHJF 1E0KA 1Z83A 4OK5A 1QIEA 3SYRA 4ARCA 3ZR4B 4ZOLF 4CDRA 2IELA 3DAPA 2QP4A 1C7IA 1YUMA 4LBWA 1KZ6A 1UPXA 3H13A 3CV3A 4C03A 3CUVA 4TT3A 4X8LA 3O03A 2WAYA 1U8UA 1XQXA 2RAPA 5K3FA 1A5TA 3COVA 3NBXX 5LOVB 1FFEA 3VISA 4FX5A 1E1LA 1HYGA 2VHYA 3FPLA 1LRJA 4E2YA 1NMSA 2GMWA 2QGFA 4PYKA 1C81A 1JFSA 3KEMA 3BK2A 2QTGA 1KI2A 3SHOA 4EITA 4Q1AA 2AZ4A 4G36A 5A3VA 2JPDA 1G8HA 2Q7DA 1E4EA 1FU4A 1PSZA 1SKBA 1BE1A 3KQWA 3DW1X 3O9VA 1A2QA 3AR2A 5EOVA 3WBJA 1II9A 3EPLA 4LVOA 4LY6A 3P5BA 4XWTA 1Y7TA 3K0EA 1FCJA 4QQNA 3WGUA 2QVGA 1HEIA 5KJEA 4ZYZA 1YA4A 1DI0A 4MUFA 3LQRA 1E66A 1JKXA 2RBKA 4PZLA 2QLTA 1RAEA 2H18A 3L6UA 2WR8A 4YP6A 2FFBA 1CY2A 3U26A 5TVKA 2M1XA 1Z12A 3SBXA 3ZH9B 3LY9A 3SN6A 3MT8A 4UQOA 3E84A 3GFFA 4WCFC 3V55A 4W5RA 3LJKA 1XZDA 1TM2A 4K9QA 4Z0NA 2HMUA 2R6DA 4DWJA 2VNAA 3FYUC 3ORQA 3VOTA 2ZOSA 4NCJA 4E88A 1HDYA 2Q5OA 4OYYA 1Y4DE 3RYHA 2CJPA 1MAAA 4B3JA 4CV1A 5IYZA 1GKKA 1SVMA 3DTYA 3V32A 1FZTA 2R1VA 4FYPA 4TVKA 2YNMD 2DPLA 1VKNA 4FBGA 3D6UA 2O8BB 3DMHA 3I37X 5JBIA 1A7UA 3A4MA 1HYEA 4R2HA 1G0NA 1N3BA 1OU4A 4HYYA 4IHJA 4ZT4A 5AVVA 5J5VA 1BA2A 1S2NA 3OEHD 4CT5A 3CUYA 3NFYA 4C7KA 1J0BA 3LFUA 2O4CA 3FFBA 1H2FA 4MPPA 1XVUA 1WPGA 4DCPA 3E2IA 3L7BA 1UM9B 1ZJ6A 2XTZA 3NHKA 3A1CA 1S2DA 1I80A 4E1VA 4P36A 1HOXA 2PKQP 4URYR 1N3LA 4F4JA 3KJIA 1IZ8A 1KJ9A 1T35A 4P32A 5CFLA 4AJLA 3DHYA 3RFCA 4H1UA 1DIOB 4WN9B 2GD6A 2WE8A 1BJTA 4X1IA 1V7PC 4P2BA 2M1ZA 2O6HA 1G19A 1DFHA 4FMBB 4PQEA 3BQNB 1USUA 3EPJA 3KSZO 1ZGJA 2XB8A 1T24A 1XD8A 4KNYA 3SHTA 3GN1A 8LDHA 3UMBA 4MVYA 2I7VA 4J6EA 4ALIA 4ZMRA 4FNGA 1TUGA 2IEBA 1CTQA 4L5AA 4R16A 1X7YB 3CUKA 3HV2A 2MR6A 2O1EA 2PIDA 5JSKA 1IG3A 1OT5A 2PJUA 2AEFA 3EGDB 4YNBA 4UCQA 3MUOA 3O4RA 3ZC3A 1UADA 3BXFA 3BT7A 2Q3BA 1RPJA 3EDMA 2FQYA 4IJQA 5T67A 4D44A 3WWDA 1J21A 2GPTA 3EPKA 4QD3A 5IEJA 2DHDA 5DNWA 1KDPA 1UQRA 4NENB 4FJ0A 1Y34E 3Q15C 4EVQA 2AWNA 4LHXA 4AUMA 1XD2A 2VCHA 4BKMA 1RWVA 1F2TB 4HNAA 1P9WA 4YREA 2Z1NA 1GU0A 2A0KA 3N6RA 3TN7A 1ZAYA 4IV5A 5CW1A 1JJIA 2YN0A 4Z4FA 1OXSC 4ZTBA 3F7NA 4B3HA 4HH3C 3WYAA 3DWFA 5KOJA 1D1PA 1W0CA 3N7UA 4MO9A 4Z8XA 4LPKA 4G6ZA 2CUKA 1UZMA 2G06A 5I5GA 5J4VA 1GQOA 4RTMA 4X20A 1DRVA 5MF6A 1GGHA 3SYNA 4MI6A 2FNAA 5DLYA 3GDOA 4DNOA 1RP1A 3MCTA 2QUAA 3NHLA 3G59A 1AXGA 5CDUA 1M8FA 3D6TB 3OKPA 2FZVA 2OCPA 3G6KA 3IUBA 3QVOA 1DINA 4KX5A 5SY4A 3TPZA 1GLGA 1GQRA 1WZUA 1ZXBA 5KNCA 3G5AA 4UTVA 1PFKA 1WVGA 1GG2A 2XT6A 3BRQA 1AURA 3CCCA 1Z28A 5B6PA 2CD7A 1PVVA 4HDQB 1LNQA 2FUKA 3K2BA 4ZT6A 5IM5A 1GQYA 3IPCA 4FNOA 4KWIA 1U1DA 4OH7A 2LPMA 2R7KA 1XN4A 4C0KA 4EAQA 5MGNA 2NZUG 5LMCA 4HQ0A 1DRKA 3K53A 4UUMA 2DPMA 4HDMA 4DYHA 1I7SB 3N7TA 1XKTA 2XDYA 4CTMA 4UCXA 2WWXA 3EGCA 5IZCA 3PEWA 1FSSA 2HCJB 3AM5A 3HUEA 1RYHA 4DR3B 4F3YA 3DXXA 3MS2A 2BH2A 2JLXA 3TRHA 1B16A 2COEA 3I4LA 4OYLA 4QPJC 3F9CA 1I1QB 3ESBA 5AK4A 1C30A 1HFWA 1HNWB 221PA 4PCUA 4PZDA 4QVGA 1EK2A 1V4VA 2V0GA 1YQWA 1O4VA 2NSDA 5KNBH 3G02A 3KKMA 4OJTA 3BWCA 2DERA 3BWDD 4QNRA 3DOEA 3L41A 5LOVF 3TX2A 4BDSA 1MA0A 4J7UA 2DETA 3DEFA 1I4DD 3N87A 5IC6A 3ROXA 4IY1A 3FHTA 1YZQA 4BVBA 4JJIA 1EXNA 1X1AA 1GQFA 2ODBA 4MW0A 3ZHSA 3LDHA 4LYYA 3AEXA 2HJRA 5J5CA 3LP8A 4Q48A 1I4WA 1S9DA 3HHPA 4IDEA 5E7MA 1M76A 2WIAA 2ZPUA 4Z7QB 1RBZA 4IDFA 2AIRA 1V35A 3H9BA 2YV2A 1HSOA 1GR0A 3BD6A 4K6MA 4WK6A 4AZVA 5AVZA 1FUEA 4YJ2B 3RC1A 3X1ZA 2L42A 1NI4B 3R9IA 3T4UA 1F2UA 2FLVA 4W7HA 4XWKA 5AW7A 1DCTA 3SBOA 1G63A 3LECA 5JPCA 1C7ZA 1YI0A 4FOLA 2J3MA 5BYBA 1N2IA 1YMUA 2GZDA 4LGMA 3M6VA 2H1WA 1C80A 4BPRA 5KJFA 1W29A 4DNPA 1G5RA 2QUJA 1OVGA 1VXRA 1M7HA 3DZBA 2ZRNA 3EBPA 5FORA 2SKDA 1Z26A 3HRHA 4BN4A 1AQLA 1YFLA 3EX7C 5EZYA 2GWRA 1FIUA 4DM3A 3HCCA 4OL0A 1JB1A 4DABA 4P0PB 3LV8A 5AICA 2DQSA 4YR7A 2PS0A 4Y0VA 2GHTA 4A36A 1I5RA 5LQSA 2J4DA 3ILXA 1FDTA 1SBTA 4DLAA 1Q0QA 2UZAA 3OFVA 3AESB 3I39X 1P0FA 5JALA 3M0EA 5BV2P 4LGYA 4HJRA 2FSVA 2H9AA 4MQ5A 3OZWA 1H3EA 3KZVA 1S89A 5BN4A 1GSAA 2QMOA 1XTPA 2NSYA 4WCVA 2XB9A 3I8SA 2A7QA 5M04A 2J87A 4HNSA 4D9HA 1U80A 5G4KA 4WCFA 1DE0A 2JD0A 4ACAA 2FSSA 2CLCX 5JAHA 3EWNA 4RADA 4OXNA 4E22A 3NG1A 4CGZA 4JJZA 4IL5A 4EQ6B 1UFKA 2Q27A 3RVOA 4ACBA 5DEOA 3E1KA 3Q7IA 5EXPA 2FMTA 4ZRNA 4BY9E 2ZTHA 3EGXB 3AINA 2J9ZB 4INAA 2X5KO 4FB5A 4HQLA 5BQFA 2PX6A 4DMGA 3CTPA 1OOEA 1Q7RA 4IVPA 1U0BB 1J00A 1TADA 2NYVA 4ARUA 3V4FA 3AZOA 3QPWA 4G2TA 5KJCA 1RXUA 1CUEA 5KWSA 1Z07A 3O3OB 2V6MA 1QB7A 2LCQA 2I6TA 5FO0A 2WFMA 3UB4A 3PKZA 5F3RA 5SV2A 4ZXPA 1ESZA 2WJPA 2YJNA 5EJ7A 2REXB 3W04A 4L75A 4IIYA 4WKNA 1GILA 1YVDA 4JLWA 4OXRA 3RKUA 4MWCA 3TGWA 5JH7B 4BMYA 5E3IA 3VTZA 2VZEA 3MVEA 2HDWA 5H3LA 1PAUA 4IUDS 1BDJA 2DKNA 4TLEA 5REQB 3L1JA 1MUUA 1U1IA 1H93A 1QNFA 4AMZA 3OIFA 5CGQB 5CA0B 4NQZA 1LKZA 2ZVJA 5HQTA 4Y6PA 5IFLA 2ORWA 2DPYA 3C4JA 4DTIA 5LQRA 1HM5A 3I2JA 1SHLA 3T8YA 2XV1A 2PTHA 2ZJYA 4GOOD 4J1NA 1MQSA 1HQDA 2G17A 1Z7BA 5E1OA 3RFTA 5BVHB 5JVDF 2QRZA 4FT4A 2B3TA 1MNQA 5A7FA 1Z0DA 4O25A 4DZRA 2HM7A 5KUTA 1NSFA 2QLJA 1H94A 2BEJA 4DA9A 4JDUA 3T99A 1I13A 1WCIA 3I64A 1PL6A 4JOBA 4YHHB 2FZGA 2PUAA 2X0KA 1Z36A 3FHLA 1UZNA 2Z08A 3OZ7A 5EXXA 3SSMA 2C7GA 3TSZA 3IUYA 5CMLA 2XVYA 4IWYA 4ZCIA 4Q21A 1QRUA 3IOYA 5A4KA 3TNLA 4ZTUB 3L7JA 2MSKA 2WVJA 3LDGA 3I9NA 1BC5A 3MRXA 2O8EA 4LZAA 4TMYA 3VGJA 2WDZA 4B6QA 4E3WA 5EWJB 4ZYTA 1UM8A 2GA9A 1Z62A 4DYDA 1VLLA 3Q7EA 4ZVLA 4NICA 4KLZA 1NZDA 1LB1B 2J9FA 3CFYA 4LQCA 3ETNA 1TJ4A 3WR5A 2JKYA 2P3OA 1T8PA 1NAHA 1Z4KA 3MBOA 3OM1A 5HUJA 1T0PA 3A4YA 5ALLA 7MDHA 1LH0A 5BNWA 3QFCA 1WXFA 1G41A 1V1MB 5IJ9B 1M34A 1WEHA 1NW6A 4M9ZA 1O0BA 1B1CA 4M1WA 4PCAA 4B44A 5JAMA 1IZYA 3B1ZA 3U3RA 2JGLA 2QD4A 3BZBA 5CTJA 3P45A 4D9KA 3GFBA 1OCEA 3OJWA 4XYMA 3EULA 3GPIA 4EB6B 1GCOA 1EFRA 2PEYA 3AH8A 1ZK2A 2Q4EA 4K2AA 4RGYA 5K3AA 4S1PA 1DAKA 2XZLA 2EFHB 2BMAA 2NUPA 1UC4B 1QONA 1W30A 4J7CA 1IUOA 1FTSA 1WHSA 1ZH6A 1RT9A 4MXDA 3RSZA 1GKLA 3QPUA 1BEZA 5ADUS 4HUTA 4B7ZA 4DKJA 2J9RA 1T3LA 4N3AA 2HTEA 4TWIA 2JF0A 1Q50A 1Z5NA 4M7OA 3W2TA 3Q88A 4G0MA 1XNRB 1R8XA 2GD0A 3HDGA 3WAJA 5I7OA 3SDSA 4OQLA 2C5BA 3P2OA 3RUHA 3VMFA 2RCYA 1M34E 5FQOA 3WJ2A 2JCSA 5KZMB 4KIJA 5CGZA 3QIVA 1G9XA 1L6RA 4OA8A 4WZBB 2XYRA 3TECE 3ABOB 1NV8A 3CRZA 4PAMA 4TV9F 3A3OA 5CDTA 5IUNC 3SC2A 4M0MA 1YVEI 2B2XA 2F8SA 2H4XA 1R18A 2QX8A 2QN8A 1QPZA 1FDVA 3AFMA 2CYAA 1ML4A 4V1CI 4JENA 1MHPA 1TKCA 1K4YA 2Y4NA 3Q3CA 5DWQA 1PT5A 2J0QA 4FYKA 1GEGA 3USZA 4CEIB 1JG7A 4OH1A 4EFLA 1SXGA 1B6GA 3BMCA 3OPQA 3HA5A 3HJBA 1W581 3MC1A 4UQPA 3GLRA 3Q0EA 3JPWA 4MITA 1O0CA 4G23A 5CDFE 4DLSA 1NU8A 4MVJP 1V43A 3UMGA 5C0OE 1Y5RA 3IB3A 3DDWA 4ZQGA 1VJDA 3EGOA 5DLPA 3ESZA 3RUDA 3RWBA 2X7XA 2I91A 2SBTA 2DWQA 5JJLA 1KY5A 3OQ6A 1JN0A 1KMIY 4KN5A 4MLZA 1E5DA 2DY0A 2X0EA 2WK1A 3RFUA 1OTXA 3DEAA 3K9BA 4PR3A 2JZOA 4M83A 3NU1A 4TLAA 5B7PA 2PRZA 2IPXA 3HSYA 2FPLA 2WMNB 3A6LA 3C6XA 4O2BF 4WJZA 5DYIA 5THQA 3AO0B 1RIFA 3K73O 5TMDA 3TRKA 1NMEA 1XHEA 1KO4A 2DBQA 2IEGA 4U8HA 3AY3A 1K5PA 3K8OE 5E4JA 5AW1A 3GVHA 2GZAA 3GJYA 3T7CA 2X5JO 2X8BA 2WG1A 2R11A 4X91A 1AQIA 4ZI7A 5TF0A 5HJEA 3KTAB 1B74A 1U11A 1XCBA 1GHTA 4J4HA 4L0CA 5B2FA 3KG2A 5J3JA 1LI7A 1ZG3A 2YIJA 4NBKA 2UKDA 3TD9A 4BQRA 3DFIA 2J3KA 2ZR7A 3VR6D 1UMCA 4IPTA 1AC5A 4MMYB 2NYAA 3FIUA 1OW3B 1NN5A 4IDAA 3CZ5A 2ECFA 4KO4S 4L76A 4AQ7A 1WBDA 4R68A 3ZCXA 4JEHA 1BJRE 1IY1A 2RAFA 3P2YA 4BKOA 4FS8A 5CBKA 4EDHA 2FPGB 3EGWA 3MTJA 1TJ5A 5TPWA 3NIFB 2PTGA 3BQMB 1CULC 4MCJA 4R2KA 4ALKA 3C15C 4CM4B 2DY1A 1LZLA 3KQMA 4PF1A 1D2GA 3A6DA 4HDAA 2XD9A 2QM8A 3SHQA 5BSWA 2BFOA 3ZHCA 1GFSA 3EZFA 4DG9A 3NATA 2JBAA 3VZPA 4Q1BA 5FWDA 1NPYA 4NYMR 4FDLA 2CT8A 3A04A 5JJ5A 1C9MA 2WZCA 2PSFA 2JGFA 3F7OA 3D6HA 1JTEA 1MAUA 2HPVA 3O1JC 4ND1A 4AZ3A 1ZMRA 4F2PA 1EUCB 5K6RA 4RNDB 3CZAA 1AT1A 4AP6A 4ABYA 3GGCA 2Q62A 1FRQA 1CY7A 1R50A 3FSGA 3HP7A 3QPVA 4MW1A 3VU9A 2QTTA 1HT2E 4XPIB 4YR9A 5TR9A 3G2HA 2J8ZA 3L40A 1E89A 2EW1A 2H16A 4HY3A 2RGXA 1X80B 2VJCA 3BSWA 4U3JB 2B5VA 3KAQA 5E0OA 4QNMA 4MKRA 5DGHA 2X42A 3UQYS 5G53C 2QTRA 4GI3A 3U13A 4D9GA 4EY3A 4HP8A 1MVOA 1GYRA 5LP6C 1W36D 1T10A 5JDIA 2PX3A 1KE2A 2PMEA 4RDHA 2QDXA 5AI0A 3QFFA 4URHA 1N57A 2FGJA 1JSRA 1WAMA 1GUYA 4LUCA 2PT7A 2WTAA 1Q3HA 1ZVKA 1IQPA 1NMXA 1N5IA 1CJUC 1UWKA 4C4AA 4RZXA 2ZROA 1RCTE 4EHAA 2BUBA 2J3EA 3M1LA 4K6CA 4QU0A 4ON9A 5CAEB 3GQBB 2Y1XA 3N2GA 5HNKA 4LE0A 2L82A 3OPMA 4HB3A 3HKCB 2OORC 4R7ZA 4L07A 4QXOA 5T6MA 1AX9A 3WB2A 5JQGB 2QXYA 2FG6C