4R8LA

Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
354
structure length
354
Chain Sequence
b'ERHLLLIYTGGTLGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Identification and Structural Analysis of an l-Asparaginase Enzyme from Guinea Pig with Putative Tumor Cell Killing Properties.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Hydrolase
total genus 111
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r8lA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4r8lA01
1JSLA 1O7JA 5CBPA 4NJEB 5K45A 1HG1A 5CBPB 2WLTA 1HO3A 4ECAA 4RA6A 5I3ZA 1IHDA 1HFJA 4Q0MA 4RA6B 2HIMA 3NTXA 1HG0A 2WT4A 2HLNA 5HW0A 1AGXA 5I48A 1NNSA 2JK0A 1JAZA 1DJPA 5K4HA 5DNDA 5K4GA 1HFKA 2P2NA 1WSAA 1DJOA 4R8KA 2GVNA 5DNCA 1WLSA 4PGAA 1ZCFA 3PGA1 1JJAA 2OCDA 5F52A 5I4BA 2P2DA 1HFWA 4RA9A 4NJEA 1ZQ1A 3ECAA 4RA9B 5K3OA 1WNFA 4R8LA 2D6FA 5DNEA 1JSRA 3NXKA
chains in the Genus database with same CATH superfamily
2VYCA 3RNLA 2FPUA 4L51A 3NG1A 3Q3VA 3AVWA 2FETA 4KX3A 3QNUA 2V7UA 1AOXA 4I81A 1P5JA 1G5TA 1S8FA 2IRWA 1X80A 4E15A 1N34B 4L4SA 4B3TB 1DUSA 1D7AA 1Z62A 4HOYA 3T1HB 2QPTA 4XKJA 1K0FA 1JB1A 2W2KB 1ZD9A 1YHYA 4RJIA 1LVGA 3WRVA 3CNNA 1MB2A 3W5UA 1VP9A 2IH4A 4G5FA 2QJRA 2QM8A 5EWJB 2JFBA 5AWFC 4TKUB 4BJ1A 1Y8CA 3TTUA 5JJLA 3VUFA 2JLVA 2PBLA 1A9QA 1H8HD 1W94A 1X1DA 1VPTA 1XWWA 4PU0A 5CFZA 1W9MA 1Z36A 2WTMA 3BHJA 3VGJA 1OYVA 2XNDA 1JMVA 2R25B 1JR3D 4U2CA 1OVGA 3ET5A 4PXAA 1KK1A 1V1RA 3H8VA 5FAKA 1J1UA 4B4OA 2GA9A 3GAMA 2PK3A 3WKBA 3QXJA 1CZNA 2E6KA 1PFVA 1G1MA 2G5TA 2RHRA 4J07A 2W71A 1QM5A 4MQFB 5AW5A 1HRDA 1W7AA 2NVUB 4XFKA 2V98A 2WE8A 2PS3A 3L6CA 3QEOA 3R44A 4PYIA 1TQHA 4DTIA 1EM8A 3N8GA 4D9MA 1XZFA 2Q3HA 4WBNA 4KRGA 3PX2A 4YUVA 2VDMB 5JHHB 4AO8A 2DPYA 3WL3A 2DB3A 4MS3B 1BDBA 1K08A 1SCKA 4E1AA 1NKVA 4JKYA 4DR3B 3WB0A 2ILVA 4S2UA 1T10A 3BMXA 5KDLA 1ZWKA 3DH0A 5HOQA 1GQ2A 3E1KA 4YI5A 1W52X 1NFRA 2BFAA 3PZBA 2D00A 5HCNA 3EMKA 1T2VA 2QNBA 5IK2D 3V4FA 3TGPA 3LTNC 2QX7A 1YVUA 1PZXA 4O4JA 1RP1A 3S27A 3R0QA 4Z9YA 1E66A 2DWCA 3P9PA 3KZ1E 4C7JA 1P6UA 2H9YA 4RHCA 3VHXA 1R4MB 4O2AF 4BNGA 1Q1QA 4XOIA 4XWKA 2CHQA 4IUBS 4J49A 4RFSA 4AJ1A 4D3FA 4D8XA 1AS3A 4LY9A 4DOMA 1GKUB 1PJ8A 3DXFA 1XRJA 3ZWMA 4YV7A 4BJ6A 1IL0A 1MRZA 1UDXA 4BMDA 1T1RA 3MJCA 4EIWA 2WR8A 4DGQA 4E13A 5K2OA 2O8FA 2ZAGA 4D56A 4ZDWA 3I45A 4Q6WA 3U56A 4EB6B 1AZSC 2IUUA 4FEAA 3P4UA 2VSFA 4JLMA 4OATA 1E6UA 3NRCA 4O8ZA 4Z5XA 1YVDA 2G76A 1U8AA 2R11A 3AYZB 4RHUA 1O6ZA 3N6VA 4KIJA 3TKLA 5KOJB 9LDTA 2PQ6A 1X7XA 2Y1FA 3OOEA 3CRNA 3OQ6A 1U1IA 3RHFA 1O94A 1DKPA 1PJQA 421PA 2JCGA 3LBHA 1NIJA 3GFQA 4QUKA 3RC1A 3REFA 3LH5A 3WGNA 2QTWB 4R6WA 1IUKA 4ADSG 1H6BA 1W9HA 4KPYA 1E2BA 3I1YA 1BYUA 3EZ7A 1LJUA 3JWJA 4TUYB 5I7HA 5BN5A 4JCOA 5LD2B 3SHWA 2ZDHA 3ONFA 4PZ9A 1RQRA 1RPZA 2M9MA 1AKMA 4EUSA 5L7YA 1C0EA 4CT0A 4YAIA 4LNUA 2IS6A 4W6ZA 1NJ1A 1GU0A 2RAVA 4HATA 3DMRA 3DBHB 3V3KA 5JJCA 4XEHA 5GOTA 1QG6A 1W0KA 3PG5A 2VP4A 4RE6A 4U4AA 3DDCA 3S7TA 2XCQA 1WY7A 3EIOA 3F1KA 3L3BA 1Y1PA 2GNOA 1RYEA 2DWQA 4M0EA 4MWZA 3WL7A 4E4RA 1KOLA 2NU6B 2V74B 5JSYA 5AM2A 2UUCB 4IDFA 3IBSA 3SJCA 3TQFA 3AR7A 4IMIB 3V46A 5D3MA 1O2DA 1Q7EA 2FA9A 4MV7A 1IDOA 3AHEA 1IZ7A 2AUTA 4H3HB 4EY5A 3D4NA 1V7CA 3F71A 5EGNA 3QW2A 1Q21A 2QAGC 3Q3CA 1JIIA 4YN3A 5BWLA 1TO6A 2QMZA 1UJ2A 2QN9A 4D8UA 2VH2A 4LOIA 1V9CA 4ALKA 4N9WA 1PNQA 1WAMA 3PFGA 4FFRA 5F73A 4F85A 1LFDB 4IW3B 2ZE8A 4LJRA 1N9ZA 4Z0PA 1DEOA 3ESAA 5T7BA 4Z9AA 3E23A 4DLBA 4OU5A 4UQLA 4JLSA 4WXYB 4AJIA 4CL0A 5CFOA 2EYUA 3IDSA 4B35A 3GVXA 3FHOA 2FMXA 2O3RA 5L53A 2CNOA 5EJ6A 2OVFA 1MB9A 4HWOA 3OUUA 3G8YA 2FSUA 1E8DA 2H2GA 2ZRDA 3ESBA 5DKFA 5DNUA 1KVTA 1QCCA 4PNHA 2C7OA 3MBOA 3FHCB 1XB2A 1DIGA 1H6DA 2HDOA 3WBBA 2XCLA 1ZO8A 3ADKA 4QYXA 1CNFA 1TC2A 2OCKA 2O54A 3FVQA 3I53A 3RS5A 1OWOA 3AO0B 4JUFA 1BX0A 1CIJA 3LZ6A 4EI7A 4FD2A 5JXGA 4ZC8A 1Z0UA 2C54A 4HLCA 3S4YA 4R1TA 3T35A 3KQSA 4EBFA 4RL6A 1PR0A 1Z26A 1PL8A 4OKNA 3OIFA 1J7KA 3ONEA 1BW9B 1F8XA 2GEUA 3AFNA 4Q03A 1YMQA 3ID6C 2IYNA 3O8OB 1FRNA 1MQ8B 4FMPA 3VOSA 4E2WA 4TQUS 2JH3A 2VJCA 1UP7A 3WDLA 1NJFA 2XJ4A 3RTGA 5ESWA 5GAJA 4BUCA 3GA5A 3RV3A 4WZAB 2X5OA 3CONA 4UNNA 4N76A 3ANLA 3OZEA 1I6MA 1P1BA 4QSHA 5HA5A 2XUDA 4LVCA 5JQGB 3CUYA 5JJKA 1JEOA 4O33A 3UB2A 2CL6X 4H31A 2OCGA 3FPHA 4GLOA 2O3UA 1GN8A 5UKDA 1OI7A 1QFXA 1UBFA 3AC0A 1T2AA 4DWWA 1QTRA 2OPBA 2BR4A 1QK4A 1BROA 2QL7A 3OLZA 4TYMA 3ESCA 5IARA 3WWPA 1SXHA 2NLOA 2ZRJA 2NTJA 4C7OA 1M8FA 1N75A 2XAUA 4NCNA 3WGYA 2GT1A 1TW2A 2R6AA 2GNAA 1OT3A 3AR9A 4XA8A 2Q49A 1VSUA 2RHMA 1RKXA 2ZE5A 3WJ7A 2ATCA 5FLEX 2H7XA 3UOAB 4RJ2A 5JD6A 3PX7A 1RRPA 4JYZA 3URMA 2GM5A 3VSAA 1I1NA 2AZMA 2BFBA 2C8KA 4M1WA 4G97A 1OX4A 5J1TB 4S05A 4XVQA 3G0OA 5C1DA 4EAQA 3D7KA 1UKAA 3QY0A 3GXOA 3UBTA 4ZVOA 1PUXA 2QVBA 2WIAA 1UT8A 3ACDA 4WNCA 4J3NA 4DG8A 1HNXB 1U1GA 5TJ9A 3UANA 2AUMA 4YCSA 1JKFA 2OGTA 1GD1O 4MLDA 3KNZA 2ZCVA 4FUTA 3PNVA 3IODA 2VKTA 1SCAA 5A1TA 4UCWA 2ZITA 5LQCA 1T3SA 3QU9A 3HNPA 1EVQA 1LK7A 2J0EA 4N5MA 4CUJA 3IB6A 5CX4A 5BSEA 3AM1A 3WJAA 1GUAA 4Y30A 3RYHA 4XWGA 1OFUX 3F47A 5HJ7A 4JEIA 2AX4A 4L3VA 4D4LA 1ZC3A 3QBVA 3M49A 4N1AA 3Q8WA 5FORA 1NC1A 3O4RA 4ND3A 3VO9A 3C1OA 1U98A 4GO1A 4D4KA 3H2BA 2OCYC 4HF7A 1COWA 3AM4A 3G5TA 3W5SA 4F96A 4Z0TA 1KTIA 1Z4PX 3K9CA 4O02B 4MIKA 4DANA 3BICA 1Z82A 4JT8A 1WDLA 3LFTA 1S7CA 4MRRA 5KNBA 3IP8A 4J0KA 2VEDA 5EOVA 5K3FB 1KSGA 1Z17A 3BYZA 1FFDA 2J9FA 2RGNC 4FCVA 4N0EA 4JOBA 4HSEA 4LWOA 1DSSG 4RFVA 4CIYA 2PH3A 3ND5A 3U9SA 4PFQA 1H69A 3BD6A 4B73A 3RYCA 2GS9A 1L2TA 2BY4A 2E4XA 3OVMA 4QOFA 3RVBA 4BC0A 4DDTA 4FKMA 3GPDG 2EIXA 2WWHA 4MVJM 5ALKA 4FHZA 2Q3FA 1ZHHA 3B3QA 4ZRNA 4O3FA 2PS1A 1MNQA 3GOQA 1GTG1 2DQ4A 4B3GA 1J5XA 4I5DA 5DGCA 3SJZA 3MJEA 3PQDA 1L7OA 2P65A 1W4AA 2P78A 4RKQA 5DHRA 3ROEA 4ZYZA 3R76A 1WRBA 3H86A 2FW8A 1EVZA 4PZLA 4WOKA 1OFGA 3R9KA 2F8LA 3OIYA 3SYNA 3DJFA 1NU8A 4HNTA 5EKTA 2ID8A 1A9ZA 3COSA 1N9GA 2Z43A 3CZAA 3M82A 4Z49A 4OJKA 3H9JA 2ZUVA 2P6MA 5KKCA 1RQLA 2GAIA 2Z1NA 1EUDB 2GM3A 2I62A 3ZLVA 3ZLJA 1TYEB 2PMWB 3GUVA 1F17A 4MQMA 4N7JA 2PIDA 2Y0DA 1E2EA 2W2MA 4WD3A 1OXVA 1QYCA 3U80A 2UYHA 1RADA 4KIGA 1ZOIA 3MT7A 4P7GA 2ZULA 4V0KA 3TUIC 1IRIA 5IWAB 4KXQA 4CCYA 2P75A 1RCTE 5FI0B 5IFLA 2D8AA 1BXZA 2QU8A 3CPEA 2K7FA 1R9NA 3QF7A 4KBGA 2R6HA 4A8PA 1G64A 1Y89A 2VWQA 4DWVA 2XY4A 1X7HA 3DLBA 3RC7A 3P9QA 3ASYA 4TT3A 4O1HA 4PHGA 5CT6A 5H4HA 4BZWA 2WW8A 4V0SA 4A23A 4NMMA 4HUQB 3RG8A 4DIBA 2YASA 1NAIA 1NURA 2Q28A 4Y9SA 5HM6A 2QL9A 3L8YA 1N92A 4CF7A 4DSUA 4NU5A 5FA8A 1F9EA 3AKCA 1IAVA 3AUSA 4ETWA 3EGEA 4CM4B 2QVXX 1A98A 1Q57A 4CG2A 1JIUA 1KI7A 3UM9A 4DWOA 3AERA 2XRYA 4H1HA 3VR0A 5KYUB 1MCZA 4IDAA 3R3WA 4O5OA 4IGKA 4X7RA 4AAYA 1JJ7A 1PE0A 1R8QA 4QFCA 1RI3A 2JDID 1FP1D 5JFOA 3CVUA 1LW6E 4CMAA 1ZGAA 2AOTB 1N0IA 1ZBQA 4QG7A 5DBIA 4E14A 1GYRA 3TG2A 3OTOB 3PGVA 4Y7CA 1UT5A 4LZNA 1H8HA 2PGXA 4QO7A 2YC4C 3E84A 1ZJ5A 3EXHA 5DX0A 3GWGA 3O74A 2G7ZA 2OPHA 3I1IA 3DPIA 2QLFA 4TL9A 3B85A 4V0QA 1EWRA 2ZSBA 1ZM7A 2NUTA 5JNVA 3CG0A 1AQNA 1RAHA 1AG9A 1L1RA 1YVPA 4HDSA 4TTIA 1K06A 1GAXA 2GRAA 2ZU6A 1GRNA 4LDJA 3DLTA 3GCXA 2C88A 1FLDA 2Q9UA 1ZK1A 2Q7DA 3OEHA 2D0IA 4QPNA 1T4MA 2YV1A 3KHTA 1OF1A 3CPSA 4NU0A 1Z6XA 4V39A 2EXXA 1KOGA 3L1HA 2OHIA 4Y18A 1NRIA 2YMQA 4DC1A 5HUQA 1DLJA 4EM6A 3TWOA 1N5OX 4OYLA 4ZOBA 1M2NA 2G07A 4FYVA 2X7HA 4U7GA 4CW7A 3W6OA 2G1UA 4PYRA 2J59A 5HXAA 4EGJA 1P7PA 3VKGA 2V7XA 5EUBA 1Z39A 3F5SA 1BO6A 2GRUA 5KVCA 3A9RA 4URYR 5EJ9A 5FO0A 2VH1A 5JCOA 4KDFA 2HOQA 5ER6A 4A6DA 3EG5A 3LQ4A 4QU0A 4PPQA 1LPNA 3HEAA 4RACA 3QH4A 3HSKA 3U1VA 2ZI9A 1SJ9A 3MBKA 4I99A 5LN1A 4ZALA 1NF2A 4R0NA 5DOZA 2OV3A 3G82C 4F12A 5HQTA 1YE3A 4KX5A 2DBQA 2YJTD 4LF8B 4RTQA 3IQZA 4R81A 4U02A 2QTAA 3E81A 2JKZA 2Q27A 1HDYA 2YWDA 3JPYA 3MCTA 1GAWA 1T9ZA 1N1EA 2VXBA 3PPXA 4YGXB 3NC0C 1TUBB 2QUKA 4FNOA 2FWAA 1E69A 3S70A 8AT1A 3C3BA 1TLLA 5C2JB 2AT1A 4UVEA 1YMUA 1AKQA 1R8SA 1LVUA 4R8MA 1F60A 4PFJA 3MWKA 1MB0A 3N8IA 1DRWA 3M5DA 4KMOA 1PSZA 3K5IA 4FGZA 4TRRA 2HDWA 3ST7A 1E8MA 2H00A 4N9QA 1EUCB 2A5DA 2WUWE 1EK5A 4XB1A 4XCVA 4C22A 2QVCA 3E35A 5F7JA 3RRYA 1XZPA 3R5SA 1DO0A 3T9EA 5IAGA 5KOHA 2KS6A 2O3TA 2PO5A 2BP7A 2BF4A 2J3JA 2VJNA 3EC1A 1UBRS 3JQDA 2A9OA 2OM6A 3LPLA 3UT5A 1FX1A 2W7TA 3OETA 3MILA 3V4VB 2IEGA 3FR8A 3ZNPA 4DLKA 1LQ2A 2ATIA 2VSQA 1QP7A 1Q44A 1FX0A 1V35A 2EZTA 5GJWC 2VP0A 1M2VA 2ZRQA 3G9UA 2H5JA 2FUG1 1U8TA 2ZI3A 3R0JA 4TS3A 2FEAA 4M0PA 1RHJA 4QU8A 3C6KA 4GL2A 2C61A 1RWVA 5CUQA 1QHYA 2I4RA 4ENUA 3HU2A 1SB9A 1KKLA 5I6DA 3HLYA 4Q3CA 5JMWA 1Y8QA 5HE8A 3VR3A 5FV7A 1GUDA 2WWRA 3KJIA 2Q4TA 1C29B 4WXRA 4MRPA 1DDOA 4GPIB 4PO8A 3HXQA 1TEZA 2PE5A 4OO3A 3UWMA 2LWIA 1E0JA 3KJXA 1KMHA 1H66A 5IJZA 1Q50A 1QRDA 1JHZA 1UIRA 1X7ZB 2WJIA 4M8LA 4OCZA 3A10A 5FADA 1XDUA 3OLYA 3ANMA 1USKA 4F3CA 4P6VF 4UEQA 2ZBVA 4PC3A 5KSZA 1Y7PA 4MVWA 5AVYA 3ESYA 1F12A 2FN7A 4OBEA 1VG1A 3NWEA 3PIRA 1WQ1R 4IHQA 4C0BA 2XITA 2ZAYA 1BU5A 1N36B 1CF4A 1WM1A 1R4ZA 1NBEA 3AOEC 4JU8A 3ZK9A 5AUOB 3A3YA 2BMAA 1USGA 4ZEWA 3HM2A 3UV3A 5CT5A 3ICEA 5COBA 1JDUA 1G20A 1EPUA 1QVAA 4O1IA 1O03A 2SICE 4DXAA 2IXGA 2ZIEA 3FIJA 4FYKA 4MR8A 3TINA 3WS7A 3ZVLA 3UW1A 5JAIA 4C08A 3DE1X 4W9RA 3D0QA 2E5WA 1CUGA 2DHCA 2FPPB 4XVRA 3MQ2A 3UJ9A 4YR7A 3TX6A 3UT6A 4N5IX 4AL4A 1Q3HA 4CI0B 3GBSA 4RCZA 2PMFA 3UJPA 1ISMA 4G9BA 4C04A 2Z5LA 4ND4A 1WEKA 3ZDXB 2OP1A 4ID3A 4HRYA 2P4QA 3V8MA 1OH7A 4DB2A 3DOOA 2DQSA 3EFBA 4L73A 1PZGA 1K3TA 4RF2A 2VPYA 2HMVA 2WFLB 4JQYA 3AUXA 2EJVA 3EA0A 1NM5A 2QE7D 1A2BA 3C4QA 4R2WA 4RK5A 3R7FA 4G4IA 1MX3A 1UBGA 4AG5A 4ZYTA 4W5WA 3QMVA 3ZIDA 5BWBA 3HXMA 2HK6A 2PH1A 3HR4A 5DYGA 3X0DA 1NF9A 2OLKA 1G8MA 3EYWA 3AIIA 1ZD5A 3KBBA 3NT4A 3JRXA 3ORFA 1MKYA 1ZNXA 1XTVA 4HL6A 4N7RA 5K2MA 3BMQA 3LG2A 4TV9B 1G19A 2AE2A 2NU8B 5EZ6B 5LZ5A 3WMXA 3WGLA 4Y1EA 2Y9MB 2L2QA 4OUKX 4ZTUB 4EKEA 4C0XA 4MJ3A 1U5AA 4OUDB 1KVRA 5CBPB 2VP9A 3CW2A 2ODNA 2XUHA 3Q7QA 5BY2A 1KJIA 1BX3A 2GN2A 1Z4QA 2CNBA 5C9ZA 3J7AC 3IXLA 5EESA 2WIGA 4I4TA 1U0NA 1P1CA 3H19A 1JAZA 3EEOA 1K6MA 2QQ5A 2CUNA 4ME6A 2O3SA 3SC2A 2ID7A 5CB8A 3NHYA 3KYDB 5C8VA 5I9LA 3LWBA 2BEVA 1V9SA 2EBUA 4CLOB 2JJQA 4JB2A 1S2GA 3A70A 1VFNA 4H18A 2KHZA 2I29A 4BRUA 2PGNA 2O23A 4J0JA 4OHWA 4CCAA 2B5WA 3TRDA 2B99A 5FBWB 5GJVC 4BX9A 1Q6ZA 3HUUA 1I4EB 3ADPA 1NW7A 1T8WA 1U0GA 2B4YA 4O2BF 3S3TA 1G7RA 3BPSA 4BTEA 1GIAA 4OHVA 1XCJA 2IHKA 3ASZA 4IJVA 3QIAA 2WWYA 2IPOA 2XMSA 3SIPA 5JQGF 2GGSA 1U7DA 1T1GA 5J3JA 4DEVA 4GQIA 3PUJA 2YQ5A 3B3JA 2MYPA 4PQFA 1YZLA 1XAGA 1P8JA 2C3MA 1M1UA 1POWA 2JA1A 2WSSD 5DX8A 3IAFA 4FHCA 4XH9B 1H2HA 2HWUA 2Q1UA 4GYJA 1I3CA 2ZJ1A 4EGSA 1G8SA 1I13A 2COKA 3TSWA 4PZEA 2QZZA 2P9TA 1DG9A 1D2NA 1THTA 1HE1C 2XTZA 2XH8A 3HZZA 1NNEA 1JLLA 1XKXA 2GK6A 3GJXC 1GQSA 3KHUA 3PC6A 4KPUB 3ROZA 3ML1A 3VZSA 4HEHA 1AMOA 1J8YF 1RMQA 3KT6A 4QODA 1JF8A 4RV5A 4TTSA 1PQ4A 4ZWNA 2HREA 3KKMA 2X42A 4R2MA 3LY7A 5C8YF 1CY7A 1JG2A 1ODKA 3KE8A 4TV8A 2RGCA 3NC1C 5DK6A 4M9SA 3RVOA 4MQ5A 3OF3A 1JT9A 2VP3A 1RJ9B 1JGTA 2JB9A 1S8NA 3CEHA 4IDBA 4NYJR 4PF1A 5EXSA 1FU7A 3KM0A 3UN1A 4BV3A 3G8BA 5BV2P 1RVV1 3VKFA 3H16A 4LZZA 3ZZ0A 5DM4A 3KG2A 1MAHA 3HN2A 2B21A 4EPWA 2QRNA 4HYEA 2F4VB 2VK8A 1VE5A 3ORRA 1PLJA 2VI5A 1CVLA 3AETA 2I7TA 3DEZA 1YCHA 2B4AA 3M81A 1EEHA 1EK6A 2FMUA 4GZLA 4P2BA 4QQ8A 1V3TA 3DL4A 5EZQA 1XEXA 1C2TA 1QB8A 3ABZA 3ND6A 1S8AA 1REQB 1JFFA 1OBCA 5H68A 4X61A 5E1BA 2AYZA 1UQRA 2C7BA 4QYSA 4DQKA 3EY4A 1QG4A 3DR5A 2B3DA 3TF5A 4B7AA 3VSBA 2IUFA 3KT0A 4DTCA 2IZ0A 3BFJA 3MM4A 1ULZA 5F23A 1FFYA 3M34A 3ZGLA 4HRXA 1IU9A 3THWA 3BWYA 3DE2X 3VOTA 3R5XA 1U04A 2OCIA 3KYCA 2P1ZA 2XZDA 3B3GA 2YWRA 5DF1A 3LLSA 3E1SA 2P2GA 3H05A 4J8PA 5CPBA 3WJ2A 4DA7A 4TLMB 2VQ3A 4HLUA 4HRVA 3STXA 1A96A 1ONPA 1DUVG 4QBFA 3DVRX 5KTYA 1FYVA 2CNLA 3I6ZA 1AV6A 3IV6A 3E9ZA 1RPTA 4M0DA 2EKDA 1Y4ZA 3ELYA 1G16A 5B3JA 3JQ8A 1Y6GA 2R5WA 2JLRA 1V1RB 4M37A 1VKOA 1FQOA 3IAEA 5EUMA 1Z8DA 1CUBA 4BLOA 4EJSA 3F6PA 5HQ3A 2C8VA 2VF2A 3E03A 5B3JC 2OXEA 3TE6A 3C3JA 3EVFA 3F4LA 3HDTA 1KPGA 3A1WA 5G1OA 5D87A 4CKYA 1H9AA 1R5BA 4GICA 2V03A 3EXFB 3EVBA 4AX4A 3TW6A 4WBNB 4QGFA 1GGVA 5KYYA 4YMSA 3OTGA 1QC5B 3PJEA 2Y4OA 3VVLA 1RPNA 2R87A 4YXFA 3H6GA 3DR3A 2WA2A 2FV8A 3D1LA 3K09C 3KOXA 3N58A 3U37A 2WF8A 1DAKA 1CVIA 4QOGA 3GAZA 2IY9A 4HYYA 3UWPA 4BFTA 5I3ZA 3C98A 4KODA 1DC6A 1F3OA 2AR9A 3LCUA 4FBGA 2VYFA 4NMXB 4KQ9A 3WYAA 5KJCA 3W7BA 1L7EA 2JDIA 3GLFE 1GM5A 4LX8A 3IURA 5AHKA 1T36A 3KV3O 3Q5GA 4I8IA 4D0SA 3C5VA 1L8AA 1MHPA 4RFSB 5CYPA 1L5NA 1G9TA 5FPSA 1VMEA 1ILEA 4JYBA 3AEUB 2FG5A 2XTJA 4S12A 4NRDA 1A5AB 5E1OA 1IJBA 1CUYA 3VX3A 2QWXA 4GG1A 4G0MA 1G8KA 2OKCA 2X2FA 2QA5A 2B83A 2Q2QA 3UGJA 3AZPA 1IUPA 5A5GA 5JBNA 1U2RA 2FPGA 1MJHA 3A1SA 3N75A 2NSJA 4QXPA 5LJLA 1O58A 2FSFA 5TS3A 1YQUA 1MAWA 1MLDA 3KEMA 3EDCA 3HGMA 4MUEA 5TARA 3T54A 5DIFA 5J4LA 1GNVA 2CNWD 2BGIA 2R1TB 3DWIA 5AO9A 5H1YA 4MUXA 1MO4A 5HRAA 4CBVA 5ALVA 2PS0A 5D2CA 3GJ4A 1N0WA 3CUWA 3HPQA 3IO5A 3ZY5A 3H4MA 4GH5A 2ZT6A 4AJ2A 4PLPA 3QPDA 3IBTA 2PQMA 4FDVA 3NM5A 2PV0A 1UPCA 4OSEA 2OBNA 3U9TA 1TMKA 2ODQA 4V1CA 1EIZA 4A8JA 1N2HA 3OCJA 2OB2A 3ECCA 4MEBA 4A27A 4ZVVA 1I4WA 3DAGA 1WF6A 1YMVA 3OZGA 3EQ7A 3NOXA 3GJZA 3BHIA 4IX1A 4EHDA 2XZOA 1LI7A 1PYGA 4XGRA 7ADHA 5KINB 2ZSAA 3CZRA 2GSWA 2UYCA 3ZJUA 2QRUA 4R9RA 4ZU1X 1W35A 4HAWA 5EJAA 3RUEA 4XQEA 2W8ZA 1ZNWA 3T6KA 4RH0A 4J1TC 4BQPA 3ZV4A 4LNUB 3SPXA 4BVJA 5CNIA 1FBNA 1R6BX 4FFMA 1Q7GA 1A7KA 1UKCA 3H1FA 4QXMA 3IILA 2FQYA 3VU3A 4DB4A 2J48A 3W34A 3MRVA 2PA3A 1VG8A 2B0CA 3I8SA 1PFUA 1OWMA 4HFMA 3NHMA 1SG6A 1DKMA 3NPMA 4LYJA 1FDTA 5ICSA 1D07A 3A8TA 3JZDA 3GCGA 3R8XA 1Y7LA 1E9AA 3UAWA 5JY1A 2G40A 3IP3A 2FZGA 2J46A 2ZXFA 3SM9A 1JKXA 5CVUA 2H2DA 4XM0A 3TD2A 3VU8A 5CFNA 5I7EA 1PR5A 5LFAA 1SXPA 1L4UA 1KOFA 3I52A 4ND2A 3V8EA 1MN6A 2XT6A 2GHRA 1VI2A 2AMLA 3TRIA 1QYXA 2RSLA 2C04A 2RHWA 3G8AA 4RETA 2W98A 2PRYA 1QBGA 4B45A 3K1AA 3PFHA 4XM1A 3LK7A 2YV2A 2IF2A 1K8RA 1PGPA 5H80A 5CAEA 1H85A 2OHGA 4HDQB 5JH7B 2V6GA 1Z5OA 1IHOA 1EFLA 2G71A 3DGEC 2ZJAA 3MC1A 4LV5B 4DJDC 2ZYGA 3F6EX 3HKEB 4D8WA 4HP8A 5HS6A 5CVEA 4P3OA 3AL3A 3A4IA 4Y6GB 4Q9DA 4EVSA 3DW3X 3NHBA 4PHFA 2C4HA 2KBFA 5F9MA 1VCHA 2HLHA 5D6OA 3B1ZA 1A71A 3ENWA 4ZVNA 4BLSA 5K0ZA 3IJPA 2WHYA 3GAAA 3BE5A 3IESA 3DVLA 2TMDA 1ZVQA 4L4UA 4NP6A 3W2FA 2O7RA 1TECE 4ZEXA 1JWLA 1B0UA 1M83A 1A04A 2FDRA 3MCAA 3MUEA 4WXHA 5LP1A 1DX4A 2IOFA 2BKAA 3FOFC 2A0FA 3HV2A 1JIKA 3U09A 1H6AA 4KI7A 4GE3A 4AI6A 3FFTA 3KD2A 4DEXA 4ERNA 2O8BA 5K4AA 4TKLA 1T6NA 2ECOA 5G0VA 1Q3KA 3NTRA 4BCCA 1TJ3A 4KKXB 1NX6A 2VHTA 5BWMA 3H2HA 5FEUA 4KWTA 3ZHZA 3AXTA 5BORA 5LQMA 4CZ2A 3IT2A 3VKVA 1E2LA 1YDWA 2CUTA 1Z4NA 4TT8A 1G5RA 1N0UA 4GM0A 4UHJA 3HWWA 2XKKA 2OLEA 3NVAA 4IEFB 4AUMA 4XLTA 1XMJA 1H5NA 4YAEA 3NHWA 1Z5PA 3KEGA 1VBMA 1XO1A 2B7BA 3ESDA 2NO5A 4KPGA 1QMPA 4JBGA 4PLYA 5C80A 2C2MA 2CJWA 2FPIB 1H2EA 4JXKA 4NF2A 2YWGA 3WVNA 4G5OA 1KL7A 4HEA6 3HGQA 2GPSA 1JYFA 4PLCA 4GX5A 1DKRA 2X9QA 1LRKA 2DKOA 2ISQA 1FUEA 2P79A 3AW8A 3PUHA 3AB3A 1AZWA 2KWIA 3QWAA 4RQAA 1Q1AA 3U7FB 1U0HC 4XR9A 1PP4A 5LDGA 1MPXA 2NT4A 5DW3A 1L5RA 3JAWA 3U7RA 4IDGA 2QLMA 4X24A 3VTZA 5IZCC 1K5HA 1N6HA 5CDFE 4X85A 3H84A 1Q7CA 2QRLA 1BE0A 2ZP1A 4WBSA 3JYPA 1KETA 1D1PA 1RWQA 1UPAA 5A04A 1TJYA 2EP7A 4PLTA 3RROA 2X13A 4XYGA 2OKGA 3IIMA 1Z3IX 2QMOA 3KHSA 4EF6A 3FSJX 2CL7X 1QKIA 1JECA 1AK2A 4JYCA 3UMVA 1CJSA 2Y1KA 2ENWA 4N8EA 3GFPA 2BCGY 5B1DA 5C4IA 3BSYA 1HL3A 3B2EA 3LUBA 1WEHA 3FGOA 3OT1A 4INJA 3RTCA 4LEIA 4CMCA 4BE7B 5GONA 1NDQA 4UE6A 3B1KA 1GU1A 1Y7IA 3I58A 4RA9B 4L5IA 4QO8A 4CDNA 3FDXA 4FINA 1AHIA 1XALA 1SG0A 1L4BA 2JGMA 3HTXA 2FR8A 1QOPB 1QX3A 3CLUC 1W2GA 4HN2A 3SHQA 3G2LA 1XHLA 1KERA 4AKIA 1L4KA 2ASVA 3UJDA 4RA6B 1J23A 3R3ZA 4PONA 4OI0A 5TV2A 4G4JA 3K3PA 5JANA 1CQWA 1WS6A 4WY8A 2VA9A 1DTWB 4ZIRA 1E94E 2BN4A 1CE8B 4CG0A 4DCCA 5IAOA 3DDZX 2J7PA 2PLAA 2W11A 2YZMA 4HVCA 1FDRA 2I99A 1D2RA 1JR6A 3CCFA 1SK9A 1UEIA 3RYCB 3TLYA 3EA5A 2PXAA 1YB2A 2W6OA 5J59A 2BFCA 2IYEA 3QTTA 4NZYA 4C6RA 1EE2A 3JD3A 1NR7A 3BA6A 1GKIA 5AVKA 4CN9A 2XSZA 3KVOA 5FJJA 2Z8ZA 2C92A 3DFZA 2B20A 3QU2A 4LDAA 4HZUA 2FGJA 3A9CA 2HSJA 1TLFA 2POCA 2W58A 3BE6A 3K05A 2WYUA 1IJFA 3FUUA 5FLYA 3EQ6A 3RODA 1LBQA 3B1JA 5KVSA 1VRVA 3BG5A 3QNWA 4JLAA 4C2UA 2G5GX 4QUDA 4RK7A 3RSFA 1EB8A 4JJGA 4FEGA 1GPBA 1QO7A 2QNRA 1J22A 3FOBA 1CEEA 4HDMB 1FQKA 2ZVDA 1EAYA 1KJYA 1QVVA 4MVXA 3PQ2A 4N82A 5DEOA 3U31A 3IRVA 4EPXA 5JSHA 2WIFA 3GZJA 2OEPA 2PFSA 2H48A 4OHPA 1XJ0A 2D7CA 3HKDB 4IXTA 4PXSA 4RNCA 4J90A 5BUSA 3T41A 6REQA 1RXWA 2ZSEA 2CFRA 1KAHA 2FSPA 3UJAA 3G9QA 2A5GA 4ZI5A 4O2LA 1TCAA 5JADA 3I12A 2O59A 4MUFA 4JBIA 2CSXA 2R97A 1KYWA 4ZYXA 4HDKB 5F5LA 2IZOA 3P5SA 4CMIB 4B2IA 1CJKC 4LKOA 1H1TA 1OH8A 4CCYB 2QBYB 1NMXA 1ORIA 2FZKA 2R4UA 1P0MA 1YRAA 2TYSB 2V9PA 4HGOA 4L9AA 2POQX 3QHAA 3J80A 1QPBA 3PF8A 1KF0A 1WKBA 4DADA 5IZCA 5AJXA 2D2XA 1VLMA 2PWAA 2GX6A 2PX8A 2DUJA 1OXTA 4GC9A 4DSTA 5D5PA 1YZUA 1X7YA 3E5HA 3TLBA 1OH6A 3KB8A 1G3MA 1II9A 1HFWA 4OB7A 3A28A 2P27A 2W4IA 3BL5A 1A95A 2D1FA 3GCDA 5A3JA 5JCJD 2BCJQ 4CPDA 1QB7A 1UMCA 4O8CA 4EYKA 3F4BA 5EZSA 2YIMA 4LY3A 5CTJA 3K70B 3WB1A 2O2ZA 3WAGA 2ZE6A 4H1TA 2YRFA 1PEKE 1UMBB 4Q7MB 1Z06A 2NO4A 3FOEC 1MF7A 4RTJA 3RS3A 3SSNA 3IOMA 1ZH4A 3FWZA 3WP0A 4BDTA 5JAZA 5L45A 2JJYA 2XCRB 3O8LA 3KYIB 4GOJA 5LB4A 4LWZA 4N54A 1IG3A 1AHHA 4J43A 3Q7EA 1A4XA 3U4HA 1DJQA 4QATA 4HX5A 4PTZA 3PD1A 1AHNA 1GGMA 3GJ8A 1R4AA 2AMVA 3EUAA 3LUDA 4R01A 2OUKA 3JYNA 4D41A 1KQGA 1V25A 3C6MA 3JQQA 1LPAB 3NIBA 1SZDA 1ZBDA 4OKIA 1RKVA 1MEEA 2J32A 1U0BB 1O95C 3ZBUA 5IG2A 2Q45A 2RONA 5CT9A 4UD6A 2Z4RA 3Q8LA 3NBZC 4FFVA 3GP8A 3ZDZB 3MMZA 2AN1A 2FWBA 1AKVA 3H8SA 1N2XA 1EA5A 4LHVA 4M1KA 4KOEC 3BHMA 4MI1A 5CRIA 1YRLA 1XROA 1P91A 2QTRA 3UZUA 1VRCA 3TAHA 4D0LB 1Z12A 1ZI8A 2R85A 4JVMA 5BT9A 2ZJZA 1VA4A 1JKIA 4LQLA 1P2GA 1SNYA 1QZ3A 4DUGD 2HH9A 1FK8A 3SF8A 4FHEA 3BZBA 3A26A 4OHRA 2EGGA 2V6MA 2GYVA 3EX7C 4LE1A 3P4YA 1XRSB 1EFAA 1GDHA 4X1KA 3I83A 1NR5A 2RHHA 3DNPA 1YNOA 3MCZA 1W85B 4RK0A 3I2HA 1M6EX 1A2OA 1NW6A 2P2SA 3BMNB 3EIFA 2CB0A 3KJZA 1G7CA 2DBZA 3ZWYA 7GPBA 2OHHA 1XZHA 3OZIA 4LDRA 2FX3A 3VSCA 1N2CE 4UUAA 2YJZA 4B5KA 1QHHA 4CG3A 4US2R 2XWPA 1AQJA 2PQ0A 1C30A 4G26A 4MOWA 4L3WA 1TAGA 1UKYA 5CX1B 5IM5A 1CUXA 2EEPA 1ISPA 3MT8A 5CLGA 3RUIA 4X44A 2O3QA 4E1VA 3R7BA 2FDCA 5LDHA 2BTEA 2X2EA 1H1DA 3K9HA 1FLVA 2Y6UA 3LIIA 2R86A 3L79A 3M89A 1V1JA 2F8SA 2QW8A 1M2WA 2YHSA 3UMBA 1ZISA 3ER8A 3A0UA 3Q0IA 4KRXA 2BLLA 3VNUA 2EJUA 1NONA 3OU2A 3SKYA 1LV7A 3C3PA 4FMCF 3UJ6A 4RSMA 3M4XA 2UV8A 4B4UA 3ORSA 1CF2O 3KU4A 1J1IA 2AD5A 3UA4A 2D13A 1UC4B 1R8XA 5MN5A 1HX7A 4K9NA 4N01A 4WPGA 1V7PC 4G0ZA 4NH4A 3UK6A 5BN1A 4XWOA 4E5KA 4HCJA 4DDMA 1C3OB 1VJTA 2C0QA 3DEJA 4TRMA 5ES3A 1SXJD 2BFDB 3WX0A 4EUHA 5LR6A 3I28A 1Y6ZA 3UMSA 1WLSA 3FNHA 4F5DA 3C4JA 5IU6A 5J58A 4EARA 4JKOA 3D5QA 5GTDA 2FJUA 3JVVA 4KNWA 4DV5B 1RHMA 5KWVA 3E27A 2Q3LA 4G4SP 4G23A 5TE9A 2X0FA 4J75A 1NMYA 2AW5A 2WHQA 4P53A 4PVCA 2ORYA 1Y7TA 3EW9A 4HGZA 2B61A 1G8FA 5CR9A 1I94B 3CXUA 3QUAA 1F0NA 4EPVA 2BONA 1WXHA 1UBEA 2O2DA 3DF7A 3KUCA 3L07A 4BWYA 5BMVA 1L5KA 4R31A 1L5ZA 1DKUA 4QJIA 3OE7D 4AN1A 4L4XA 2H0RA 1V2GA 2B78A 4UBOA 1SD5A 3NEJA 1F4PA 3DPSA 3DM9B 4G07A 4MGKR 4QEZA 5DN9A 3OPNA 4GEKA 2B2CA 4U63A 5KAMA 4A26A 5DASA 5AKXA 3NS7A 5K0NA 5J5VA 3JQGB 1J7JA 5DVZA 2FZ4A 4P0PB 3GRCA 4JNCA 5BW5A 5IXJA 2A9JA 4Q9AA 3BUSA 2O07A 3VISA 2ZQ5A 4FILA 4LJ7A 4J0CA 4PYLA 1IQ0A 2BKEA 4MJLA 1SHKA 2XNSA 3G5LA 1ONSA 1SOWA 5E2IA 4JBHA 1ZWLA 1J21A 1D6NA 2B98A 4CHGA 2Z95A 1GDTA 1RM4A 5CDFA 1J2RA 1UK6A 2VYQA 4QLAA 3LGXA 2E89A 1V6AA 3GOHA 4WE3A 1HXHA 1QO0D 3PBKA 1DIAA 5FHRA 4DMMA 2ZR0A 4BO7A 4F4DA 3O82A 5K0FA 1DAMA 1V5IA 3SC6A 3K0KA 2DTEA 5L3VA 4DUYB 5BRAA 2WUDA 1EQ2A 4KQWA 1UPXA 2Y3IA 6ABPA 5EIXA 2PRSA 4NIMA 2P62A 5AI4A 3VBCA 1GKKA 1XK6A 5BQOA 1NJGA 3FLAA 2VOJA 2EZUA 2GBGA 3ITEA 5TVGA 1YA6A 1YACA 2XOXA 2A57A 4J91A 5TEWA 4MR8B 1K7YA 1VCMA 5LM3A 2CV2A 2MDTA 2NUPA 1MO6A 3HMKA 4KAJA 4MINA 1YVRA 4WH0A 1C9JA 1NP6A 2NZWA 5JPIA 5JAHA 3INTA 2P0AA 4FFWA 2WT8A 3EDRA 3U13A 5IUJC 1IHDA 3CJRA 5TF4A 5ALJA 3HM9A 4PO9A 1PD0A 3PUZA 3E0QA 3I6QA 2JIPA 3JVIA 1R74A 2BH9A 2DSNA 4LI0A 5ALDA 2PD6A 4EYQA 3FWNA 4I1PA 2CXUA 1Q7TA 4L9WA 2QPOA 3NH9A 3A6ZA 3MJRA 5L3RA 1S2DA 3I8OA 4J7CA 5FTNA 3WKCA 5KNDD 4HH3C 5LQNA 1BZYA 4FOPA 1Q0SA 1WCYA 5I9BA 1I2DA 1E3LA 1QE5A 2B82A 1GSOA 2QEQA 2ST1A 2VN8A 3MIZA 1YR3A 1NOIA 1QQ5A 1XDZA 2QTMA 2C4NA 4KYIB 1MC4A 3M4YA 4O4IA 3EJWA 4OYYA 1KQNA 4GI7A 3T52A 2FB9A 1HMYA 2H54A 4P5DA 3TZKA 2V59A 2EBFX 4AN4A 4D82A 4X91A 1XVUA 5C1IA 4KITB 2XWJI 5IHXA 5BSMA 1VKZA 2VNSA 3ZU3A 2A9QA 3T3PB 3HUDA 2PM8A 2EQAA 3A2LA 4UVHA 2ZAMA 3B3FA 3E7WA 1QH8A 1BGXT 2NZYA 2H52A 3E22A 4ZVKA 1QIHA 3Q3JB 3E2IA 4RLSA 3E8XA 4YJHA 2HRZA 4UASA 4BLUA 1OWLA 3ABOB 2QLJA 5HEKA 1YCFA 3S1AB 4D5GA 4EHKA 5EN4A 2ZJ2A 1DJOA 4KR3A 1GRVA 1HDXA 1EVYA 1XXHB 4DMCA 5IJAA 4GKJB 1I5OA 2F90A 4Y98A 4P80A 1Z75A 1ADFA 1PDOA 3ESXA 4MMYB 3UUGA 1K7CA 3JZAA 2ZWIA 2WAAA 1ZIYA 3W4IA 3QFFA 1YR7A 1NSYA 5JDIC 2A5FA 1GEGA 4OFZA 3TJMA 4BRZA 3FVWA 4RTLA 2BIFA 1GLNA 3RSZA 3QWHA 1T1IA 1GAQA 3T95A 2XIQA 1TKAA 4L28A 5DIZA 4CLRA 1MXFA 2NZUG 2EAUA 2QAGA 3ET4A 3KOZA 1NUQA 4TLLB 5CMLA 5CVDA 4ZVSA 5M3BA 4ZHSA 3QEBZ 2J5QA 1ZY2A 3Q11A 2YW9A 2BEWA 2G1PA 3B53X 4JODA 4MP6A 1IHYA 4GOKA 3WNVA 3LWDA 4C0HA 1EHYA 1ZIOA 3E70C 4D97A 2UZ1B 3QNMA 2FLVA 1X0VA 3RC9A 1SPBS 3CCCA 3WP1B 4BLTA 1T4DA 1Q0QA 1WDKA 4B1FA 2QTVB 1JILA 3B36A 3C8DA 3VR4D 4H15A 5F76A 1WZUA 3QX9A 4TOIA 3M5PA 2GH1A 2QRPA 3WZLA 4YRNA 3QPUA 3MS7A 1EFTA 1DX9A 2QD2A 3EVAA 1JLLB 3HP7A 4DJAA 3BS4A 5AP9A 4B09A 1FSSA 4GIBA 3W3AH 2AI2A 5F4BA 3IUMA 2YHAA 3ORHA 4AZ3B 3KOUA 3WGVA 1AVTA 4CQJA 1PO7A 4G01B 2D1QA 2RHOA 3B6ZA 3ESZA 1SBNE 3JZMA 4IVNA 4MRMA 4TTAA 2HK9A 5JBIA 2X86A 4M8SA 3Q87B 3L5OA 1LC0A 4AB1A 2IL1A 1J8VA 1OBVA 2I4OA 3W3ZB 5KVAA 1KRHA 1NKSA 3N0VA 2O1XA 1AKWA 1RZ3A 4J0EA 5LMNB 4CL8A 1P44A 1X14A 1Z5UA 3LT1A 2QP9X 1CHNA 2B8JA 4XSHA 3RVDA 5JU6A 1E32A 3KUUA 2EZ9A 1HQDA 1ADBA 1DAPA 3RJZA 3B8EA 3FNFA 1KA9H 4GYWA 4YRGA 1TM4E 4OXNA 3GRVA 5E6UA 2ZR8A 2AEFA 4FT2A 3HB9A 4L16A 2G9ZA 3WXMA 3B38A 1JE1A 3FNRA 3IEKA 4W9MC 2EP8A 1QKKA 3N2YA 2D4HA 4G9EA 3THWB 4KSBA 4IM7A 2DM6A 1CY0A 1WL8A 2MR6A 1T3ZA 2L19A 3T7DA 3W06A 3NP7A 3KYCB 1U8ZA 3II6X 1SEVA 2WLSA 3V8QA 4EYOA 2DR2A 5KNCA 3U60B 2QU7A 3FZGA 3U1TA 2L18A 4EFLA 1WABA 5LOVA 4KWEA 1ESMA 5IP5A 4QPJC 4YJGA 5HBRA 5J9FA 3I5YA 2CWWA 5IASA 4GQAA 1KI1A 4NBNA 3ZY3A 3CLKA 4JJ6A 3LNCA 2AFHE 1PFYA 3L0DA 5BOVA 4E7OA 4XR4A 2V7PA 5FOXA 3EDYA 4RMIA 2DUMA 3PEUA 1L3BA 1T5HX 3BAZA 4EA8A 5JLAA 5GZ1A 4DIDA 1N2CA 3M5CA 1Q11A 4XUCA 1Z47A 4I1SA 5CHYA 2RI6A 3KZKA 2WM2A 5F1YA 2NTEA 1T0BA 2I3DA 5FUWA 4CKXA 1LCIA 3CF4G 3LL4A 4KGVA 1VJGA 2IT1A 4PQRA 1R00A 1VKHA 3KUDA 1ZD2P 4LECA 2YIJA 3SWWA 5J2UA 3QK7A 2ZM5A 4ARZB 4I3GA 4X71A 5CITA 1KO7A 1XZMA 3P9XA 2UXBB 1BJTA 1EZZA 3HB5X 1T5TA 3VGPA 2A33A 3VR5H 4RSHA 4BNJA 4RVOA 2QLLA 1XMVA 4BP8A 4LJ9A 3ONNA 2H1IA 3AVPA 4JP5A 2JLSA 5A2QA 1Y5NA 3H0CA 3VSEA 1NBIA 2M98A 1WXWA 4JASB 2CFTA 4LGVA 4A6PA 1Y37A 1UMKA 5B53A 2ZS7A 4P5PA 4MDYA 5DCUA 5A6VA 4M3NA 3AWIA 1UKBA 3KFVA 1F8FA 3KX2A 4G25A 3LHKA 3TQRA 3I1JA 1EXWA 3DAOA 4GPZA 3VPHA 2B30A 2IITA 2WKSA 1GPUA 3DHNA 1J70A 3PF9A 3VQTA 1QFJA 2YJ6A 5LDDC 3OPQA 3L7MA 2YHBA 5DMHA 4A0RA 5A4FS 4X95A 2KX7A 1P7CA 3JQ6A 2V9ZA 4OHCA 1UFVA 1UBHS 3GUYA 4H0FA 1CRLA 5K3BA 4JZYA 4B0OA 5CCEA 1ISFA 3LPNA 4YA6A 2WYHA 3AUAA 4HAIA 4BP1A 3PGJA 2PUGA 3TCNA 1DEHA 1WDTA 3KSDO 3LC1O 3O0TA 1YI8A 1JV2B 3F9RA 4RWEA 3GRYA 3ZIAA 2I2XB 1P61B 4RDHA 3WY9A 1OWPA 2D4AA 2LXNA 1CFJA 3FWHA 3GN1A 2ZIXB 5K20A 4DIEA 2E4YA 2W37A 3DMHA 5IAJA 5TXGA 2HQ1A 1II8A 4LYEA 3BSFA 1ZOPA 2VRCA 2D5LA 2WICA 4A8JB 4IJ6A 4XPIB 2LIPA 1VLLA 2CT8A 2O19A 1ZM9A 3ZOZA 2XUIA 3EEIA 3IMKA 3MMXA 3ZQ4A 4NAUA 1Y5LA 5CYOA 3RH0A 3DXXA 3HCPA 1M67A 4GX2A 4KNVA 3RVQA 4LGYA 4X3CA 1XYGA 2OK7A 3OT4A 1DKNA 4PBTA 4BKMA 5JO0A 1KYYA 1KMMA 2VPWA 3GGGA 4TQAA 1E1QD 4JDUA 1M8PA 1VTKA 2ZANA 1T4CB 4OM8A 4R71A 3EPJA 5KU1A 3F6SA 1I51A 2BMDA 2EKBA 3GFRA 3LYUA 5HOEA 3T4UA 1OLUA 4QDUA 4QTUB 5B1IA 5K0TA 2P2NA 2H63A 4AKTA 2PUHA 3VMFA 2E3JA 2QROA 4LXYA 5GWXA 3GPCA 3LQQA 4JR2A 4R1UA 4E2ZA 1NVKA 3W8DA 4EG4A 5FWYB 3LNTA 3WLHA 1PJRA 3KQPA 1R0RE 2IA5A 3NHJA 3JD2A 3PCTA 4H6PA 4IIJA 1VPDA 3CV3A 4LOHA 1SKAA 1P0PA 2ZUSA 1W2HA 3BXEA 5E1MA 1OILA 1WHSB 5SY4A 3WBFA 2PYDA 3RU7A 1IXSB 1GZUA 4Q6BA 3NWPA 1QHFA 5HTOA 1JZTA 4IX9A 4LJ6A 4YDQA 4E5SA 1U8YA 2C1EA 2Y92A 3NC4A 3BGSA 3P9NA 4H35A 1IVSA 4EUFA 3GV0A 2JD2A 4MVYA 2IYWA 4NATA 1TJ5A 3TL6A 4G3XA 4DT1B 4AVYA 3AI3A 2IOYA 3K1AB 5AUNB 4RPLA 3LVRE 1OBHA 5CXSA 5K4HA 1SXJA 2VHUA 3EARA 3TLXA 1Q0LA 4HADA 5KJFA 5B3LA 2UZ3A 2JKYA 3TEJA 3WDKA 1JKJA 5A5EA 1ZG3A 3WGJA 3BJIC 3JQBC 4YRQA 3RFFA 3HCEA 4C0QC 3M6IA 1R6VA 1NR1A 2OG2A 3IO3A 4HBGA 1JDBB 3CVWA 2X8JB 2XKJE 4RIEA 4M9UA 1RLJA 1YGPA 2J3MA 3EVGA 3PWTA 2ZVQX 3WLFA 1BN6A 2NVOA 4QTXA 3HU5A 2AJCA 2GTHA 1E96A 4FMBB 5BVGB 3LRXA 3IP6A 4D25A 1MNAA 1UXKA 4QDZA 1IVYA 3OQ1A 1TYAE 4WZBE 4ARAA 6PFKA 2BHTA 3IIIA 1KVQA 2Q6VA 3AHCA 3V4SA 5JCPA 2PVCA 3N3BC 3LY8A 2VA8A 3P27A 2W6QA 3BDIA 2O1EA 3V2IA 5JAUA 4JVSB 4ETIA 4RO0A 4AULA 5EFOA 3OQHA 3DMNA 3UNXA 3ZW8A 3MGCA 4D9FA 1TF2A 1GVNB 4H7IA 2O8BB 3FCSB 5A9SB 3MJFA 4UU1A 4PCLA 5JMOA 1HKUA 4FWBA 3JYHA 1A9XA 4PC2A 4OK6A 1TQ6A 3IPAA 4CGZA 5K01A 2P40A 4OX9B 1BYIA 2R8YA 3DKKA 2ZB2A 3LUKA 4X97A 4IY1A 2TS1A 3MMPA 1P80A 4YWHA 3U3JA 5A05A 1NATA 4ENRA 1HEIA 2EGHA 1JW9B 3A3KA 3EF1A 2X7JA 4R54A 1RCFA 1CY4A 4F4HA 2G1AA 3H1TA 4C89A 2MWMA 5P8WA 2EG5A 3OWHA 4XX0A 2P9JA 5EP1A 3OJFA 3QHPA 1T26A 1QTNA 2E7ZA 4IUDS 3BQ9A 1WLYA 2IXTA 5EP3A 3TIXB 3ZTYA 4ZYYA 4LWQA 5I45A 3JWIA 2Y77A 1E2JA 1MRSA 3EQ9A 3OMXA 5DSXA 1VIMA 1GPYA 2MIIA 3HCOA 3KFXA 5DNAA 3B5JA 1V8FA 4BNFA 3ZY2A 1DRJA 1JHRA 2AFVA 1RQXA 1V96A 1VMKA 1R9MA 1BVUA 1C9YA 4JBYA 5F21A 2XB2A 1NL3A 2WNSA 3NUGA 4S1WA 3D8BA 4CJXA 1M66A 3JAWB 4B48A 3SZMA 1EXMA 3GLKA 4ERXA 2QSZA 4RZ2A 1XTRA 3DPUA 3TI7A 1EE1A 4AF6A 5IT5A 2UXCB 5AKIA 2BGTA 5TMDA 4A91A 4E31A 4JA2A 2IOFK 4P7KA 4ZHQB 2XNKA 3SQDA 2GUGA 2V8OA 1TCVA 4U0JA 2J3EA 3RJ9A 1GNQA 3EIHA 4W5NA 3V6MA 1YDHA 1G18A 1HT1E 3PNBA 4OIFA 3RDPA 2BBOA 4KQ1A 3EUEA 4Q1AA 3G2QA 3TRKA 2GARA 4HI0E 1MPTA 1XKQA 4C03A 4A0GA 2P3QA 4F4IA 1RJFA 2ONKA 4AJ4A 1YJ5A 4JLKA 1WB9A 4WWHA 5I7SA 2RH5A 1Z16A 3HJHA 5IVHA 2A5LA 3GLSA 1ZVMA 2D59A 1TYZA 4EO4A 2AJ8A 3PNPA 5JTUA 4J2TA 2R7AA 5E6SB 3FOWA 4WVFA 1RXIA 5IFKA 2VDRB 5EMJA 2WU0A 4E2YA 2HLPA 4GI1A 5K0EA 4F3TA 3NVDA 1S4QA 5L3QA 4XPZA 1NQ5A 2R5FA 1ZNZA 1GNPA 2VFAA 5FNVB 4ZIRB 2GJ4A 2HEGA 2MINB 5EYPA 5B6JA 4M46A 1IM8A 1XCMA 3TIFA 1N1GA 4FPXA 5HFJA 3DZ8A 2EKPA 5KVVA 1N7HA 4LXGA 1YE8A 4XM2A 1NGSA 2RG7A 4UBKA 3C5HA 1FF9A 2ONYA 4ND8B 4AY6A 3GA0A 4BMOB 5K0BA 1VMAA 1GUBA 2Z8XA 5CFRA 1BHSA 3BIWA 3H2SA 1EKXA 3GELA 3O47A 3GY0A 4Z99A 2Q4EA 4RW0A 4RVDA 5EI5A 3ZEAA 3C8UA 4BNTA 3DEIA 3U4QB 1M2HA 1EK2A 1T5OA 2YNMD 5FBVB 4JR0A 4DCNA 1ZSYA 1AB6A 4H1UA 4ZODA 2D2EA 2RH4A 2ZSKA 4MYSA 3OZWA 4KVFA 5ECYA 4D3YA 3TLCA 3C1UA 1JU4A 3VPAA 1NHGA 4IIUA 2XDYA 3K9NA 1AIPA 4FKZA 3AOEA 4AURA 1KJ8A 4A2CA 3ZV6A 2J3QA 4I4LA 4MWGA 3FN4A 3ANTA 3H5RA 2VJAA 4FNGA 2V4MA 3FVVA 3AI1A 3EZ2A 3KQLA 4LQCA 4J3FA 3KEOA 4M86A 1QRSA 4ND7A 3AR2A 4DNFA 4FFOA 4CEJB 1EVJA 3WMFA 2C9OA 3ABSB 3IQWA 4W82A 5TQVA 4U00A 1WVMA 4BQFA 5JQWA 2PZKA 2VSYA 1FSPA 4UU0A 3GLFB 2ZTHA 3N6XA 2WU4A 1YBHA 1OYYA 4ZOCA 3NJ4A 1V11B 4JOCA 3G0DA 3H0KA 4CFYA 5P21A 4GNRA 5H0IA 4L50A 1FDVA 1A77A 3K4PA 2XCOA 1TMGE 3N7UA 3OIVA 3VDQA 1AA6A 3GR6A 1QR2A 3BIXA 3NX4A 1BQ3A 1IMOA 1MBZA 1LLUA 1N5MA 1OTHA 3EASA 3QLUA 4WCFA 4PRZA 2JFUA 1KQFA 1A76A 5FO1A 2EFYA 4GBED 4D3XA 5J47A 1QPZA 4TWIA 2G63A 4JY7A 2Y67A 2ZYTX 1KY3A 3OJCA 1CZLA 2DU8A 3DBOB 4K6KA 4G24A 3WQHA 4OV6B 1K7FB 3HDHA 3VBEA 1EBFA 2JCBA 3HPRA 3O8DA 2TECE 3RLFA 4EOGA 3VPBA 2H59A 4E33A 5IH7A 2Y1OA 3SXUB 4RQBA 5A4MS 1KEUA 3O1JC 4BGIA 2GHIA 2ZSDA 4MV3A 1TM7E 2ZBUA 3CBGA 3G89A 4UNQA 3VI3B 4E6PA 2O5CA 2FUG6 5D6NA 3GGDA 4NWIA 3UG7A 2X2OA 3DLCA 2CDRA 5CDYA 1J2EA 3SF0A 3NXKA 1DC7A 4YJFB 1RAEA 4S3MA 3KKZA 4MH0R 1USWA 1L7BA 1SCIA 4ROSA 4R9UC 3QVWA 2ENUA 4CNBA 3I39X 4KH1A 3PQEA 2PSJA 3WIDA 1PJZA 2CNNA 1SUWA 2F7SA 4KQKA 5AKLA 4F60A 2NXEA 4MKGA 3ZY4A 1RYDA 1OXKB 3QBJA 5DI9A 5JS8A 4C2TA 1RHQA 4BJHB 3FPEA 4IPTA 4UMEA 1L3IA 3EFEA 4KJZA 4NCAA 2NVWA 4P32A 4UVGA 4ZAWA 2J8ZA 5C8ZA 3RTAA 1KP9A 3ZW7A 3WBJA 4IDPA 1CZHA 3QQ5A 2V7BA 3EK2A 3LBIA 4PGMA 1M1NB 2JLBA 4RK6A 3U26A 2OD2A 3RSHA 4V3CA 4Q7QA 4DV1B 3UV7A 1Z6TA 2FI1A 4PX9A 3ZHSA 4R51A 1BGVA 2Z98A 2H4XA 3K0FA 3GLIE 4OHFA 2FK8A 4RESA 1TLTA 4YACA 5KTNA 2ZSHA 4X92A 1TPZA 4G1FA 4M55A 4GXQA 2YXPX 3PGXA 4CM8A 1XVIA 3QOWA 2BSXA 5AW1A 4ESVA 3NANA 3MUNA 2I4MA 3F3YA 5DTIA 1RKQA 1SU6A 3RC8A 5GGYA 3S2GA 4EYSA 3D4BA 3UYKA 3H2KA 4MPPA 2FEOA 3ISTA 4B3DA 4UHDA 5TNXA 4DNQA 3N87A 1SHJA 4X93A 4HVLA 4CN8A 3WA7A 1QK3A 4KO4S 2IHVA 4RGYA 1Z0AA 1KE2A 3UICA 4U5QA 5E3IA 1ODTC 1GQYA 2ZTMA 4BN0A 3AVUA 1QHHB 3F2IA 2D8MA 4RVNA 1I24A 2VL7A 1CVRA 3FF4A 4OAOA 2XQKA 4XAQA 4KREA 4YRTA 2D6FA 3FVRA 1Z0KA 3FW1A 4EBBA 1YRHA 1YS2X 2OBBA 3EQ8A 4IH4A 3W5CA 1Y4UA 1JXMA 3PNSA 4YMHA 4B6EA 4Q1VA 1Q1BA 1W5SA 2AWNA 2BJVA 1KS9A 2C9DA 2PJUA 2MSEB 4C0LA 2TSYB 2PMCA 4WLOA 4BBJA 3EZNA 3KR2A 2YWBA 1Z37A 5EHGA 2G77B 4IDOA 2AVNA 3KE9A 1BVHA 5A7GA 4QE3A 4I5GA 4DR4B 1NXTA 2NU7A 2OV1A 4WZZA 3DA8A 4C5AA 3RTEA 3LMKA 3NBXX 3KCQA 3D7NA 3BWDD 4UJ5A 4FNAA 1DARA 4R7GA 4P2GA 3LUGA 3ZGOA 1R6UA 2YVAA 2IIPA 4N3NA 4YH1A 4IOKA 3WGGA 1C8LA 3ZZUA 5I7FA 1X92A 3OF5A 1SZJG 2DCMA 3DMGA 2DLCX 2ID4A 4C6TB 5B4TA 4UOQA 2JLUA 5J4KA 4IKOA 1OHHD 4CLHA 3CVYA 3O83A 2BE9A 4J29A 5D1HA 3T94A 1A1SA 1GGEA 2P1DA 3R09A 5EE5B 1D6JA 2WWGA 4FC7A 5DHFA 3RW9A 1GNSA 1W6UA 3KVYA 4XOUA 1SU8A 1I7LA 3DO5A 4FZ3A 4FCTA 4TVKA 4WOBA 3SR4A 3BCRA 3VR6D 3L9WA 4HMQA 4IFIA 4MCAA 4HXGA 3IGFA 1D4FA 2C2XA 2Q8QA 1SR8A 3AZQA 5C3MA 2XNJA 2QJOA 2IJGX 4BO5A 4BBPA 2I7CA 2W2PA 3QUQA 4L27A 5B7GA 2QD4A 3UXHA 1G5FA 2JGDB 1UCFA 2GF2A 1BCRB 2CV1A 4GSYA 2YZKA 3Q1KA 2GVZC 1GEEA 4JH0A 4OK5A 1ONBA 2AQ8A 3HO6A 4PSCA 3ZWNA 3TDKA 1KI6B 5EIEA 4J16C 2QUJA 2WWIA 2DR0A 1N7JA 1E3WA 2F3UA 1UK7A 2WYVA 3IKLA 4BN5A 2E21A 1NQOA 3DHYA 3PWZA 3BF8A 1Q0PA 3RIHA 3AJDA 3AHHA 4R05A 4F8JA 2WA1A 2E87A 5I7WA 1QJCA 4EW3A 1RXVA 3T99A 3NIFB 4ARBA 3QVTA 3K09A 4KQGA 1ZJ6A 4LZOA 4O0MA 5YASA 4DLUA 2CFSA 1YJCA 4JYMA 3OTHA 2JAXA 2FUKA 4U7PB 1A3CA 4YR9A 3ANNA 1RKBA 5ENDA 4QJ3A 3RI3A 2VUUA 5D5QA 3G5AA 1IIRA 1PF7E 3LCJA 1ZESA 2NXWA 4PAQA 1O4WA 3PLNA 2F9MA 4CT4B 4E94A 4JJFA 3ZTWA 1F0YA 3FMGA 1NJ2A 4N3AA 5EMNA 1AKEA 2R9VA 1OSNA 2ZYAA 4RQTA 4TXJA 1R4NA 4WK6A 3WFZA 1CQZA 3WWEA 4MVJI 2HUNA 1XA3A 4BVHA 4F2PA 4E12A 3DKIA 3R2JA 1FVFA 4WRRA 3THXB 4U2KA 5FA6A 4XQ9A 4DIUA 4QDOA 4GBGA 2V58A 1YB1A 4DMKA 3L0PA 1JLMA 3X2SA 5E3HA 4W1RA 2O57A 4EHBA 4C4SA 2JZNA 3NNNA 3IKJA 4OQMA 3HY6A 2JIOA 1ZPDA 3IMFA 1DC3A 3MYRA 1NUHA 4O0LA 1P2UA 4DNOA 1CY2A 3BB4A 5PGMA 1C3XA 2A3NA 2PD4A 2AC2A 2CL5A 3K15A 3T06B 4L2IB 2B1JA 3NP9A 2JD0A 4BQNA 2F6RA 4QTYA 1QCZA 1Z4MA 2ZATA 3ZWKA 2XVYA 4Z7JA 3OKFA 3G13A 3OICA 1JVBA 1JMYA 4LXUA 3RYTC 1DWQA 4INAA 2F1RA 1CQXA 4CGYA 4DCJA 4J3JA 1KK0A 4WXEA 2JHFA 4O4IB 1M2GA 3K5PA 4HN9A 4W7HA 4W6QA 3RVRA 3W05A 2P5UA 3NALA 4P4NA 4X41A 4UOEA 821PA 3QKTA 1RYNA 5LBUA 2FXIA 1XG5A 2R8EA 2VJQA 1Z13A 2QN7A 5CCDA 3A32A 3LP8A 5J23A 4M9RA 3TLMA 1EX1A 4GE0A 3VH2A 2O4UX 3N74A 3SEFA 4OL9A 4F2DA 1QH8B 2D06A 5LYYA 2J87A 2NADA 4Z7QB 2X8LA 4OHBA 1SVIA 5DI3A 3BEDA 3V7WA 2JGAA 4X66B 4TMTA 4A73A 3KK0A 4LSGA 2I2FA 3LFUA 5DLQC 3U3DA 5JD4A 1T6XA 1SQFA 2XZPA 3BCUA 3NYIA 4PCUA 5DSTA 4ZT6A 3T7EA 2AC4A 1QGDA 1PNTA 5KMGB 4N5LA 1MDFA 1B73A 1DPFA 4OJYA 2JGIA 1UM8A 4N3CA 4BE4A 3T9FA 2PUEA 3A6DA 4I9NA 3ZN2A 1W76A 4H0NA 4IFEA 1QWOA 3PDIA 1C3JA 5BNFA 2B8WA 4H1VA 2WZCA 4Q4JA 1K4KA 2FE4A 2GD0A 3MOIA 3G7SA 4QX6A 2IV2X 1DC4A 3REGA 3WB9A 3I5MA 4ZZ1A 4CXMA 2OXTA 1AXEA 2Z56A 3K92A 3IAS1 4NJOA 4JUDX 2XTMA 3T3OA 3ZWOA 4B8YA 1PL7A 1NT4A 2I2DA 4HB4A 4YDRA 1S01A 1BMFD 2BEWB 1M76A 1NQVA 1VLJA 2D5AA 4RIIA 4KSCA 1GKLA 1NN5A 1XEFA 3X1XA 5KBYA 3SBXA 1UANA 1QYDA 2ONZA 3EF3A 4A92A 1U9IC 5CFPA 4M88A 1LNZA 4C29A 4MPDA 5CH8A 3WBKA 4KQHA 3RS0A 3ZCSA 4FIDA 5LBIA 3W5BA 2VAVA 2BWJA 2HK8A 4QQNA 3WLAA 2A9PA 2Y0CA 2P6PA 3OEED 2JBHA 5G53C 1CUVA 3LOQA 3EDQA 2F3QA 4F71A 1MO2A 3LXMA 3AUKA 4M8IA 4XYBA 4YROA 5ALOA 5F9FA 1B8VA 4F11A 1GA1A 1IN8A 3ZHQA 4DV7B 1KY2A 3VC7A 1HFKA 2VPPA 1I3KA 1P18A 3G49A 4NV3A 5K1ZA 4XWWA 3DYIA 4M1YA 1U28A 1KYQA 1YJBA 3P0FA 3KAKA 1OGYA 4DW8A 1L4LA 5E6RA 1HUQA 3M6AA 1YUBA 2XECA 2GYYA 5AQEA 2CFIA 3A05A 4YRFA 5J2TF 1L4MA 2IXEA 3TNJA 1PQUA 1UAGA 3BKWA 4N39A 3L1IA 3OG9A 2UZIR 4YCAA 4M6WA 3EGXA 3BL6A 1D2HA 1E5QA 3LO8A 4ZHQF 3KQHA 4E5VA 2PDAA 1JI0A 3PUYA 4MHOA 5IWCA 2ALJA 4UCQA 1PKEA 1GTRA 3G0IA 4V0RA 4O4HB 1PWHA 2PUAA 1JB9A 1VRWA 2P9BA 5JISA 5CEFA 1F2TB 3BC1A 1IFXA 5BW6B 2ZDQA 1CR0A 1WMDA 3GVHA 4BYGA 1Y1RA 2HFJA 2P5TB 2CLOB 4EEZA 3D7SA 4F9TA 1XU9A 4XLZA 5DXFA 3QG5A 2FN8A 3L4KA 4Q9NA 2BSAA 2GCOB 4PYJA 1TRHA 3HR8A 4IWNA 5DZSA 2Q6IA 1ZI9A 5B4UA 5KYTA 3ORYA 1T2CA 4I36A 5IKPA 4W8OA 1B8PA 1RYHA 1YDGA 3A6LA 3G0CA 2XYRA 1U8CB 1EP1B 5FBHA 5ADWA 2IEYA 2BGGA 2BGJA 1L0BA 1RP7A 3MGAA 4UAUA 2Q3JA 4ABTA 3PDCA 4QEDA 1GU7A 2Q50A 3KD3A 1IE3A 1V16B 2PGLA 4UUOA 3MHPA 5FNVF 1G3UA 2YFHA 1AO3A 3W79A 5T5QA 1FVHA 1Q95A 2HWKA 2OG1A 2PU5A 1JLHA 1EJ2A 3KR0A 4WEQA 4UEWA 5F78A 4YT2A 1BXRB 3PS9A 4FDMA 2FX2A 1FNBA 1ICEA 3LLCA 5H3LA 4HV4A 4RD0A 3JRNA 1BJKA 4GLBA 3WLSA 2BKUA 1V3UA 2PMDA 4I6EA 4ZGBA 2IEZA 5KWIA 2VS1A 2ZQZA 1E2DA 2XQIA 3IR6A 3GRKA 2QRGA 4MWCA 3SU8A 2WJZB 1KSHA 4RPIA 1N6PA 2VNKA 4CKCB 2MR5A 1PWEA 4GBJA 1PRYA 4NQZA 3PJRA 3GDWA 3K5WA 3Q8MA 4HLDA 1UC5B 2HMWA 3O6VA 4BKPA 3IHLA 4KWCA 4KQ2A 1FDSA 1ODLA 4QXAA 4KTTE 5ALQA 2G9QA 4ZVUA 2EJTA 1SD2A 3I2FA 2H2HA 2V7WA 2O2XA 1W1WA 1PVOA 1L5LA 1D4OA 1SKQA 4JYAB 1WSAA 1DC5A 4IXMA 4D0RA 1Y1KE 4EHHA 2EWVA 2VDQB 1M2OA 1G8HA 2ZSUA 4Q7EA 3DW1X 1XTJA 1PEDA 1VHLA 1W8IA 1DJLA 3FFWA 3JARB 5E9JA 4F2GA 1ZGHA 4TMVA 2H07A 4LF6B 3CKKA 1V2HE 1V45E 4I55A 1PJLA 1C7FA 4U7HA 1B8OA 1CY1A 3BSWA 2XEDA 2FU5C 3FUWA 4B3XA 1FFWA 2Q1WA 4FYJA 3WWOA 4BQQA 3H9CA 4YX9A 1OFIA 2JIDA 3GRAA 3CHYA 1W48A 2ZT7A 2OV4A 3P9SA 3G2KA 1I10A 4NEGA 4NZNA 2WUVA 2ZI7A 5HF6A 1DU4A 5KSWB 4BFYA 2GN8A 2W6JD 1WJGA 2IDMA 3CZCA 5F5NA 2P3OA 1PW7A 4LE0A 3BXOA 3R8FA 1YF3A 5B1HA 2XXAB 4I3FA 2GJSA 4CM6A 1U2SA 3FPFA 3FUCA 3KQQA 2ZTLA 2B3TA 2C8JA 1LPOA 2CK3D 2PFGA 2JFZA 1L1QA 3PHJA 5EMKA 1Y4DE 1ZCFA 5IBCA 3I5UA 5A2GA 1JJIA 4K05A 1N2ZA 2HL6A 1N77A 3RAPR 3DEHA 5F7OA 2NQTA 3IXMA 4NJEA 2GZRA 3T1NA 2PUBA 1NXQA 1XTTA 3M4JA 4BPBA 1DT3A 1M34B 1X3LA 1ZD1A 4R40A 4DNXA 4RABA 1KWKA 3BTOA 3ESRA 4IILA 1KTVA 3MVEA 3USES 2WM8A 4F46A 5EJ8A 1BFKA 2VUHB 3LW7A 5CLHA 3VNAA 4FW8A 3K0SA 4UM8B 4DQ0A 2QVLA 2GBPA 1B15A 4OBXA 5FBRB 3MLEA 2O2YA 2LVBA 4LJYA 4CL2A 4P93A 2XF8A 1EP3B 2FPRA 3OZTA 4I4IA 4PRYA 3FE2A 3SHTA 1PG5A 1LBEA 3DXYA 5SZHB 1HTBA 3RSSA 4CL3A 4JVOA 3TRHA 1W47A 5LMUB 5I47A 3CSDA 4FFBA 4L95C 5BYKA 4F38A 4G5HA 4G0NA 1B6GA 2Z57A 1X77A 5IBQA 5IX8A 3JYOA 4RVUA 2PR7A 1TQDA 3JR7A 2PRJA 3KRTA 2F9FA 4WBXC 1IY9A 5FWXB 4A2QA 1LWOA 2BTQB 5JS6A 4F3RA 3HH8A 5C5CA 4Q9IA 4ND6A 1BRMA 4WGGA 2XKBA 3WICA 1B16A 5IAKA 2FQWA 2WYIA 2WQ7A 3DE7X 4UEKA 1WOMA 4FOSA 5TPZD 5FWNA 3T7RA 3B1FA 1UBUS 2ZJ6A 2ERXA 4Q00A 1BDHA 1WVGA 3LOPA 1Z2CA 4GMHA 3ZYCA 9GPBA 1DQSA 3AR3A 4LZWA 1L5HA 1XQ9A 1RQ2A 3CPHA 2O8NA 3HCBA 5FOWA 4AK9A 5KPDA 2I2WA 3TZ6A 3GFFA 1F0PA 1OHHA 2DFKB 4NC9A 5NULA 1JKJB 2YZGA 4TL8A 3PYLA 4GR4A 2PT6A 1B8NA 2R2GA 3Q3EA 4JLBA 4R1OA 4A3SA 4UUNA 1N8TA 2XE7A 1KI4A 1OKKA 3PT9A 3R75A 3P26A 4WK0B 4DR7B 4FSHA 3DVAB 3ND9A 1QX4A 1BVRA 4OXQA 5ALZA 4M1QA 3TQSA 1EFDN 4MUHA 3UK7A 4RYDA 5EJ2A 2DJIA 2C9MA 3AUUA 2IU3A 1S02A 2N9UA 5JTTA 4JJIA 4B7CA 3D81A 3VKUA 1YJQA 5I3CA 5K7SA 3VV2A 2Z6UA 1O95A 3P2MA 1GVHA 4RAOA 3D8SA 8GPBA 1G21A 3P19A 2FOXA 3C85A 1SUDA 1VIDA 3MTJA 4MDHA 4POAA 1L7PA 4QYIA 3IP7A 1XPJA 5AKZA 2YJ5A 2G7MC 3JWHA 2WV7A 1XFAA 3GA7A 4YDHB 3D7MA 5IBRA 5FL7D 1DVRA 3EWSA 4EI9A 3RVLA 4JLOA 2VCEA 4V24A 1PJ4A 2QTCA 1JPVA 1RACA 2XQGA 1FC0A 4DL9A 4BOYA 1A9XB 1CU1A 4R2JA 1XZBA 4NQRA 4DR6B 3SC4A 4PNPA 4ETNA 2ERCA 2IYUA 3T3HA 1QAQA 2QSUA 4B8ZA 1C1DA 1JR4A 3WL8A 5HZKA 3JQEA 5DBOA 2AXEA 1KP2A 2Y05A 4EZIA 1DGQA 1UJ4A 3E3LA 3LKBA 4HAZA 1N5DA 1R0CA 2DEUA 3GPBA 4TXHA 1AK9A 4EK9A 5BOSA 4RFLA 3LZCA 3U7QA 1A4RA 2IGTA 1SBQA 2B5VA 1CXZA 2PANA 4L5BA 1YB7A 4D9BA 1EXNA 2AQKA 1I4OA 2EF0A 2MSCB 2PH7A 3EQZA 3RIMA 9ATCA 1XTUA 1DRKA 2NV6A 2PX2A 3CZ5A 4YRZA 2BI4A 4WACA 3ITDA 4RENA 1P5RA 1W4RA 1IHXA 2B34A 5C3UA 1NUUA 1QXSA 3ZV3A 3AIOA 2YCLA 4G4GA 1E79A 5GVRA 3RS2A 2VK1A 1DV1A 2XQJA 4WKBA 2D0DA 1Z7WA 3CW8X 1KH2A 3V4ZA 3I4LA 1DQPA 1OW3B 1U02A 4HS9A 1GXSA 2ACWA 3L8FA 4Q16A 4RKWA 5JC8A 4X65B 3ZVNA 5SZJA 1ORWA 4Q21A 1H8ED 4JL6A 2BKXA 3L02A 1HH4A 2FF7A 1L5MA 4GP9A 1U3UA 3SZUA 4YGYA 3TUJC 2OSBA 2PXXA 4BXOA 4D9CA 4YTEA 2VDNB 1QRTA 1LKZA 2C9BA 2OVBA 4ESEA 4UMFA 3CEAA 5GINE 4IIYA 2ZUEA 3G2JA 2WHRA 3HLTA 1FDWA 2EU8A 1SC6A 1E58A 1SCDA 1B6TA 2F9LA 1FU8A 3ZHXA 1DHTA 3DDNA 1EGQA 3ELBA 3BDVA 1RIFA 4B3SB 2X15A 3BREA 4QREA 4LXIA 4AY4A 5SYNA 2WJJA 3NBFA 4ZOEA 4MJ7A 2AEEA 3CE6A 1PAUA 1XTZA 1WQ3A 2HLNA 2YRXA 3W8NA 3KYBA 2O7NA 4XQ0A 4MS1A 3ZK7A 3HCFA 2VTEA 3M9LA 5AUQA 1VCNA 2EFCB 3TL2A 3WKEA 2GZAA 5D84A 2IVFA 3CN7A 3D7LA 1U3DA 1ZD4A 3CT6A 4C78A 4IJUA 4Z4HA 2Q1TA 3C16C 3ZK8A 4ZXFA 1RZRD 4GL4A 2FR1A 4GZMA 2W2VA 4L4ZA 3G1TA 3CEPB 3T1QA 1FBTA 4B9AA 4I9FA 1UEXC 1IXKA 2E0IA 3ELUA 1PX2A 221PA 3R7WA 3ULKA 2Z09A 1E7SA 1E61A 2R1ZA 2G6BA 1K6XA 3COJA 3WISA 3JQ7A 2LNDA 1RHUA 3A4VA 4JSYA 4LV8B 3FMPB 4K6GA 4HB0A 4OIMA 2WBLC 5IN4A 3EXG1 2E55A 2MSWA 5IEJA 1CS0B 1H5UA 2PVPA 5ITZB 2Z5GA 3NHPA 1DI0A 4JZKA 3OKAA 4CIVA 3P2OA 2AFHB 3FMVA 5EZYB 4XJXA 5A3SA 2ZR7A 3RBZA 1L6IA 3GQBA 1XZIA 1TK9A 3GP3A 3A6HA 3P0HA 2IW3A 4IIFA 4MWSA 2HF9A 2VNHA 3GDOA 1XYVA 3HA5A 2AJLI 2YL2A 3OJEA 4L7VA 5BSGA 5HRCA 5U9CA 3RUAA 3Q5DA 4X20A 2JCSA 2HGSA 1YBFA 3GRZA 1W19A 1E2NA 3KXDA 1EI9A 3STUA 1VCOA 4K0RA 1EFRA 1XELA 1XSEA 2O8EB 3UTCA 2XUGA 3INRA 5KQGA 2BBSA 4F4CA 4KFRA 2VJDA 3EXIA 4BU1A 2B69A 4CCSA 5MDHA 1UPUA 1NVTA 5HIIA 1E7QA 3KV1A 3LIPA 4HO1X 3IUQA 4FC6A 5F33A 1IBCA 1ACJA 2X6QA 4Z54A 5ILQA 2PX3A 1HNZB 2JH8A 3F5DA 3OJWA 4IKPA 1BFDA 1NPTO 1Q74A 2A84A 2HO5A 3KSZO 3OU6A 4FDUA 4WN3A 5DXJA 1Z08A 3RLIA 1HT3A 4G65A 2X0EA 1SBZA 1JT2A 3Q4GA 4P81A 1WZIA 2OCDA 2QIOA 3D6VA 3THYA 1EXDA 3A3NA 3KHKA 4CUZA 3R77A 3P5BA 1A1VA 3LY9A 4LCBA 2QM3A 5E38A 1FUYB 3TO5A 1NIPA 1KNXA 3M1YA 4EYGA 4LJLA 2OECA 3C3MA 5D85A 5JRJA 3RYFA 2Q41A 2WPNA 4ECAA 2PLRA 1RC0A 2DLNA 2FP4A 1IPFA 2ZJYA 3CLSD 1BWPA 3O94A 1Y34E 3KTOA 4P4SB 1FSZA 2IPAB 2K7ZA 1TNDA 2OQ2A 3WRWA 3R0IA 4J9VA 3E9RA 1XKLA 3HEMA 1ZSNA 3OX3A 1FP4A 2P9QA 3HK2A 3CUSA 3D8HA 3OM9A 4GDMA 4O4LA 1U0RA 3K6SB 3FVTA 1GGFA 3TBHA 1D03A 1JQJC 2DECA 4TVSA 3ZDEA 1U7PA 3D3KA 5TIIA 4DDHA 1XD2A 2JHPA 5DRYA 3RJTA 5AKGA 2O4CA 1YS1X 1OI4A 1GCIA 5AKEA 2OSVA 1X7DA 5JXWA 4JI2B 1P2VA 4QPZA 4BWGA 1AUQA 1DBRA 1TCBA 3OPXA 4LQ4A 3A4LA 3R7AA 3HBMA 5L8VA 2CYCA 1M75A 1QDLB 3A2NA 1MABB 2WJPA 3CFYA 5CJ2A 2P1RA 4CCWA 3AHDA 3H5NA 4DBVO 4F5YA 2Q3DA 4KH0A 2CMFA 3S2SA 4RK1A 4EZBA 1CB0A 1L8QA 1XF9A 2SBTA 3HSYA 4KHZA 3VOBA 1S7GA 2A9RA 2GJ8A 4QRHA 2JGEA 1OXUA 2FWNA 2NQ8A 3DL0A 4XB6B 4F4UA 3BHNA 3N8NA 4G1EB 2W6ZA 3WO0A 4QT4A 4QOHA 3U17A 1ZH6A 1M7BA 1PCXA 2WHPB 5JDIA 4UHFA 2UVPB 1N6OA 4NG5A 5LQRA 1HDOA 3WSVA 4F9GA 1G7SA 1Z4KA 2IE0A 5T3UA 3TTTA 3W7VA 1JEQA 1RZUA 2B35A 4G2TA 4AKHA 5E3JA 1TZ2A 3ASUA 1R3DA 3IELA 1YL5A 1JSRA 1IH8A 1IYZA 4NDAA 2Y1DA 4O4HF 4QAJA 4ZQCB 2FZCA 3KKLA 4WNAB 4TYYA 2ZREA 3E7PA 4KL8S 1C4XA 4K28A 3KL4A 3CINA 3C7KA 2YFKA 4R7ZA 2X77A 5DEIA 1NQXA 4ALNA 3WYDA 4MRNA 3PDHA 2XVAA 4B3BA 2A1IA 4ILEA 5ADHA 3QU4A 1T2UA 3WYNA 4CM8B 1XLTA 1SCUA 4IUYA 4EHAA 3GJQA 3TLZA 3ND7A 9MHTA 2IGBA 4KRYA 5G0WA 4GGPA 2BE7A 1JA0A 3VJKA 4E3ZA 4EO9A 1U2ZA 2NUBA 4Z2YA 3CF6R 2YMPA 2GO1A 2GZ3A 4D4MA 4LZPA 3FPAA 3UGQA 1T6YA 4HR7A 4MP8A 3T1YB 2BUAA 1TKCA 2YVUA 3K6JA 2BEJA 4PNEA 5DN6D 2YQ4A 1ZU4A 3EAFA 2AYYA 3H5OA 4K9OA 4ZQHA 2DVMA 5BNTA 2F8TA 1AUVA 2XDQB 4AWXA 5I7VA 3IUEA 2PZAA 5LPNA 2JHGA 2HPZA 1FY2A 3HP4A 1TQ4A 1CV2A 3LK6A 2X58A 1ESDA 3QWBA 1SWWA 5FFFA 2IHNA 5CH5A 5LMCA 4MQ6A 2L69A 4GM1A 4BNDA 5HJEA 4OHUA 1Y33E 5BR8B 4TM8A 2PGAA 2JJ2A 3F9CA 2GF0A 3AG6A 4XD2A 2NQ2C 3HYCA 3B6JA 4IS2A 1TIPA 2VRWA 4NECA 3M3DA 1CY6A 1CR1A 3AF2A 5HDBB 3ZEIA 2HQBA 4G1UC 1I6WA 4C3VA 1L5WA 1AXRA 3QU7A 4Q37A 4QBTA 3WGTA 4DSZA 3WAKA 4OI1A 1NHWA 4IZ6A 3ZXSA 1BKYA 3EY9A 4KXNA 3IT1A 3MCWA 3GLGE 4FFNA 4A82A 5LU8A 4MKZA 1NP3A 4ML3A 3S44A 1PQYA 1QOQB 1UBNA 2X9GA 3IQDB 1KBQA 1T3LA 1I7DA 3ZUGA 1WBJB 2PU7A 3GI1A 4IZOA 3A3OA 1T15A 3HABA 1O3YA 4EGAA 2X0JA 1Z88A 3BJEA 1S1CA 2XWBF 1Y1QA 3FSGD 3T38A 5CA1B 2QUIA 2GB4A 1XTSA 5LXTF 1YE5A 4ZDJA 1V1MB 1ZLXA 3NT5A 2DMRA 3D2CA 3BBLA 1Y7HA 1K8YB 5AJZA 1X13A 4HRAA 4URZR 2GLUA 1KH3A 1Q0HA 3K9FC 1YU9A 2QW1A 3TZCA 3R74A 2IP2A 3FOAA 1VSTA 3G2HA 5HMLA 2G0TA 2GBLC 3S0JA 4B6SA 1JL3A 2Y8EA 2O8VA 1VPWA 3S99A 2ECPA 3BE8A 3OZDA 1P7WA 2E4AA 3IHWA 4AECA 1D6MA 5EVCA 2D1YA 3UPTA 3ZDCA 3E61A 3UAXA 1I3LA 3LHSA 4B32A 5EMHA 2EV9A 4JQCA