4R8QA

Structure and substrate recruitment of the human spindle checkpoint kinase bub1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
348
structure length
332
Chain Sequence
b'FIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEFQLGSKLVYVHHLLGEGAFAQVYEATQQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLESAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1
publication title Structure and substrate recruitment of the human spindle checkpoint kinase Bub1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.80 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4r8qA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4r8qA02
4QP7A 4EH9A 1IEPA 3PIXA 4G3CA 3U9CA 1AGWA 2W1IA 2XCKA 1V0OA 3WZEA 2UW6A 3PUPA 4FSWA 3TKIA 3EYHA 2QKWB 4O91A 4ACDA 1OECA 2XKDA 1KE8A 5EK7A 4KKEA 3FJQE 4B8LA 3F5UA 4I5CA 1Y8YA 4JBPA 4MXXA 4RIYA 4TYHB 3WE4A 4YO4A 3IW8A 5AR4A 5GNKA 2XKCA 4YPDA 3CPBA 4C4HA 2BRGA 2YISA 3R9DA 2JIIA 4H3QA 3QHRA 4YTIA 4G3EA 3F61A 1WBTA 2V7OA 2XH5A 3NNXA 4FKJA 3VS5A 4AX8A 4FTQA 1ATPE 3RKBA 1WBPA 3Q4CA 1DAYA 5DI1A 3E3PA 3M42A 4FV6A 3R6XA 3UO4A 5M55A 3E8DA 3N51A 4DC2A 4MBIA 2A1AB 3QRJA 3NZ0A 1K2PA 2XNOA 3P78A 4HGLA 2C6KA 5CYIA 3I5NA 4BDJA 3EIDA 4FTNA 4YJPA 1OIYA 4F1TA 3LFFA 2OG8A 4JVGA 2HXLA 2OJIA 2QO2A 2X8EA 3DQWA 1PMEA 5F20A 5HHWA 2WD1A 2W5BA 2VTLA 4ASEA 2R3HA 4OTGA 4C4IA 2ZOQA 4XG7A 4DITA 5LCJA 5JGDA 5M56A 4YJRA 2WO6A 2PZYA 2IO6A 2PVFA 1SM2A 2ITQA 4IIRA 4LQMA 4ANBA 3A2CA 5KO1A 2OIDA 2YEXA 4PMMA 4ZP5A 1KWPA 4XG2A 4MEDA 2QOCA 3EL7A 3MIAA 5EG3A 1BUHA 5FDPA 4LRJA 4TN6A 1U5QA 3KRRA 3AC8A 4F08A 5CAQA 1R39A 4S30A 2C5XA 2YACA 3RWPA 3MH1A 3QTSA 4ZZOA 3CBLA 3KC3A 1YXSA 2BFXA 4X21A 4RIWB 4BDKA 5J1VA 3HKOA 4U45A 4K6ZA 4EH3A 3RBWA 1M7NA 3OBGA 4M7IA 4OR5A 4XRJA 3VS4A 2YA9A 3QQLA 4FGBA 4GK2A 4EJNA 3C7QA 3L9PA 4UXLA 4UZDA 4XV3A 3L9LA 3Q9WA 3UMXA 3QCQA 4FV4A 4M66A 4ID7A 4X2FA 1W98A 4FODA 3D5WA 4AA0A 3GC9A 3BPRA 2R3GA 4RLLA 4F1MA 1EH4A 4LOQA 4BCMA 1STCE 3ACKA 3DFAA 2PVKA 4LM5A 4AOJA 3R83A 4BKJA 1Q5KA 4LL5A 4RC3A 2UZUE 2R2PA 1BLXA 4NJ3A 2VAGA 2JAVA 4Y46A 1OPKA 2Z7LA 3BX5A 4E5WA 3DFCB 2W9ZB 3V3VA 3FE3A 4QYHA 3AGMA 4IB1A 3VUDA 5DIAA 3TL8A 1Q41A 2PZPA 3W18A 5HNGA 3W2CA 5CU3A 3AMYA 4QPAA 2OF4A 3S2PA 2OIQA 3QZGA 4CV9A 4KBCA 4K8AA 4D0WA 4E73A 3BELA 2IZSA 3FMEA 3F2AA 1FMKA 4U3ZA 1KV1A 4D2SA 3GENA 5ANKA 5EH0A 4YLLA 4YZDA 4M68A 4ASXA 5CAVA 4U7ZA 3SVVA 3RAHA 4F4PA 2VTSA 3O17A 5J7HA 4I24A 3I4BA 3VBXA 3HA6A 5DFPA 2QR7A 5AP0A 1RE8A 5I9XA 2BHEA 3OOGA 1ZY4A 4IHPA 1UVRA 2GDOA 5JZNA 3UBDA 2Y4IB 4EZ7A 3WZJA 4PV0A 4LV8A 3DK7A 4YO6A 4EZ3A 4HVDA 5M4UA 5I5ZA 2YAAA 4JBQA 3VRYA 1XKKA 4NKAA 3L8XA 1M14A 5HTBA 3QRIA 4TL0A 2WZJA 4YURA 3D5XA 3U4WA 2IZRA 3PSBA 4FBXA 5D41A 4CKIA 4ZTQA 4QMTA 3DK6A 3O8TA 4NEUA 2OK1A 3UZPA 4ANOA 5IA1A 4JG8A 3A8WA 1YXXA 5I9WA 1QPEA 4ZAUA 4BZDA 2FUMA 4MHAA 2Y0AA 3FY2A 3MPTA 3ALOA 4X2GA 4Z16A 3QTIA 3TZMA 3W2OA 1BI7A 1VJYA 3DBFA 2FVDA 3RK9A 1XHAA 3SW4A 4F64A 2WEIA 4XG9A 3UG1A 3JY0A 4EK5A 4ZZNA 4IZ5A 5B2LA 3MFTA 3ALNA 1PF8A 4O6EA 3TZ8A 4UMUA 3R8LA 5FQDC 1KE7A 4S31A 4L7SA 4KBKA 2CLXA 3HYHA 3GBZA 3OCGA 2I6LA 4DINA 3PA3A 4BRXA 3IONA 4WO5A 4FTCA 4XV1A 5A14A 3BGZA 3DV3A 2FYSA 4IXPA 4F63A 3FAAA 1WBSA 1ZAOA 3QD4A 2WPAA 1PHKA 4BN1A 2X7GA 5CF8A 3LOKA 3EQHA 3PJ2A 4FYOA 4G9RA 3C51A 2QR8A 5JFXA 2XNEA 4OTHA 3DLSA 4WNPA 3R28A 3W8LA 4F9WA 2RFNA 3MB7A 5ANJA 4YP8A 4CMOA 3ZU7A 4ZSLA 5CXZA 4RJ7A 3UZTA 1GZ8A 4RIXA 4DLJA 5J9YA 2XNGA 3O0GA 4QMVA 4JI9A 4U43A 2I0VA 2HZNA 3IW7A 4FSMA 4WBOA 4EOJA 4KINA 4D9UA 5JMSA 4KNBA 5EOLA 2RGPA 2W1DA 2X2LA 3A99A 4WG3A 4AFJA 4C33A 2WTDA 1ERKA 3PP0A 4X6RA 4BIEA 5EI2A 4EUTA 4M12A 4D0XA 3HEGA 4CKRA 3EL8A 2PVMA 4O1PA 3BGPA 3ORMA 4W4VA 3EFKA 5CT7A 3TTIA 4HOKA 3QCSA 1CKPA 3UODA 4DEAA 3G33A 5HIEA 3QQGA 3ZBFA 3MY0A 4TW9A 4QTBA 2R3NA 3Q5IA 3VULA 5EI6A 3KN6A 4E6QA 5BVFA 1SYKA 3DJ6A 2UZTA 4UV0A 1U4DA 4PTCA 4OAVB 4ERWA 5E8UA 3Q96A 4LL0A 3QTRA 4UN0C 2RFEA 1OPLA 3Q2MA 2QO7A 4PDSA 2Y9QA 4RSSA 2JAMA 4JNWA 3NW6A 2OZAA 2B55A 3W10A 5DR2A 4M69A 4BCPA 1VEBA 4JDKA 3VRZA 4IC8A 5I3OA 4MAOA 3ZXTA 4IFCA 2C0IA 3ORZA 4FKPA 1WBOA 5ANIA 3UGCA 4EOQA 4ZY5A 4K77A 4ENYA 3R9HA 4RBLA 4I5HA 3R71A 2G2IA 4WUNA 4ALVA 2C5VA 4FVRA 4I4EA 5D9HA 2X4ZA 3KRXA 4G9CA 2VWIA 3VBWA 4NCTC 1JSVA 2IN6A 5DN3A 2OI4X 4G34A 5AUWA 2BRNA 2W7XA 2QO9A 3RM6A 4QTDA 1X8BA 5IF1A 3AC5A 4EONA 1MRYA 3V01A 4NW6A 3UC3A 5M4IA 3P5KA 3T9TA 4EUUA 2OW3A 3Q5ZA 3JVSA 4FIIA 3AT2A 3NW7A 1OKZA 5IA0A 2ITOA 2W05A 2PVLA 2X1NA 3IK3A 3PXRA 3TZ9A 2PUUA 3BIZA 3D7ZA 3LCDA 2BILB 1YDRE 1ZOEA 5DVRA 4KABA 1W7HA 3IQ7A 4HZSA 1ZARA 4ASDA 2XRWA 4F6UA 5HNIX 4R3RA 4FKGA 3B8QA 3V6RA 3CIKA 4IX4A 1JKSA 2XIKA 3V5LA 1YXVA 4FL2A 4RFZA 3DBEA 5CSHA 1YI6A 3VS2A 3OROA 4EYJA 2J90A 2RG6A 4TKSA 1J1CA 3SA0A 2WQEA 4MCVA 4NH1A 3VQUA 3W16A 5JSMA 2HZIA 4QMXA 1XH6A 4O0RA 4AE6A 2QHNA 5BVEA 5JT2A 3W2PA 3IGOA 4A4OA 2WTJA 4ERKA 3KB7A 2HZ0A 3AMBA 2CJMA 3FUPA 3AC1A 4BWKA 4KRDA 3A7GA 3HNGA 3R2BA 4V04A 1PXMA 4Z9LA 5IG1A 4RFMA 2PL0A 2BMCA 5IA2A 4Z55A 1DM2A 1OKYA 2XK7A 4I5MA 5E8YA 5AP7A 4L53A 3HV4A 3PIZA 3U6IA 2ZV2A 3NAYA 1NXKA 3PPJA 4IH8A 5L6WL 3VO3A 4MNEA 3ORTA 3QYZA 4UYNA 3FYJX 3P79A 3TG1A 4PTEA 3O71A 4EOMA 1J3HA 1QL6A 3BEAA 3CTJA 3MPAA 3ET7A 4II5A 5CSWA 3ZSHA 4G6LA 3UVRA 5HCXA 4C37A 4MXAA 3BHYA 5DR9A 3DGKA 5CZIA 1YI3A 2FSLX 4IANA 4IX6A 4IWOA 4PY1A 3RJCA 4QNAA 3R2YA 2YN8A 2ZM4A 2W96B 3MFRA 2C0OA 4QMZA 1GAGA 2WXVA 2R0UA 3RALA 3ZOSA 4LOOA 3D0EA 3ULZA 4I22A 4JDIA 1FQ1B 2ITNA 2W5AA 3F7WA 5IPJA 3U4UA 5AIRA 2Z8CA 2BAQA 1AD5A 3AOXA 2QOOA 3RPVA 3QTQA 4XJ0A 4NJDA 4BDAA 2XK6A 3NEWA 1REKA 3JY9A 1YHWA 2VUWA 1XBBA 2VWXA 3GC7A 4RIYB 3TN8A 4JG6A 4NTSA 2F4JA 2UVXA 1XO2B 3P4KA 3I1AA 4JAJA 4CCUA 4N6ZA 4E7WA 3BHTA 3MTLA 4W9XA 2UW5A 2XUUA 3BBWA 4CTCA 1ZZ2A 5I9YA 1JBPE 2RFSA 4FG9A 4LRKA 3GC0A 4WHZA 2W1CA 4UMQA 4BDHA 4EWQA 5IZFA 3PE2A 1OUKA 3I0QA 3NCZA 5BVWA 4BI2A 1PXPA 4XOZA 3HX4A 3UG2A 4G2FA 4CT2A 4AZTA 5HD4A 4MXZA 3QKLA 2W1FA 3H0YA 4J52A 4QMOA 2O64A 1QPCA 1G5SA 3W2QA 4EH4A 2C1AA 4BDBA 4ARKA 4UBAA 1ZYSA 5M57A 2ITTA 4GG7A 4D58A 3EKNA 3NNVA 2VZ6A 3GNIB 4YHFA 3ODZX 3ODYX 2XEZA 4RVTA 3G0FA 3ZLWA 3CQEA 4AU8A 3OW3A 2OJFE 5BX0A 1E1VA 5HLPA 2C6MA 2C5YA 3MV5A 3RI1A 1K3AA 3HMIA 4FV7A 4QP3A 3ZSGA 3QZFA 4CLJA 3FKNA 5AP3A 3SW7A 4XUFA 1H25A 2GNJA 1SVHA 2JIVA 2WQOA 4JR7A 3C0IA 3GFEA 2YJRA 2XIYA 4BI0A 5KUPA 3PWYA 4A9TA 1CKIA 2YCQA 2R0IA 1LUFA 2UW8A 3R7OA 4DAWA 3FZSA 2LGCA 3BQRA 4HZRA 3POZA 5J9LA 4FG7A 2EWAA 4UB7A 3PSDA 4PDPA 3NUUA 1YDTE 3S4QA 2VO0A 2HWOA 3MYGA 3N9XA 4FIGA 5AR2A 3VS7A 3VHKA 4YC8A 1FMOE 3GCPA 3VUMA 3VHEA 5C8KA 2R3KA 2UZLA 3HLLA 3IKAA 4FUYA 4NCTA 5HI2A 3ZEWA 4CZTA 4DEHA 2VU3A 4RT7A 1Q3WA 4GUBA 4F9BA 2VTJA 2ITYA 4UMTA 2GSFA 3TI1A 4M0YA 3ZO2A 3KF4A 3U9NA 4A4LA 3E87A 3ZS5A 1UNLA 2KTYA 2ZV9A 4FT7A 2WGJA 4D4YA 4C3RA 2ITPA 4F9CA 2J2IB 1M7QA 1V1KA 2B54A 2JFLA 1XBCA 4OBQA 2WQMA 4M84A 3GP0A 4WNOA 1DAWA 4Q2AA 3W1FA 3DBCA 3SOAA 2Z7QA 4QMMA 1ZMUA 2X81A 4DEGA 3DNDA 2JEDA 4FL3A 5ACBC 4JDHA 2E9UA 3ZZWA 4DBNA 4IMYA 3UIUA 3P08A 5GJDA 4HNIA 4DEEA 4FV5A 4Z7HA 3R7UA 4Y73A 3FSFA 3PG1A 5DBXA 5E8WA 4JXFA 5DLSA 2OJGA 4DGOA 4U79A 4I92A 4XG3A 3QCYA 3AD5A 2ZMCA 3EQPA 4V0GA 5D12A 3LMGA 4DGMA 4I6BA 3UQCA 4DFYA 2QC6A 4E5BA 4KS7A 4EOSA 2YCRA 5JFWA 5TR6A 4F70A 1E9HA 2C1BA 4AOIA 5BUEA 2RL5A 4WOVA 3E3BX 5DT3A 5HZNA 5AM7A 3UP7A 3NGAA 2W17A 4Q9SA 4FICA 5IISA 2Z60A 4D1XA 3C50A 4HGSA 2WU7A 3FLZA 4FV0A 4U6RA 3MH0A 4CMUA 5KBRA 4IAFA 2VRXA 3OXZA 5KHXA 3AC3A 4C62A 1ZMVA 4FNYA 2WTKC 3V5TA 3VJOA 4DH5A 1R78A 4JG7A 4MF0A 3QX2A 4RZVA 1GNGA 3MH3A 4L7FA 2PWLA 2EXEA 4IX5A 4BBEA 4Q5EA 2KULA 4IM0A 4CMTA 3COMA 4F7LA 3QA8A 3R1YA 3I6UA 4X2NA 5J9ZA 1PXOA 3SLSA 3V51A 4XNEA 2OH4A 3EFWA 5AAFA 2YLFA 3QQKA 3LHJA 5K0XA 4WBBB 2GS2A 5ETFA 2IZUA 5FRIA 4AN3A 4GFMA 5J7BA 2P33A 5K5XA 3P1AA 4JS8A 3LM0A 2X2KA 4QPMA 3TT0A 4RA5A 2UW9A 2F2CB 2QOHA 3VBQA 2FH9A 4QRCA 5AP2A 3OTUA 3UO5A 1H1PA 2UZBA 3HMNA 3IS5A 3KRLA 3KXGA 2ZVAA 3Q32A 2VWWA 4IAKA 4RA4A 3PTGA 4WIHA 3KKVA 3ZRMA 4MXYA 2CGUA 3QC4A 4GVAA 2BALA 2HYYA 2JBOA 5M51A 3E5AA 3MVLA 3L1SA 3Q4TA 3R01A 4CRLA 3BYVA 3CY2A 3A4PA 3EZVA 5HEZA 3TV7A 3RTPA 3WARA 1T45A 2AC3A 1JSTA 5AV4A 5LVNA 1IG1A 3QD3A 2YERA 3I5ZA 2Y4PA 5HX6A 2J0LA 3OP5A 5CY3A 2QQ7A 3FMMA 4WD5A 3AT4A 4F65A 5IH5A 3F88A 3OCTA 4J99A 4MTAA 3ENMA 5CEMA 3O96A 5AUTA 2V7AA 3QTXA 2E9OA 4IFGA 4FSQA 3C4XA 2GFCA 1IASA 4RIXB 3BLHA 5IEYA 2O8YA 1TVOA 2P4IA 1WZYA 2BZKB 4M14A 3VF8A 1JOWB 1HCLA 2WAJA 2YJSA 3R04A 4QNYA 4F1OA 3UQFA 4J7BA 2JIUA 1BI8A 4HGEA 2UZNA 1APME 4FT0A 3H30A 2G15A 2V5QA 2B7AA 3GCVA 2C3IB 3BLQA 4PRJA 4XHKB 5DEYA 3S95A 4ZTSA 1H07A 2XYNA 4I1ZA 5L8LA 4OUCA 5AA8A 2PTKA 4DEIA 4U3YA 2C47A 4U9AA 4EQCA 2WMVA 2GNLA 2XBJA 4JQ7A 4EOPA 5FD2A 2GHLA 2WMTA 2PVHA 5GHVA 4FTAA 4IBMA 1RQQA 2OZAB 4E20A 3HUCA 5H8EA 2HENA 3DU8A 4M69B 3UIXA 5LOHA 2IVVA 5HD7A 2PZ5A 2OIBA 3VBVA 5CASA 5FXRA 4GT4A 4XP0A 2R3QA 5T68A 3T3VA 5LQFA 4BTKA 5CX9A 3QTUA 4E93A 1YRPA 3L9NA 3OCSA 2F9GA 1FGIA 2GS7A 1JKKA 3FLWA 2BKZA 3VS1A 3DBDA 4UZHA 3VBYA 1NVSA 4IJ9A 4DEDA 2LAVA 3PJ3A 4IAZA 3NYXA 3Q4ZA 4QQ5A 1TQPA 5F1ZA 4BWPA 1WAKA 2V55A 3S3IA 1URWA 4HCUA 3LFEA 5FGKA 2GU8A 5EYMA 5AWMA 1Z9XA 4FT3A 4CQGA 4AFEA 2PZIA 4J8NA 3Q9YA 3WF8A 3TZ7A 3MI9A 1Y8GA 2B53A 4E6AA 4S33A 2OKRA 3PA4A 3VWAA 3S0OA 3LLTA 4E8AA 4ONAA 4QMQA 5A4LA 1OIRA 3IOPA 5DRDA 4AQCA 2OGVA 2C3LA 3QFVA 4GIIA 5C27A 4B0GA 4FEQA 4LMNA 3W32A 4YC3A 2EB2A 4S2ZA 2P2HA 2QNJA 3QXOA 4FMQA 3LCTA 4C4FA 4X3JA 4NK9A 4PNKA 4I20A 4MD9E 4EHEA 5J5SA 1UU3A 4YZCA 4A9RA 2HOGA 4C2WA 4RJ3A 4ZTMA 2WKMA 2J7TA 4C36A 2P2IA 1TKIA 1M17A 2VWYA 1XH9A 2WMQA 3SXFA 5DGZA 4RJ5A 4YZ9A 2ITZA 4J98A 3W2RA 4QMWA 2W1ZA 3OFMA 4YMJA 4GEOA 4A07A 3S1HA 4W4WA 4XP3A 5HIBA 5ETIA 2BZHB 2IZTA 3QZHA 2VX0A 3F3WA 4FZFB 3MN3A 3VAPA 4ZJJA 3ZBXA 3QD0A 3UNZA 3DKOA 4MH7A 3TACA 4H3BA 4FTRA 5JGBA 5KMKA 3CJFA 3FLNC 5CS6A 3BU3A 3TXOA 1OKVA 4MNEB 1QPJA 5DEWA 2Y6MA 2RKUA 4C0TA 4EL9A 3KMMA 1YQJA 2J4ZA 2YDKA 3C4WA 3E7VA 3RHXA 5EHYA 1OKWA 5L4QA 3F3ZA 4D9TA 5BVDA 3VC4A 5HTCA 4BVUA 4N0SA 4HVSA 5F95A 4X3FC 4KA3A 3U6HA 1H00A 4ZTLA 2NO3A 5J1WA 1PMVA 3R63A 4QD6A 3H3CA 2JBPA 4FKIA 3RAIA 3UOHA 4AT3A 5HVKA 1ZWSA 1ZOGA 4GJ3A 5AV0A 1OMWA 2UZEA 4BZOA 4O0WA 4YJOA 5CNOA 3KU2A 4QMYA 2YIWA 4DCEA 2W99B 5I3RA 2WMUA 3ZH8A 3C13A 3QQHA 3P7AA 3CJGA 2P55A 1O6KA 3L8SA 3G6GA 4LUDA 4IWPA 5HNBA 4CZUA 5E7RA 2F49A 5LARA 3BYSA 1FVRA 5E90A 4BDFA 2RFDA 3ZDUA 4BCNA 5CAPA 3KVXA 3VS3A 4RRVA 4C2VA 3WF7A 5HCZA 4WT6A 4XV2A 3E8NA 2BTRA 4DH8A 2G2FA 2QURA 2I0EA 3NWWA 3BEGA 3CKWA 3QYWA 4O22A 3LFDA 3UIBA 4CRSA 4C02A 3D9VA 3EHAA 3KEXA 3I0OA 4PWNA 2QLQA 2C0TA 1MQBA 3OWJA 4X2JA 4BICA 4WNMA 4OTWA 3KXMA 4TNDA 1KOBA 5EW8A 4AG8A 4BTFA 3DS6A 3O51A 2XK4A 4BCIA 5IDPA 4BBMA 3WBLA 3ZRLA 4AW1A 3ZC6A 3OTVA 5IA4A 4HVHA 3A7JA 4L9IA 3FBVA 5FWKK 5K9IA 2J0JA 3COHA 4FK3A 4WUAA 4LGHA 3MW1A 5H2UA 4UMPA 2BZJA 4HYIA 1ZOHA 4YHTA 3A61A 3I6WA 2VWZA 3S00A 4CFFA 3DDQA 2ACXA 4WA9A 3RK7A 3QL8A 3MBLA 2GTMA 4UY9A 4AZVA 3PY1A 4YTFA 3R1NA 2VTPA 4G3FA 3V5WA 4EK6A 3PXZA 5B7VA 4YZBA 5FEEA 3DAKA 3LM5A 5BVOA 4K9YA 3BYMA 3RAWA 5C8NA 1Q61A 3QF9A 1J91A 3K54A 3QCXA 4ZLYA 2VWVA 1GZNA 3QU0A 3LXKA 2H96A 2QU5A 4BCJA 5CAUA 4KIKA 5E1SA 5BQ0A 3IECA 4FV8A 2VWUA 5CU4A 4CFWA 3DAEA 1A06A 2J0KA 4H1MA 1F5QA 3Q52A 4QMUA 5L6PA 1PXLA 3JYAA 5ETAA 2QOKA 2ETMA 3C1XA 3NS9A 2R3RA 4WKQA 3R7IA 4O21A 4FSUA 3ZONA 4DGGA 4G1WA 5D7AA 4MKCA 4CTBA 2QODA 2ERZE 1OITA 4M8TA 1OM1A 2ITUA 3NCGA 5DG5A 2PMLX 5CF5A 4O96A 4H1JA 5GZ8A 4J53A 4KS8A 2JKOA 5I4NA 1OUYA 5KMIA 3UOLA 5FBNC 5L8KA 4R3PA 1B6CB 2ZYBA 1SMHA 3FWQA 4AUAA 3MVMA 4W8DA 2WMAA 4IB3A 4AZSA 3DY7A 2JC6A 2X9FA 3II5A 3Q3BA 1SVGA 3LXPA 3UVPA 2WIHA 4J97A 3M11A 2GFSA 1RDQE 2ESMA 4RJ8A 4W4XA 2C6TA 5CLPA 5J8IA 3R8VA 3TNIA 3UDBA 4EQMA 5HLWA 3GI3A 1R3CA 3R73A 1YHSA 1WFCA 1UNGA 2VNWA 5AV3A 4U41A 3RZBA 4I5PA 4V0GB 4DLIA 3KN5A 2VTOA 4QMPA 2CSNA 5LMKC 3A7HA 4YR8A 2X4FA 4O27B 2CGXA 4G3DA 4LI5A 4C3FA 5BNJA 1H0WA 2OFUA 3LPBA 3BKBA 3NUSA 5H8GA 5HBJA 3PWDA 5HG8A 5FXQA 5FG8A 4JOAA 5AMNA 3TIZA 3NSZA 1JPAA 4M13A 3RPYA 4YUQA 2WTCA 3O8PA 3ORLA 4HVGA 5DE2A 2HY0A 3PXYA 4XBRA 1XH8A 3E63A 4FKVA 2WNTA 3ELJA 1I09A 1PKDA 3WF9A 4GJ2A 4EZ5A 4EH6A 5BUJA 4DHFA 3F6XA 3NUYA 1CSNA 3QUEA 2Y7JA 3GU8A 4XH6A 5EYDA 5BVKA 4F0FA 5HLNA 5DOSA 3QKKA 4R7IA 3TWJA 4EQUA 3GXLA 4M97A 1TQMA 4RJ6A 2H34A 4X3FA 4A4XA 1LEZA 2UUEA 3D2IA 4OTFA 2XP2A 1Q24A 2VTHA 3KQ7A 1PMNA 2R7BA 3MJ1A 4OW8A 4RQVA 4P7EA 1XH4A 3L8VA 5HVYA 5M4CA 4O2PA 5EFQA 4P2KA 3DQXA 3FI2A 4XYFA 4BGGA 5BPYA 4D2WA 4FVPA 5EYKA 3AMAA 3SRVA 5HU9A 4RZWA 3F7ZA 4YTHA 1WVXA 4OTRA 4F6SA 5A9UA 2WQNA 4BCGA 2GNFA 4N6YA 4W8EA 5CT0A 5HESA 3ROCA 5I0BA 1KE9A 3OWPA 3LIJA 1TQIA 4E4MA 2RIOA 2WIPA 2BDJA 3D94A 4K11A 4DH1A 2W1HA 5FDXA 1DI9A 4OBOA 3HDNA 4FIJA 3SXSA 2ETRA 2O2UA 3TNQB 1F3MC 5HO8A 2PMNX 2XIXA 3MVJA 1YI4A 4AE9A 2QONA 5DA3A 2ITVA 4D4VA 1GZKA 2JDTA 2BRHA 3DDPA 4E26A 4AZEA 4B9DA 4BYIA 2XF0A 4ITJA 5ANGA 4X0MA 4Y83A 3LJ1A 3PZEA 5HBEA 2SRCA 4GL9A 3QRKA 4D2PA 5CSXA 4E5AX 2BROA 1YKRA 5E1EA 5HX8A 3IO7A 3ORKA 4LRMA 2YABA 1ZRZA 3FMKA 4BKZA 1WBWA 4HYSA 1JKLA 2VX3A 4H58A 5ANOA 2A19B 1REJA 2Q0BA 4ZSAA 3K3IA 2BUJA 4BTJA 2XZSA 3ZFMA 4I23A 3AG9A 3ITZA 4XP2A 3PE1A 3F5PA 5K3YA 3NIEA 3CKXA 4IVCA 4XRLA 4CFUA 4CZYB 3V8TA 5E8SA 1MRUA 3FMHA 1T46A 2IVUA 3QUPA 4FNXA 4YJTA 3SOCA 5JZJA 4HCTA 3OVVA 4IE9A 4A06A 4JQ8A 5KCVA 3D83A 3M2WA 4G31A 3F69A 1K9AA 4NTTA 5CNNA 5TKDA 4ZXTA 2XK3A 1KE5A 1OB3A 3FZPA 4QOXA 1MQ4A 4E4LA 2PVYA 2B4SB 3BLRA 3CQUA 3RCDA 5ICPA 4E6DA 4L67A 3PXFA 5CI6A 5JN2A 2GHMA 3EN7A 3OHTA 4TYJA 4YC6A 2BDWA 1RJBA 2GS6A 2JGZA 2O65A 3ZHPC 3NYVA 3MVHA 4OLIA 3GUBA 3RAKA 4EOOA 5A4CA 5C26A 4IM2A 5CEKA 5JKGA 4YNOA 4YJSA 1JQHA 4I41A 4C59A 2GNIA 2XNNA 3NUNA 2X39A 3NLBA 3GU6A 5JQ8A 3RCJA 2FA2A 4JIAA 3HGKA 2GHGA 3DK3A 1FVVA 3POOA 1V0PA 3QWKA 2FSMX 2BVAA 1OIQA 4RPVA 3VF9A 2YIQA 4IAYA 5FTOA 4PDOA 5DWRA 4AA5A 4ACMA 4FR4A 5JK3A 1XH5A 3CP9A 2UZDA 3DTWA 5CEIA 3VUIA 3BWFA 3OF0A 3SHEA 1LP4A 3CTHA 1M2QA 4I6FA 3VVHA 2DWBA 4GSBA 4YZMA 3SKCA 5IDNA 1U54A 3FHRA 4WRSA 5AAGA 3WE8A 3ZO1A 4AF3A 3HRBA 4WG5A 2VTMA 3RMFA 3PVBA 5BYYA 1PXIA 1UU8A 4U44A 3TCPA 3EFLA 1CDKA 4ACHA 1Q4LA 4WSYA 1IA8A 2F2UA 4IAIA 4L3PA 5GZAA 5LMKA 4D1ZA 2ETKA 5EOBA 3T8OA 3CD8A 2UW3A 3CGOA 3R1QA 2C4GA 3DBQA 1H27A 3OWLA 3ZRKA 2XM8A 3QD2B 4FT9A 2FSTX 5FLFA 4USDA 4QPSA 4G16A 3V6SA 4MX9A 3DKGA 3V04A 3CLYA 2R3JA 3NNWA 4FSYA 5LXMA 4BDEA 3WILA 2W1EA 3LXLA 4EWHA 2OSCA 4NT4A 4PP7A 3KK8A 2WTKB 4UWCA 4IDVA 4BCOA 5CZHA 5CU0A 4FVQA 2WELA 5L2SA 3UPXA 5L2WA 3M1SA 2G01A 2I1MA 4UALA 4GV1A 4Y8DA 5AR5A 2V0DA 3QGWA 5JQ5A 4U40A 3ZEPA 2BAJA 2C69A 3PY0A 4C3PA 1OZ1A 2UW4A 1YOMA 1UV5A 1XR1A 2R5TA 2RF9A 4DFNA 2Z2WA 2PE1A 5KZ0A 2QHMA 3EFJA 1W82A 4I0RA 2QD9A 3KMUA 4NKSA 4CFXA 4FSNA 3BI6A 4NFMA 4TRLA 5CTPA 3NX8A 3HMMA 4BCFA 1H4LA 3JS2A 3VS6A 4XCUA 4B6LA 5K4IA 3PY3A 5EDRA 4HW7A 4FKOA 4BGHA 1IR3A 3W8QA 1MP8A 3RM7A 2BHHA 1UWJA 2E9PA 4FTTA 2E9VA 3GGFA 4K33A 1NY3A 3IG7A 2WQBA 3FQEA 4XOYA 2XK9A 4I93A 4KIPA 4UX9A 4U81A 4EC8A 4G5PA 4RVMA 1H24A 5I9UA 4ANMA 5FP6A 4IACA 5JEBA 4PL4A 2BFYA 3WZKA 4AW2A 1CKJA 1OI9A 4F7SA 2J51A 4TWNA 2OO8X 5TF9A 4BWXA 4FOCA 3NW5A 1OL1A 2IJMA 3AQVA 4PPCA 4GYGA 4O0SA 3RP9A 4FK6A 3ZO4A 2O63A 4K0YA 5AUYA 4NUSA 3IW4A 3OUKA 2B1PA 4IW0A 3BV2A 1Q62A 2CN5A 3CCNA 3LQ8A 3F5XA 3LXNA 4GK4A 2EVAA 4KKGA 4QO9A 4RVLA 3O23A 3OOMA 4YJVA 5CSVA 5AADA 2HCKA 2HY81 4JRNA 2QCSA 4ZTNA 5FM2A 5HG7A 2XS0A 4CSVA 1OPJA 3MSSA 5CQWA 1DS5A 3LZBA 3U8WA 5L3AA 4KIQA 3OBJA 4ZY4A 4XV9A 3R00A 4RG0A 5CEQA 4DGNA 5LWNA 3R30A 3E64A 4DH3A 1H08A 5JRQA 3I79A 4D2RA 5EM5A 3VJNA 4EOIA 4P4CA 5TT7A 3B2TA 3BHHA 4D2VA 1CMKE 5C9CA 3ZLYA 4C7TA 2OBJA 2VO6A 3ORNA 3ULIA 5IMEA 4KB8A 2XCHA 2NRYA 3DB8A 3TNWA 3W33A 2XVDA 4QP9A 4NU1A 4KIOA 2I0YA 4IB0A 5M4FA 2YLEA 1Y91A 4O1OA 4DFXE 3F3UA 3H9OA 1IRKA 4FT5A 1YOLA 4C58A 3OWKA 5HO7A 5I9VA 3K5VA 1Q8YA 1Y57A 3DAJA 3LJ0A 4JDJA 4JT3A 3FI4A 4YJNA 4ZOGA 4QTEA 4EH5A 4QMSA 3Q53A 5CQUA 4QP2A 4FZ7A 2X9EA 1H1RA 4EBVA 3ZFXA 3TJCA 4PPBA 3KULA 4KIKB 2G9XA 3PYYA 2B9IA 4DG2E 4ZSEA 4O0TA 3EN6A 5C8MA 1CM8A 4ACCA 4BGQA 5BYZA 4RX9A 3F3VA 3P0MA 4R3CA 4U80A 4IVBA 2OU7A 2C6IA 1PYXA 5L6OA 1AQ1A 1VYWA 3PLSA 4D4RA 2FB8A 4ZK5A 3FLQA 5E8ZA 5HE3A 2ZM3A 3NUPA 1B38A 3KA0A 4ZJIA 5CVFA 2AUHA 1S9IA 4L52A 3DZQA 3H10A 4O0UA 4TWOA 3UYSA 3KRWA 4BFMA 4EI4A 4AZFA 4M15A 5KMMA 4OGRA 4BCQA 5CVGA 4C4GA 1JLUE 1W83A 2J9MA 3PXQA 4FSZA 3NRMA 4L01A 5E8XA 4EKLA 4YTCA 4FTOA 3CQWA 4LG4A 4MD7E 3R8PA 3FMDA 2DUVA 4KSQA 2JLDA 2WMRA 2C3JA 4ASZA 3CTQA 2Z7RA 4XEYA 3KL8A 4AS0A 2VO7A 4L8MA 2ONLC 4ZS0A 4L3LA 4YU2A 3OY1A 2IW8A 5A4EA 5EYCA 5A4QA 4JIKA 5CF4A 2BRBA 4TWPA 2J0IA 4ALUA 3RNYA 2YWPA 3P86A 2VN9A 1ZMWA 3FZOA 5A3XA 3F3TA 1E1XA 4Y72A 4J95A 3QHWA 2XIRA 3BBTB 2C5OA 2O0UA 2R3LA 2H6DA 2W4JA 2X8DA 3HV5A 5AM6A 2B9HA 4F99A 2P3GX 4YJQA 2IVSA 3H9RA 4KRCA 2CKEA 3RNIA 3FQHA 3FMJA 4FV2A 4UYAA 4YZNA 1ZYJA 4F09A 3UPZA 3ANRA 4BKYA 3IGGA 2F57A 3QXPA 3KXZA 3LFSA 4BCKA 2WMXA 4M0ZA 1M52A 5HQ0A 4X3FB 4BI1A 2J5EA 2OXXA 5B2MA 3V5PA 5K0KA 1OGUA 1YW2A 3FL4A 3LFAA 4FI1A 3RINA 3ZMMA 3SV0A 5KBQA 4QQCA 5TE0A 1FGKA 5F94A 2BR1A 3E93A 3NNUA 4NW5A 5DR6A 1PXJA 3A60A 4FNZA 4R1VA 3THBA 4GG5A 2JKKA 2QVSE 4LV5A 4IX3A 4EH2A 4OBPA 3SRVB 3B8RA 4N4SA 4RWKA 4D4SA 2I40A 3FC2A 5LCKA 2R3FA 4CYJA 4ENXA 5KKRB 5DHJA 5C03A 1ZXEA 1OL5A 4QYGA 3ETAA 5HG9A 4AA4A 4RJ4A 3TNHA 1W84A 3G0EA 4P90A 3MY5A 4L43A 4S32A 3VN9A 1L3RE 2Y8OA 3D5UA 2W06A 3QAME 3SC1A 4A9YA 2YAKA 3FKOA 5ANDA 3IDPA 1HCKA 3F66A 5CSPA 3UE4A 3JPVA 3BYUA 3G90X 5J5TA 3SX9A 3T9IA 5EW9A 1WVWA 1P5EA 4FOBA 4LUEA 4TXCA 3FY0A 4RVKA 4QMNA 4ZTRA 2G1TA 4JX7A 4YSJA 4C38A 4USEA 3EJ1A 1F0QA 1PXKA 4U8ZA 5LMBA 3LE6A 5AV1A 5HG5A 1GZOA 2H8HA 3EQRA 4P5QA 1W8CA 3HZTA 4RX8A 3KGAA 2C3KA 3F9NA 5IUIA 3UQGA 4ACGA 3GQIA 3RK5A 1ZZLA 5IA3A 4AGCA 3CC6A 5L8JA 3EYGA 2V62A 3HMPA 4LYNA 4NWMA 2X8IA 4YNEA 3OEZA 3UTOA 4ALWA 5HU3A 4TYIA 4FZ6A 3O7LB 1M2PA 4L00A 1QPDA 4JR3A 4FKWA 5D11A 5J95A 5KMLA 2BZIB 4GU9A 3VIDA 5JH6A 3ZCLA 4QP1A 2X6DA 5BVNA 4AT5A 1GJOA 2YIYA 2AC5A 3HRCA 2X0GA 2CGWA 2YIXA 1GIHA 4JBVA 1YWNA 3DA6A 4MXOA 4EH8A 4F0GA 5CEPA 3LFCA 3D4QA 2CDZA 2YITA 3GCSA 3REPA 4TY1A 4PPAA 5HCYA 3FMLA 1R1WA 4IVAA 5A46A 4FTUA 4QP4A 3TKHA 4APPA 3D15A 3UJGA 5T3QA 5AX3A 4CLIA 4UWBA 1DI8A 4FA2A 2WMWA 3BHUA 4K18A 3TUBA 2UVYA 2WTIA 2OXDA 3QC9A 4R8QA 4OTDA 2XA4A 2DQ7X 2J50A 2RG5A 3EMGA 2XJ2A 2IW6A 3UC4A 3E62A 4EH7A 1KE6A 4AN2A 1RW8A 1Z5MA 3ORPA 2QG5A 4FKUA 2BPMA 3TIYA 5HO6A 3QZIA 3NUXA 4YBJA 4BYJA 3HUBA 3RPRA 3RHKA 5I9ZA 4RC2A 5EM8A 5AA9A 1U54B 2ONLA 1SNUA 3LJ2A 3BHVA 4HGTA 3RPSA 3CR0A 3C4ZA 5HGIA 5KKRC 3B2WA 4CD0A 3R9NA 3MH2A 1P4OA 4MXCA 1BMKA 1W0XC 4MWHA 5L2QA 3HA8A 3EQIA 3OZ6A 1ZYCA 4HYHA 3UYTA 4E4XA 2ZMDA 2WEVA 2C6OA 4GFGA 4J71A 3L9MA 3TTJA 4AZWA 2XM9A 4BDDA 3HRFA 5HBHA 4QTAA 4F7NA 3QRUA 4IAAA 3PVWA 2IW9A 1H0VA 3I81A 3BE2A 1GIJA 3CXWA 1UWHA 3C4EA 5IMXA 3EQCA 5KZIA 4WSQA 1XH7A 4HPUE 3ROYA 1ZYDA 5AX9A 4FTMA 2CGVA 3PPKA 4NM3A 2VV9A 4FYNA 4FKTA 4EORA 1R0PA 4I21A 3C0GA 3CY3A 3QQFA 4AT4A 4NM5A 4F7JA 3MJ2A 4I94A 4RWLA 4Q9ZA 4RLKA 2JDRA 2ZDTA 1YXTA 4GT5A 3VW6A 3VUHA 4CVAA 2YIRA 3FLSA 4QMLA 3G6HA 2OZOA 5AV2A 5HIDA 5HICA 3GEQA 3DKCA 2A2AA 3EOCA 3WZUA 3QWJA 5A54A 4IADA 3Q4UA 1H1QA 3OS3A 3R0TA 4KAOA 2IWIA 4EC9A 4FKRA 4CT1A 5IUHA 3PVGA 5KNJA 3I7BA 4TT7A 4C57A 4Y5QA 3LFQA 4PMPA 3U87A 1BL7A 2PK9A 4NFNA 3SD0A 1NVQA 1FPUA 4CYIA 5LWMA 1LR4A 1M2RA 3SQQA 2E2BA 1VYZA 3GC8A 3PIYA 2ERKA 2XJ0A 3FKLA 4PP9A 2F7ZE 1P2AA 3R7YA 4C4JA 4CFVA 3BV3A 5JFSA 3DZOA 4X2KA 4H36A 3FXXA 3A62A 5IU2A 3U51A 2G2HA 3EKKA 4FV3A 1KSWA 1YWRA 2YDIA 2YM3A 4GH2A 4RIOA 5GJGA 2YZAA 1H28A 4IDTA 4ZZMA 4KWPA 1PY5A 3D2KA 4EEVA 2BDFA 2OFVA 3H9FA 3KK9A 3TV4A 3MFUA 4BDIA 3JXWA 3GOPA 3UO6A 3H4JA 4XG4A 4HYUA 3A7FA 1UU9A 2GMXA 2YM7A 5K4JA 2R3OA 4NM7A 3BYOA 3GU5A 3PVUA 4I6QA 4OTIA 2J6MA 4G17A 4ZTHA 3VBTA 4BZNA 2A0CX 4Y5HA 3IDBA 2YM6A 4FSTA 2ITWA 4TNBA 2R9SA 4FZDB 2UVZA 5D10A 1Q8UA 2OWBA 4FV1A 1Y6AA 5IA5A 5CAOA 1GIIA 1OL2A 3NIZA 2R3PA 3D7TB 4D5HA 1WBVA 1P4FA 4V01A 5M53A 5AUUA 4LOPA 2GNGA 3IPHA 2OICA 3PZHA 4AN9A 1BKXA 4HNFA 2VTQA 5FP5A 1Q3DA 2YDJA 1YWVA 3Q6UA 2UZVA 4DG0E 3HDMA 3D5VA 5IH6A 4JBOA 4G6NA 4L46A 2BCJA 3KXNA 4E4NA 3U6JA 2ZAZA 3FXWA 4D55A 3EN4A 4BCHA 4PTGA 1R0EA 2GPHA 3HV3A 2BAKA 3FMNA 4F0IA 3FV8A 4DN5A 3SDJA 4EHZA 4KSPA 4M3QA 4GUEA 4B7TA 1Q8WA 1B39A 1XQZA 2X2MA 4FTJA 1QCFA 3GCQA 4EKKA 3G5DA 4YPSA 3GU4A 4JRVA 5AR8A 3AT3A 5F9EA 3BZ3A 3UMWA 2OJ9A 2FO0A 3H0ZA 3FXZA 4E1ZA 3LFNA 3HL7A 2NPQA 3LAUA 4IJPA 5BMSA 1YXUA 3G9LX 3ZC5A 3KULB 3R1SA 3VNTA 2Y6OA 3PJCA 3HP5A 4O38A 1QMZA 3P23A 1U46A 3BQCA 3R8UA 2VX1A 3PJ1A 5EW3A 3DXNA 1JWHA 5AAEA 1XWSA 3QALE 3OEFX 4JX3A 4MWIA 3V8SA 5DMZA 4AGUA 3QTWA 4XG8A 3NYNA 4CFNA 2R3MA 4QQJA 3ZM4A 2EU9A 4R1YA 4XLVA 3CGFA 2Z7SA 4FNWA 3V5QA 2VTAA 4FZAB 4GVJA 5J87A 4EK8A 3TUDA 4L45A 1OL6A 1GOLA 5EDPA 1UU7A 3MY1A 5KMJA 2HXQA 4BHNA 2PY3A 1ZY5A 2EXCX 2QOQA 3A7IA 4S34A 4XMOA 3ZSIA 1WVYA 4AOTA 2OJJA 5AJQA 1URCA 3MIYA 4MK0A 4UMRA 4DTKA 4Y95A 5L2TA 2W5HA 3WYYA 4L6QA 2FGIA 2JKQA 2PVJA 4MQ1A 2X6EA 2R64A 4EK3A 4N70A 4B99A 3OCBA 2AYPA 4TPTA 3ANQA 3WIKA 2EUFB 2PE2A 4B4LA 4USFA 1UKIA 4FL1A 4RFYA 4GCJA 2Y4IC 4DFLA 4ZY6A 2UZWE 2XMYA 4X7QA 3UOJA 4CXAA 3E8CA 1YHVA 4YBKA 2XNPA 3F5GA 2YHVA 4MBLA 3ZXZA 4IC7A 2YM4A 4FTKA 4ITHA 3TJDA 5HE1A 4IM3A 3VUTA 5FEDA 3PRFA 4XX9A 3CD3A 2VTRA 3ORXA 1XJDA 3VQHA 4TZRA 5CI7A 3GCUA 4RWIA 2BIKB 2XYUA 3A4OX 3Q04A 4W9WA 5IEXA 1KV2A 3ZUVA 4TYEA 3ZLSA 2WHBA 3P7CA 4JL9A 3BU5A 3FPMA 4NIFB 3LQ5A 1VZOA 3OMVA 1S9JA 3LVPA 5KHWA 5TOZA 5CENA 4A9SA 3O50A 2HWPA 3GQLA 1WBNA 3L8PA 3OUNB 5CVHA 5HKMA 5LVOA 4XLIA 2REIA 3I7CA 4RQKA 4TYHA 5GZ9A 3PSCA 3DKFA 2B9FA 4YLJA 1PXNA 3IDCA 4CNHA 3ZLXA 3BE9A 4AACA 4DGLC 5LJJA 4BC6A 4LFIA 1H1WA 2WTVA 3DNEA 2WOTA 4KD1A 3K2LA 4PNIA 4CEGA 2B9JA 3HV6A 3OY3A 3R21A 4I4FA 4QYEA 3CE3A 4DEBA 4GT3A 3RZFA 3NR9A 4QT1A 2UZOA 4EK4A 4O0VA 4NZWB 1PJKA 4P5ZA 3UIMA 3ZYAA 1PMUA 3AGLA 2WMBA 3FLYA 3EQBA 3MFSA 2CCHA 5C1QB 4PMTA 4TYGA 2QOBA 4GS6A 1O9UA 1FOTA 2PSQA 5DH3A 4KBAA 5ETCA 5KMOA 1O6YA 4GYIA 2O3PA 4L42A 2YCFA 4JLCA 2VO3A 3AXWA 2PE0A 3IOKA 3OXIA 2JDVA 2WU6A 1Z57A 1GY3A 4ZIMA 2EXMA 2BTSA 1YOJA 3Q9ZA 1H26A 5CWZA 3PJ8A 2HZ4A 2R7IA 3ACJA 5ACKA 4YGAA 3DB6A 4QQTA 5EKOA 2QKRA 2VGOA 2QU6A 4R5YA 2FSOX 2Q0NA 2CLQA 3GOKA 5FTQA 5AP6A 4CKJA 3RWQA 3E92A 3UNJA 5H9BA 2E9NA 5D7VA 2OH0E 5HVJA 1LEWA 2CCIA 3MWUA 3V5JA 3TUCA 3SAYA 3KCKA 3WIGA 3FDNA 4PF4A 5E8VA 3QQJA 5LVLA 4F9AA 2QI8A 5A6NA 5EHLA 3OD6X 4G6OA 2ZM1A 5CXHA 2YCSA 1BX6A 1FVTA 3R7GA 3R7VA 4OT6A 4DYMA 2A4LA 2VTTA 3KVWA 5F4NA 4C61A 2J0MB 5HE2A 2PHKA 4AAAA 2W4KA 5EM6A 5FBOA 3R9OA 2C6EA 1SVEA 1V0BA 5AR3A 5CU6A 1JVPP 2BIYA 5HE0A 2HAKA 4C8BA 2JDSA 4RIWA 1O6LA 3DJ7A 4MYGA 5B0XA 1U59A 3MDYA 3BCEA 3HMOA 4FV9A 4R6VA 4HCVA 2XKFA 1CTPE 2VGPA 2V22A 3GU7A 4PL3A 3RVGA 2OF2A 4ANLA 4ANQA 5CF6A 1OIUA 4PQNA 3DLZA 3KFAA 2DYLA 1PKGA 5EI8A 2QOIA 3AD4A 4YSMA 3FL5A 1NA7A 4RX7A 3AD6A 4HVIA 4AW0A 2UW0A 2PMOX 5CANA 1OL7A 4IQ6A 3W55A 2CPKE 1UNHA 1JAMA 3F2NA 1H8FA 1Q99A 4GU6A 4EHVA 4EOLA 5IEVA 4F9YA 4RGJA 3QKMA 1G3NA 2YM8A 4O0YA 4RWJA 5IH4A 3QX4A 4LGGA 3FI3A 4A7CA 4WRGA 3FPQA 1JSUA 2GCDA 2C6LA 4V05A 3WF5A 4ITIA 3HV7A 3WF6A 1BYGA 3HP2A 3QUDA 4FTIA 3P7BA 4J8MA 3AC2A 2VWBA 1VR2A 5HORA 5AEPA 3RPOA 4GMYA 1UA2A 2CHLA 3LW0A 2ZV8A 4JAIA 3R22A 5AUZA 2X7OA 2P0CA 3C4FA 3PRIA 4FIHA 2PVRA 2WMSA 4I3ZA 3QBNA 3TNPC 3WYXA 4Q5HA 3EH9A 1WCCA 2XNMA 4U42A 4H3PA 4OTQA 4CCBA 3KY2A 3MS9A 3JUHA 3QRTA 4ZLZA 2XK8A 4FUXA 4IVDA 3G9NA 1MRVA 4I0TA 3ZO3A 4EOKA 1Q97A 3LCSA 4FF8A 4Z3VA 5A6OA 4NSTA 5D1JA 4DG3E 5DNRA 5FEQA 3QTZA 2JKMA 2NP8A 2R4BA 4PX6A 3IW5A 4ZJVA 3WZDA 2W4OA 4XG6A 1LPUA 3D7TA 3Q6WA 2GTNA 3T3UA 3BRBA 2QOFA 4BBFA 4IZ7A 2HW7A 4Y85A 3K5UA 1PW2A 3FC1X 4AGDA 3DTCA 3PP1A 3QLFA 5B2KA 4WNKA 2XRUA 4L3JA 2PMIA 4YJUA 2QLUA 3V8WA 4GFOA 2XIZA 3PA5A 4U0IA 5L2IA 3EN9A 3COIA 1SNXA 4FKLA 5AIKA 3E88A 3JVRA 2R3IA 5H3QA 4BDGA 2RSVA 5BMMA 3OW4A 3WOWA 3ZZEA 3R8MA 2JFMA 2JITA 5H8BA 4O0XA 4BIDA 3C9WA 4C35A 3CEKA 1OVEA 3W2SA 4EHGA 2X7FA 2XEYA 2ZJWA 3EN5A 3EWHA 4J1RA 5G6VA 4O2ZA 1J1BA 1A9UA 2XJ1A 4H39A 3FZTA 5GJFA 4FKSA 5E91A 4C4EA 2C5NA 2JD5A 3OG7A 2XNBA 3VUKA 2JDOA 1HOWA 4FC0A 4ANSA 3DT1A 4FIEA 5A4TA 2A27A 3ZUTA 4EBWA 4MVFA 5DT0A 4BF2A 3UP2A 5G1XA 3KXXA 3VW8A 4ANNA 4MNFA 4UWYA 3C5UA 4NM0A 4F6WA 3BGQA 2XBAA 2WB8A 3OXTA 5E8TA 4XS2A 5K5NA 1KOAA 3MA6A 2ZDUA 4BIBA 3O7LD 4TTHB 3EQFA 4D5KA 1ZLTA 3NDMA 3LFBA 1JKTA 4D28A 4K1BA 5E92A 4DH7A 1WMKA 2VNYA 4DFZE 3KXHA 3ERKA 3QLGA 4IB5A 3PFQA 4G3GA 5C01A 3MGYA 4I0SA 2H9VA 3QQUA 5KX8A 3UOKA 5LVMA 5M44A 3DCVA 3RGFA 2PVNA 1NVRA 4PUZA 3GVUA 3DPKA 3BWJA 4K2RA 2UV2A 4QYYA 2CMWA 4UXQA 4Z7GA 5T6KA 4OT5A 2C30A 5TO8A 3DOGA 4L68A 4UEUA 5EDQA 5LVPA 3E7OA 4ZSGA 3O8UA 4EYMA 4WG4A 4BDCA 1Q8TA 3G51A 2YM5A 3KF7A 5IKWA 2HELA 4AGWA 3KMWA 4FX3A 4TWCA 3R7EA 2W0JA 5JGAA 1H01A 5FXSA 5KE0A 4IZAA 5AR7A 3CPCA 2YFXA 4QP6A 3BU6A 2GQGA 4HPTE 1YDSE 3R8ZA 3EZRA 3I60A 4OAUC 1XBAA 2PZRA 3ENHA 4U5JA 3F82A 2NRUA 3QGYA 4W4YA 5DPVA 4OTPA 5HTIA 3EQDA 3OT8A 4I6HA 2B52A 3FZRA 1ZYLA 2IVTA 3PPZA 4IWDA 2VTIA 2ZV7A 4GW8A 5AUXA 4RC4A 2HK5A 4YHJA 3ZTXA 1BL6A 3FHIA 4CFMA 4RX5A 4RMZA 3VS0A 3ZFYA 4BTMA 2VD5A 5AP1A 4C34A 3P9JA 2C68A 3ZUUA 1YVJA 3UVQA 5JRSA 2ZB1A 3EQGA 3WI6A 5AP5A 4ZLOA 4FIFA 3MTFA 4NIFA 4JQEA 4M67A 4B8MA 4QTCA 2I0HA 3TEIA 3O2MA 4MF1A 5CU2A 3E8EA 3PXKA 4IWQA 2QOLA 2BRMA 5DT4A 3GFWA 3FYKX 3FQSA 3CS9A 2ITXA 5LMAA 3NPCA 3IW6A 3QA0A 5AP4A 3Q9XA 3ZDIA 5DRBA 4LGDA 4MBJA 2GNHA 3EB0A 4GK3A 3LCOA 2UW7A 4CV8A 3KRJA 4IZYA 4GRBA 5KMNA 3MPMA 4U97A 1H1SA 2VTNA 4E6CA 2CN8A 2OXYA 5EKNA 2W9FB 3C0HA 3NAXA 3C4CA 3MA3A 3PG3A 3K3JA 2WTWA 3SXRA 5EHOA 3VUGA 2W1GA 4PMSA 4PL5A 4G5JA 4APCA 3G2FA 4IEBA 2F7XE 4QYFA 4R7HA 4AP7A 4E3CA 3KCFA 5BUIA 4X6QC 3GT8A 5IUGA 4KKHA 4L44A 2C6DA 1PYEA 4R5SA 5HOAA 2XKEA 1Q8ZA 3OT3A 3HVCA 2F7EE 5EM7A 4FSRA 4O6LA 4BL1A 4FTLA 4AXAA 3GB2A 1I44A 3NYOA 3UNKA 4AWIA 4ZEGA 1FINA 4LMUA 4QP8A 5CALA 2HW6A 2J5FA 3FSKA 4MD8E 3OC1A 3COKA 1U5RA 3Q60A 5FM3A 3DJ5A 3LCKA 4GIHA 2O5KA 5AUVA 5CEOA 5ANEA 4MQ2A 4CQEA 4A9UA 5ITAA 4D1SA 2XB7A 3TV6A 2EB3A 5JFVA 2HIWA 4BB4A 3D14A 3FZ1A 1Y6BA 2ZB0A 4HJOA 1UKHA 4D2TA 3HECA 4AW5A 2WOUA 3AC4A 4FKQA 1P14A 4J96A 3TKUA 4FG8A 4BHZA 3MB6A 1JNKA 1MUOA 4YLKA 3R02A 3ORIA 1SZMA 3A8XA 4JJRA 5J79A 2DS1A 2WFYA 4XBUA 4ZSJA
chains in the Genus database with same CATH superfamily
4QP7A 4EH9A 1IEPA 3PIXA 4G3CA 3U9CA 1AGWA 2W1IA 2XCKA 1V0OA 3WZEA 2UW6A 3PUPA 4FSWA 3TKIA 3EYHA 2QKWB 4O91A 4ACDA 1OECA 2XKDA 1KE8A 5EK7A 4KKEA 3FJQE 4B8LA 3F5UA 4I5CA 1Y8YA 4JBPA 4MXXA 4RIYA 4TYHB 3WE4A 4YO4A 3IW8A 4O4DA 5AR4A 5GNKA 1WPLA 2XKCA 4YPDA 3CPBA 4C4HA 2BRGA 2YISA 4NE6B 3R9DA 2JIIA 4H3QA 3QHRA 4YTIA 4G3EA 3F61A 1WBTA 2V7OA 2XH5A 3NNXA 4FKJA 3VS5A 4AX8A 4FTQA 1ATPE 3RKBA 1WBPA 3Q4CA 1DAYA 5DI1A 3E3PA 3M42A 4FV6A 3R6XA 3UO4A 5M55A 3E8DA 3N51A 4DC2A 4MBIA 2A1AB 3QRJA 3NZ0A 1K2PA 2XNOA 3P78A 4HGLA 2C6KA 5CYIA 3I5NA 4BDJA 3EIDA 4FTNA 4YJPA 1OIYA 4F1TA 3LFFA 2OG8A 4JVGA 2HXLA 2OJIA 2QO2A 2X8EA 3DQWA 1PMEA 5F20A 5HHWA 2WD1A 2W5BA 2VTLA 4ASEA 2R3HA 4OTGA 4C4IA 2ZOQA 4XG7A 4DITA 5LCJA 1N3TA 5JGDA 5M56A 4YJRA 2WO6A 2PZYA 2IO6A 2PVFA 1SM2A 2ITQA 4IIRA 4LQMA 4ANBA 1WURA 3A2CA 5KO1A 2OIDA 2YEXA 4PMMA 4ZP5A 1KWPA 4XG2A 4MEDA 2QOCA 3EL7A 3MIAA 5EG3A 1BUHA 5FDPA 4LRJA 4TN6A 1U5QA 3KRRA 3AC8A 4F08A 5CAQA 1R39A 2AQXA 4S30A 2C5XA 2YACA 3RWPA 3MH1A 3QTSA 4ZZOA 3CBLA 3KC3A 1YXSA 2BFXA 4X21A 4RIWB 4BDKA 5J1VA 3HKOA 4U45A 4K6ZA 1FBXA 4EH3A 3RBWA 1M7NA 3OBGA 4M7IA 4OR5A 4XRJA 3VS4A 2YA9A 3QQLA 4FGBA 4GK2A 4EJNA 3C7QA 3L9PA 4UXLA 4UZDA 4XV3A 3L9LA 3Q9WA 3UMXA 3QCQA 4FV4A 4M66A 4ID7A 4X2FA 1W98A 4FODA 3D5WA 4AA0A 3GC9A 3BPRA 2R3GA 4RLLA 4F1MA 1EH4A 4LOQA 4BCMA 1STCE 3ACKA 3DFAA 2PVKA 4LM5A 4AOJA 3R83A 4BKJA 1Q5KA 4LL5A 4RC3A 2UZUE 2R2PA 1BLXA 4NJ3A 2VAGA 2JAVA 4Y46A 1OPKA 2Z7LA 3BX5A 4E5WA 3DFCB 2W9ZB 3V3VA 3FE3A 4QYHA 3AGMA 4IB1A 3VUDA 5DIAA 3TL8A 1Q41A 2PZPA 3W18A 5HNGA 3W2CA 5CU3A 3AMYA 4QPAA 2OF4A 3S2PA 2OIQA 3QZGA 4CV9A 4KBCA 4K8AA 4D0WA 4E73A 3BELA 2IZSA 3FMEA 3F2AA 1FMKA 4U3ZA 1KV1A 4D2SA 3GENA 5ANKA 5EH0A 4YLLA 4YZDA 4M68A 4ASXA 5CAVA 4U7ZA 3SVVA 3RAHA 4F4PA 2VTSA 3O17A 5J7HA 4I24A 3I4BA 3VBXA 3HA6A 5DFPA 2QR7A 5AP0A 1RE8A 5I9XA 2BHEA 3OOGA 1ZY4A 4IHPA 1UVRA 1A9CA 2GDOA 5JZNA 3UBDA 2Y4IB 4EZ7A 3WZJA 4PV0A 4LV8A 3DK7A 4YO6A 4EZ3A 4HVDA 5M4UA 5I5ZA 2YAAA 4JBQA 1IS7A 1XKKA 4NKAA 3L8XA 1M14A 3VRYA 3QRIA 4TL0A 5HTBA 2WZJA 4YURA 3D5XA 3U4WA 2IZRA 3PSBA 4FBXA 5D41A 4CKIA 4ZTQA 4QMTA 3DK6A 3O8TA 4NEUA 2OK1A 3UZPA 4ANOA 5IA1A 4JG8A 3A8WA 1YXXA 5I9WA 1QPEA 4ZAUA 4BZDA 2FUMA 4MHAA 2Y0AA 3FY2A 3MPTA 3ALOA 4X2GA 4Z16A 3QTIA 3TZMA 3W2OA 1BI7A 1VJYA 3DBFA 2FVDA 3RK9A 1XHAA 3SW4A 4F64A 2WEIA 4XG9A 3UG1A 3JY0A 4EK5A 4ZZNA 4IZ5A 5B2LA 3MFTA 3ALNA 1PF8A 4O6EA 3TZ8A 4UMUA 3R8LA 5FQDC 1KE7A 4S31A 4L7SA 4KBKA 2CLXA 3HYHA 3GBZA 3OCGA 2I6LA 4DINA 3PA3A 4BRXA 3IONA 4WO5A 4FTCA 4XV1A 5A14A 3B0BC 3BGZA 3DV3A 2FYSA 4IXPA 4F63A 3FAAA 1WBSA 1ZAOA 3QD4A 2WPAA 1PHKA 4BN1A 2X7GA 5CF8A 3LOKA 3EQHA 3PJ2A 4FYOA 4G9RA 3C51A 2QR8A 5JFXA 2XNEA 4OTHA 3DLSA 4WNPA 3R28A 3W8LA 4F9WA 2RFNA 3MB7A 5ANJA 4YP8A 4CMOA 3ZU7A 4ZSLA 5CXZA 4RJ7A 3UZTA 1GZ8A 4RIXA 4DLJA 5J9YA 2XNGA 3O0GA 4QMVA 4JI9A 4U43A 2I0VA 2HZNA 3IW7A 4FSMA 4WBOA 4EOJA 4KINA 4D9UA 5JMSA 4KNBA 5EOLA 2X2LA 2RGPA 2W1DA 3A99A 4WG3A 4AFJA 4C33A 2WTDA 1ERKA 3PP0A 4X6RA 4BIEA 5EI2A 4EUTA 4M12A 4D0XA 3HEGA 4CKRA 3EL8A 2PVMA 4O1PA 3BGPA 3ORMA 4W4VA 3EFKA 5CT7A 3TTIA 4HOKA 3QCSA 1CKPA 3UODA 4DEAA 3G33A 5HIEA 3QQGA 3ZBFA 3MY0A 4TW9A 4QTBA 2R3NA 3Q5IA 3VULA 5EI6A 3KN6A 4E6QA 5BVFA 1SYKA 3DJ6A 2UZTA 4UV0A 1U4DA 4PTCA 4OAVB 4ERWA 5E8UA 3Q96A 4LL0A 3QTRA 4UN0C 2RFEA 1OPLA 3Q2MA 2QO7A 4PDSA 2Y9QA 4RSSA 2JAMA 4JNWA 3NW6A 2OZAA 2B55A 3W10A 5DR2A 4M69A 4BCPA 1VEBA 4JDKA 3VRZA 4IC8A 5I3OA 4MAOA 3ZXTA 4IFCA 2C0IA 3ORZA 4FKPA 1WBOA 5ANIA 3UGCA 4EOQA 4ZY5A 4K77A 4ENYA 3R9HA 4RBLA 4I5HA 3R71A 2G2IA 4WUNA 4ALVA 2C5VA 4FVRA 4I4EA 5D9HA 2X4ZA 3KRXA 4G9CA 2VWIA 3VBWA 4NCTC 1JSVA 2IN6A 5DN3A 2OI4X 4G34A 5AUWA 2BRNA 2W7XA 2QO9A 3RM6A 4QTDA 1X8BA 5IF1A 3AC5A 4EONA 1MRYA 3V01A 4NW6A 3UC3A 5M4IA 3P5KA 3T9TA 4EUUA 2OW3A 3Q5ZA 3JVSA 4FIIA 3AT2A 3NW7A 1OKZA 5IA0A 2ITOA 2W05A 2PVLA 2X1NA 3IK3A 3PXRA 3TZ9A 2PUUA 3BIZA 3D7ZA 3LCDA 2BILB 1YDRE 1ZOEA 5DVRA 4KABA 1W7HA 3IQ7A 4HZSA 1ZARA 4ASDA 2XRWA 4F6UA 5HNIX 4R3RA 4FKGA 3B8QA 3V6RA 3CIKA 4IX4A 1JKSA 2XIKA 3V5LA 1YXVA 4FL2A 4RFZA 3DBEA 5CSHA 1YI6A 3VS2A 3OROA 4EYJA 2J90A 2RG6A 4TKSA 1J1CA 3SA0A 2WQEA 4MCVA 4NH1A 3VQUA 3W16A 5JSMA 2HZIA 4QMXA 1XH6A 4O0RA 4AE6A 2QHNA 5BVEA 5JT2A 3W2PA 3IGOA 4A4OA 2WTJA 4ERKA 3KB7A 2HZ0A 3AMBA 2CJMA 3FUPA 3AC1A 4BWKA 4KRDA 3A7GA 3HNGA 3R2BA 4V04A 1PXMA 4Z9LA 5IG1A 4RFMA 2PL0A 2BMCA 5IA2A 4Z55A 2PN0A 1DM2A 1OKYA 2XK7A 4I5MA 5E8YA 5AP7A 4L53A 3HV4A 3PIZA 3U6IA 2ZV2A 3NAYA 1NXKA 3PPJA 4IH8A 5L6WL 3VO3A 4MNEA 3ORTA 3QYZA 4UYNA 3FYJX 3P79A 3TG1A 4PTEA 3O71A 4EOMA 1J3HA 1QL6A 3BEAA 3CTJA 3MPAA 3ET7A 4II5A 5CSWA 3ZSHA 4G6LA 3UVRA 5HCXA 4C37A 4MXAA 3BHYA 2WSEK 5DR9A 3DGKA 5CZIA 1YI3A 2FSLX 4IANA 4IX6A 4IWOA 4PY1A 3RJCA 4QNAA 3R2YA 2YN8A 2ZM4A 2W96B 3MFRA 2C0OA 4QMZA 1GAGA 2WXVA 2R0UA 3RALA 3ZOSA 4LOOA 3D0EA 3ULZA 4I22A 1WUQA 1FQ1B 2ITNA 4JDIA 2W5AA 3F7WA 5IPJA 3U4UA 5AIRA 2Z8CA 2BAQA 1AD5A 3AOXA 2QOOA 3RPVA 3QTQA 4XJ0A 4NJDA 4BDAA 2XK6A 3NEWA 1REKA 3JY9A 1YHWA 2VUWA 1XBBA 2VWXA 3GC7A 4RIYB 3TN8A 4JG6A 4NTSA 2F4JA 2UVXA 1XO2B 3P4KA 3I1AA 4JAJA 4CCUA 4N6ZA 4E7WA 3BHTA 3MTLA 4W9XA 2UW5A 2XUUA 3BBWA 4CTCA 1ZZ2A 5I9YA 1JBPE 2RFSA 4FG9A 4LRKA 3GC0A 4WHZA 2W1CA 4UMQA 4BDHA 4EWQA 5IZFA 3PE2A 1OUKA 3I0QA 3NCZA 5BVWA 4BI2A 1PXPA 4XOZA 3HX4A 3UG2A 4G2FA 4CT2A 4AZTA 5HD4A 4MXZA 3QKLA 2W1FA 3H0YA 4J52A 4QMOA 2O64A 1QPCA 1G5SA 3W2QA 4EH4A 2C1AA 4BDBA 4ARKA 4UBAA 1ZYSA 5M57A 2ITTA 4GG7A 4D58A 3EKNA 3NNVA 2VZ6A 3GNIB 4YHFA 3ODZX 3ODYX 2XEZA 4RVTA 3G0FA 3ZLWA 3CQEA 4AU8A 3OW3A 2OJFE 5BX0A 1E1VA 5HLPA 2C6MA 2C5YA 3MV5A 3RI1A 1K3AA 3HMIA 4FV7A 4QP3A 3ZSGA 3QZFA 4CLJA 3FKNA 5AP3A 3SW7A 4XUFA 1H25A 2GNJA 1SVHA 2JIVA 2WQOA 4JR7A 3C0IA 3GFEA 2YJRA 2XIYA 4BI0A 5KUPA 3PWYA 4A9TA 1CKIA 2YCQA 2R0IA 1LUFA 2UW8A 3R7OA 4DAWA 3FZSA 2LGCA 3BQRA 4HZRA 3POZA 5J9LA 4FG7A 2EWAA 4UB7A 3PSDA 4PDPA 3NUUA 1YDTE 3S4QA 2VO0A 2HWOA 3MYGA 3N9XA 4FIGA 5AR2A 3VS7A 3VHKA 4YC8A 1FMOE 3GCPA 3VEJA 3VUMA 3VHEA 5C8KA 2R3KA 2UZLA 3HLLA 3IKAA 4FUYA 4NCTA 5HI2A 4O4BB 3ZEWA 4CZTA 4DEHA 2VU3A 4RT7A 1Q3WA 4GUBA 4F9BA 2VTJA 2ITYA 4UMTA 2GSFA 3TI1A 4M0YA 3ZO2A 3KF4A 3U9NA 4A4LA 3E87A 3ZS5A 1UNLA 2KTYA 2ZV9A 4FT7A 2WGJA 2WSCK 4C3RA 4D4YA 2ITPA 4F9CA 2J2IB 1M7QA 1V1KA 2B54A 2JFLA 1XBCA 4OBQA 2WQMA 4M84A 3GP0A 4WNOA 1DAWA 4Q2AA 3W1FA 3DBCA 3SOAA 2Z7QA 4QMMA 1ZMUA 2X81A 4DEGA 3DNDA 2JEDA 4FL3A 5ACBC 4JDHA 2E9UA 3ZZWA 4DBNA 4IMYA 3UIUA 3P08A 5GJDA 4HNIA 4DEEA 4FV5A 4Z7HA 3R7UA 4Y73A 3FSFA 3PG1A 5DBXA 5E8WA 4JXFA 5DLSA 2OJGA 4DGOA 4U79A 4I92A 4XG3A 3QCYA 3AD5A 2ZMCA 3EQPA 4V0GA 5D12A 3LMGA 4DGMA 4I6BA 3UQCA 4DFYA 1W2DA 2QC6A 4E5BA 4KS7A 4EOSA 2YCRA 5JFWA 5TR6A 4F70A 1E9HA 2C1BA 4AOIA 5BUEA 2RL5A 4WOVA 3E3BX 5DT3A 5HZNA 5AM7A 3UP7A 3NGAA 2W17A 4Q9SA 4FICA 5IISA 2Z60A 4D1XA 3C50A 4HGSA 2WU7A 3FLZA 4FV0A 4U6RA 3MH0A 4CMUA 5KBRA 4IAFA 2VRXA 3OXZA 5KHXA 3AC3A 4C62A 1ZMVA 4FNYA 2WTKC 3V5TA 3VJOA 4DH5A 1R78A 4JG7A 4MF0A 3QX2A 4RZVA 1GNGA 3MH3A 4L7FA 2PWLA 2EXEA 4IX5A 4BBEA 4Q5EA 2KULA 4IM0A 4CMTA 3COMA 4F7LA 3QA8A 3R1YA 3I6UA 4X2NA 5J9ZA 1PXOA 3SLSA 3V51A 4XNEA 2OH4A 3EFWA 5AAFA 2YLFA 3QQKA 3LHJA 5K0XA 4WBBB 2GS2A 5ETFA 2IZUA 5FRIA 4AN3A 4GFMA 5J7BA 2P33A 5K5XA 3P1AA 4JS8A 3LM0A 2X2KA 4QPMA 3TT0A 4RA5A 2UW9A 2F2CB 2QOHA 3VBQA 2FH9A 4QRCA 5AP2A 3OTUA 3UO5A 1H1PA 2UZBA 3HMNA 3IS5A 3KRLA 3KXGA 2ZVAA 3Q32A 2VWWA 4IAKA 4RA4A 3PTGA 4WIHA 3KKVA 3ZRMA 4MXYA 2CGUA 3QC4A 4GVAA 2BALA 2HYYA 2JBOA 5M51A 3E5AA 3MVLA 3L1SA 3Q4TA 3R01A 4CRLA 3BYVA 3CY2A 3A4PA 3EZVA 5HEZA 3TV7A 3RTPA 3WARA 1T45A 2AC3A 4NE5B 1JSTA 5AV4A 5LVNA 1IG1A 3QD3A 2YERA 3I5ZA 2Y4PA 5HX6A 2J0LA 3OP5A 5CY3A 2QQ7A 3FMMA 4WD5A 3AT4A 4F65A 5IH5A 3F88A 3OCTA 4J99A 4MTAA 3ENMA 5CEMA 3O96A 5AUTA 2V7AA 3QTXA 2E9OA 4IFGA 4FSQA 3C4XA 2GFCA 1IASA 4RIXB 3BLHA 5IEYA 2O8YA 1TVOA 2P4IA 1WZYA 2BZKB 4M14A 3VF8A 1JOWB 1HCLA 2WAJA 2YJSA 3R04A 4QNYA 4F1OA 1A8RA 3UQFA 4J7BA 2JIUA 1BI8A 4HGEA 2UZNA 1APME 4FT0A 3H30A 2G15A 2V5QA 2B7AA 3GCVA 2C3IB 3BLQA 4PRJA 4XHKB 5DEYA 3S95A 4ZTSA 1H07A 2XYNA 4I1ZA 5L8LA 4OUCA 5AA8A 2PTKA 4DEIA 4U3YA 2C47A 4U9AA 4EQCA 2WMVA 2GNLA 2XBJA 4JQ7A 4EOPA 5FD2A 2GHLA 2WMTA 2PVHA 5GHVA 4FTAA 4IBMA 1RQQA 2OZAB 4E20A 3HUCA 5H8EA 2HENA 3DU8A 4M69B 3UIXA 5LOHA 2IVVA 5HD7A 2PZ5A 2OIBA 3VBVA 5CASA 5FXRA 4GT4A 4XP0A 2R3QA 5T68A 3T3VA 5LQFA 4BTKA 5CX9A 3QTUA 4E93A 1YRPA 3L9NA 3OCSA 2F9GA 1FGIA 2GS7A 1JKKA 3FLWA 2BKZA 3VS1A 3DBDA 4UZHA 3VBYA 1NVSA 4IJ9A 4DEDA 2LAVA 3PJ3A 4IAZA 3NYXA 3Q4ZA 4QQ5A 1TQPA 5F1ZA 4BWPA 1WAKA 2V55A 3S3IA 1URWA 4HCUA 3LFEA 5FGKA 2GU8A 5EYMA 5AWMA 1Z9XA 4FT3A 4CQGA 4AFEA 2PZIA 4J8NA 3Q9YA 3WF8A 3TZ7A 3MI9A 1Y8GA 2B53A 4E6AA 4S33A 2OKRA 3PA4A 3VWAA 3S0OA 3LLTA 4E8AA 4ONAA 4QMQA 5A4LA 1OIRA 3IOPA 5DRDA 4AQCA 2OGVA 2C3LA 3QFVA 4GIIA 5C27A 4B0GA 4FEQA 4LMNA 3W32A 4YC3A 2EB2A 4S2ZA 2P2HA 2QNJA 3QXOA 4FMQA 3LCTA 3LW5G 4JA3A 4C4FA 4X3JA 4NK9A 4PNKA 4I20A 4MD9E 4EHEA 5J5SA 1UU3A 4YZCA 4A9RA 2HOGA 4C2WA 4RJ3A 4ZTMA 2WKMA 2J7TA 4C36A 2P2IA 1TKIA 1M17A 2VWYA 1XH9A 2WMQA 3SXFA 5DGZA 4RJ5A 4YZ9A 2ITZA 4J98A 3W2RA 4QMWA 2W1ZA 3OFMA 4YMJA 4GEOA 4A07A 3S1HA 4W4WA 4XP3A 5HIBA 5ETIA 2BZHB 2IZTA 3QZHA 2VX0A 3F3WA 4FZFB 3MN3A 3VAPA 4ZJJA 3ZBXA 3QD0A 3UNZA 3DKOA 4MH7A 3TACA 4H3BA 4FTRA 5JGBA 5KMKA 3CJFA 3FLNC 5CS6A 3BU3A 3TXOA 1OKVA 4MNEB 1QPJA 5DEWA 2Y6MA 2RKUA 4C0TA 4EL9A 3KMMA 1YQJA 2J4ZA 2YDKA 3C4WA 3E7VA 3RHXA 5EHYA 1OKWA 5L4QA 3F3ZA 4D9TA 5BVDA 3VC4A 5HTCA 4BVUA 4N0SA 4HVSA 5F95A 4X3FC 4KA3A 3U6HA 1H00A 4ZTLA 2NO3A 5J1WA 1PMVA 3R63A 4QD6A 3H3CA 2JBPA 4FKIA 3RAIA 3UOHA 4AT3A 5HVKA 1ZWSA 1ZOGA 4GJ3A 5AV0A 1OMWA 2UZEA 4BZOA 4O0WA 4YJOA 5CNOA 3KU2A 4QMYA 2YIWA 4DCEA 2W99B 5I3RA 2WMUA 3ZH8A 3C13A 3QQHA 3P7AA 3CJGA 2P55A 1O6KA 3L8SA 3G6GA 4LUDA 4IWPA 5HNBA 4CZUA 5E7RA 2F49A 5LARA 3BYSA 1FVRA 5E90A 4BDFA 2RFDA 3ZDUA 4BCNA 5CAPA 2IF8A 3KVXA 4RRVA 3VS3A 4C2VA 3WF7A 5HCZA 4WT6A 4XV2A 3E8NA 2BTRA 4DH8A 2G2FA 2QURA 2I0EA 3NWWA 3BEGA 3CKWA 3QYWA 4O22A 3LFDA 3UIBA 4CRSA 4C02A 3D9VA 3EHAA 3KEXA 3I0OA 4PWNA 2QLQA 2C0TA 1MQBA 3OWJA 4X2JA 4BICA 4WNMA 4OTWA 3KXMA 4TNDA 1KOBA 5EW8A 4AG8A 4BTFA 3DS6A 3O51A 2XK4A 4BCIA 5IDPA 4BBMA 3WBLA 3ZRLA 4AW1A 3ZC6A 3OTVA 5IA4A 4HVHA 3A7JA 4L9IA 3FBVA 5FWKK 5K9IA 2J0JA 3COHA 4FK3A 4WUAA 4LGHA 3MW1A 5H2UA 4UMPA 2BZJA 4HYIA 1ZOHA 4YHTA 3A61A 3I6WA 2VWZA 3S00A 4CFFA 3DDQA 2ACXA 4WA9A 3RK7A 3QL8A 3MBLA 2GTMA 4UY9A 4AZVA 3PY1A 4YTFA 3R1NA 2VTPA 4G3FA 3V5WA 4EK6A 3PXZA 5B7VA 4YZBA 5FEEA 3DAKA 3LM5A 5BVOA 4K9YA 3BYMA 3RAWA 5C8NA 1Q61A 3QF9A 1J91A 3K54A 3QCXA 4ZLYA 2VWVA 1GZNA 3QU0A 3LXKA 2H96A 2QU5A 4BCJA 5CAUA 2LO0A 4KIKA 5E1SA 5BQ0A 3IECA 4FV8A 2VWUA 5CU4A 4CFWA 3DAEA 1A06A 2J0KA 4H1MA 1F5QA 3Q52A 4QMUA 5L6PA 1PXLA 3JYAA 5ETAA 2QOKA 1EL6A 2ETMA 3C1XA 3NS9A 2R3RA 4WKQA 3R7IA 4O21A 4FSUA 3ZONA 4DGGA 4G1WA 4DRBJ 5D7AA 4MKCA 4CTBA 2QODA 2ERZE 1OITA 4M8TA 1OM1A 2ITUA 3NCGA 5DG5A 2PMLX 5CF5A 4O96A 4H1JA 5GZ8A 4J53A 4KS8A 2JKOA 5I4NA 1OUYA 5KMIA 3UOLA 5FBNC 5L8KA 4R3PA 1B6CB 2ZYBA 1SMHA 3FWQA 4AUAA 3MVMA 4W8DA 2WMAA 4IB3A 4AZSA 3DY7A 2JC6A 2X9FA 3II5A 3Q3BA 1SVGA 3LXPA 3UVPA 2WIHA 4J97A 3M11A 2GFSA 1RDQE 2ESMA 4RJ8A 4W4XA 2C6TA 5CLPA 5J8IA 3R8VA 3TNIA 3UDBA 4EQMA 5HLWA 3GI3A 1R3CA 3R73A 1YHSA 1WFCA 1UNGA 2VNWA 5AV3A 4U41A 3RZBA 4I5PA 4V0GB 4DLIA 3KN5A 2VTOA 4QMPA 2CSNA 5LMKC 3A7HA 4YR8A 2X4FA 4O27B 2CGXA 4G3DA 4LI5A 4C3FA 5BNJA 1H0WA 2OFUA 3LPBA 3BKBA 3NUSA 5H8GA 4DRAE 5HBJA 3PWDA 5HG8A 5FXQA 5FG8A 4JOAA 5AMNA 3TIZA 3NSZA 1JPAA 4M13A 3RPYA 4YUQA 2WTCA 3O8PA 3ORLA 4HVGA 5DE2A 2HY0A 3PXYA 4XBRA 1XH8A 3E63A 4FKVA 2WNTA 3ELJA 1I09A 1PKDA 2X0QA 3WF9A 4GJ2A 4EZ5A 4EH6A 5BUJA 4DHFA 3F6XA 3NUYA 1CSNA 3QUEA 2Y7JA 3GU8A 4XH6A 5EYDA 5BVKA 4F0FA 5HLNA 4E45B 5DOSA 3QKKA 4R7IA 3TWJA 4EQUA 3GXLA 4M97A 1TQMA 4RJ6A 2H34A 4X3FA 4A4XA 1LEZA 2UUEA 3D2IA 4OTFA 1N3RA 2XP2A 1Q24A 2VTHA 1EFUB 3KQ7A 1PMNA 2R7BA 3MJ1A 4OW8A 4RQVA 4P7EA 1XH4A 3L8VA 5HVYA 5M4CA 4O2PA 5EFQA 4P2KA 3DQXA 3FI2A 4XYFA 4BGGA 5BPYA 4D2WA 4FVPA 5EYKA 3AMAA 3SRVA 5HU9A 4RZWA 3F7ZA 4YTHA 1WVXA 4OTRA 4F6SA 5A9UA 2WQNA 4BCGA 2GNFA 4N6YA 4W8EA 5CT0A 5HESA 3ROCA 5I0BA 1KE9A 3OWPA 3LIJA 1TQIA 4E4MA 2RIOA 2WIPA 2BDJA 3D94A 4K11A 4DH1A 2W1HA 5FDXA 1DI9A 4OBOA 3HDNA 4FIJA 3SXSA 2ETRA 2O2UA 3TNQB 1F3MC 5HO8A 2PMNX 2XIXA 3MVJA 1YI4A 4AE9A 2QONA 5DA3A 2ITVA 4D4VA 1GZKA 2JDTA 2BRHA 3DDPA 4E26A 4AZEA 4B9DA 4BYIA 2XF0A 4ITJA 5ANGA 4X0MA 4Y83A 3LJ1A 3PZEA 5HBEA 2SRCA 4GL9A 3QRKA 4D2PA 5CSXA 4E5AX 2BROA 1YKRA 5E1EA 1W2FA 3IO7A 3ORKA 4LRMA 5HX8A 2YABA 1ZRZA 3FMKA 4BKZA 1WBWA 4HYSA 1JKLA 2VX3A 4H58A 5ANOA 2A19B 1REJA 2Q0BA 4ZSAA 2WSFG 2BUJA 3K3IA 4BTJA 2XZSA 3ZFMA 4I23A 3AG9A 3ITZA 4XP2A 3PE1A 3F5PA 5K3YA 3NIEA 3CKXA 4IVCA 4XRLA 4CFUA 4CZYB 3V8TA 5E8SA 1MRUA 3FMHA 1T46A 2IVUA 3QUPA 4FNXA 4YJTA 3SOCA 5JZJA 4HCTA 3OVVA 4IE9A 4A06A 4JQ8A 5KCVA 3D83A 3M2WA 4G31A 3F69A 1K9AA 4NTTA 5CNNA 5TKDA 4ZXTA 2XK3A 1KE5A 1OB3A 3FZPA 4O4FA 1MQ4A 4QOXA 2PVYA 4E4LA 2B4SB 3BLRA 3CQUA 3RCDA 5ICPA 4E6DA 4L67A 3PXFA 5CI6A 5JN2A 2GHMA 3EN7A 3OHTA 4TYJA 4YC6A 2BDWA 1RJBA 2GS6A 2JGZA 2O65A 3ZHPC 3NYVA 3MVHA 4OLIA 3GUBA 3RAKA 4EOOA 5A4CA 5C26A 4IM2A 5CEKA 5JKGA 4YNOA 4YJSA 1JQHA 4I41A 4C59A 2GNIA 2XNNA 3NUNA 2X39A 3NLBA 3GU6A 5JQ8A 3RCJA 2FA2A 4JIAA 3HGKA 2GHGA 3DK3A 1FVVA 3POOA 1V0PA 3QWKA 2FSMX 2BVAA 1OIQA 4RPVA 3VF9A 2YIQA 4IAYA 5FTOA 4PDOA 5DWRA 4AA5A 4ACMA 4FR4A 5JK3A 1XH5A 3CP9A 2UZDA 3DTWA 5CEIA 3VUIA 3BWFA 3OF0A 3SHEA 1LP4A 3CTHA 1M2QA 4I6FA 3VVHA 2DWBA 4GSBA 4YZMA 3SKCA 5IDNA 1U54A 1TZDA 3FHRA 4WRSA 5AAGA 3WE8A 3ZO1A 4AF3A 3HRBA 4WG5A 2VTMA 3RMFA 1TFEA 3PVBA 5BYYA 1PXIA 1UU8A 4U44A 3TCPA 3EFLA 1CDKA 4ACHA 1Q4LA 4WSYA 1IA8A 2F2UA 4IAIA 4L3PA 5GZAA 5LMKA 4D1ZA 2ETKA 5EOBA 3T8OA 3CD8A 2UW3A 3CGOA 3R1QA 2C4GA 3DBQA 1H27A 3OWLA 3ZRKA 2XM8A 3QD2B 4FT9A 2FSTX 5FLFA 4USDA 4QPSA 4G16A 3V6SA 4MX9A 3DKGA 3V04A 3CLYA 2R3JA 3NNWA 4FSYA 5LXMA 4BDEA 3WILA 2W1EA 3LXLA 4EWHA 2OSCA 4NT4A 4PP7A 3KK8A 2WTKB 4UWCA 4IDVA 4BCOA 5CZHA 5CU0A 4FVQA 2WELA 5L2SA 3UPXA 5L2WA 3M1SA 2G01A 2I1MA 4UALA 4GV1A 4Y8DA 5AR5A 2V0DA 3QGWA 5JQ5A 4U40A 3ZEPA 2BAJA 2C69A 3PY0A 4C3PA 1OZ1A 2UW4A 1YOMA 1UV5A 1XR1A 2R5TA 2RF9A 4DFNA 2Z2WA 2PE1A 5KZ0A 2QHMA 3EFJA 4Q7JA 1W82A 4I0RA 2QD9A 3KMUA 4NKSA 4CFXA 4FSNA 3BI6A 4NFMA 4TRLA 5CTPA 3NX8A 3HMMA 4BCFA 1H4LA 3JS2A 3VS6A 4XCUA 4B6LA 5K4IA 3PY3A 5EDRA 4HW7A 4FKOA 4BGHA 1IR3A 3W8QA 1MP8A 3RM7A 2BHHA 1UWJA 2E9PA 4FRFA 4FTTA 2E9VA 3GGFA 4K33A 1NY3A 3IG7A 2WQBA 3FQEA 4XOYA 2XK9A 4I93A 4KIPA 4UX9A 4U81A 4EC8A 4G5PA 4RVMA 1H24A 5I9UA 4ANMA 5FP6A 4IACA 5JEBA 4PL4A 2BFYA 3WZKA 4AW2A 1CKJA 1OI9A 4F7SA 2J51A 4TWNA 2OO8X 5TF9A 4BWXA 4FOCA 3NW5A 1OL1A 2IJMA 3AQVA 4PPCA 4GYGA 4O0SA 3RP9A 4FK6A 3ZO4A 2O63A 4K0YA 5AUYA 4NUSA 3IW4A 3OUKA 2B1PA 4IW0A 3BV2A 1Q62A 2CN5A 3CCNA 3LQ8A 3F5XA 3LXNA 4GK4A 2EVAA 4KKGA 4QO9A 4RVLA 3O23A 3OOMA 4YJVA 5CSVA 5AADA 2HCKA 2HY81 4JRNA 2QCSA 4ZTNA 5FM2A 5HG7A 2XS0A 4CSVA 1OPJA 3MSSA 5CQWA 1DS5A 3LZBA