4R7TA

Crystal structure of glucosamine-6-phosphate deaminase from vibrio cholerae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLPTGGTPLATYKALIEMHKAGEVSFKHVVTFNMDEYVGLAADHPESYRSFMYNNFFNHIDIQEENINLLNGNTDDHEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDAQEIMILVTGHNKALALQAAVEGSVNHLWTVSALQLHPKAVIVCDEPSTQELKVKTVKYFTELEAKNIVGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glucosamine-6-phosphate deaminase from Vibrio cholerae
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
molecule keywords Glucosamine-6-phosphate deaminase
total genus 93
structure length 266
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r7tA00
1FS5A 3ENQA 5HJ5A 1LK7A 4NMLA 1FRZA 3LWDA 3L7OA 3NWPA 4TM7A 1HOTA 3HN6A 1Y89A 3ICOA 3IXQA 4R7TA 1UJ6A 3BXEA 1HORA 2RI0A 4M8LA 1KS2A 3E7FA 1M0SA 4L50A 3KV1A 4L5IA 3BXHA 1LK5A 2WU1A 1LKZA 1UJ4A 3CH7A 4GO1A 1JT9A 3BXFA 4IO1A 1NE7A 2GNPA 3LHIA 3ENVA 4GMKA 1PBTA 4L4ZA 2R5FA 4L5JA 1DEAA 4OQQA 3ENWA 2J0EA 3E15A 3U7JA 4X84A 4L4YA 4OQPA 1FQOA 1XTZA 3EB9A 2BKXA 1UJ5A 2BKVA 2F8MA 2RI1A 1O8BA 3KWMA 3UW1A 3TX2A 4L51A 1CD5A 1FS6A 1VL1A 3HHEA 4R9NA 3OC6A 2W48A 2OKGA 3NZEA 4TM8A 1FSFA 3EFBA 3CSSA 2O0MA 3BXGA
chains in the Genus database with same CATH superfamily
4ZKDA 5B58C 3UAVA 2VH5R 2EJCA 4FLFA 4OD0A 4QD3A 3TTWA 4HDRB 2LRHA 3EXFA 1REQA 1ZUD1 3BCHA 4G01B 4ZPXA 4EHFA 3ROFA 4NXNB 1UFQA 3KAJA 3QTBA 3OPNA 2GXQA 4MV1A 4JJZA 4PAGA 4WY2A 2XB9A 5G0VA 4XXHA 3GV0A 4QXMA 1M66A 3ECAA 1MC5A 4Y1GA 1H5UA 3ZZ0A 2H5IA 1F4LA 3ANYB 1P6XA 5AK0A 4BO8A 5CEFA 2IDMA 1XMVA 1NKSA 5DEIA 3G59A 4G4GA 3ROKA 2GS9A 4FU0A 3E2IA 1C7EA 1EFKA 1RHKA 2A8YA 3CVOA 3OLZA 4LZJA 3BK2A 4YRTA 2IWRA 3SZLA 4IPTA 1DO2A 3RWMB 3VPCA 2G76A 4JX8A 1YQWA 1KFJB 4DIUA 3OPYB 4FFWA 1XVIA 4DQ0A 1PLJA 3FCCA 4NNJA 1SVSA 1Z13A 2AGVA 2ES4A 3S44A 1A9YA 1FRZA 1G0NA 1NI4A 2BR4A 3FSGD 3IDQA 1L4GA 3UV3A 4GM4A 1LBQA 1UJ6A 2AQKA 4MWDA 3I1IA 4PFSA 4UBLA 3ZZUA 4X66B 4AWBA 2JFOA 1BS2A 3O2NA 3QEMA 3SXPA 4YRGA 2B4YA 3N75A 4QKQA 4GPD1 4XR9A 4M3NA 3MMNA 3KX2A 3SHQA 1EK5A 3HBJA 3ZU6A 3ENZA 2Z95A 4EB8A 5AM3A 3TZBA 3P8ZA 4BX9A 1TKRA 1IUPA 3JSXA 5KNDH 3G6WA 4KEAA 3ADDA 2K6GA 2IY9A 3KPWA 4HDSB 3THSA 4JLOA 3RU9A 2WHXA 4RVHA 2JAUA 4XEUA 1FTQA 2HWUA 3HVHA 1RPJA 3NAMA 3P9YA 4L0MA 4EENA 3ZLTA 3B1JA 1KDPA 1GUZA 5KYYB 1H8HA 3BJEA 4WLVA 5HKKD 5B37A 1CUWA 3MC1A 4O4IB 1JDBB 3LW8A 5L7WA 2GASA 5J2UF 1M8JA 5DM70 2J1LA 4PHCA 4JP2A 3GFBA 4L3VA 2W2TA 1M0WA 5FR1A 4YV7A 1XQXA 1ZIPA 2VRCD 3LJKA 3MINB 4HAIA 1NW8A 4KX3A 4OIMA 1J70A 2VYVA 1UXHA 5AUPB 4R83A 1NW4A 3T7DA 2MSCB 1R8SA 3B89A 3CEAA 3OY7A 1B8NA 2ZTSA 2RAUA 1V7CA 4L78A 4YQZA 5FBRB 2RE8A 3HVKA 2ZGVA 5JLAA 2UYQA 3LXRA 4B3BA 1KO5A 4OHOA 1GN8A 1RQGA 1D4OA 2BZ1A 4J1NA 3M49A 4WOPA 2MYNA 4NOKA 6PFKA 3OD1A 1VCOA 1ND6A 3OT1A 4GI3A 4NAUA 3SFZA 4CCAA 1KI6A 3VQTA 2YC2C 2VYQA 4ZI7B 2YQZA 3BL8A 1GIAA 2VYFA 1G6Q1 1IEQA 4G1CA 5H68A 2BFEA 4DFDA 3S81A 3RGGA 4ZVMA 2J3HA 5FQNA 4UULA 5EXXA 2XD4A 3QP9A 3W4KA 1ZG3A 2C95A 3GNQA 5E1MA 1GNRA 4BEJA 1LNZA 5I9MA 1Q95A 2PR7A 4EFMA 4OFXA 3KYBA 4LNUA 1KC3A 3KB1A 4AJ2A 3A58B 2GR9A 2XPCA 1JHRA 5KQGA 3L07A 4DV1B 4X9XA 4CLOA 1DB3A 4FVTA 3ZGOA 4NYJR 3TRIA 1JECA 5C5CA 1P7PA 1SXQA 5CB4A 2GPSA 4QEKA 4JOCA 2IOHA 2KBEA 5FTJA 3V1TC 2FMUA 3GQBB 4DBVO 3MTEA 1H3EA 4MUHA 1JA1A 2LNDA 2VSFA 4B48A 4W8HA 2IFTA 4P0PB 4FNAA 1ISGA 2I4LA 1F7VA 4KLCA 4D3SA 3D0QA 3E5HA 2MWMA 4IHQA 1XWWA 1QG4A 2AN3A 4MCAA 4WD3A 4WY5A 1YQGA 2C88A 4QYXA 5D1HA 1QFMA 4ZHSA 3GF4A 1SULA 2W70A 5AVZA 2BKUA 4NYMQ 4XDYA 4AO7A 4CV1A 2Z4RA 3B7GA 4D3XA 4RAOA 4CODB 4D9NA 2BGGA 1RLMA 1GCUA 2QTBA 2R4UA 4JODA 3UH1A 5F98A 5F1KA 1ZZEA 4HGPA 4IH4A 5GONF 4AY2A 2PJZA 1NBAA 3Q72A 4PAWA 1UWLA 4M99A 4F3NA 4RETA 2M6LA 1XRLA 1KA9H 1U0OC 1SVIA 1UEXC 2O52A 1K4YA 3HB1A 4V1CB 2L0XA 1Q1ZA 3DMTA 1EGVB 3FDXA 4HF7A 4M0PA 5GQSA 5FI3A 4Q7JB 4Z9XA 3W6OA 3EPRA 2NVWA 4QAQA 1FOEB 5LZ7A 1OIWA 4MUMA 2RIPA 4RH1A 5PGMA 2NTEA 3KYDA 2ZXFA 4HO1X 1JHPA 1X19A 2WU1A 1ZJ4A 4WBNF 1P4AA 1RXVA 4YIKA 3RKRA 1CJUC 2PXAA 3NM6B 2L82A 3DVQX 3HCEA 4OHYA 2A6PA 2XDWA 4S3MA 1BMFD 1QHYA 4NBWA 4EOGA 1EHYA 2ODWA 1M7GA 5SY6A 2OFPA 2YYZA 3C5WP 4O4LF 1BROA 2R6DA 4NY1A 3JVVA 4QOGA 1QUFA 3U49A 1XN1A 2VUIB 5U4XA 3VBEA 4DLNA 4E4YA 3NRBA 3ZDDA 3QE0A 1I01A 2H57A 3GVCA 1GADO 4EFDA 1RQRA 2YFKA 3D1LA 3OCVA 1L8AA 3CLUD 3DD1A 3QVUA 3QVWA 4KKVA 3NIBA 3CZPA 2WIAA 1Z08A 3H0KA 4QEDA 4QXQA 4RMJA 4BQPA 2G82A 2O2XA 2ZROA 3FMVA 3ACBA 5FI0B 1C3EA 3AF1A 4OI2A 2GN2A 1C9DB 3ANNA 1P5HA 3NKVA 5IJ9B 5HKKA 4C0XA 2BI7A 4L5JA 1D8AA 4HL6A 1NURA 1JEQA 3GFFA 1P7VA 3TQRA 1F8GA 1LLQA 5C8YB 5HIKA 3HGTA 1X14A 4RESA 3U7FB 3IYLW 3QLEA 4CDRA 1FFHA 2EC5A 3ZE1B 3RCBA 2WHQA 1M2OB 2VQDA 2ISCA 3MWGA 1Q0QA 3O8QA 1EI9A 4KGXA 5K3AA 3RFUA 1N2CB 4CTNA 3IT2A 1PWXA 1P0IA 3ETHA 3AOEA 2CFIA 4NCHA 1C3OA 1SB9A 3M5PA 3VBCA 5I7VA 1K6IA 1HDYA 2V9PA 2Y3IA 3GFGA 4JBNA 5K01A 2I6UA 3O83A 3GGCA 3EQ2A 5K6TA 5K3EA 1A9QA 3D3JA 1NW6A 4MV5A 4C6HA 4I55A 1FLNA 4OB7A 1MT3A 3K9FC 3H3JA 2BL4A 1BO6A 3FI9A 2GSWA 3FR8A 3KV1A 4IGAA 3AEUA 5CM9C 2HA5A 5AICA 2AD5A 4M53A 1QJ4A 4HTAA 4KWIA 4DVGA 4DC9A 4HWGA 3ESQA 4B6PA 1Z2NX 1TTPB 4D92A 4P6VF 1RIFA 1RYBA 3QPBA 1XEWY 4NH0A 4FW8A 1T1JA 4Q82A 2QIOA 3BMCA 3TLBA 4LTDA 1MKYA 3DJYA 5U4QA 3UCEA 1I2BA 3MCAA 5KTNA 1V95A 2DUNA 5JALA 1UPBA 1SC3A 1ECLA 1EUCA 2GJ8A 3OF3A 4QFBA 4RMHA 5CH5A 5AK5A 2GX6A 5H3CA 4DIMA 1QNFA 4JP8A 2PMCA 3H1GA 3HS3A 2Q4DA 4JU8A 2I55A 3PUZA 4G1MB 3CEPB 1KBZA 2KE5A 1JDPA 1QH8A 4QYMA 1RWOA 4OO3A 3T3DA 4C07A 4Z4GA 1PAUA 4F85A 3OZCA 4IDAA 2YV4A 1JAXA 4RGQA 4R16A 4F4JA 1ULZA 2EYQA 3UV6A 3GFVA 3JY6A 1GPLA 2FSSA 4IFTA 5JZMA 4ZIRA 1TW3A 1W1UA 1CHNA 5COAA 2EDAA 2ZUUA 4PSKA 4PZCA 2AIRA 5A3RA 1GQSA 4N01A 3S55A 5J4HA 4DB4A 3RJMA 1CVRA 2J87A 1G20E 3DBRB 1EFHA 1JKJA 2AOTA 5DYTA 1TU4A 2FZVA 4LOIA 4NP6A 4D9FA 3H5IA 3WWEA 2O7RA 2D1TA 2IKQA 1QRAA 4CW7A 4HNGA 1N8TA 3LC2O 1J97A 3CWCA 3LDHA 4LYYA 3I52A 1UBEA 3WOHA 1F0NA 2AMVA 2KQUA 2VPZA 3H2IA 3D9QX 5BPFA 5CDHA 1JMKC 1R27A 3QLJA 4ROSA 1CCWA 4ZOQI 1PZHA 3QBEA 5GOTA 5AVYA 5IEJA 2G5PA 1BKDR 4QRIA 1UKAA 1J0BA 1IDOA 2W6QA 2X3FA 2XVYA 5TGDA 2ZYGA 3A9SA 4H0NA 1U9ZA 4KFCA 2JFNA 1ZCFA 2P65A 1M2VA 4U3JA 4P34A 3ZCXA 4Z5XA 1VI2A 1LI4A 3D6MA 1QIDA 2H1VA 3PNVA 5LNK6 4LCBA 5DULA 3TUJC 1R4NA 1DKRA 4NHEA 2BJHA 3GARA 1B1AA 3RTAA 5A9SB 2AOWA 4N3AA 1IIRA 1J7KA 1XLTC 1DBWA 4Y6SA 2DLCX 5DYGA 3A1FA 2CCJA 4EBFA 1GY8A 4HX5A 1YBFA 2HCFA 3EMVA 3MVEA 3S1AB 3EG9A 2XD9A 2GETA 1PG0A 4HQKA 1G5IA 5DN9A 1QBKC 3UXYA 3YASA 3ZE8A 4DA9A 2YJGA 2RGWA 1RXWA 4AY6A 1NZFA 1II9A 1W85A 2QTMA 3BXFA 3C3XA 3EUEA 1FXWA 2W90A 1LJ8A 4TTJA 4MW6A 1E8MA 1TNDA 1J99A 3IB6A 4WSOA 1EUDB 2CE7A 4AO8A 4IX1A 3FOBA 5L95A 3PCRB 4RK6A 1PBNA 3GUVA 2P9GA 2FLVA 2P4HX 4J29A 3PNSA 4Q4LA 4ZT4A 4J2HA 3VH2A 3NAQA 3Q3IA 3LC1O 4EUKA 1UBNA 1E2KA 4B6OA 5LU9A 5FEMA 4DBZA 2FPGA 4WXEA 1N75A 3EW9A 1PSZA 2HSZA 1NBHA 5H9WA 1GKYA 5J9FA 4BQOA 1A71A 3W5CA 2XADA 3A4VA 3NPAA 4XX0B 5EMNA 1N0IA 4O3MA 4IIJB 2NZYA 2O2DA 4QTXA 2ATCA 1RNLA 3JWEA 2WWTA 3DL7A 1AX9A 2XUOA 3AONB 1JTFA 4CKBB 2O3UA 5IUKC 2C2BA 4EW6A 4DV7B 3AUTA 4GYJA 4O4HF 5IBPA 1J1UA 2D3WA 1R16A 4LAFA 5ERXA 1WR8A 2Y1OA 1USWA 2EKQA 4EBBA 3FYSA 2PUBA 2FUCA 3CHYA 2I9KA 5LU8A 3HJFA 3UGQA 1VDZA 4AF8A 3QLUC 4XQ9A 4WBSA 3RVQA 1AQNA 2ZR7A 4P8RA 1R8YA 5FULA 2CY0A 1QGDA 1MG5A 4KMSA 4QSMA 1RI5A 3T3OA 5JE8A 2B7BA 4JLNA 4M46A 1N7HA 5AVOA 1L7AA 5LP6C 3TRKA 2BP7B 2HQ1A 2BGNA 2HQOA 1KGDA 2QYHA 2ZS7A 3KOZA 3O9ZA 4LC1A 4PRKA 4BNLA 1BEZA 2MSDB 3AHDA 3K72B 4XFJA 1WHTA 3DLPX 5DE3A 4S05A 2VK8A 4MX8A 4YPOA 4W8GA 3OZWA 4AS3A 5IRCD 5DK4A 2VFAA 5U1PA 1UBFA 3H6HA 2BDUA 4JR0A 4YJGA 5TF4A 1NT2A 5LDHA 4PLPA 4BU0A 2PVPA 1M1NA 3BMQB 3O8DA 2J3DA 2O2YA 3ISVA 3H5LA 4JDPA 4N3GA 4RPKA 4ZU1X 3SOZA 1C50A 1ZI8A 3E18A 2EV9A 4MHTA 3KKEA 1GQYA 3HM2A 2MYTA 3HYNA 5SYAA 4QXPA 2GRAA 2NO9A 1CVLA 2Z2JA 1NUSA 3DOHA 3DXFA 4CMHA 5EVJA 1MTZA 2YZNA 3JD0A 4YROA 3QHAA 4RPIA 4TV9B 1YF3A 1E3JA 5GY7A 2E85A 5K20A 5KWSA 4X1KB 1OIXA 1BE1A 3RSCA 1YIOA 1L5YA 2IS2A 1PTJC 4GIBA 3S2SA 4QDZA 3UMMA 2PYIA 3R77A 4R8SA 2GHTA 2HCRA 4LUCA 4G1BA 2XNDD 4FDTA 4I3FA 3MMXA 4YAOA 1X9HA 1ZK4A 2Q5JA 4Y98A 5HP4A 5HIIA 2CFSA 3CT4A 3A28A 3VOBA 1V8BA 2CJWA 3HDGA 3U4DA 2V55B 4KVFA 4CM9D 1SCIA 3H16A 2AJ8A 5A4JA 3VYSB 1T5HX 1ILEA 4G25A 2CW5A 3LT2A 2CVZA 5DK6A 2FKNA 4C2TA 3AI3A 3QOYA 3JARA 2DBQA 2NX2A 2EVWX 5EIAA 3ZY4A 4BIMA 1WF6A 3PGVA 4RK0A 4UEQA 4JEIA 4LCEA 4DA6A 4C1NA 2DR2A 3SQWA 1OX6A 4MUBA 3ZVNA 1PWYE 2RI0A 2JGLA 3FPLA 3EEFA 3FTEA 2Q29A 1DNPA 4Z4FA 4PXAA 2H48A 3K92A 4J2TA 3UTCA 1NR5A 3ESYA 3CMCO 2PGJA 3TLZA 1QPZA 1A76A 2V98A 2EWVA 2RHOA 3C7TA 2B61A 3DZIA 1FUEA 3ELDA 3ZXXA 4BNHA 3EVFA 3QSGA 4CMIB 3ACCA 1TVEA 1ISRA 1ZSYA 5AT1A 3EZYA 4J07A 5JWHA 1OYWA 2NU9A 3RTBA 1PEYA 3CUWA 5F3RA 1DDIA 1AXRA 4WA8A 1YR8A 1WDWB 2Q1YA 4ZGWA 2Z57A 2MSNA 4BB5A 2D0DA 4Z0TA 3U4QB 1JPUA 1OHHA 1M2EA 3SIWA 2PGAA 3KOXA 5C1PA 1SBHA 4U4AA 4XVQA 3FHJA 2LKCA 3KT3A 3OA2A 3O8BA 2CKMA 1HETA 2ZJAA 3GG9A 4QBIA 2WJ3A 4J7UA 4LDQA 4RYLA 3CVJA 1ZKMA 3RC9A 4DKXA 2AE1A 2F3RA 3U09A 1M1XB 2V9CA 1QIHA 3E22B 1AJEA 1SUWA 5GGYA 2KM1A 4KPUA 1W1WA 1VB5A 1SEPA 2IZZA 4ZO9A 2QYOA 1V8PA 3GLFE 4ISCA 3ABIA 3ODGA 4ZC8A 3UXMA 3ADCA 1GGMA 1B7GO 3UB4A 3OC6A 1GCOA 1RJ9B 2WWFA 1T9HA 3G0IA 4TRJA 4RJTA 2PPVA 3IMCA 3WYNA 3UJNA 1W48A 2R6R1 3RIEA 3M4JA 1I9GA 4UXHA 4M7PA 3OMXA 1E92A 4G0PA 4NR0A 4P81A 3ID6C 3FROA 4LV5B 4WK4B 1ABFA 3HPQA 5KO2A 4A36A 1P91A 1Y3DE 5CD1A 5IKPA 4J9VA 4MXDA 1OC2A 2PH7A 2WIKA 4KMMA 3F73A 1T2VA 4TS4A 5KNCA 3IV9A 2BGKA 2LWIA 3FCYA 4Z4EA 4B6RA 2NZWA 2B2CA 2CZQA 1LBHA 1RFLA 4NC9A 1UZNA 5CVEA 4F92B 2ZWMA 3LBFA 4NZOA 2RGEA 5ALJA 3WGQA 5JDCC 1QGUA 5ULLA 4KE6A 3FGOA 3TJMA 4ZFNA 2ZDHA 4C7OB 4HX9A 1EA5A 3KT8A 3PSHA 4BEVA 2IZ0A 3PNKA 3VVMA 1CR4A 2NPOA 5J2TF 2F8LA 2WYWA 2XTZA 1OZ0A 1SXJC 2QU8A 2WF9A 2Z1DA 4N6NA 5I48A 1D4ZA 2QROA 2WHPA 4DGQA 4YMSA 3RI3A 2QI9C 3GRZA 3TRJA 4H1HA 3KV3O 4MKIA 4OBXA 5E6RA 1RADA 3LE8A 3OE5A 3MUOA 2QG9A 4DLUA 5C7IO 3LP6A 1E2HA 3W5UA 3WZLA 4EHAA 4EX6A 4ZVKA 1I0IA 2PS0A 3HMKA 4LGYA 1P1BA 1YRWA 1FDTA 4RD4A 3T0GA 3V7YA 1G21A 4YRLA 1MAAA 1EFVB 3RG2A 2PZLA 3EGDB 1SBCA 2P6UA 2UYGA 3DDNA 1FSFA 1YMUA 4KG7A 4NCNA 5EHNA 1TECE 2HA3A 5FADA 4ZZ2A 3NRJA 5IVDA 3U3XA 2PRIA 3JWHA 1DC3A 3MT7A 2ZIXA 5FTMA 4I9FA 1EBUA 3U81A 3UFBA 1LRKA 1YBHA 2Q1UA 4JA2A 3T7KA 3LKBA 4FE4A 3WGKA 4C3ZA 4ZI3A 2VWQA 4KSYA 3CZAA 4GQBA 4ND7A 4BTLA 3K31A 4Q3KA 4CM4A 1LPNA 1NBEA 2NSDA 2GXUA 2JLAA 4IRUB 2B4AA 5SY4A 1KFEB 2OT3B 2ZJBA 4PNEA 2G06A 3IBCA 3MIZA 4Q3BA 3OHPA 4E70A 2CL0X 4FT2A 3T4EA 1KJNA 4ZO8A 2VF5X 5I4CA 1DRJA 5JSHA 2C2YA 2WI8A 1KTVA 1ONSA 2XDAA 1F2TA 4DBLE 2C61A 4D44A 1JN0A 1TCVA 2IYLD 5LMUB 3RHZA 4OQLA 3AYXB 8ADHA 4OU5A 1N78A 3FHTA 3UWDA 3M1AA 3V3TA 1JFVA 4I4TA 1U1GA 2G9RA 1OYVA 3AY6A 5D5HA 4AXBA 2J45A 4ZVUA 2BKLA 3KU1A 4TROA 2QQ0A 4NABA 2FRDC 1PFKA 3PR2B 3KHSA 3RHFA 4CEIA 2YRFA 5J4LA 3ZHBA 1GPBA 4JLMA 4D9HA 1GDDA 1I36A 3INYA 1T1IA 2RMKA 1T4CA 4OQPA 1SU8A 1DTSA 1L4KA 1TC1A 1JPVA 2Y1XA 2YYAA 3AUFA 2WWIA 3GWGA 1SEVA 1S8OA 2CKDA 3LY8A 5G0WA 1OBFO 2RHTA 1XU4A 1NMZA 3L92A 2BGJA 2WG1A 4TSFA 1IC6A 2RH9B 2BZ0A 3TQFA 3PP8A 1HFEL 2ZITA 1CZHA 3GPIA 3OE4A 5HA5A 3TMAA 4E2XA 1XN4A 5G41A 4F7WA 1NQAO 3FOZA 3EAQA 2GBCA 1AZLA 4ZQIA 1G3IA 2FG7C 4NTZA 4PGMA 1YE5A 3IKLA 1U2TA 1QG0A 3A1VA 3HR7A 4IG9A 1K6XA 5EVCA 5JCOC 1BYUA 1ZVQA 4JJGA 1USIA 3R0XA 1P4SA 1JU4A 1MNQA 2R6HA 4Y2SA 3S2EA 3HK2A 1FZTA 4M88A 4B3RB 1MIHA 1US8A 3F6BX 2DR0A 3FHCB 5E1DA 4BWVA 3F4KA 3P20A 5A3VA 3R76A 1A77A 4IO0A 5ALKA 4L9AA 2AG1A 1XA4A 1YULA 4Q1EA 5CLLA 1XNGA 2AZXA 1H6AA 2VXBA 4C7KA 5B1HA 4F45A 3PX2A 5KWIA 2X2EA 2X40A 5A62A 2VBGA 1Z82A 3JVIA 3ESBA 1XE3A 2ZR9A 3DV0B 1QZXA 1E2GA 4KPFC 3VU0A 3CKKA 3G2QA 4AZTA 5CFOA 2ZCUA 3DEKA 3GLHB 1QU2A 4MDFA 1WKBA 5H0IA 3FKSD 4YJ2F 2JKVA 2PBLA 4G24A 4MR8B 4OI0A 2CFCA 2J08A 5CCXA 5JWOA 3NHKA 3PHCA 5EP2A 2QN1A 1CPYA 2BFMA 1I4OA 2CHEA 1YD7A 2I99A 3GLKA 3HWRA 2YWHA 4MB2A 2BFNA 1QB8A 3UM9A 1XCBA 3IEKA 3G23A 5EZYA 3ZZTA 1Z16A 2E7ZA 1EM6A 2FW1A 1L8OA 5LB4A 4YMHA 2BFOA 4Q3DA 2IHVA 4LYDA 4K46A 5ECWA 4EY8A 2O1WA 4G84A 2K7FA 4IVRA 4ZAWA 3RARA 3WV5A 3HWSA 1YJ8A 4RXUA 2RAFA 4KK3A 1C3VA 1BXRA 1FSZA 4D80A 2PJDA 1Y82A 4BWFB 3IUSA 3DPSA 4L8VA 4LQCA 4TLBA 1BEUB 4WCFA 5DOZA 5SY9A 2PRKA 2Y6UA 4BY9E 1G8AA 5P21A 1H3FA 5DI3A 3UAOA 2O1EA 2R8YA 3C45A 1Y9EA 2V5VA 4MITA 2NSYA 4RIGA 4ZD6A 1OW3B 3BHJA 1W4BA 1XRJA 2H6EA 1H6BA 2X4DA 3SHVA 3VC1A 5TPZA 3JQ7B 4LYAA 1BVYF 2PL5A 1V1RB 1XQ9A 2V7TA 2SKCA 3HNRA 3NH6A 4J4TA 4JBLA 5ALWA 1TVMA 2OP1A 4CCYB 3R8XA 3DHYA 1N2XA 2WWRA 3T9CA 1L5HB 3A6LA 3TSZA 2I2CA 5L3RA 3PNYA 4YJ3F 4RULA 2C7PA 2Q9UA 4IYJA 3ZWPA 3GL9A 1VL2A 1E2LA 2CMHA 3M9XA 3ZW9A 3FWHA 1KMCA 3L40A 2B6NA 4IDEA 4L57A 3ZJYA 3WLSA 4B31A 4J91A 4F12A 1NZJA 1Y6ZA 3LG2A 1LB1B 1OBCA 3FRJA 3ET4A 1MGPA 1TJ5A 3NNDA 3OPYA 1THZA 1K4KA 2ZE6A 3KZVA 4LE0A 4Z8YA 5AKYA 4W5QA 5BV1A 4CGZA 5EIEA 1D2EA 1ZIOA 4X93A 1A4XA 4MRAA 2NM0A 1MO4A 2P9ZA 4X63A 4YFYA 1C1DB 1P1HA 1J0EA 1TO1E 2OCGA 5B3JC 1NM5C 1NIPA 3NJ8A 2BFPA 1W4RA 3FNFA 2J31A 1CDDA 4KQ2A 4HNUA 1OKKD 1HL7A 1XCMA 1Y0BA 2PKWA 3PNBA 2E4ZA 2Z43A 1QCZA 4JLWA 4L8WB 2G04A 3MHTA 3K0FB 4Y0VA 1G0OA 3H3FA 1QKIA 4QZVA 3FBWA 4UXIA 4XM0A 1Z5ZA 3TBFA 3U4IA 1S01A 1QWOA 3K1AA 4DTCA 1JAYA 3EMKA 5JNWA 4I5GA 3I9JA 5JBIA 3PC6A 4DQVA 2BGMA 5EIHA 5LZ4A 1K5PA 4C08A 1JBEA 3CPHA 2ZRLA 4BKQA 4S1WA 3RS2A 1IBRA 3R7BA 3T7SA 3AHCA 3W8NA 3ZWNA 2N42A 1RZRA 2EWMA 3C6BA 3DE6X 3ZNOA 2W6JD 4N82A 2ZVQX 1UC9A 1VKRA 3LWDA 3WQBA 1IOVA 1T0PA 1I0ZA 3N5CA 1HG1A 4Q7MB 3T1NA 3RAFC 5AHRA 4BMVA 3EDQA 1KZ4A 5DTQA 2GDJA 1VLZA 3AU8A 5GONA 2GCOA 3E9RA 2B92A 4PYJA 3GEDA 4E0BA 4ZHQB 5KNBH 4XQ0A 3VR4A 3WK7A 3TSCA 3VGJA 4LVOA 3WGZA 1TEXA 4FYHA 3BAZA 3KLNA 5HCNA 2XYRA 1UPTA 2QR5A 4KUHA 3EVDA 4UPEA 2BFEB 1E61A 2GM5A 3O26A 1F2UB 1RWPA 4PLZA 1ZR2A 4JI8B 3RU7A 1XZPA 4ZQCB 3ZEAA 1T6BY 2PKQP 4IBOA 1LS6A 2WFAA 4IFEA 4C2BA 1Y8QB 1XZMA 4GS5A 1W49A 3C98A 3PKZA 5DFAA 3TDKA 3U0VA 2VIIA 1ZZGA 4TN1A 2FW7A 2GD0A 2GJ4A 1LC3A 4DG5A 4OPMA 2A59A 1GV1A 1HRKA 1Y7HA 4M60A 5T6MA 5C3MA 2H59A 5JJIA 4HZUB 3CRRA 3CUKA 3O4HA 3PDUA 2QT9A 5DYNA 1G8KA 3DKRA 3VPGA 3SYKA 1T2FA 2G0TA 2OP0A 3CF0A 2FAXA 5DO9A 3T5TA 1RKVA 4FOOA 2FWJA 4I9NA 3N2LA 4IV8A 4ND6A 4OJNA 2QTVA 1G3QA 1T3ZA 3TNDA 2X5OA 1BXGA 2A88A 1UBUS 2WJYA 3EIWA 1C0LA 3PT5A 2W00A 4JITA 3ZHUA 4BVBA 1O1YA 1QV9A 2VBCA 2YV3A 3HYTA 3DEHA 4UBKA 3U7EB 1YAHA 2CWWA 1DIHA 3MT0A 3PXCX 4XARA 3UAYA 2AFRA 3THXB 1ZFNA 3AR3A 2PTGA 3BX1A 4GLBA 1E20A 2AMLA 1E2IA 3A6FA 3BGWA 1XTPA 4MZDA 1R0CA 4RDIA 5T4EA 6YASA 3FOEC 1HNWB 3SEFA 3RUCA 3LQ2A 2ZWPA 4JQSA 2OCBA 4OGLA 5CYOA 4A9AA 4ZK2A 2Z6VA 2PEZA 5DASA 1SKQA 3SSNA 2Q3MA 1OAAA 3WDSA 1IEXA 4IVNA 4FLEA 4RF2A 3PLAE 3KYIB 2Q4BA 4DNXA 4YI5A 4IWNA 4BNDA 3E53A 1OT3A 2R5FA 2F64A 1ZXBA 3Q12A 1CQPA 3W3AA 1BTOA 5AXBA 1SKYE 4Z54A 3CYFA 1O0CA 1DQYA 4ILKA 2P67A 2AZMA 5EE0A 1Z0FA 4IOLA 5EWJB 2E4VA 4RGVA 3FLMA 3TXYA 3CUSA 4IIVA 4FYWA 3AETA 4NBVA 2YNMA 3PWKA 1IB6A 4QBKA 1QO9A 1Q1AA 4QJ5A 3UHAA 4C88A 3L5OA 3VDNB 3P0RA 4PQYA 2O14A 1N5KA 2QZ4A 3AR4A 4C4AA 1WXIA 5CDGA 3PPWA 2AEEA 5J23A 3OT4A 2HU7A 2VH2A 1TIPA 3GAFA 1BDIA 2G71A 3E5NA 4NNPA 2IYAA 2NSLA 3U0BA 4BUCA 2HBQA 2PBRA 2I87A 4RJKA 3HU3A 3PGLA 4UBJA 1YZQA 4R5HA 5BSHA 4KQ6A 4MP3A 1JA0A 1L8QA 4LSWA 3UJHA 1L4LA 3NBAA 4UTPA 2QXUA 3VOAA 2BEVA 4Q9IA 4AZWA 2O1SA 2BGIA 1BKYA 1NDUA 1ZGAA 2Q1WA 5G53C 3DL2A 3ONVA 2HXYA 3O0TA 4PPYA 2VJBA 2H0QA 2X0KA 1YOBA 4QHTA 2OBFA 4DWVA 5KNBA 1GVHA 5HKBA 1N4DA 3AYZB 2CNDA 4F72A 4MW4A 3QW2A 4BC1A 1XJ5A 2IH5A 1IDN1 3SF8B 5IJ9A 3PQDA 5KYUA 3IPLA 4KV9A 1UWVA 3KR1A 2IE0A 4BKRA 1PJCA 3T61A 1UFRA 1IY9A 3SY8A 5B6PA 1QVAA 1TZJA 2BTQA 3I30X 4V1CI 1EG7A 3AJDA 1YI1A 2AYZA 2I1VB 3F6YA 3IVMA 1YB4A 1T3SA 4FYPA 2C2HA 4H7IA 1N1MA 3OOJA 3VR3D 1FU7A 4EMBA 1S1MA 1BRMA 1DAFA 2Q3DA 2YWJA 3KU4A 3LCCA 2XLCA 4P3NA 3TOXA 3GLFA 5ESWA 4M0UA 1P72A 2QD4A 2RH4A 2AFIB 4UTRA 3H4MA 2IHTA 2FE1A 3RAEC 1XMQB 4X6LA 5CNMA 1Y5MA 2OO5C 1P2VA 2VQSA 4PAQA 3T9FA 3DEFA 2A4MA 3JD4A 2O2SA 2PTHA 2GRJA 3TZEA 5B3LA 5ALOA 1KSJA 1B2RA 2ZYHA 4QA9A 1KQFA 4TOIA 3UUWA 1V8DA 1GEEA 3K0AA 2XUQA 2A1UA 3KUCA 4KQHA 5LP6F 4L6AA 4A8TA 1V45E 2JFFA 2QPOA 3P7MA 16PKA 5ALTA 3RNOA 3ZU5A 3ZVRA 3E9YA 2QW8A 3FOWA 4PE5B 2XOKD 2DHDA 3KVOA 4PICA 3T38A 4Z0NA 4LFAB 1YZGA 3L02A 3UXEA 3VR5H 5EJ5A 2F8SA 5DH9A 1EP1B 4CLRB 4CEHB 3TZQA 3PVZA 4KWHA 4GDFA 3T3GA 3VKUA 4P7KA 3MG9A 1SVUA 3AO0B 1E0SA 5CLHA 5C1OA 4B3GA 2H2FA 4F6RB 4Y6LA 4EVIA 5JNVA 2YR0A 2QTHA 2QX9A 4PQGA 1UP6A 4BV3A 3LFHA 2NT3A 2OORA 2YZ2A 3BREA 3CBQA 3D8TA 1AK1A 1U7PA 3K5PA 4P83A 1M6WA 4S24A 4CN9A 5H8WA 1PE0A 4QYSA 1G4AE 5M04A 5JNSA 3EULA 4MRNA 1C4WA 1JUDA 5I9BA 3GP3A 3C85A 1OROA 5GIOE 3BXEA 3ZTWA 2Z2ZA 1BXKA 3R24A 1KU0A 4OQDA 1DC4A 4PNZA 3P4UA 1K8YB 4J9UE 4M8SA 1JKJB 4Z9AA 5LDGA 1UBTS 5DT2A 4CGYA 4FHDA 2G9UA 1SPBS 1YRQA 2Q9BA 1Z5NA 1B8PA 3ONEA 4FDAA 4IKPA 3VNSA 5F7ZA 4DSOA 2IYNA 1NKVA 1VL6A 2IV2X 1CV2A 3O38A 2I2FA 2OBBA 2JIMA 2F9FA 2OHOA 3AR5A 1HK7A 3EUWA 4XCQA 4WMLA 4ZVNA 4ZMRA 2DHRA 3EVAA 2R1TA 4R2JA 4WWHA 5F2OA 3F9IA 1NVUQ 2IHKA 2IYXA 4U8HA 5EPUA 3QFRA 3P2IA 4HLQB 4BFCA 3ZNPA 1YA4A 3N2IA 4YCAA 1BMFA 1ONBA 3HR8A 2IQ5A 4BFVA 2P9HA 1LV7A 3B70A 1MH9A 1W5FA 2VLIA 3OLXA 3LH5A 3LSYA 4HUQA 4Y3UA 3D3QA 1KH2A 1S3FA 3R6DA 4TTPA 2GPTA 2XRFA 5A9SA 1JX6A 3PYLA 1TTTA 3IVRA 1U7TA 5I7RA 1D03A 1H1LA 1U5BB 2AXNA 1UPAA 5C5EA 3ZVKA 2BAGA 2GYYA 1P45A 3CH4B 3R9XB 2C03A 1NXXA 1E4EB 3B6IA 3H75A 4IZ6A 4UU8A 3IULA 4JGIA 1M5RA 2P9JA 2ZSHA 3TLKA 2R85A 4RAQA 1AVTA 3HA7A 3DZGA 3LUJA 4Q1AA 3WRXC 1ORHA 1E5TA 4NPAA 1RJFA 1UDBA 4EIWA 4H7EA 2R00C 3NOQA 4HAXA 1XU7A 3H83A 1E4YA 3OZEA 1WCXA 3BHNA 1UJCA 3CKLA 4IJVA 2OHIA 4Q24A 3SU8A 1VSQA 1BX1A 4JCCA 2F9LA 3GLSA 5BSRA 1T6YA 3K9NA 3ANXA 4LXQA 3HV0A 2RJNA 5IBRA 4N54A 4ZARA 1F5SA 1HTWA 1NXSA 5FBQB 3KQTA 1SBNE 2MHCA 4OREX 1VA4A 4GXQA 4HPXB 3HXTA 1F6DA 2R8ZA 1S02A 2NU6A 5JAZA 5EIFA 2R1UA 1VZ3A 5EZYF 3WR5A 3TDNA 3WG9A 1W46A 1QMGA 2XTAA 3B36A 1Z83A 4C7BA 1WPGA 1P6UA 1FUUA 1A2BA 5JECA 5JS6A 4OGGA 1ZGZA 4FM9A 1RC8A 2AWNA 4D4JA 3VMMA 1OVMA 1BE8A 1GTVA 4JT8A 4J0CA 4UUAA 4BMXA 1C8LA 1KSHA 1G2OA 2I8LA 4L73A 4QASA 2FN9A 3FD8A 4EPXA 2VCHA 1I3LA 2XOEA 3F6RA 4RW0A 4M38A 4E31A 1QV6A 3B1YA 4IHAA 4AS1A 1EK2A 5EJ9A 5EUCA 4DMLA 2X5JO 5J3JA 4JL8A 5E1OA 3WZ2A 3E8XA 2H2GA 4BNVA 5BUZA 3C6QA 2L2QA 2QSZA 1EE9A 1FX0B 1WLSA 5DM0A 3D8BA 1CUGA 1O97C 3V2GA 5C37A 2O3SA 1QOZA 4M9SA 1TUEA 1L7MA 2QPTA 3IHKA 1XRPA 3MN1A 3GD7A 2DAPA 1TT7A 3ORRA 3OTHA 3V33A 4O1IA 2I6TA 3C5HA 4MPTA 1XZDA 3C3DA 5GMOA 1E98A 2GTPA 2GLUA 3EPLA 2ATIA 1STOA 3LXXA 4ZYYA 2QM7A 1K4MA 2AG8A 2CB0A 3K0HA 2JHGA 1AM4D 1ABEA 1DXQA 2HLNA 3LFUA 3HKEB 1U9JA 3UPUA 4ZVLA 4P38A 2V74B 4C6TB 1CB7A 4L0QA 4RLSA 4Y67A 4Z9BA 3L8GA 1XXHA 2NLOA 4YJDA 3C14C 3WBBA 2D13A 2DKOA 2RIRA 2B5VA 3KLBA 5BYKA 4BV9A 4DQXA 1JF8A 2ADOA 4OQMA 3JQGA 3IKMB 3NXSA 1ICIA 1Q19A 2H7YA 2QSUA 4JSRA 3VNRA 3E4DA 4N3NA 3ZYCA 2XOXA 1UEJA 1L5KA 3AF2A 2ZWVA 3EEYA 1C0PA 2FFHA 2EEZA 2MSKA 3MXOA 4X5OA 1Q1QA 5AKXA 4BUJA 4GEKA 2H4JA 1HFKA 1JQ5A 2NOAA 2NO6A 3E3NA 4U2EA 4ZYWA 2JBAA 4BGEA 1I80A 5BMOA 2VNJA 4EKNB 1U9IC 1TIBA 3AR9A 4NCIA 1N5OX 1T9GS 2QMYA 4C0SA 1V5GA 2OQRA 5K0NA 3IV6A 3ZW8A 1R9GA 1A7JA 1VPVA 1WCIA 2PL9A 3SQNA 4MLPA 4DKJA 2QI9F 5AJZA 1IWBB 3HV2A 2P7IA 3CH6A 2DPHA 3INNA 1FP6A 1KPIA 2OO5A 4FB4A 1KC1A 3QLUA 3H18A 1E2UA 1U4NA 3N8DA 1A96A 4GOLD 4UHFA 1DUSA 3OC0A 3ICVA 3MELA 3THOA 3H1PA 2FXVA 4TYYA 1XTKA 1EB9A 1RFGE 3FYHA 1NYQA 4F6CA 1R6UA 3DLAA 4QPNA 5FFFA 2ZT5A 5GIPE 4XQCA 5DLYA 1ZPDA 4OQNA 2G9NA 4E07A 2KSQA 3D4NA 3EVCA 1XMSA 3B9QA 3H9BA 3KVNA 4GKVA 4KGDA 4P3OA 4G0XA 2ZRBA 3WLHA 1Q0RA 4M9XA 1OX5A 3HKDA 3SHTA 4DILA 1L4BA 4UTVA 1ADYA 4I66A 3IX7A 2GNPA 1B16A 2B9VA 2Q27A 4RJLA 1C1HA 3A2LA 2PBZA 3F3MA 2I6SA 2OUKA 2VWGA 1L5FA 4BO9A 3HXLA 4L95C 1JHZA 3CNQS 4K6KA 3UJPA 2WAMA 4QATA 1PR6A 3BJMA 2DHCA 2Q5LA 1T5LA 4WDQA 2C9BA 2X3UA 1VHLA 2Q2QA 1I7NA 1PNTA 2F3SA 1VRWA 2OC9A 3GAZA 3QKSA 2YUTA 3T52A 3ND9A 3VI3B 4KPUB 3VKFA 1DARA 1D0VA 2H5JA 5AQ1A 1FBNA 1Q7EA 4KXFB 4CQMA 2WUEA 3NLLA 4AUKA 2B35A 1GZHB 6Q21A 1G3MA 3H8VA 3VR6H 5LCXA 1RJ9A 1QO0D 5EIBD 5DCLA 4YRNA 3NT5A 5CXUA 4K6MA 4BKUA 5IEBA 4IFBA 3CUEF 2UVQA 2X9LA 1DKPA 1WOMA 1O9GA 2OQIA 5FUVA 4EUFA 4ZCIA 1DJMA 1FYWA 1PJRA 4WA7A 3B51X 3LPDA 5F12A 3ME5A 5J47A 5LD2B 3QXSA 4YASA 1A7UA 4BVEA 5SZIA 3KSBC 3BYZA 2Q3CA 1U9IA 1ZXXA 3IKVA 3I2HA 3IHTA 3ZIUA 1V7QA 1Y6RA 4TWAA 1X9GA 3OQOA 2UUPA 5A3SA 4UJ5A 2JRLA 1B14A 2PPLA 4Q1VA 3AIMA 3ZY6A 1EBFA 2HBRA 1RXUA 1V8OA 4KREA 4ERXA 5HZHA 4D5EA 2DBRA 1G41A 2C7GA 3OMLA 1MRZA 1T2AA 4JVLA 1GRVA 1SCAA 5B1EA 4NQZA 7ADHA 3G5AA 1TEVA 4WESA 2P3OA 2CL6X 4M87A 3T3PB 4RGBA 3I0NA 1P7CA 3L77A 2D54A 1YZVA 1L5NA 3D3WB 2FFAA 1BOFA 3OPXA 5REQB 3EWIA 4BO2A 5C8VA 1SZJG 4IP0A 3PG5A 4XUCA 4DV2B 2MYPA 2DX7A 3PPVA 3WLPA 3AEZA 4RF5A 3D8RA 1YZTA 1SQFA 3QOFA 1O0BA 4EQ6B 5HXAA 3BA1A 3HCRA 1ZGBA 1RKQA 2CCKA 5HMLA 4CG3A 1NJ8A 3IAEA 2XMCA 4H7HA 4X45A 1FPQA 3M33A 4QU8A 3MCTA 2DTXA 3A1NA 3IFSA 3PQ4A 4QTTB 5CA0B 2IV7A 4CXMA 4BV2A 2PZMA 5BYBA 5FV4A 1HOXA 1K6MA 3TOZA 4CTOA 2Z6QA 1VE1A 3ESXA 4HYYA 3TLCA 4DARA 1TC2A 1R12A 4JC0A 3BSYA 3R3ZA 1OAOC 1H66A 3CW8X 4JN6B 4RA6B 3F9CA 4R2HA 4WY8A 4C0LA 4BGDA 1LSSA 1PL6A 2X0DA 3SEQA 4A0SA 4C4SA 3ND5A 4FFOA 1DWPA 2J6CA 3LM8A 3KVYA 4I3GA 5I51A 1HE1C 3OU6A 2OFFA 3L0ZA 2O5VA 3PJEA 1W4ZA 3B12A 2XUDA 4KDEA 4TXJA 4RYDA 2PRSA 4YUVA 1AOXA 2JJ2D 3AKEA 4CF6A 1M8GA 3DAFA 4EFLA 4U6NA 1R5OA 3L8YA 4IF6A 2G83A 1OBOA 2IUFA 4NYIQ 3WL3A 1TQ8A 4II7A 4MUYA 4MV3A 3RHTA 5CBPB 5LMCA 3GXBA 2G09A 2ENWA 3PXBA 2XE6A 1NMEA 3NJRA 4AF6A 4EPVA 2WFLA 2AA3A 3ZHTA 4ZCRA 1VYVA 3VOTA 1HDCA 2ZYSA 1AGXA 1NQ5A 1HT2E 2QK4A 3PZRA 3P9KA 1UC4B 3ZY2A 3QE9Y 1T4GA 5AVVA 3CVUA 2X9NA 2JLSA 3N76A 4JYAB 2GD1O 4F21A 4NFYA 1CRLA 4BUZA 3UXHA 2KPOA 3V8NA 4XWOA 5KNLA 2VP5A 3R41A 4GSYA 1Q77A 2HJRA 3ITKA 3QWFA 4B76A 4TM8A 4YUYA 3VR0A 4MW7A 5BSWA 5JBQA 2AI2A 4JJEA 3H5TA 2GZDA 5IH7A 4KAAA 4DY6A 1VHTA 1LNQA 5AI8A 1V5WA 2NUAB 2JVKA 2V03A 2YJTD 2NTJA 3I5UA 2HPVA 1NVVQ 2P9FA 2VRNA 4G4IA 4HFJA 1G98A 4BLRA 4YJ3A 2QVLA 5TPZD 4RZIA 1CTQA 3GCXA 4COKA 4EUNA 2CBXA 2EWWA 1EDBA 1E7RA 2G1JA 4JJ8A 4M89A 2WJPA 4CIBA 2E2WA 3CUUA 2N47A 2WE7A 4JLVA 3IAS1 4H6VA 2ORVA 2VJAA 1MO2A 1U8ZA 2H54A 2VP4A 2P5SA 4LRSB 4PRZA 1XNHA 4U7PB 1N9ZA 4OAOA 3VVBA 1Y5RA 1RRMA 2CEAA 2B4QA 4TV8B 3EZ7A 4G41A 4B5KA 4MWOA 3F3KA 2VYND 1I6KA 4RLQA 3A4LA 4UPVA 1ODTC 1US8B 3DC7A 1OLUA 5CW1A 1ZWKA 4Y6PA 2H65A 2FPSA 1VSTA 2JBWA 3GAAA 4RKRA 1WB6A 2C5LA 4YDSA 2D00A 4QPZA 1E3QA 2DUJA 2QN9A 4L50A 1WUIS 5IT4A 1SA0B 1ZD2P 4O1HA 1YDHA 1JKFA 1Y81A 2NQ8A 3TR5A 4D6PA 3I72A 4EPTA 2EIHA 5EHQA 4C21A 1I3MA 3L1VA 3MWEB 4PSUA 4QVIA 3A0UA 2WRZA 4NCAA 4K9RA 4AJEA 1VHQA 2ANCA 3UB3A 3VPHA 2O3RA 3DCNA 4L08A 4XYEA 5BXQC 4MUXA 3PHLA 4TRNA 3JX9A 3ONDA 1J90A 2O8BA 4D4HA 4EHBA 4YP7A 2IDZA 3VZPA 5KYGA 3F7MA 5A06A 2Q7OE 2QD3A 2BMAA 3B6JA 1UBRS 4PCVA 3G02A 3IQFA 4M21A 2AG6A 3CVVA 2IX3A 3KT0A 3GCDA 3N2KA 5C35A 2HIMA 2GN4A 3OEWA 3X2SA 4X85A 1GTJ1 3N39C 1T13A 3RASA 2ZWIA 4XYBA 1TTQB 4UMEA 2LCQA 3D8UA 3E27A 3V48A 4CI0B 3UW3A 4FCCA 2Z0MA 4YR7A 4OK3A 5ADWA 1LF5A 1Z7YA 2JGAA 5JD3A 3RYFA 4EL5A 2PL1A 1GZ5A 4TMTA 1YR2A 2WM8A 2FEAA 4E5YA 4KHZA 4LPKA 5IDXA 1M34B 3KSMA 2JHFA 4DIKA 2G08A 2IP1A 5FTWA 4RVSA 2HHAA 2WD9A 4WCFB 4KOEC 4R2XA 4OLFA 4K88A 2GXSA 4V0KA 1BGVA 4ZOLB 2EIXA 5EFZA 2D3TA 2GF9A 4EGFA 3A05A 4EHNA 7AT1A 1JWBB 1TUGA 3AVXA 2DLNA 5BSKA 1IB0A 4XVCA 4QGGA 4JP3A 1CZLA 2YWXA 3CPJB 4ZAVA 1V3UA 2J4DA 1CUVA 2VEOA 4LYEA 4K1XA 2ZYAA 5C7LO 1H1TA 4I8IA 3NHLA 4FGKA 1GRCA 3NCHA 2QTRA 1AC5A 1NBOA 1D2GA 4NYJQ 3O3CA 1MPXA 1EP2B 5LC1A 3SFTA 1XEAA 3LT1A 1T5TA 2PQ0A 1V3VA 4XJSA 4YRJA 3SJUA 3HYLA 3QWIA 3UG7A 2EKBA 3L6UA 1L5SA 4W7IA 4CCYA 2QAJA 1PNRA 4L4YA 1RTTA 3GP8A 2BKXA 2EXXA 1V5FA 2RGNC 5DLPA 1K8RA 3W9BA 1KWKA 3WLKX 4FMDF 4KYUA 3OAAA 4R9SA 5EZSA 1OFHA 4KQ1A 1QRRA 4ZTBA 1I2ZA 4UE2A 3SZMA 5AVKA 2FQXA 3L0CA 2CLMB 1VJGA 2PDAA 3FRHA 2HHJA 3W6UA 1Z3IX 3WLEA 3E03A 4X20A 4YXFA 4LY9A 1G1AA 1ANKA 4FGWA 4Z9FA 2QUIA 2G0AA 2HJWA 4JSYA 5FAKA 2XKKA 5IAOA 2P6PA 2X7HA 2PZBA 2XZDA 4GQAA 4Q3LA 4TKVA 1VHDA 4INJA 1GGVA 3KKQA 4B4VA 3CLKA 1F3OA 4ALNA 1SVMA 2PYZA 3N53A 3EY9A 1HE4A 2I4OA 2VOEA 3F9RA 5FX2A 1DQZA 2BY4A 4NCKA 3Q5GA 3WHLA 1K98A 2E4WA 3K0FA 2ZUVA 1BH6A 1IBCA 5GZ6A 1CDEA 1QGOA 2G5TA 1MB3A 1SIUA 4QFMA 2B1RA 4I1OA 2BM9A 4UBIA 1EWVA 2Q3HA 1O97D 1OXSC 1XZKA 3EXHA 3GT3A 1J21A 1EXWA 4P58A 3W3AD 2VT7A 1P2GA 3D6TB 1TT5B 3FNEA 1O03A 2WLTA 4HNHA 4QFCA 3BWYA 4DJ5X 2EBHX 3G2JA 4U0JA 2BD0A 1YZFA 1VM6A 3LDUA 1AQUA 1MA0A 2NPFA 1D6MA 1ZD9A 4RZHA 4ZGGA 3O6VA 1N25A 4G9EA 4GH5A 4KQ9A 2TS1A 1F4VA 2FFBA 4AMBA 5HTOA 2DKFA 2FZKA 5EC8A 5JSFA 5A4AA 1U2QA 1WEKA 3RQSA 4AZVA 2RHJA 2WYUA 5K3BA 4F2DA 3KR0A 2N3ZA 2NAFA 1SHUX 4B7ZA 1PJSA 4KTVE 1KRWA 1TQ2A 2VK2A 5ALGA 1HYQA 2BLNA 2EP8A 4BFLA 2WJWA 2IPAB 3N07A 2QRZA 5DKFA 4DZZA 3WGNA 2PSFA 2ISQA 4Z51A 4ER5A 4N7JA 1BEEA 1YOVB 3MJHA 3PD1A 4V0LA 1RW4A 3UOGA 5KTTA 1QRUA 2XGSA 4A2QA 3F2IA 3M6IA 2FR8A 2KYRA 3AP3A 1JR4A 1FU8A 4EY5A 4G5FA 4Y2QA 1YJXA 3PQ5A 5JD5A 3MOSA 1XBTA 1BAPA 3NDPA 1F60A 5IJXA 2WWGA 4ZZ1A 4YCBA 3EK2A 4X95A 3GJ7A 2VL7A 3GW8A 3ZJVA 4OXXA 1QKJA 2OBNA 2W93A 2X23A 2YQ5A 3IAXA 2AZDA 1GPYA 1O5IA 1UBJS 1XD8A 2F1OA 2D59A 1FYXA 3DCJA 3RSLA 1TVKB 3JYLA 1J22A 4UHDA 4DMCA 4GR5A 5J2TA 2GA9A 1E3WB 2KLHA 1NYRA 1OOEA 3CZ4A 1POXA 4W5HA 2OAEA 4WN9A 1BMTA 3MF4A 5C5IA 1CE8B 1WUKS 3L7BA 4LZOA 3B78A 1VL0A 4RMIA 1KZHA 1JHAA 1CUBA 1Z0KA 3E9CA 3HVJA 1HYEA 2NYRA 5AJYA 3OIDA 3TINA 1OH7A 4DV5B 3SF0A 2HPZA 4G5SA 1FNSA 4ESEA 2RG1A 2YWEA 3EGXB 3WIUA 1SQSA 3QEBZ 3F49S 2R2AA 1RRFA 5T4FA 4CEJA 1KFCB 2B78A 1SZDA 1FP4A 1B42A 2VDQB 1HDEA 2VS1A 2PU7A 4M9CA 2JAWA 3C6XA 3PRYA 4BQNA 4EELA 3QFFA 4DCJA 3F8WA 3TVYA 1KJJA 1XA3A 5E4YA 3OEED 4YHHB 3WLRA 3H17A 3JAKB 3QJ5A 3A6JA 3W2HA 1CSEE 3EY4A 1JFTA 3PQ6A 2JJYA 3GRRA 4BNDB 5I4KA 3K32A 1GPH1 5DNCA 1DJOA 4MHSA 4EUEA 4R2MA 2JFGA 4YPVA 1QU3A 2ILTA 1RLJA 3B48A 2HW8A 5EHXA 4EJFA 3PC2A 4AZ3B 1ZINA 2IUEA 3SVTA 1KYXA 3UT6A 2AKEA 3U7IA 4PO9A 3AETB 3ABOB 4X7BA 3C3EA 3NANA 1OH8A 1PR2A 2HGSA 1FYVA 2R9VA 3VXKA 3ONWA 2BI4A 3NEAA 1R0WA 3I01M 3PHBE 4ME6A 4H6XA 1X7XA 3L7KA 1QRTA 5CP8A 2V65A 3BFKA 1KY5A 1W73A 4PHHA 2EP7A 1ZK0A 4QEZA 4E5VA 3P9CA 1AKVA 1QTRA 3C5VA 1QIJA 4UNQA 1PYOA 1KXZA 2FW6A 2BYTA 1NNEA 2HA0A 3G2HA 4J0IA 4ZOCA 1DQPA 2I34A 3NDBB 1D09A 3R5JA 4NONA 1W4CA 3DW1X 4Y2YA 2WP8J 4JBGA 1N2BA 2BBWA 3AM3A 3IOYA 3HSKA 3LUAA 1G8JA 5JR3A 4BE9A 5KYWB 4MGKR 2EFEB 1YUMA 2M32A 3IUQA 1NQWA 2XWJI 3DQZA 3NG1A 4MEBA 3T1OA 4IIGA 3WB1A 3TWOA 1JR6A 1VLJA 1RE0A 3HDQA 2YMMA 4FHGA 4BWYA 2M6SA 1JTVA 2YWGA 2YFQA 2CD7A 2F1IA 1KO1A 4ZVTA 4BQRA 3CPEA 3GZNA 1JWAB 3ORYA 3PDJA 1IHYA 5J63A 4JBWA 4P1ZA 1A98A 1CX9B 2R1VA 3AEYA 1W4AA 5EL0A 2OBMA 2Y66A 5IC5A 4Q66C 2FZGA 3BB3A 4FE7A 4JFRA 7YASA 3T7EA 3QWHA 3VDQA 4G5HA 4G63A 2JDIA 3GJYA 1VLQA 3O8OA 1K86A 3PGKA 4N0QA 4MVYA 3S8EA 2YMLA 3ESDA 3TLGB 3MLEA 3B1VA 3GVPA 3TECE 1V7PC 4Z3KA 3GPBA 4AIIA 3NR2A 5BT9A 3SMQA 4OKSA 3KQKA 3RUDA 2XTNA 1VJTA 1B41A 3A14A 3BCSA 4XIYA 3QXJA 4QGFA 2IXTA 4V0NA 3ZE2B 4Z53A 2YYYA 2H4XA 1NP7A 2YJ4A 5AKGA 3KJZA 2ACKA 1EFCA 2DFNA 2ZPTX 4KVGA 3LTEA 4FR0A 1PLLA 1GPMA 4JJIA 3NBUA 3SK0A 4CU5A 4CMJA 4EK9A 3K70D 3D5EA 5THKA 2XAAA 3GUUA 1G5QA 4CU2A 2WF7A 1HSZA 5EP3A 1L7BA 1X1EA 3JASA 4DY4A 4NI5A 5IUNC 2FHPA 2V7UA 1GCIA 2M1ZA 2Q4EA 3ZV6A 4QUEA 1HORA 1U3UA 2I2XB 4ENUA 3LUFA 1NPDA 1NTOA 2WMDA 1HPLA 3E23A 2VUUA 1T8TA 3B6KA 2Q6VA 4O4HA 3SM9A 4BX0A 1L7NA 1B0PA 2V6BA 4MKXA 1NHWA 3P96A 5AVQA 3K6SA 3ONFA 1E0DA 1ZX1A 2NTVA 2OMKA 3NC0C 3G5MA 5AI6A 3WX0A 4IRXA 2IZ6A 4TKLA 3VO9A 3V7FA 1O54A 2R7NA 5DBGA 1UK9A 1HFJA 1Z68A 1NUAA 5CJ2A 5HNKA 3DV9A 5DI9A 3VNVA 1Z5PA 2W7TA 2OENG 2P79A 4L72A 1LQUA 1A1SA 1XTRA 2BFDB 4UFNA 5HFNA 2A58A 1ZM9A 4K2AA 3Q8MA 1ZAYA 1G55A 4GVPA 4URZR 5TEVA 4B7UA 1GFWA 3QK7A 1UPUA 5L4LA 3ZPXA 1X7ZB 2PMWB 2R00A 2GARA 1PQPA 1M72A 2EQAA 3E7XA 5C4GB 3ZHXA 3LNCA 1WKVA 2PR2A 3NBZC 2D2IA 3RANA 1HQDA 2UAGA 4LYGA 4Q4HA 1I9CA 2DBZA 5AW9A 4LK2A 2AVNA 1IXYA 4FZ3A 1Y8RA 3B13B 3KDAA 3SCZA 3PVCA 5ALVA 2YIVX 3HA5A 5JSUA 4ZEOA 3SFVA 2J3QA 1CZRA 1FC0A 5T3UA 3AFMA 4AQ7A 2ZU0C 3FTQA 2IUUA 5CH3A 3D02A 4EI9A 4PX2A 1XZQA 1H1LB 1F0YA 1U5BA 4DNPA 3DD5A 4YYEA 2QX8A 2GF0A 2XGGA 4OJYA 4RMGA 3VR2A 5AVJA 3PRKE 4R40A 3WLJA 5JZOA 2VH1A 5EMHA 1YQQA 4G6ZA 1Q2UA 2O5RA 4GKBA 1RMQA 1T1GA 1XZBA 3KBOA 1SKMA 4Q4JA 4QULA 5HG0A 2IGTA 3KQNA 1T4DA 1DCTA 3TTUA 5D51S 1TIKA 4MJLA 1X15A 3A4TA 1FB5A 3LS2A 5BW4A 3BGVA 1W9MA 3EDYA 3OCUA 5ESRA 2EBWA 3CB4A 3DAGA 3JAWB 1KO4A 2YW9A 3EFBA 1PQYA 4Q37A 4R2WA 3CCFA 3ENWA 4R9VA 4TKZA 5D8DA 1RAEA 2I3DA 2JI7A 3KVRA 3W8EA 2H0RA 3WK9A 4PRYA 4AAYA 1CZNA 1SUSA 4HS9A 3PENA 3F6PA 4XASA 1WTCA 4HXEB 1VIDA 3AXTA 1HA3A 1KMNA 1O87A 1P7ZA 1QHGA 2RKBA 3HC7A 2JKYA 1YZUA 2NXJA 3GRKA 4HNAA 4IIUA 2OYRA 3CINA 1Q3TA 1Q0PA 2FF7A 1P0CA 1QIKA 2AD1A 4J3NA 2JH3A 5FLEX 2E4XA 4ZAYA 2ZIEA 2Z09A 3UHOA 1II0A 4KDFA 1JSCA 3EGWA 2D4AA 2AXPA 2HLHA 5ALXA 1T26A 3ZR4B 4EGSA 5JO0A 3WA7A 1Y1SA 2HB6A 2QVXX 1M2WA 1T9ZA 3MGGA 1KBOA 1ZJJA 3HACA 1V2GA 3OZBA 4NFLA 2NVUB 3T35A 5ADUS 3LP5A 1EWYA 4I19A 2UYHA 5FPQA 2JFPA 2PKRA 4EY7A 1Q2XA 5BW6B 3OPYI 4CDGA 1BVRA 2IOQA 3RBAA 2DQSA 3F4BA 3HFGA 1T8SA 3BORA 3A1SA 1VKOA 4YAFA 5B1DA 2ZYDA 1L9XA 1PGQA 2W8ZA 4IDBA 4DNQA 4K9DA 3L3BA 4JBHA 3O5AA 2H7XA 3PQFA 1EEHA 1IL0A 1Y7PA 1JDJA 1THMA 4ND1A 1GV0A 1QZZA 4KXXA 1XGKA 2WQ7A 2BRUA 2B4TO 3BSSA 2W4MA 2Q1XA 3K7EA 3AIOA 3BXOA 2Q6KA 4ZV7A 4F2PA 1SMKA 2YOHA 3Q5DA 4FWBA 3OLQA 4YAEA 5IN4A 3EIEA 2Z8XA 3LOPA 2VP2A 2V8BA 2X0RA 1BXZA 3ZW7A 2C5BA 3ADOA 4JB2A 1GZVA 1M9NA 1DX4A 1ZO8A 1DTWA 5EEHA 2HA7A 4MIOA 1TPYA 2Y1WA 3R3HA 1HYBA 3VSAA 1GFSA 4ED9A 2NU8B 1Z06A 2ZBUA 3FYDA 4QSHA 4D25A 4CKEA 3PS9A 2ZFUA 1UMCB 3AY3A 3H87A 1TD1A 1IPFA 1W0JA 3FNQA 3FPBA 3HI6A 2NXEA 4B45A 4QPDA 3MTDA 4F5ZA 1QP4A 4UUNA 5JZVA 5K4AA 3T5DA 3X43A 2HT1A 2Y0BA 1Q0ZA 3G8BA 1N5IA 3TB6A 4ZO6A 2PZ8A 4OBEA 1MIOB 3RJTA 1AUXA 1B00A 5KEIA 2VQEB 1KZYC 2UXBB 2WHRA 1HLFA 1U0JA 4XSHA 4Z9YA 2ZSAA 4XWYA 3AHJA 2XUZA 1DXYA 4I2NA 3RSQA 3KQOA 5F77A 1TM7E 1COWD 2ZR0A 5HKLA 4RHTA 5C8ZA 5JHHB 4Z1MD 2AJBA 1S89A 5NLLA 1QP7A 4UU7A 5T7BA 3X1DA 1JDSA 2WJHA 4YLEA 2OXEA 5JY6A 3W5BA 1W47A 1NBWB 5DVZA 1QH1A 4TTSA 4HDCA 3KSUA 2HYIC 3HEBA 3ZJTA 1UQRA 2WR8A 1DSSG 3R3XA 4WVFA 4UM9B 3M4ZA 1ZD4A 3DBLA 2UYOA 2FV8A 1T0UA 3GBPA 3R20A 2VYCA 4NVRA 4D97A 5CCDA 2NN3C 4RHXA 3EXFB 3L18A 5F52A 4DA7A 4IKOA 4QRHA 2EQ5A 2C4WA 4ZEVA 2KMLA 2SKEA 1YRBA 3AWIA 2PWPA 2CXOA 1GN9A 5THQA 4BNYA 3E7PA 3A1EA 1Z62A 5KYXA 2C9DA 2P3SA 5EZ6B 1EH5A 4HWKA 2ZBQA 3TE6A 1T9KA 4MUFA 3QELA 2J0QA 4KSCA 1E6CA 2F2TA 1Z2DA 1U2RA 4X3PA 1L7OA 5L7TA 4XB6B 3HJRA 1C0IA 2QZ9A 3N8HA 4X1IB 1FSPA 1PIWA 4DE5A 5EJ7A 4JR2A 3VU1A 1OFUA 4ZQBA 4WXPA 4C4XA 2VPIA 3WMXA 1R15A 5D5PA 1YFKA 2CMGA 2C29D 1NI4B 3M5CA 3HKBB 3DZ8A 1R9JA 4W82A 1Q3KA 3S99A 2G9QA 1GT6A 2G77B 4BX8A 2R7LA 2PUHA 3GHHA 2WTXA 1TW2A 1POWA 2GWHA 4MYRA 2RGAA 3O73A 4HXGA 4N65A 3R9IA 5KVCA 1W1IA 2QRGA 2A9RA 2CDNA 2QM8A 5ED0A 4KRFA 4A4DA 3ZDEA 1OFGA 1P9NA 1VJCA 5BXYA 1KEEA 4MARA 3DF9A 4GL2A 3D6JA 2GZRA 1I4WA 2D0PB 3EBOA 3M5DA 4KGZA 1KHTA 2V7PA 1THTA 1J49A 1P18A 3DMDA 3HEAA 3PLNA 2R5NA 4RPGA 2COKA 2H07A 4LG1A 1E9VA 5DXFA 1H2AS 4JR1A 1KGSA 1H8EA 2J6HA 2VP9A 4YRBA 3KOMA 3MGCA 3OJ0A 4IILA 2HAEA 4FFLA 1TYCA 5FJIA 4DWJA 5JXJA 3O2JA 2P77A 1HSOA 3EFOB 2E3JA 4NZPA 1MPTA 3NIDB 1M67A 4B8ZA 2IGBA 2FN8A 1T1EA 1ZNWA 2FA9A 4ARVA 4DYHA 1X1DA 2YMPA 3VU9A 4EKDA 4Y2VA 1G291 2WAXA 2Q2VA 1CY7A 3TLEA 5KOHA 5LIPA 3K15A 2NIPA 3LF2A 2H8GA 3A3KA 3CLSC 4NOMA 4OMUA 3BL5A 1WPQA 1TK2A 5D00A 5ALMA 4IIXA 5IZCC 3S29A 1DKMA 1KI6B 4N40A 2WZBA 4JT4A 2J7PA 5C32A 1J4AA 1PP4A 2BE7A 2IDKA 3OTIA 5JI3E 1GM5A 2VDWA 4EJSB 2OV1A 3IR6A 3SSMA 4U9HS 4D4IA 2W43A 4BX2A 1G5RA 2GPNA 4RSHA 1GD1O 3UMBA 2N1MA 3WJ7A 4JROA 1L5OA 3DEZA 3GVIA 4M86A 4CZ2A 3T1TA 4EKIA 2AFHB 3M89A 3KYCB 1UXKA 2Z30A 4I0WB 1AKYA 4J2OA 1AN0A 4KQWA 3RDPA 5IKEA 1KQ3A 1YUBA 1J1ZA 5B2ZA 3ICPA 1RXCA 2I2DA 3KPJA 4HEQA 4DCCA 2JIRA 3RIGA 4ZZ0A 3HDYA 4DS3A 3NEJA 4F60A 4QGSA 2VRBA 4GMGA 3V55A 5IULC 4FSDA 2CLCX 2RC5A 1Y6JA 5FI5A 1XAIA 3IP7A 3MFQA 4GOMD 3TKLA 3U31A 4TVOA 1RWWA 1NFRA 1D1QA 4KCGA 1Q7TA 1MEOA 3HCPA 2BEWA 2P4QA 4UAVA 5FPYA 2FZWA 1Q0HA 4OI1A 1SKYB 3CF2A 4Y2HA 3PLRA 4MLZA 4P31A 3EZGA 4M4SA 1O8BA 3KWMA 4NZZA 4YP1A 3ASVA 1HXHA 1XHFA 2ZYIA 4IIBA 3C7DB 4W8OA 4DM4A 3KFVA 4FC7A 4LOKA 2B83A 4R8LA 3X1ZA 2D7DA 2LDXA 5AJHA 3LA6A 4MI6A 2Q07A 1I7DA 1GAEO 1NLYA 1H0HA 2PFGA 4A3SA 4B35A 2FPPA 3PQ2A 2FOIA 3I2YX 4NATA 3DZDA 4NFHA 1J9ZA 3L7CA 2PMBA 3S5JA 4CFZA 2FGJA 4YQEA 1FMCA 5HE8A 3THRA 3ZU2A 4V1CA 1NX9A 1KI9A 2OV8A 2XKAA 3QX8A 5IKXA 5TC4A 1HRDA 3GA7A 1V2HE 1NWCA 3JTEA 3U6KA 5KJ6A 1TB4A 3H1FA 3A37A 3AJ8A 5EMMA 4D41A 4ZT7A 2W98A 4KLNA 4YJ3B 5LR6A 1QIGA 1QANA 1ZI9A 3TDMA 2AC4A 3F46A 3K8YA 2YQ4A 3H1TA 3CEHA 4GZ6A 3ZHOA 4BGVA 4RUKA 3ELBA 5AESA 1G38A 2WPDD 3HXPA 4F3RA 1VFPA 1Z75A 2N1BA 2C1ZA 2XZPA 1OI7A 2FK8A 5EE9A 4O8ZA 3T15A 3UMVA 3IV7A 1B76A 1G7CA 5TF0A 4YBZA 3V2IA 2AFHE 2GBGA 3DW3X 2JC3A 1WZNA 3KQWA 3KTFA 5BW8A 4CWAA 2X2PA 3O8NA 4H27A 5LBUA 1U65A 2GYVA 3LRXA 5CYFA 4F84A 4ARIA 3LGSA 3N8KA 2HSDA 2WWYA 3GK3A 1Y4DE 4KR9A 4DQKA 1ZONA 3ZUPA 3W6PA 4X7RA 5DM4A 1P4JA 2FN4A 2NSHA 2WFMA 1X8KA 1M8KA 4QLAA 1SA0A 3IEUA 2I7XA 1QYRA 2UZ0A 2QGZA 3EH2A 1V11B 4GI2A 2OE2A 1VKJA 3LUKA 4I1YA 4QFDA 2FCAA 5G3YA 3RAGA 4DCOA 4ZAFA 2ZK7A 3O94A 3AQIA 4Z3DA 4C6RA 1VLMA 2BFWA 1IM8A 4UTOA 3WNCA 3B85A 1VIAA 4DJDC 4IS3A 1UBMS 2AQIA 5F7OA 3FTCA 1N9KA 3DOIA 3E81A 3TQHA 4PG8A 2O8BB 4KPYA 1Y98A 1VLVA 5C4IA 1N2CA 4RC9A 3V80A 2Y1CA 4IWYA 2C7QA 3CXRA 4JKOA 4EAQA 3OCYA 2BMDA 1EKXA 3QTTA 2FETA 4X64B 4DG8A 1IN5A 5JBNA 4TMXA 3NEPX 5D5QA 4UZEA 3I6MA 3RQIA 5DRYA 1E0AA 2FOLA 3FMOB 3ILXA 5KDDA 1Z5OA 4L9WA 1QK5A 5AI9A 2IPNA 3FGZA 3HDHA 3T0IA 3RC7A 3K70B 4DGSA 4F5WA 1PZFA 2VHYA 2IYOA 3F8SA 1N0VC 3NQ41 1JEOA 3JQBA 2ALJA 1LDGA 1N6HA 2A92A 4WZAA 2C78A 2D5AA 4CIWA 1PW7A 1SBTA 5LYYA 2D06A 1B0AA 4RIEA 3RRMA 4JNKA 3FW1A 4ZOLA 2OZLA 1GNTA 4WZBA 4HVAA 2OAGA 1C3JA 1FP2A 3IILA 3DO8A 2X6TA 1J8QA 5AW4A 4YXWD 4ZI5A 2VF8A 4Y2GA 4GLLA 5DW0A 4Q00A 3WHPA 1X0VA 3E15A 4IGIA 4N12A 4RY2A 4HFRA 1FQOA 1HO3A 3EFHA 5AIBA 1WBBA 1GGNA 4EUSA 2WEKA 4D96A 2D7CA 3PHGA 3W2TA 1BFUA 1NI3A 4LJ8A 2C20A 3FUCA 3OFND 2VJDA 1U1IA 3G8DA 3QVVA 4R1UA 4ZOBA 4E2FA 2PUAA 1SXPA 2CV1A 2Z2IA 1BN7A 3WKCA 3PYXA 3AHGA 2YHBA 2WYHA 1RKBA 1BD4A 1QFSA 3ZV5A 3MAAC 4EDHA 4GM1A 3SS9X 1XCOA 1K2WA 5CA1B 3DHWC 1LPOA 2QRVB 5FUBA 2NXWA 1R6TA 2NNWB 1T2NA 4N1AA 5FPSA 1WHSA 3WLQA 1OF1A 2WDZA 4FW9A 4KYTA 4TTAA 3SEAA 1JEEA 3T3HA 4LJLA 1VKZA 1CY6A 3PBKA 4II3A 5LLSA 3VDMA 2PS3A 1DLIA 4A0GA 2ERCA 4OHCA 3EB9A 2GVDC 2ZCVA 2ZJ1A 4MW9A 1A27A 1GU1A 1BIFA 3SDSA 1P1FA 5AI4A 3EVBA 2J4FA 4ZVRA 3CEJA 1IY0A 1NLUA 3OJFA 5JQGB 3NC1C 2Q0SA 1W5AA 1U7OA 5AM1A 3GCWA 4DCPA 1E2JA 2P41A 1GR1A 1CP2A 3EZ2A 4MRRA 3ETDA 5FCDA 3U7QA 3ZDBA 1YK1A 1XVVA 2EZ4A 3ICOA 1HDZA 5K0TA 2VTVA 2V1UA 2ZBDA 3GAMA 3OOHA 4B33A 4LVNA 2PUFA 1FW6A 1XZHA 4QDJA 4BFZA 1K66A 4U2KA 3ZV7A 1NXVA 3K8ZA 5HUQA 1IY2A 2ZRQA 1SB8A 5HQJA 3V4VB 2Q62A 3VR3A 1WDTA 4JX9A 1Y7LA 3ZC3A 5I4IA 3OO0A 3RV3A 4GZLA 4MW0A 5CFRA 2P78A 5F1PA 3EXHB 3FY4A 4JT9A 4MRSA 2CLIB 3BN3A 3IUPA 3EG9B 4JY7A 4WCVA 3PA8A 5FTNA 3ER8A 3HBFA 4JUBA 1FK8A 3KRTA 4K9LA 1AZTA 3TJRA 3G2OA 2O8CB 3IAS6 1RYYA 4RH3A 2YKGA 2Y76A 3EH1A 1N5LA 5BMVB 2CDBA 1WQ3A 4OI4A 5E8RA 4D5GA 1UDWA 2VQFB 1PDOA 2XHZA 4X0EA 5SZHB 1ZSVA 5TMEA 2G80A 2D1FA 5JYCA 4RF4A 1EG2A 1W2GA 3MMPA 1Q74A 1M8FA 3M81A 4L7QA 3KFXA 4BXOB 2EL9A 4TLEA 3ZQ4A 1WG8A 3ZXSA 4B74A 5CGZA 4B0OA 1CZKA 1A4IA 3B3QA 1H8HD 3IPAA 3R6WA 3ET5A 4YA6A 2WUGA 4FT4A 4YBRA 5FPTA 4C7XA 1O9HA 2WSYB 3ZWVA 3B1FA 7MHTA 3KZOA 3V4PB 1Q0SA 4HGZA 4IY1A 4ENQA 1BE6A 1F48A 2C5EA 2G1KA 3MWLA 2BM1A 2SBTA 4DCUA 4NFSA 4QVKA 5CITA 2I3GA 4KC0A 3MA0A 2QP3A 3F6SA 4XX0A 2EOAA 5K03A 3EF3A 1GUAA 3PEYA 1MAVA 5AW5A 3VZDA 1QXSA 4BWGA 3EOBI 2BV3A 2AC7A 4ZQFA 5CDUA 3AFOA 3OLCX 1CP3A 2ZETA 3CNBA 4H7JA 1GTL1 2NSJA 4YRCA 4BQIA 3WAJA 3UJ8A 1TCUA 4N5NA 1E1YA 1Z34A 3A6GA 2C8LA 2QQEA 2ZW9A 1DOHA 4BAGA 1OB5A 3AESA 5A2GA 3IP8A 3CM0A 1M1ZA 2IIPA 4RWEA 3JQFC 4D8UA 5A6VA 3EQ8A 3AR6A 3QJGA 2ZIZA 5B6IA 2OSVA 4GPBA 4AJNA 3HL4A 4Z3OA 4DEYA 3KSRA 1T3HA 3RYIB 4K81B 1L7VC 1YI8A 4BNXA 4CQJA 4XPIB 2BP7A 5SICE 5A4FS 1QHSA 2ZREA 3BA6A 2C57A 5DX8A 3T9EA 5LP1A 2YZ7A 3S2UA 1MX9A 3NW9A 1RKXA 1KJYA 2QSYA 1WHTB 3LY7A 3P26A 4FFVA 2JA2A 4W4TA 5A0VA 2FLWA 2GCIA 4MPRA 2VPTA 2C9ZA 3U7HB 3PC7A 1FS5A 3IIKA 4X54A 3AB7A 1CERA 5D7NA 1P1RA 1P39A 2EX1A 5KUTA 2FN3A 3CEMA 5E4FA 5LMNB 1ISPA 3LT5A 4OJTA 4B75A 3BJRA 1VG0B 3EQ6A 5AVXA 1WMFA 3U19A 2WD7B 3ZYZA 1O4WA 2YASA 3RBXA 4BEWA 1T10A 3EPPA 1P77A 4TV9A 4PZUA 2HU2A 5F2NA 4FMCF 1JS1X 3Q5EA 2W0SA 4KFRA 3TX6A 4DZRA 1E7SA 4KUEA 4Q12A 4NEQA 4U7FA 1X94A 1J00A 2JH8A 3FNBA 1P2UA 2VDUE 4K6OA 3SQOA 3PPXA 2QM0A 4YREA 1X7WB 1E4OA 2CJWB 3AJAA 4JH0A 2B37A 4URXR 3R0JA 4M98A 4XX1A 1VBNA 1FFGA 5F3WB 4JVNA 1JI3A 3BGIA 3C7KA 4X61A 3V4ZA 4N0EA 4LDPA 1S9HA 5FWXB 3JARB 4FEYA 3DEAA 3PEUA 4ETIA 2NQ2C 3ZGLA 2RGDA 1MG0A 4Q21A 3ZQKA 2HUPA 2JIDA 3H2BA 4GMFA 4Q3AA 4GRAA 3KWFA 4G0QA 3QBJA 4JD5A 4X92A 2OQVA 3TYXA 5JMOA 4JJ7A 4KB5A 1Y6FA 4NXMB 1FS4A 2A0UA 1YASA 1N2HA 2AC2A 1U0GA 2OUIA 1DBQA 2HWXA 2GN1A 3G1UA 3OH8A 3ZHQA 2WJJA 5EZQA 2YN2A 4D3ZA 1IZ9A 4ENWA 2HX1A 3ZBUA 3AVTA 3WNBA 1GL7A 2ZKLA 3TAUA 3JZDA 4J0JA 4BLOA 5I45A 5KNDD 1J8FA 3PUYA 4FZ5A 4MVJF 4RA9B 2JFXA 4JK3A 4KQJA 4E1BA 4NCXA 2W6OA 2D1RA 2P5TB 3PJDA 1MR3F 1ECBA 3MMSA 4RXMA 3V2HA 5KHLB 2CXXA 4B79A 4FR5A 3WDLA 5AHKA 3SYRA 1A1VA 3AM1A 3TPZA 5IVPA 1DC8A 3FDZA 5TPWB 1YB2A 3JQ9C 1R9MA 1K7YA 3TL2A 1XPRA 5CA1F 1DXHA 3DKKA 1NNSA 5ICEA 1XL1A 4YUZA 1SK9A 1MB2A 1PDVA 2GYUA 4FI3C 1DXOA 1QM5A 3L7YA 5LPNA 2GB4A 2O5CA 2RGGA 4A15A 3VYTB 1T34A 2P9YA 2HNAA 3T1QA 3IXQA 3QXXA 3VH4A 1NX6A 2BI8A 2QJWA 1MOPA 3M4XA 1PFGA 2Y67A 4BP1A 3ILHA 2HA2A 3CT6A 5K6AA 1P0MA 4ZVOA 1QDLB 1C3XA 1X3SA 2CHQA 2SHKA 3MCWA 4MO2A 2OXFA 2EJVA 5AJXA 2JANA 2ZB3A 1IEWA 1VPEA 1R4ZA 2RJOA 3EF0A 4L4XA 4MJ3A 1LLDA 5ADVA 4XDGA 5JS1A 1ULAA 2OOKA 3O7WA 4X84A 4EG5A 3T5MA 5L3VA 1NKTA 1UOPA 4RLHA 4HLNA 3OHSX 5EAIA 1FYFA 1T3TA 3C8DA 3IUYA 1UIMA 4OFZA 4OUDA 3IVAA 2JIZD 3R0ZA 2BSXA 3RUHA 2DETA 2PS9A 4NK5A 3MJCA 3OPVA 1AV7A 4K9PA 4OHXA 1OV6A 2VWPA 2J5QA 3EPHA 2XA1A 2WPDA 4Q16A 1NL3A 1RWQA 1ZJYA 4DIFA 3OI7A 2FQQA 2PZJA 2VR1A 2TMDA 4V38A 1NVKA 1SK8A 4AN0A 5L45A 1ZM2A 1H1DA 4ZOEA 4LZLA 5TB5A 4WKBA 3QF7A 3OCJA 2XYQA 2BW0A 3FZGA 2Q2WA 3C7CB 1DG9A 4IIJF 4U7HA 4U0KA 1PVVA 4RDHA 1E5QA 4KZKA 4BJ1A 3D31A 3G7UA 5I7EA 5KNDA 2DR3A 3FCUB 4N4AA 4YCCA 2I8AA 1CUYA 2ZI3A 3CX8A 3BRSA 1JRLA 1JSLA 1CQJB 2XDYA 3HE3A 3KYJB 4NCJA 3TLAA 4Q15A 1TL7C 3DWGA 4HMOA 1CZUA 4WGFA 4JLPA 3ZJ5A 1KEUA 5E6RB 4E1AA 3GGPA 3T3NA 1L4FA 1FJ2A 1KY3A 5LP6A 1RVDA 4C05A 3PUJA 1VL5A 3A9RA 5CNJA 5BNFA 3E8MA 4PC3A 5FOSA 3SZGA 3WO1A 1DBPA 3NHBA 4XGIA 1NWHA 3RVDA 2NACA 2DHQA 1H6CA 1BSVA 1PZXA 3L7NA 3F7OA 3LNTA 4KODA 5H81A 1L1FA 3RK1A 3GGJA 1U2PA 4HDAA 1E62A 1GZ3A 4M9UA 2Q2OA 1QHXA 5A0FA 3CSUA 1D1TA 5TGZA 1LPSA 3PNMA 5FBWB 3UBMA 3C3WA 3M1YA 4HVLA 4YAUA 3F47A 3A9VA 1QQ6A 3IVCA 3WSTA 1LK0A 3MGAA 1YZNA 4FFRA 4GI5A 4LZWA 3QFTA 5BQOA 4DLPA 5A4DA 2Q4RA 5F9FA 3L4KA 1L5RA 2H0AA 1YT5A 1Z56C 4HWSA 1GT91 5ALYA 3WK6A 1PJAA 4A8JA 5MHTA 4E3WA 5IWCA 4Q4JB 3HG7A 1IJEA 1YC2A 2PSDA 2E6UX 4TZTA 3R7NA 4WK2B 4QXAA 4KTTE 5FBKA 3HO8A 1DEKA 2VHTA 3NALA 1EZ1A 2XVXA 1GARA 3JAWA 2DC1A 4C4YA 2PKCA 2ECFA 3C43A 5EJ4A 3N2EA 3U16A 5J58A 2OBLA 3KWJA 5KU1A 13PKA 1I0LA 3QUCA 3MS2A 3OTQA 1FDWA 4GECA 4KIJA 4ML3A 3PGMA 1D7AA 5CX4A 4CM3A 2A2ZA 3BMNA 3IL2A 1WF3A 1XYGA 2OLKA 2WU3A 5AM0A 4F06A 1PL8A 3ZS8A 2A67A 2ZRNA 4WOCA 1PWHA 3SVLA 1GCAA 4IZOA 3G0HA 3ZTYA 4BVLA 1RHMA 2Z1NA 4MSUA 2FU5C 3DYBA 4R1NA 4TM7A 3UTDA 2BC9A 4XDHA 4A7PA 2ZT6A 5IS2A 1WXWA 3M6AA 3B52X 1UP7A 5EPEA 1LLUA 4WCFC 4EO9A 1RYDA 4ZO7A 2CJPA 2LV8A 3WYCA 3KOYA 1ZVKA 4MAFA 5E2BA 2ZSBA 4W5NA 2YVQA 2C5SA 4PNPA 4OBBA 2WU0A 3OOSA 3QX9A 4BZXA 2PZFA 5EE3A 2QZSA 1MJNA 3OY2A 4OFBA 2JI4A 4PX3A 4WFJA 1QYXA 4KH0A 2YUIA 5JDIA 2ZVDA 1GUDA 2R7AA 4XCXA 3QU4A 4UFOA 4ZRDA 1FLAA 1U0RA 2QJRA 4C6SA 1BFDA 2W6PA 3A4YA 3D7RA 1RXYA 4I3HA 2ZUDA 4QXRA 2IDJA 5ALFA 5H82A 4A10A 5HILA 1XIVA 4MH0R 3F3YA 4M9QA 1M34E 5A05A 5FL3A 4AQDA 4BGIA 1UJBA 3OEYA 4NS4A 4YVFA 3OQMA 4TN5A 1OKKA 3OUTA 4LXUA 1DKLA 1JBQA 1HDGO 3M5WA 4MUKA 1CRWG 3DZKA 3G9XA 4OQYA 3MD9A 2HREA 4JWKA 2ORIA 3OIUA 5KJEA 5JH7F 2VUSA 4H3VA 3F4LA 1IHUA 4YRQA 5CXQA 1JILA 1UMBB 4EB0A 2O0LA 4IZHA 3O90A 4ISBA 2LR0A 3B60A 5IAKA 5AFSA 5BOSA 5IP5A 2HZBA 3CX3A 1IVSA 3QVMA 5BQ3A 2XT6A 5JIBA 4ZXPA 4FNOA 4X90A 1YKGA 4WIAA 1REQB 4JAVC 2O54A 1U04A 4C22A 3N1UA 3R3VA 2ZQ5A 3TI7A 1EP9A 3NHUA 3SBDA 1P9WA 2RJ3A 4YXWA 3UAWA 4CKEB 1DIBA 1B0UA 1JSZA 3TGLA 2QMEA 4XM1A 2ZRJA 2CHGA 4LZAA 2HRCA 5DPMA 3SYNA 3EGCA 1YBVA 1IQRA 3KIPA 2E4UA 3HB7A 5TXGA 1E3MA 3NO4A 4NV0A 1AO3A 1W0KD 5C8YF 4JT2A 2SECE 4TMKA 1T0HB 2BFBB 2QA5A 3KLMX 821PA 1JPJA 2E5FA 3FKQA 1F4PA 4MYUA 4DMGA 4ENSA 3IUJA 3PFBA 1RWMA 4ZXFA 4EG3A 1LLFA 1UF9A 1J24A 3RB8A 4YMGA 1CF4A 2H9IA 4FYYA 3F1LA 2PLNA 4OH7A 2GCGA 5CR9A 4GKKB 1EBBA 1VCHA 1KR5A 2QHXA 1DAIA 1LX6A 3O91A 3ZXIA 2JCGA 2I22A 4WK6A 5GJVC 3WGOA 4JBIA 1NJFA 1XTVA 3JSAA 3A6PC 4W5WA 3JQ7A 3K2EA 4O25A 1JBKA 1D4FA