4R97B

Crystal structure of the fab fragment of kko
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DIQMIQSQKFMSTSVGDRVTVTCKASQNVGTNVAWYQQKPGQSPNALIYSASYRYSGVPDRFTGSGSGTDFTLTITNVQSEDLADYFCQQYNSYPLTFGTGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic description of the immune complex involved in heparin-induced thrombocytopenia.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords platelet factor 4 antibody KKO light chain
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r97B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r97B01
1WK0A 2R2HA 3KJ4B 3QXDA 1OY3B 4EOWL 3R1GH 4AT6B 3FB6B 5HI3D 1A6ZB 1UEMA 3MJ8A 4LK4A 2VDLH 3W81A 3QUYC 3ABZA 5EOCH 2F74B 2CRZA 3NAAL 3O2DA 1ZHLA 1SYVA 1Y18B 3DGCR 3FB5B 5EU3B 4UAOB 1R0AH 4TPRL 1F5WA 1XGUA 4Z7VA 4A6YH 4LASH 3MSPA 1RZFL 3LEVL 4U1MB 1KNOA 1R5IB 1LO3H 2AXFA 4Z7UF 2IC2A 4R4BA 3GIZL 3QPXH 2AJZA 4YDLB 5IP4A 1GH7A 4G80B 3K1DA 3O9WB 5IKCA 3U9PL 1FVEA 4WI8A 4X6CE 5C3TA 3H8NA 4M43L 4MLIA 1NL0L 2IFFL 2ZUYA 3FQTB 4NQEB 3O41B 3GMOB 1HHGB 4G6JL 2X40A 5LCVL 2VH5H 1MLBA 3FO0H 5EA0L 4RRPG 4Q6IC 2FX9L 3QFJA 4E42A 2DLIA 4FNLL 1QSFB 2FBJL 3DX8A 4HUUB 3F58H 1G7LB 3SKJH 1U3HB 4XVTH 5C0AA 4FZ8L 3LKPB 4ZPVA 1MFBH 3VFRA 1CGUA 1H0DB 1Z0NA 1S5HB 2XZCL 3HPLA 5EUOB 4WEBL 1X7QA 3CLEH 5DR5H 3WLBB 2XFXA 5KJRL 4OZIB 1T7XA 4PJHA 5K93A 1YEHH 1J1OH 2EIZB 3NPSC 2ADJB 3U48A 3T4YB 4LP5A 3MGTA 2Z93A 3M1BB 4P3CH 2VUOA 4OFYA 2G9HA 3IDXH 3PL6B 3NCMA 4HPOH 4HUWA 1JMXA 1T0NA 3SBWA 5GSRB 3HE6A 4QYOB 2UYLB 1BVKB 3L1OH 3ULVE 3VDCA 4BFIB 1MJJA 3T1FB 4FHBD 4NN7B 3HMWL 1S7QA 4L4TA 2CKBA 1QLRA 2EDKA 1U8HB 3QG7L 1TCRA 2BERA 5KS9E 3B9KC 1CE6B 5A2KH 3WIFA 3H9SA 2EDYA 4HUVA 4JCMA 1G6VK 5AWNH 3QO0A 4PY8I 5JHDE 3MLWH 3TIEB 1MCFA 3VRIA 2W9EL 3L3JB 2A6IA 4PFEA 5BO1H 4LHUB 1WBXA 1CFSA 3WMSA 2NPLX 1OTTD 5ALCL 3MRGA 2V2TB 1JPSL 2DLHA 3WFCH 4WFHE 5HYQA 1PKQA 4ODVL 4R90H 5F7MC 5ADPL 1TQCB 1XZ0B 4EQ2A 1EFXD 3QSKB 4L8BA 1CFBA 2VDNL 4LKCB 4DKAA 1IQDA 3NIDF 4KUZL 3MBED 5D93C 5F3BB 3O45B 3TBWA 3OAYH 1GGBL 4FMKA 4MA7H 5T33L 2NY6B 3SE9L 4K2UH 3VXME 3W11C 5IBTH 3PWPE 1TENA 4KJPD 4X4XB 4G8GE 3T0XA 2Q6WA 5M7QA 5C0AE 2W9DH 1OF2B 1F90L 5DRXA 3TO2B 4XC1L 3LRHA 1UXWA 3QEHB 1KBGH 1ERNA 5D7JB 1K8IB 2AXGB 4ZTPL 3MLUH 3THML 1YNLL 3PNWB 4ODUB 2BHYA 4XMKL 1U8LA 1FNSH 4NN5B 1GZPA 3C87A 3D0LB 4YHPA 3I6LD 4GKZB 4OCYH 2E8ZA 5J6GB 4KRPB 3VGEA 4CL7A 5ECJE 4F7PB 1PY4A 4P57B 2X4UA 2ENYA 2IWGA 3UMTA 4HK3N 1TXKA 5C0JA 4TNWF 1KIQB 3OJ2C 2VSCA 2R69L 2JJTA 5GS0C 1YMHB 2P1YA 3UCRA 1WICA 3G9AB 3MA9H 3QWQB 4XWOD 2DTMH 4PTTA 4O58L 3S6CA 4ZUUA 2OZ4A 4CVWA 1HYSD 5GRZA 4APQD 3ARYA 2HFGL 5D1XB 1XCTB 3CLEL 3CVHH 3WS3A 1D9KC 3V7MA 4GRWH 3EHBC 3H3BC 4YPGB 1OWRM 4LVNC 5EDXA 1FLRH 3QIWD 2MCPH 1JFQL 3C60D 3GB7A 4FFWD 1ZGLB 5F8RC 2IAND 4UB0L 4NC2B 1C7TA 4NQSA 3Q5TA 1BIIA 1SMAA 3NTCH 4LCWD 1U92B 1EPFA 5CBAB 2FZ3A 3IFLL 1EK3A 3PWPB 1YECL 3EOBA 4ZTOL 1F4YL 1FNGB 3F5WB 3MXVL 4NC1E 1VB9A 1FYTA 2J4WH 4K7PH 5DD6B 1JPST 3O4OC 1FZKA 5I1AB 3BZ4B 4F3FA 5I16B 3VW3H 2P4AB 3H0TA 4UT7H 1RHHB 3IDJA 1CDYA 5FUZL 3U30C 3UPRA 3JV6B 2APVA 2WBJA 3GSNA 2DQUL 2YZ8A 4RWYL 1MCLA 4K2UL 2A83A 1R3LA 4HXAL 5JZ7D 3LVEA 5E08L 2F58H 4NP4H 2DBJA 1CG9B 2XOTA 3DHMA 4S1QH 1LNUB 4QTIL 1L6XA 2R8SL 2PTTB 4MCZB 1MUJB 3IDYC 2Z31B 1HH9A 1PSKL 2AJVH 2QHLA 4U6YA 5D7IF 4JM2B 4JO4L 3RIAF 3TT3L 2R1WB 4YK4B 1J5OL 4GFTB 1YQ2A 4NNXA 1P84J 3E0GA 2VDNH 4I3SH 3ZYOA 5FB8B 4HXBH 32C2A 5E6YA 4R0LB 3IGAA 1JGLL 3FT4B 4UQ2B 2W9LA 3RVTD 2GJ6D 5HHME 5A2JH 2IAMB 2WIMA 2VJXA 3RWEB 1IRAY 1F6FB 3HMWH 3K8LA 3T1WA 2BNQA 5EU4B 3VD7A 4ELMA 3MBEC 3S37H 4G42A 1KT2A 1I8MA 2HKFH 3FOLB 3WKMH 3U46A 1UM5L 3HI1B 1R3HB 3W11D 5ESAA 3SOBH 3C8HA 1E4XL 4Q9QL 5HYJE 5E6ID 5B4MC 5JW4Q 1ZK9A 3WL9B 4U1HA 2WAHA 5H8DA 5DI8B 4FQXB 4JDTL 4KRPD 4V1DA 3WSQL 1PY9A 1NFIA 1RUKL 5ALBL 3RTQA 3A6CL 2ZG3A 3VXSA 4PRID 4GG6F 1N6QH 3D25B 4BH8A 1A6TA 1JNLH 2Q76A 3TO4B 2FX7L 4ODVH 2CMRL 1G7QB 3REVB 2YPVL 3QHZH 5JQHC 4FTVD 2DQHH 4LBEB 1S7RB 3HFMH 5KVEH 5TDPB 4PLOB 3BO8A 1ND0B 3CFDB 3IKCA 4PTUA 5TDOA 4JREC 1P1ZA 4WW1A 2E7HA 4LL9A 1A1NA 2BFVH 4OB5H 3MRPA 3MODL 1TETL 1DVFA 1HZHH 5J11C 3UTSB 4JRYB 2K9UA 4WIQA 4WHTB 1ZE3C 1J0HA 5DF0A 1V7NH 4PJGB 1HCFX 4MXVF 3GSWB 4APQC 5JW4N 4LNRB 4W4OA 1AGDA 2QJDA 4PJ7E 3BXNB 2IPKA 2AXJA 3SCMD 1CFTA 2EEAA 3KYMA 3MREB 3BAEH 5B38G 2OS7A 2VRAA 4DUWA 4EI6B 3O2VH 2A1WH 2Q8AL 1FIEA 4Z7VF 3RP1A 4QHKI 1EZVY 5DJCA 1AI1H 4MAUH 1RZGA 4PJ7A 4L8DA 4HJ0C 4Z76B 5EU5A 2GAZA 2R1XB 5EB9A 4JFQA 1A6VH 1XFPA 1QO3A 2G60L 4P49A 3DUHA 3TN0D 4A6YL 5FGCB 5DC9B 3CFKA 1MREL 3WIHH 1A7QH 3NOIA 3QAZC 4QGTA 4XP5H 4N1CA 3F12B 3HR5A 4KK9C 3BVNB 2B39A 3GI9L 3S37L 3ARGC 3OB8A 4H8WL 1BZ9A 4F7TB 4U6XA 5HHOD 2YN5A 1EA9C 43CAA 2RR3A 4MS8D 1H3TA 4A6YA 3OQ3B 4PGDA 3QRGH 1UZ8A 4PJ5E 5JZ7C 3D3VA 1OTUD 4ZQKB 4QXGL 3ILQC 1NGYB 2WUBL 3PGDA 4KHTH 4XTRD 1MCPH 2A77H 2FJHB 3ZE0E 4FQ2H 3MV9B 4MAYA 4LAQH 4WV1A 1ETZA 4OQ1A 5IT2H 4WI7A 3CNKA 1M6OA 4HIEA 2VLJA 2VXUL 1WGOA 5GGSA 3WNKA 4PJFE 2NW3A 1CGXA 5E5MB 1NDMB 5T1MA 4OGYL 1FNEA 4GG6B 1BZQK 1A6AA 5FOJA 4Z7OF 4IJ3C 1RZJL 4HHAA 2BRQA 2X4PA 4JFFE 4PRHB 1FE8L 5DWUL 1NBZA 4QHKJ 4CGTA 1YNTA 3S88H 3U2SA 3GHBL 3MRJA 4KTDL 5ICXB 1XGPA 2CJUL 4EEEA 1A5FL 4U7KA 2FO4A 2YPLB 2FX8L 2ZOKB 2BOBB 3FQRA 1X5FA 3EAKA 4GW1A 5F71A 4J1UA 2XXMB 3FT3A 1OP9A 3FTGA 1AIFB 5CS7A 3VRLF 4B0MM 4CU7A 4PV8B 4UQ3B 5F7DA 5TGBB 4KAQH 4Y16B 2J8UB 3QO1A 5K59E 1A9BB 4E41E 2Q7NA 1Q9KB 3HUJE 1IM3A 3S3PA 3RPIB 4F8QA 4PRPE 3AS1A 5CIPA 2EKSB 1G1CA 3T0AA 3JWOC 5MEPB 2OQJB 1MEXL 2R1YA 5D5MF 4ODXA 5DA0B 5JIPA 1OAYL 5DK2B 1BD2B 4NQTA 3B3IB 4BSWB 1M7XA 5JUEH 3HZMB 1KCRL 1T83A 5EO0B 2RFXB 1O7SA 2UZYB 3KXFE 5DJXA 1ZLUK 1C5CH 5F7WC 1RZIA 1KEML 1FV1B 3F65A 3OKEB 4JHWL 4GSDL 1MCKA 4JFYB 1XF3A 1T20B 1ONQA 5IK3A 4RMVA 1Y0LB 3UJTL 5K9OA 3WKML 3VH8A 4UT6H 4WO4C 2JB5H 2YXFA 4P2QE 5A2FA 2K1MA 5MI0B 1RV6X 2BNRD 4EN3C 5A2LH 2ILLA 1ZEAH 5H94B 5T5NG 3U0WH 2HFEB 4PJAA 3SCMC 1T21A 1UWGL 2ZPKL 4ELME 1QFUH 1T0MA 5C0GA 3N50A 4YEFA 2IGFH 4ODHL 3TO4C 5JW5B 4BZYA 1S7TA 2NY4B 1RIVH 1VFBB 4Y5XC 5HGDB 4XMKH 4C56D 5SWSB 4ZS7L 1FFPA 2GTZB 4P3DA 1HHIB 2VXVL 4JLRA 4KV5E 4NO2B 2R4SL 3VWKB 3OX8A 4OLUH 1JNJA 4OF3A 5DEZA 5I76B 1JFQH 1QBMH 4NOFA 5DD0H 4YDVB 1R24A 1FP5A 4OCNC 2VLJD 4IRSD 3KS0H 5HHPB 2W9DL 3BIBX 1E4WH 2B20A 2ERJB 4GW4B 4K8RL 4X6DA 5KBNC 1F11A 3VMNA 3X13A 5B21A 4U6HB 1CVSC 1P4IH 4KGLA 3C2SA 3TCLA 2GQHA 4Z7WF 2V7HB 5J13B 2H41A 2EE9A 1IGCL 4DCQA 2VE6B 4G8GB 5DZOA 4LLDA 4ZUSB 2A9ML 1I1CA 4RDQF 4I18C 5L2JB 4I0CC 2AV7B 4JHAL 3L3DB 3VFMA 3L7EA 4Z7UA 3VXUA 5BVJA 3EFFB 4GH7B 3LKSA 5DZLA 1D5ZA 2PUQT 1D5MA 4X98B 4RNRA 4G9DB 2YR3A 4RZCA 3L5HA 4M1CC 5E6ZA 1CD1A 4P9HL 4AIOA 2O5ZL 2XN9A 4NBZB 2VNCA 4KROC 5ACZA 4HZAA 4JREB 2XRAH 4M48L 3UTZB 3CSYB 1VSCA 4JANB 2ZUSA 1AXSB 1IGFL 4U3CA 3AM8A 4JN2A 4TSAH 1JUFA 4P46A 3W5NA 5DFVD 5I1CL 2NY6C 2Z8VC 4FZEL 1J9CT 3DO7B 1HQRA 2DQTH 5I66A 3IS0X 3L5WB 3EZ8A 3JWDL 4E41B 5HPOA 3PXHA 4PJDE 5JO5B 4AEHL 4XPAL 5T3ZH 1CXFA 4N68A 3RI5F 3RWFB 3TA3B 1HI6B 2PO6A 3ARDB 4J3WA 4M7KH 5GS1A 5L7XH 3ULVF 1JF6A 5I1EH 4KC3B 5JOEA 3B9EA 4YE4L 1RMFL 3ESVF 1QLFB 4PRBB 2LE9A 5LBSL 4ZFOA 3MQIA 2NY5C 3ARFA 1IMHC 4Q9CA 1KLGA 5DRZB 3VI4E 1V3MA 3FO2B 5GISH 3UZVB 4PJCB 1DQDL 1NMBH 4LIQH 3WV0A 1YNLH 4QY8B 1JGEB 1FZJA 2IPTH 1N6VA 1F6LL 3W9EA 4M3JA 4YHNA 2HYMA 4DVBB 2MKWA 5ESVA 1AD0A 2J8UF 4OB5L 4PJBA 1QOKA 4P5MA 1KJMB 4ZUWA 4P4KC 1CLOH 1QRNA 4BELD 3TC9A 1WT5A 2IMMA 1IAOB 1OSPH 3BGFC 3H7BA 2EDJA 3WKNA 4OT1H 1FSKB 1CR9L 2ENSA 3QI9A 4WO4D 1HEZB 2HA1A 3MA9L 4NRYA 5JOPE 5DFWH 4FXGB 5HYFA 2V2XB 3S5LB 4M6ML 1R3JB 1KJVA 4NQCE 3WDJA 3RUGF 5C08A 3E6FB 4KKLD 2D7NA 3CVIL 1HSAB 4X9FA 4ZNCD 1OGAB 2NY5H 4K3HA 4H1LA 4YHZL 3NZHL 1T4KA 4HK0B 5E9DB 2J8HA 3CDFA 5FYJU 3TO4D 1MFDL 5ISZA 1C1EH 3CLFL 1AE6H 1C12B 5I1HL 2CKBL 4G6KL 4KXZI 4HD9A 2YPVH 3SDCA 2EH7H 2BVEA 4G8IA 4P2OB 1QVOA 3MLXL 2EYSB 3GGWB 4LCIH 4ZOBA 1H15B 3G6AA 4KAQL 3VXPA 3KPNA 5EORH 5JW3H 5KVFH 3C6SB 1ZHBA 4M6AA 2YUWA 3QDJB 2X4OB 1MFEH 4K07A 2FNBA 3RU8H 4D9LL 4R7NA 1WWCA 5C07B 1U41A 3D85A 4QHMB 3SDCD 1HIMH 3FT2B 1DQJB 1TNNA 1JWUA 1BX2B 3WUWG 4PRIB 3MNZA 2PW2A 1WFUA 3QP3A 4GAYA 4PJIE 1N5YH 3DUUB 3GMQA 2B2XH 3O3AA 4QOKA 1TIUA 3MX0A 2D2OA 1UADC 3G5VB 1IC5H 4MD0A 3P40A 4XCCH 4LSRL 4MJIE 4RRPA 2R15A 2AK1L 3W39B 3QHFL 3B9DA 5E2WL 4NQCB 5KZCD 2YUXA 5D1ZB 1GC1C 2WUCL 5KVGH 2W9EH 4PY8J 5I8EA 1W72H 4X8JB 2XA3A 5IOPA 2EXWD 3BN3B 3DBXA 1KENH 4WU5A 5GRXG 2D0GA 3T0EB 3DV4A 2X4SA 4MQ7B 4HEPG 5FYKL 2OMNA 4HMEA 1P2CB 4KVCL 2CKBH 4G6KH 4Q6IA 3S34L 1RK0A 1CL7H 2X7LB 2P45B 3RUGA 4UILH 2NY6D 4XBGA 4OZHF 4IHOB 4Z77B 4UMGA 3TYFA 1AP2B 2VWEE 3AB0B 1MRCL 2QQKL 4I0PB 4LQFH 2VR5A 5C0IB 3NABH 5DGRA 4XBGB 1IGMH 5JHLL 3S4SA 3NFPB 4P2OD 3KPLB 4ZG1A 3MGAA 1MNUL 4RMTA 3RNQB 4XC3H 5F6IB 2QADB 3UTTD 3TBVA 3TBTB 1HH6A 5C08D 5IOPB 4X8JA 4Z8FH 3MUY1 3QUXC 5D6DA 3SY0B 3OL2A 4UOJA 4QF1A 2CH8A 1LILA 1QHOA 3R4DA 3T04D 1WT5C 2VR4A 2APXA 2VLMD 4Y89A 3MJ9L 3TJHC 1S9XA 4P4KD 3T65A 5J13C 4MD0B 5CJBA 3G5VA 3HFML 4ZAKC 4I9WD 1D5BA 1J0JA 5FK9A 1CFVH 3TIDB 3S8WA 2F9BT 4GAYB 5CSGA 4QTHA 2P5ED 4JVPA 1JWUB 1DQJA 1NCCL 3O9WD 1T7VA 4QHMA 4TN9A 5IVZB 4PG9B 5B8CA 4MSWB 1S7UA 2J1KA 2ESVA 5IROC 2Y6SC 1TCMA 3DI2B 1J8HD 3IFNH 2WINA 4OGAC 3U36A 2BXYA 5DQJB 3RBSA 3TT1H 4MNHA 4ZNEE 1M7DB 2VZ1A 1H15A 4F15B 4WHYG 4MQXC 3QJHB 1ZAGA 5ACMA 3NABL 4GRWF 3GO1H 5M95B 4WFFD 4JFZL 3KJ6H 4LCCB 4U1GB 2Z35B 1FL3B 5MEQB 4HK0A 5E9DA 2C3XA 4RMQA 3STZB 4H1LB 3KPRE 2ED7A 4R9HA 3BP7A 3K2UL 1HSAA 3D6GA 1IGCH 2NZIA 2YD7A 3DRQA 5FYKD 1KJ3L 2YPLE 5T3XE 1IC5L 1K8DB 4KZEH 1NBVL 5C08B 4TTDD 1OW0A 4XP9H 5GGTH 4GOSA 4N8CH 5F7LB 1TZHA 4PYHA 3GHEH 1YEFL 3K3QA 1KB5A 4LLUB 3U4BH 1ZT4B 5ESQB 3SE9H 4XNQA 1EEYB 4S1DD 3UP1A 1HEZA 3O3EB 1NGQH 2A9NL 4G8EA 3OGOE 5J1AB 4XC1H 4KU1A 5I1LB 1YEGH 4EI5D 4PGCA 5K9JH 5GJTH 1CFQA 4RAUB 4XNUL 1BZ7A 1IAOA 4X8XA 1QRNB 4PJ9D 2V5YA 3TT3H 5IB1B 2CO6B 3RQ3A 4PD4J 1AD0B 5TF0A 4P2YA 3IVKB 2HRPH 3IF1B 2GSGB 4UDTB 1F4HA 4FA8A 1SMOA 1FZJB 1JGEA 1A47A 5CD3B 3SPVA 4PJCA 5I9QC 1MIEH 4JG1L 1NC2D 3EDEA 2JIXB 5SX4I 1CN4A 3GSUB 4XCEA 3ARFB 3QDHA 2NY0B 4OKDA 3U4BL 3IU3B 1SY6A 4KVNH 4ZFOB 4KK5D 1J1PL 2ZSWA 1MCBA 1Q94B 2IQ9L 4NZRH 1K4CA 5KOMC 4KRMB 1QSEB 3RTQC 3N1MC 5AZEH 5LQBH 1HI6A 3MBXL 3TA3A 4L9LC 4OLYL 4XI5C 1X5ZA 3LHPL 3NN8B 5HHQB 3IFOA 2GUOB 4DUXA 2ZJSL 3DO7A 3EGSB 3TVMA 4P46B 3IETB 1B0RB 5EU6E 4YXKL 1RI8A 4JO2L 5CSZA 4F37F 5EULV 2D03L 5IR1A 2RHEA 4NQVB 1J0KA 4NOBA 4AIZB 3IU4H 5JUEL 1A3LL 3DSFL 2EEDA 3U7YH 3UX9B 5MHSE 2R69H 4WEBH 4K9EC 5E03A 1XF4A 3Q6GL 5BV7H 3JTSA 1I1AD 3FO9A 4LSSH 3BJLA 3LKSB 1IC7L 2MHAA 1Q9LB 5H2BA 3L7EB 1B3JA 4Z7UB 3VFMB 2BRRL 5D6CB 3NFSL 2IH3B 5E8NA 5L2JA 3ZO0A 4EI5B 1CZ8H 1SJXA 4ZUSA 5DEFA 4TRPL 4YDIL 2VE6A 5TPWH 2X9XA 5JOFA 5BQ7A 4ZSOB 5IV2A 4OM1H 3SDDD 5KN5B 2BNQD 4UTBH 2VLRA 2BHUA 3QIUC 4U6HA 4UOW1 3S3SA 2YC1A 2HKHH 1B6DA 4X6DB 5D1ZC 4DVRL 1CDIA 1X6LA 1T2XA 4UDUA 3HNSL 4J3OC 3SDAA 3QUXB 5GZND 4F8TA 2VLRB 1QFOA 3ARBB 2XY1A 3LEVH 1FNLA 4ONFL 5KN5A 4JPKL 5IV2B 4CJ0A 5E1AA 4HT1H 3DVNA 5DEFB 3AFLA 4EI5A 3VWKA 3RWCA 4P3DB 1FFPB 3FZUC 1E28A 1CTNA 4WGWB 1QYGH 4HXAH 1MWAL 4M9OA 3JTSB 3WEXA 3WFBH 4F37K 5AD0B 1RUQH 5C0GB 1UA6L 3SO3C 4NQVA 3L3IB 1DQLL 3ZSSA 4QRQB 1VEOA 3HI6L 3OR6B 4PJFF 1JJUA 2ZUXA 5H94A 4TTDC 5DFTA 1RULH 3HC0B 3BSZH 2Y36H 5CSZB 1FAIL 2DB8A 5F96H 2NY2C 2OZ4H 3IETA 1ZTXH 1WEJL 4XNXL 2WUBH 4LLQB 1G9ML 4W6YB 1NC4D 4MHHG 3NN8A 4EZMA 5HHQA 4EI5C 5KS9B 3C5ZD 4X4MA 1XF3B 1VENA 5FYLH 1AH1A 5F9OH 1XIWD 1IT9H 1QSEA 3WIHA 3HE6D 1CU4H 4AMKH 4JO1H 5J7CC 4N0RA 2RFXA 5EO0A 2XPGA 3ARSA 1CWVA 4PS4H 4JO3L 5EZOL 3RZCC 3B3IA 3PP3H 2JIXA 4R4ND 4ODXB 4G6FD 1BBDH 1U8OA 5JMRA 4GS7C 2DBLH 5F1NB 1GIGL 3H9SD 3RPIA 4BUHA 2B8OT 3AVEA 1OGAD 4FG6C 5IB1A 2J8UA 4Q9BA 5C0FB 1BJMA 1MQKL 2YRLA 4PV8A 1S7XB 2E6JA 4HKJA 2CO7B 1AIFA 1BZ7B 5CD5C 1UH2A 4J1UB 4GW1B 2FECI 1F42A 3IAGC 3BWAA 1F3JB 4XP1H 3LD8B 2ZOKA 2FGZA 5J1AA 5GPRA 3QQ4A 4C56B 2NYYD 2VDQL 5CJOH 5ICXA 1ZV5A 3QCUH 1KB5B 1EVUA 4JGUA 1YNTB 2AQ3A 3HZKA 5DC0A 1G6RA 4GQPH 4PRHA 4J12A 4GKOA 2DLGA 4F33B 3QI9D 4WO4A 4ZAKB 5I8OL 2MOVA 5ID1A 1G9NL 2EE3A 4GG6A 3Q1SL 2WWMD 2BSTA 2NXYB 2VQ1A 4OQTA 5F88A 3K74B 3MLZL 5GGSB 5JA9A 1RUKH 1KTLA 4ONHB 3RI5K 4HIEB 2DL2A 1NQBA 1I1AC 3FONA 3HC3L 4XXCA 2GHWB 4LCCA 1OSPL 4FFZL 3DI3B 4OD3L 1FNFA 1ZT1A 2OR8A 4LHUD 4K3DL 4GO6B 1BAFL 5I1IH 1FFOB 1RZ7H 1M7DA 3D3VB 1GAFL 2QEJA 5L9DH 3BE1L 3UROR 4A6YB 3SDDC 5MENA 3BX7C 4M8VA 1BZ9B 4F7TA 4S1SL 4ZD3L 2WINB 4Y19B 4BH7A 4WENB 3P4LA 4Z6AT 5CZXC 4PLKC 5KVGL 2CR3A 5D1ZD 4G3YL 4QO1A 2E6PA 1D9KB 1S7UB 4MSWA 3QIBC 5T1LD 4HMDA 5IVZA 2N7BA 2EKJA 3HE7B 1N64L 2GSIB 3ZYIA 3DXAD 1QQDA 4J3XA 4QTHB 1OAUH 4JFQB 4IJ3B 4YWGL 5EBLA 1N26A 2GAZB 3TIDA 4XHJD 3KPSD 5EU5B 4Z76A 1MCDA 1GGCL 5GGUA 1D5BB 5FK9B 1QRKA 5KVEL 1WFTA 2OTPA 4ZTPH 3P0VH 4D9QD 1OM3L 5DJCB 1WZMA 2CDEB 5FFLA 4S0SD 3P4NA 4TSAL 5IHBA 4PJXB 4HCRL 4WEUD 5KG9B 4YPJA 4AZ8A 1EO5A 4OCLC 5IW3A 3ARDD 3OG4B 4EIGB 4Y8DC 4ERSH 5EOCJ 1FJ1A 4OI7A 2ZUTA 4JB9H 1NPUA 1HH6B 1S7SB 5L2KA 5ALCH 3TBVB 3Q5YA 4JRYA 3RNQA 3UTSA 1WJ3A 1DBKL 3OBAA 1P4BH 2J6EA 5DMGD 4N0CD 2NY2D 3MRPB 2V9QA 2D9CA 1P1ZB 4WW1B 3UPAA 1MLCA 4LDLB 5IW6A 3CFBB 3HG1E 3CFDA 1KG0A 4MMXC 5C8JB 4Z77A 1S7RA 1CFNB 2AJYL 3LH2L 1SBSH 4R8WH 2C4FT 4HCRA 4Q6IB 3HE6C 5GS0H 1A6TB 2Q76B 1LDPL 1K5NB 2DQCL 3RTQB 4WU5B 2B4CH 4YBQC 2P5EA 4PJBF 3TFKC 2VDKL 4R2GB 3T0EA 4CMHC 4XMLL 5FYJD 1HNGA 3LB6D 4WWKB 5SX4H 4FQXA 5DI8A 1PEZA 3BDBA 1MIML 4MXWL 2VB5A 4HF5H 4OZFH 2P7TB 3CDGB 1SM3L 3W39A 1J18A 2WNGA 1J5OH 3MR9B 3RKDD 3HI1A 5E8OA 5HY9A 3GKWH 4KMTL 4XP4H 3FOLA 5EWIL 3T0WA 1JWSA 2YOCA 5ERWB 1N2RA 1DFBH 4ELMB 5J3HC 2FBOJ 4QOKB 3GMQB 3O3AB 2NCMA 1FVCB 3RWEA 1CU4L 3ZTJG 4BFGA 4FQHA 4LHQB 5BS0E 1BX2A 1QFUL 4RWHA 3DLQR 5HVFB 3L9RB 2FBJH 2DQCH 3D85B 5C07A 4X6CA 2RCSH 4UQ2A 4R7NB 4CN1A 5F44A 3MRKA 4ALAL 1YEIL 4HUNB 5J4MA 2VO5A 3IGAB 3ULVH 3JWOH 4X6BB 5HYIA 4OFIA 4NWTH 3C60B 3K8KA 1M4KA 1LO4L 1NUDA 2VLLA 4KQ3L 3KLAA 2SEBA 1F13A 4JM2A 5DUPH 2EYSA 3GGWA 1QVOB 3EFDL 3WS6C 1F90H 3SGKA 3GSVB 4CW1A 1HE7A 3SDCB 1QKZH 2APFA 4JM2F 4R8WL 4X5WB 3T77B 4NKDA 3SE3C 4AL8L 4ZYKA 5C0DB 5FHAL 1EFQA 5D2LF 2DWDA 1G7MB 4PRAB 3V7AE 1JTOA 2BJML 2H1PH 3T08A 3WDHA 1YJDC 3WN5C 5ETUA 2OJZL 3I75B 5DQDH 5T3ZD 3V5DA 3P11L 3IDJB 3E6FA 1G6RH 1ZLSL 3BZEA 1U93A 4XNMA 3BZ4A 4F3FB 3GBLA 5IG7B 1R3JA 3BD5A 3S35X 3RAJL 1T5XB 1KCRH 5D2NA 4I8DA 4QWWD 4NRYB 5GS0L 3PIQA 4ZFFB 1N3NB 1ZHNA 1IL1A 1FNGA 3F5WA 4N90D 2WUCH 3MLWL 2PKDA 3MV7B 1UB5A 3DXAA 2FYYB 4GBXA 4J2XA 4XHJC 3KGRA 4POZD 5ACLA 3EYVB 1B6UA 3H7BB 4O5LH 1EEQA 1KSRA 1JGVH 3L5XH 4PJBB 4K94L 3S88L 4JN1L 4XB7A 5ESVB 4XVUC 1KPUA 4Z7OE 1FYTE 1JHKH 4U3XA 5L7XL 2HT2C 4L4VA 3FO1A 4ZUUB 4AG4H 1WBYA 3L3KA 3MLSL 1I7RB 5F1IB 1UA6H 2I60H 3UTSD 1MREH 4DGVL 1AQKH 1H3VA 1N5YL 3BD4A 4FFVC 2X4UB 1S3KH 2F54D 5TDNA 5GS1B 5ITBL 1QSVA 3CDYA 4RGNB 2ADIA 3RWGB 4OF6A 4OLVL 4Y16C 2BVOB 2CIIA 3L5WA 3CIQA 2EDXA 5I66B 3VFGH 1HQRB 1GZPB 1QBML 1JUFB 1U8LB 5IB4A 5HI4D 2XYCA 1GOFA 2RJMA 3QFDB 3UTZA 2AXGA 1K8IA 3TFKD 5JW4M 2R0LH 2E7CA 5DJYA 1AO7D 5FUOL 1GHFH 5DMIH 1D7FA 1YN7B 1MFAL 5GRJL 1X5AA 3TO2A 3BKML 2R0WH 5FOBB 4RZCB 5DT1H 4G9DA 1MJUH 4KVNL 3V0VB 4D3CL 3PV6A 4MMZC 4ODSH 5SWZE 4AQOA 4X4XA 1CDHA 3C8KA 4PJCF 4Z7NF 3RKDC 4NFCA 2FO1A 1D5ZB 3QCUL 3U9UB 3HKFA 3TBWB 3ULVL 3LV3B 2D31B 4L9LB 4E0RA 4LLDB 4L8BB 4XBEL 3RJDA 4G8GA 2C26A 1XIWB 5LXGL 2H2SC 4PRPA 4ZOEA 4OLXH 1JRHL 1S5IL 2V7HA 3MRFB 4P4RB 2FEDC 3RGVB 4P48A 4QRPD 4HQQH 3B9AA 3MMEB 4X7TB 2J12B 2K7PA 3MRGB 5GJSL 2HMID 5DSCB 1V3KA 1CFSB 1IGIL 2GY7B 1YEGL 4FQ1L 1UVQB 2J5LB 3NCBB 4PB0H 3VRIB 3EYQD 3BYTA 2BC4B 3MV8B 4ELMF 5HDLA 3QO0B 4JM2C 1I7UB 2Z91A 1YN6A 1LO5A 4DOHE 1DQDH 5IQ7L 1C16A 4LF3B 3H9SB 2KKQA 3WIFB 2EC8A 2KZ1B 1CE6A 4RGNE 2QQLL 5F1SA 3D39A 3M17A 5I8OH 1TCRB 1U8HA 4M7LT 1CBVH 1U91B 3KG5A 5GRYA 2HTKC 1HHIA 2GTZA 1S7QB 4KUCF 5TH2A 4I5BB 4OGZA 4DTGH 1VFBA 5IESL 1B2WH 1XGTB 3QZWA 5KW9L 2NW2A 1H3UA 3ILPA 3ZKMD 3HE6B 1T0MB 1GHFL 5DMIL 5GSRA 1T0NB 3MRMA 1FO0A 2GITB 3D9AH 4PJAB 5LGHL 4X7EC 2HFEA 3PL6A 1TQCC 3MV7E 1JBJA 4RIRB 3I3EA 4JRXD 3SKUD 1LEIB 1MRFL 5D1XD 3T4YA 1ROWA 1MHCB 5LG1A 1YA5A 4OZIA 4QWWC 1UM4H 4AEFA 2AS5M 3CCHA 1X7QB 4O02L 1UACL 1ZLVK 3VH8B 4OFKA 5IWLA 4HFWA 1Y0LA 5K9OB 3U82B 1M7IA 2ZCKL 4QNPF 4HIIA 4JFYA 4ZPVB 1G7LA 3VXRA 5EO1B 4ENEC 3QG6A 1CLYH 2OMBA 3VXMD 1RZIB 3QQ9D 5DJXB 3RWJB 1CL7L 5ITFA 2K7QA 1YEJH 5C0AD 1MLBB 3PXJA 1YNKH 4BSWA 1JHLH 4QRRD 4LSQH 4XCFL 2J5LC 4AQ1B 3GMOA 3O41A 5HGAA 3QG7H 4S0TD 2BVYA 3O9WA 4Q9RL 4G80A 2AV1A 1SJEA 1G7IA 3KYOA 5F8QC 3CH8A 5SV4A 1MRDL 3LRGA 4PG2C 1V7ML 1ES0B 5KAQG 4EDWL 1E4KA 3QO1B 4Y16A 1TJIH 1NDGB 1I7ZB 3WNOA 1GSMA 4UQ3A 4WTZA 4LKXA 1L9NA 5JNYB 1IGIH 4KWUA 1OARL 3KPPA 3NBNA 4FFYH 3BRFA 3ET9F 4OQTL 2BVTA 5DURB 2BOBA 3FQRB 1V3JA 2FO4B 2YPLA 3RX7A 5C09E 1Y6NR 3GDBA 5BRZE 1XGPB 3RRQA 5C3LD 1IC7H 1I7ZA 4YBLB 3U2SB 4Y1AD 2X9YA 1ES0A 1EMTH 1UB6A 5CEZE 4AT6A 2X4PB 2AGJH 1KXQE 1G7IB 2AV1B 4MAYC 4TNWK 1G0DA 1DBMH 1FNEB 1H3PL 1RUAL 5HGAB 3V6BR 1LO0H 3QPQC 3P30H 3VXQB 9CGTA 2ATKA 3B2UD 1A3RL 2VLJB 1KTKE 3PWJB 2FDBP 3CFCL 1OVZA 5ITFB 1ETZB 2IANE 3RVXC 4DZBB 3QG6B 5EO1A 4YHOH 4KKAC 3VXRB 4MAYB 3MXWL 4WJ5B 2E9BA 2FJHA 5J56B 1NGYA 3PGDB 1H8NA 4HIIB 1MELA 4ZQKA 1VEPA 3PV7A 2IG2L 2VDQH 4X9GA 5CJOL 4KTYA 3M07A 4HFWB 2H8PA 2BVQA 3CCHB 4C57C 1I3GH 3BPNB 2CRYA 3V6OA 1N4XL 1REIA 2W91A 4L4JA 1FL5B 3BVNA 2RIKA 2NR6D 4TVPD 1LEIA 3GSNL 3SDXF 2XICA 3DSNA 2R56H 4QT5A 4RIRA 4H20L 4JM2D 1DBAH 4QLRA 3CFKB 4L3AA 2GITA 1YMME 3MRMB 4OZFG 2IBZY 4JO1L 5EIVA 1QO3B 4FQIH 3ILPB 3QZWB 1V8HA 3WFDL 4U6TA 5E6IC 5B4MD 3GBML 1XGTA 4TUKH 4OIIH 5EU6A 4PJ8C 3R1GL 3NFNB 3MNWA 5D72H 3VWJB 5TH2B 4NNPH 4KRPC 1U91A 1AY1L 5I18H 5KTEH 3D39B 3CUPB 4EI6A 3CH1A 2X09A 2XTJE 4X0KA 3KYMB 3MREA 1NGQL 3BW9B 1T83C 2H32H 4OCYL 4KZDH 1CFTB 1RFDL 2IPKB 2BSRA 2VDPH 1I9JL 1I7UA 3GSWA 2C5DC 2VUYA 2BC4A 2UY7A 4JFZH 4CDGC 3QFJD 2CSPA 2IBBA 1UVQA 4OD1H 1PJ9A 1ED3B 3S35H 1JGVL 4EUPH 5DSCA 1WQVT 1NGPL 4DQOL 3E6HA 4X7TA 3MMEA 4HIHA 3WFDH 3RGVA 4YEEA 1R3IH 3MRFA 1BF8A 3IKCB 4MQTB 1ND0A 4GMTL 1XIWA 3RNKB 3KYNA 1IE5A 3W9DB 4L9LA 4UV4H 1IEBB 2D31A 3MA7A 3LV3A 4J3SA 3GRWH 4ENED 5ICZB 4QHUA 4OSUL 3TO4A 4BH8B 3D25A 3C8KB 3D9AL 5FDYA 1FNHA 3PV6B 5DVMA 4XNUH 5CKGA 1FN4A 1NUGA 5TQ2L 2C1PA 4XCYA 2I26N 3IFNL 2EH7L 4Y4FC 4UV7L 4LPUA 4U1HB 3WL9A 5DJYB 4QOKE 3KVQA 1DLFH 1MFNA 4B41A 3C2AL 2BFVL 2WWKO 5F1OB 5MP6L 1HXYA 2PXYD 3OF6A 1I3GL 1KEGL 4L3EE 1KT2B 1I8MB 3DNKA 2Z8WC 3M45A 5GZOC 4YHMH 1MI5A 2CIIB 2Z31C 1B88A 2KQMA 4I18B 4Y2DC 1RMFH 1NSNL 4EJ1C 5E4EC 3V7AG 4Z7UE 2IAMA 4JRWA 1P4IL 4NUGH 2ZOLB 4OD3H 1FORL 3FT4A 3ILQD 4BJLA 4R2GC 4K3EH 3D3VD 2X70B 3FO1B 1AHWB 4UT6L 5FB8A 3ULUL 4HV8B 1TZGH 1NLDL 4JO2H 1AR1D 4YDJB 4U6YB 1IQWL 3U1SH 2LU7A 4D8PA 2HT3C 3LQAC 3LKOA 4LCUA 4Z5RA 1SY6L 4KKAD 1HOCB 1HH9B 2Z31A 3F7VA 2PTTA 3QNYB 3EDKA 1N6UA 2P8LB 4MWFB 2YHGA 4M1DH 4NM4L 4PRHE 1UB5B 2M8XA 3PQYE 3ZE1E 1IL1B 1N3NA 1Q72L 4XPHH 3PIQB 3I9GL 3LN4B 3ZKNC 4BFEA 3GSNB 4ZFFA 1JHLL 4YBHA 2VLKD 2Z8SA 1T5XA 5D2NB 3FRPA 3O6FC 3CSPA 1RHHA 5IG7A 4KXZH 2DYPD 1P6AB 4F7EA 5I16A 5TPWL 3U0WL 5DD6A 3QXTA 3RFZC 5HGHA 5C0BE 2A38A 1FLTX 1MPAH 3D39D 3HC4L 1A3RH 4P99A 5IBTL 3I75A 2PTUA 2ZG2A 2VWEC 3O8XD 3SGEI 4JDTH 5CCKL 1FRGL 3W82A 5CBAA 3QH3B 1NAML 4PRAA 4MWFA 1G7MA 1GPOL 4GRWE 2P8LA 1BIIB 4ZFGH 1YEKL 4OCSH 3F7VB 1BECA 5TQ2H 5B3JE 3VFUB 4PJIA 5ICYA 5GHWL 2DLFH 1P4BL 4NKDB 2JELL 4X5WA 3T77A 3E2HB 1ZGLA 1FE8H 3GB7B 4D8PB 3GSVA 1F8TL 3RVUC 2DQTL 4YDJA 4YPGA 4ZOCA 2Q3AA 1VFMA 3V4PL 1TITA 4M7ZB 5D1XA 4HV8A 5DJDA 4OV5B 1EEZA 4JY5H 3MLVH 4M7LH 4TVPL 3MRQA 4PTTB 2IPUG 3MRKB 1AXIB 1DQML 4LNVA 4X80H 3C8DA 3BPOB 2ZOLA 3C08L 4L3CB 5HDQL 2C3HA 1KIQA 3L9RA 4DJMA 1CICC 5C0RH 4FQHB 5HVHC 4GKZA 5FUCC 4H88L 4BQBA 1MI5B 2Y36L 3D0LA 3CVIH 4KRLB 1DBBL 2AK1H 3GKZA 2FHCA 1NCDL 1HXYB 5E8OB 2MCPL 3RZWA 3TT1L 5I30H 1BREA 1UKSA 5J12C 3MR9A 1LQSR 3ZKXB 4MA1C 1A7RL 2DMCA 4LIQE 3T3PF 2P7TA 3CDGA 2XN9E 4PGZA 3ULUC 4NRXB 2M26A 3TYGL 4LVOC 2B1AL 5DHXB 1JPTH 4WWKA 1T1WA 3D1MC 1TPXB 1OF2A 4UIMB 2P5EB 4CUCA 2Q6WB 1K5NA 4MDJA 1S9VB 4ZFGL 5GGQL 1F4AA 1IM9A 3EOYG 2DDQL 1IEBA 2YD4A 3MA7B 1KTDA 1UJ3A 2DM4A 1CFNA 3NCJH 5C8JA 3IDGB 4F15C 3BT2H 3CFBA 5IW6B 4HIXL 5HYQB 3MYZA 1X44A 2AP2A 4HAGA 4ETYA 1X6NA 2NY4D 5IBUB 3PGFL 2BK8A 1WBXB 5LBSH 5CILL 4LHUA 1A22B 4K71B 2WV3A 5IHLB 5I8KH 3HA0A 4PJGE 4MVBC 3NCEB 3BW9A 2KQNA 4IRSB 4M9PA 3CH1B 5CJ5A 5KG9A 3ZTJH 4PJXA 3PUCA 4EDXB 1OAYH 4OLWL 3STBA 3MNWB 3VWJA 5E95B 4OBSA 3T1FA 3A6CH 5EU6B 5GGUB 1DANT 1KFAL 1WITA 2I25N 4BFIA 1T2QL 1QQDB 2DTML 3ZKND 5L8LB 4NZUH 2HH0L 2GSIA 5AZEL 4JGMA 3HE7A 3TA3D 3DPBA 3BUTA 1W8OA 3IAQA 4QT5B 5FYLE 1PZUB 1FBIL 2G9HB 1D9KA 2VERN 3WXWH 4WFEE 3EOTH 1A2YB 1FL5A 4BH7B 1VFUA 4Y19A 1DBBH 3GMRB 4RA3A 5L0QB 2BVQB 3E2HC 4GQ9L 1H8OA 4NCC1 4RMWA 2Q1EA 1S5HA 3HAEA 4G3YH 1IFHL 1FFOA 4WJ5A 4HUUA 3DX8B 1X5XA 4D9RE 2D9QB 1WTLA 4UBDC 2FATH 3VG9C 3QFJB 3JVGA 3FONB 4YFLF 4M7JH 2ATKB 4JQIH 4ONHA 1KTLB 2UZIH 3VXQA 5LVEA 3BISA 2YD1A 5F88B 4PJHE 3X17A 5JHLH 4OLUL 4ZAKA 4WO4B 3DECA 5DVOA 1UB6B 3HZKB 5DD3L 3AREC 3SEPA 1R5IA 1NCCH 2J3SA 5L88H 1OAZH 3QWOB 1IM9D 2HKHL 1GGUA 2D7TH 3LS5H 3BWAB 4YJZL 3ZKQD 3PP4L 3FB5A 5EU3A 2Z9TA 4LRIA 4YXHL 3KPPB 3DVFA 5IROA 5JNYA 1S7XA 1YYMH 4LKXB 1HK6A 5C0FA 1NDGA 1FHGA 1JYXA 3MJ8B 4X6EA 4XCFH 2JB6B 3O4LE 4N0UA 5HJ3B 5E2WH 1SJEB 3KYOB 5F1NA 2R2HB 4V2BA 5C0CE 1CBVL 2E27L 4RISL 5HSFA 2XV6B 4N8VG 4GT7A 4TVPH 3MUHL 2V7NB 4QRSB 4KUCD 1A7QL 5DD5H 2RCSL 2ZUWA 3RWJA 3QNZA 3GBMH 4OKVB 4TUKL 5EZLA 4XGZB 3ULVD 2HWZH 4WFGD 5GGTA 3DMMC 5KS9A 1M7IB 1I7TB 1I85C 1NFDA 2GK0B 2WQRA 5FXCH 1QFWM 3SQBA 2ARWA 3H3KA 3BDXA 1OW0C 3CMOL 1U3YA 5J11B 5E1HB 1ZT7A 2YBRA 1HZHL 1MHCA 4NQCD 5C9KA 1I4FB 4YHML 1P9MA 3U7AA 3OMZA 2F19H 15C8H 4Z78A 2RAMA 3VCLB 3MOBL 1QFWI 4U1GC 2OYPA 5I8CB 3BP4B 4MVBD 1BIHA 1LEGB 3WNNA 1FO0B 3C08H 3FOMB 4HBCH 3QCTH 1KIUA 2NW2B 4M4PA 3NZ8B 2HG5A 1NGXA 1RJYA 2VL5A 3WEXB 1WF5A 1AJ7L 2E7MA 3QEQD 4D0DA 1T22B 5KSBF 4I5BA 2HWZL 5IJKA 1RUMH 5DMYA 2FIRT 1JE6A 2WBWB 3U7WH 3LH2H 4G6JH 3RY6A 1UG9A 3M17B 4JFFB 1SYSA 4KK6C 4ZO7A 1WFOA 3DVNB 3RZCB 1BVLA 1U8KA 1C16B 4LF3A 3EJZC 5E1AB 1W8NA 1LO5B 2XA8L 1YN6B 3LZFL 2Z91B 4GSDH 3TA3C 2HFGH 1I9EA 3MV8A 2Q3ZA 3TNMB 4YFDB 4RGNC 5IW1B 4OT1L 1JPSH 3HMXH 4HWBL 5F7EH 3Q5OA 1FIGH 2YC1B 4RAHA 2VSDA 2J8OA 1F2XK 2VAJA 3AY4A 4ZSOA 5BQ7B 4P4RA 1MEXH 5JOFB 5DXWA 1P6FA 4NT6A 1PD6A 4PRPB 1CXLA 1KLUA 2ZCHH 3EYUL 4E0RB 2EDDA 3ZYZA 4WCYL 3UTTA 2IH3A 5E8NB 5C7XL 5D6CA 3P9LB 4KDWA 3U9UA 2MHAB 1XF2A 1K9TA 3OPZL 4LGSB 5JIHA 4KY1L 4QCIA 5D7LA 3TJHD 2JK5B 3V0VA 2BCKA 1V3LA 5FOBA 2CRMA 2VXQL 1UXSA 4X99A 3HRZA 5I1KL 1YN7A 3KPOA 2ZUUA 1QFWH 5MEOA 3QFDA 2DQFA 4G43A 1QPXA 5IB4B 3B9KD 3QUML 3O9WC 1KOAA 3TVMB 1VGEH 3EGSA 3GBNH 4JQXA 4P5KA 3RDTB 2R0ZH 3QT2A 2BVOA 3IFOB 4IDLA 3RWHB 3O2WL 2Y6SD 2X10A 3HNSH 2ADIB 3RWGA 2J88H 2EDEA 2V9RA 5TDNB 2IMNA 1AGCA 5K9KA 2EYTA 4HBCL 5F1IA 5CGYC 1I7RA 1Q94A 4OFVA 2ZSWB 1OTTC 1WBYB 2VDOH 3L3KB 2DI8A 2O93L 4NUJB 4MCYA 2VXVH 3GSUA 4L4VB 5FHBL 4KZEL 3F7QA 5FYJL 3WNLA 2NX5D 3V8CA 3SPVB 1KPUB 3SHSA 3TH3T 5CD3A 3O0RH 2XZQH 2G60H 5EOQL 5L6YH 4UDTA 3IF1A 5I1JH 1CDJA 1JK8A 3LKNA 3F58L 1A7NH 3SGJA 2VXTH 3MV8E 5EZIL 4CU8A 4W68A 1A6UL 1BHGA 5CZVL 2DF3A 5DDHB 2DL9A 5L2KD 3E8UH 4PJGF 1J0IA 1L6ZA 3VE0B 4RAUA 5ANME 1CFQB 1CR9H 3EYVA 4PGCB 4GBXB 2FYYA 3DXAB 3QCVL 3MV7A 4W6WB 4WHDA 1ZHNB 4S1DC 2YRPA 1EEYA 3QDMD 4XNQB 2ICCA 1ZT4A 4LLUA 2H9GA 4YR6B 1TZHB 1J8KA 2QKIB 4D2NA 4XNMB 1K8DA 1U93B 4UNTA 3BZEB 3MLTA 1OWWA 3V5DB 2YZ1A 3DRQB 4APQB 3R06A 3FN3A 5ETUB 4B7LA 1A3QA 3STZA 1I1RA 4JFHD 3RY6C 5MEQA 4DGYL 2Z35A 2DWDB 2GJ6E 4NQED 5GS0D 5C0DA 4ZYKB 3UZQA 1G9MC 4Y4HA 4JFPB 4KVCH 1Z6JT 1NC4A 5GRUH 4CW1B 4M6NL 1WFNA 3QJHA 2I5YL 4POUB 2NY2B 4EVNB 2SEBB 3KLAB 2CPCA 2VLLB 4KK6D 4F9LA 1G9MH 3ZDZF 2RBLA 1F6AB 4WW2F 1QSED 4MNHB 1L0YA 5T3ZL 5FHBH 5DQJA 4XNXH 1D9KD 4JKLA 3U36B 3C60A 5FYKE 3LEYL 2YPLD 3QIWC 5T3XD 1FO0L 1OCWH 5EH1A 4X6BA 3U83A 1KGCE 4FFWC 4PJAF 4F9PA 5HHXH 1A7OL 5E2VH 1OAKH 1KCVH 3QA3A 5D1QC 1ZGLP 5B8CB 4X6CB 4PG9A 1EHLL 1A7BA 4PG2A 1JNHB 3P4MB 4YBLC 5IB3A 4MD5B 1FVCA 2YUZA 4PRIE 1DVFC 2XTJC 3MRRB 5HD8D 1CIDA 3ZT6A 3U7WL 3ZHKA 3GJEA 2IALB 1N2RB 5ERWA 1JWSB 3T65B 5LJYH 5HY9B 1II4E 5D70H 1PG7L 2NLJB 4YHKL 4S1QL 5I1HH 5DJZB 1IGJA 1S7VB 4HJGB 1DQLH 3VRLE 4B50A 2Q87A 5KSVA 5GSVA 4P59H 4KV5F 5HDQH 2Q20A 1YNKL 4QHLB 4HGMA 4YNYB 4LMQI 4K3JH 2L0DA 2E8YA 2H26A 3ARGB 4MNGA 5F9DC 1MAKA 3L5IA 3S37X 3S4SB 4JM4L 1K2DA 2C1OB 4S2SB 3SKMB 4I0PA 1FDLH 3FHQA 2AW2A 1AP2A 3NZHH 1JGUL 1KG0B 3TYFB 5CEZH 1G1YA 5D5MB 5E08H 3C6LA 1MLCB 4WI4A 2DJ4A 5EU6D 2WANA 2NTSP 2X7LA 3RUGB 4F58H 2VITB 4JY6B 1DSFL 1P2CA 1LP9F 3KYAA 2PYED 3P2TA 5E9DE 1IJ9A 4MQ7A 2X4SB 4K3DH 4FFYL 3DV4B 1W0YT 4EUPA 3AUVA 5L2KB 1S7SA 6FABL 2H2PC 2BJMH 4QEGA 5I8EB 5E2TL 1FJ1B 5MHSD 5EIIB 3TP4A 5D1ZA 1Q72H 4XPHL 2Z8RA 4NNYA 1KN4L 1N4XH 3NCYP 4HPYL 5K9QG 1IGTA 3GSQA 2ZCLH 2CLZA 2UUDK 3P4NB 5EBGA 2CDEA 1NBQA 4LOUD 1X5JA 2E5EA 5TE4H 2LAGB 2FJFA 3BH8A 5C0NC 2J6EH 4HK3J 4L29A 3RWDB 3DUUA 3NCCB 5EBLB 4O4YH 1YECH 4ZTOH 3DUSB 3V52H 4OJFL 3MNZB 4XP5L 4PRIA 2F54A 2D0FA 2XNAA 2BY3A 3FT2A 1T7WA 2QADD 5I9QB 3RPKA 2HFFB 4LPTA 5JXEA 5SWZA 3OAZH 1XCQA 2A73B 4NC1C 2NXYD 3ARBC 2X4OA 5MENB 1ZHBB 3C6SA 1JGDA 3KPNB 2MCG1 3VMPA 2FJGB 3VXPB 3VGHA 5K9QI 2VDKH 3RZCD 4P2OA 5LGHH 1JCKA 4LSTL 3S35L 1ZT1B 3ARXA 1C12A 5CFHA 3CD4A 4NKQB 2GTWA 2MQ3A 5I15H 4JG0H 3O2DH 4CVUA 5FM5O 5FYKU 1T7YA 1OGAA 2BSTB 2VQ1B 3Q6FB 4Y4KC 4LSUL 5ID1B 4JZJC 3WXWL 2HTLD 3ZE0F 3GZKA 4F33A 4X4YA 5I6XC 1G6RB 3SDYH 5CLTA 1KJVB 3EBAA 3BP6B 4ZXBB 3V4VH 5EC2A 3S5LA 1FG9C 4A2LA 2NYYC 4G8FA 1H3WM 3QQ4B 4C56A 2APBA 3QI9B 3KPSB 4G6FB 1F3JA 4G6MH 1PSKH 1Y6MR 3MACH 3S9DB 5IFAH 3UTPD 4UINH 4UNUA 5DTFB 4HKJB 2YN3A 1M1SA 3MCKA 3VDAA 3MJ9A 2WWMC 5TF1H 3ZE1F 1N59B 1JZ7A 4QRUA 5KSUA 1QR1A 4KPHL 2NY0D 3ARGD 3QXAB 4DVBA 4YHNB 3W9EB 4C58B 1NAKH 4QY8A 5IEKB 4YHYC 2IPUK 4KFZC 5IIEA 4NKMB 3O11B 1U8OB 3FO2A 4QXUH 1I9JH 5DRZA 3HHRB 5HHXL 3OZ9L 3PWNA 4DTGL 5IESH 2AQ1A 4ETQA 4G5ZL 3SDXE 3WFCL 2JCCF 2QSCL 3UXFA 2WLZA 2XPGB 4LGPB 2VZUA 2X1WL 1QLFA 2WLYA 2P43B 1U6AH 3PABA 2HFTA 1S7WB 4HUXB 3DVIA 3S3JA 1LEKA 4XNZB 3ARDA 2XZCH 4U1KB 4KDTC 3EYUH 3ULUE 2EE2A 5JO5A 2DKSA 2V6HA 4LLQA 4I77L 4E41A 4NM8L 1IQWH 3U1SL 3IXAA 5ENWA 1UWEH 4AEIL 2EECA 2F5AL 1AXSA 2VQTA 4KK8C 1RJCA 3HC0A 3CSYA 4K7PY 1A4KB 4OLZL 4X7FC 1MWAH 1JTPA 3OR6A 4QRQA 2XN9B 3L3IA 3L1OL 4M93C 4MNGE 3DYMA 1CD1B 4YUEL 1EFXA 1VACB 4X7CC 3QPXL 5AD0A 1D5MB 1BQUA 2NZ9D 4DN4H 2HT4C 4OF7A 3ZDXF 3K81A 3AU1A 1KIRB 3KPRB 3N85H 1F97A 5BVJB 3ARDC 4KMTH 5CSBA 1E28B 4LOUC 3RWCB 2AV7A 4C83A 2EDQA 5F7UA 1KCLA 4M93B 5C0ND 3O4LA 3O8XA 3I6KB 2FX9H 2JLLA 3DOSA 2EYRA 6CGTA 4HS8H 3TCLB 5DVKA 2XKUA 3ARBA 4FZ8H 2AEPL 4WUKH 3QUXA 5D6DC 4G5ZH 3SDAB 4UDUB 1F11B 3TGXA 1NMBL 3H9ZA 4OIBA 4P59L 4RDQG 3IAPA 5FM8A 4UTAH 1P5UA 3B2VH 4HGWB 3ZHLA 5F9WB 1INEL 4WGVB 5HHPA 3C2AH 5MP6H 3MROB 3NMEA 4PIRF 1R24B 3X12A 5FCUL 4LSDA 4JJHA 2UVFA 4YBQD 3TVMD 4WUUD 3CXHJ 1XR8A 4EN3D 4NO2A 1UENA 4JLRB 5DMKB 4A2MA 1Q9LA 5H2BB 5TE7L 5IVOA 2DTSA 3FO9B 1S7TB 5ITBH 5JW5A 3OKMA 2DQJH 4DQOH 1XF4B 1AQKL 4U4BA 3DO3A 3OKOA 3ULSB 3WFZA 3K0WA 4OCMC 4AIZA 3P0YH 1AGBB 2XRAL 3MOAH 3P4OB 1UYWL 4R7DA 1T03H 3VG0L 2I5YH 3HPJB 1N5AA 5IR1B 1I3RB 1RAMA 2OK0L 1B0RA 1FZOB 1PG7H 5DC4B 3RIFF 1EVTC 3CX5K 5CJ8A 2GUOA 1T20A 5IK3B 2NQCA 2D7PA 2QSCH 3UDWA 3TZVD 1N64H 3FCTB 3RY4A 1K4CB 2OJEB 4FQIL 4FQCH 4X83A 3RGHA 5DQDL 2W60A 1INQA 2Y7QA 3VXOB 5FEBA 1KB9K 3IU3A 3PP3K 1W2KT 4XCEB 5C2UB 1FC1A 4TYUA 1XF1A 3RX5A 2OQJA 5MEPA 3BE1H 4OD2A 1SQ2N 2EKSA 5CIPB 5F7FA 1FG2A 2GSGA 5KAQF 1CI5A 3IVKA 2QSVA 3OXSB 3REWB 4OUUB 1IM3B 1Q9KA 4DVRH 4Y5VC 1QZ1A 5KSAD 1GPOH 2ICWJ 5F7DB 5IGXH 3UBXA 1CVRA 4JPKH 4OLYH 2EH8L 3FTGB 3FT3B 5C2BL 3SGEH 1PLGH 1HQ4B 2PYEA 4U0RC 5I1LA 3V6ZA 4G8EB 1ADQH 3O3EA 1HSBB 1U8MA 1UT9A 3DMMA 3MRJB 2Q8BL 1G0YR 5ESQA 2AI0H 5KVDH 1NBZB 12E8H 4YX2H 4DAGH 4POZC 4HHAB 4MD4A 2X89D 5JTWA 1A6AB 2UVEA 1MWAB 5GRJH 3BP7B 2E9IA 4PD4K 3SKNB 1KTRL 4NKIH 4NO3A 4YDKH 5C70A 2XZAH 4JPWL 1NGWA 3QEQA 4O2CA 1FL3A 5D2NC 1ULVA 4Z7WB 2W1NA 1BAFH 2FH8A 3E8UL 3UJTH 3JWDC 3NH7L 4WV1B 2VC2H 3TV3L 1MIMH 2P8PB 4TUOB 3QRFM 4ODTL 3MV9A 4KI5D 3KAAA 4OI8A 5FA4A 5IFHL 1R3IL 1FH5L 2CDGA 3ZDYE 2GCYA 3BZFB 1JP5A 43CAB 4F57H 4DK6A 4P9ML 2GT9A 3OHXB 1AC0A 3QXWA 4Q6YA 2ESVB 3HS0A 5IEHB 1T89C 3F8UB 3MV9D 3WHXB 3EO1B 5LAXB 2LU4A 5BVPH 4JY4B 4FP8H 4MJ6A 3X3GL 2R1XA 3O6FB 1MQ8A 5D8JH 3U4EA 3Q0HA 4L8DB 3FMGH 5FO7B 3VFTB 1XR9B 1NCTA 2NY3B 5J57B 4XPBH 4KKCC 5T33H 1S9XB 2BDNL 1IZKA 2ZZUT 1GCFA 1R5WA 3V9FA 3GJFK 3FHAA 2X42A 4K8RC 1GGIH 4UIKH 4QF1B 1WZ1L 5IMLB 3SY0A 4H0GA 2G75A 3ARZA 4PJGA 4JO4H 3TBTA 2ZSVA 1CDUA 4JPWH 3WN5B 1Q0XL 4WHTA 2H2SD 3H9YA 5ILTH 4OFPA 4AIXA 1ZSDA 4ZFZA 1H5BB 5EORL 2IAMD 2X4TB 2VLRD 3KPLA 3H3PL 1A1NB 3NFPA 4FP8L 3X3GH 4OF8A 1X5IA 4MGXA 5TDOB 5C0IA 3BZDA 4PTUB 5HGGS 4WCYH 4YX2L 3BO8B 1LO4H 3TWCH 1CD0A 4XPBL 1IKFL 4MJIA 1YEFH 2GFBB 4LBEA 4IHOA 4IOFD 3VI3E 3CLFH 1HHKB 1OPGH 2A74A 1WISA 3REVA 1FFRA 1G7QA 1RK0B 2EICA 4FABL 2AAVA 3VXSB 5DHVA 1AO7E 5DGQA 3VWKD 3DBXB 2YXMA 3UAJD 3MRBA 2HTKD 1FLRL 2A2QT 1AY1H 2F5BL 1F58H 4LLYA 4GRMA 4NZJA 4NQCA 4PBWD 4FQJL 4HWEH 4F7CB 5TJWK 5ESAB 1IAIM 1R3HA 4KTEH 4DN3H 4U1SA 4MZ2A 5E8EA 2YWYA 3LDBB 2FLRT 2YSSA 1PVHA 3SGJC 3IRPX 1CGWA 1BP3B 2Z4QA 2BNRB 1OAKL 4MA3B 1MJ8H 2PW2B 2J2ZA 3VXUE 4YZFF 3UPCA 4WFFE 1AD9A 1DE4B 3VJ6B 1KF9B 3UBXG 1IKNA 3JWOL 1ACYH 3U30B 5FYJH 4G7YL 1DCLA 3PQYB 3I3BA 3SCMB 2O5YH 1GC1L 32C2B 3QDJA 1WVZA 1KPRB 4CNIA 1LO0L 5FA3A 1I8LA 3QQ9C 2YD5A 1MQKH 4NHUA 5HYJB 5D1QA 3UYRL 2R1WA 3G6AB 1C1EL 3MLVL 1GGYA 4G8IB 4G7VL 3ALXA 4GG8A 3G08B 3BPLB 2V9TA 4ACPA 2B7DT 1JI1A 4KI5C 1MUJA 2YK1L 4WHCA 4XBPA 4RAVB 5AUMA 3QHZL 1LNUA 1MCCA 5GXBB 5ISZB 2H6PA 4Y4HC 3UO1H 1R3LB 1T4KB 3ZL4H 3MNVB 2DYPB 1BWMA 1G0XA 1QSFE 3H3PH 2QTEA 1NAKL 1ITCA 3JV6A 3UPRB 1UEYA 1NH6A 2EDWA 3HG1B 3CFJB 3OXRB 1IGYB 4JRXE 3ZYJA 3AXLA 1KJ2H 5DUBA 1FZKB 4ZAKD 4KTEL 2NY7H 2A0LC 2V2XA 4LSVH 4FXGA 1UKTA 2Q86B 4Y2DA 1DLHB 4I3RL 2JKXA 1A7PH 4YWGH 3PWPA 2FZ3B 2FGWH 4KMLB 1U92A 4ODSL 2QL1A 4NQSB 4R97C 1TJHL 2YD8A 1KJMA 3CAFA 4LSRH 4P5MB 4ZUWB 4CU6A 5I15L 5I18L 5KTEL 2CGRL 4OGAD 2ID5A 3EYOA 3L3GB 1YUHA 4P23D 4P9MH 3F6IA 4R4FH 4TTGA 4YQXL 1I9RL 3WS3B 1XCTA 1DDHA 3RVXD 1RFDH 3NA9H 5CKAA 3KS0J 3CK0L 3LS5L 4J23A 1KLGB 4X80L 1J11A 3EO9H 4PR5A 1WCBA 5D7SH 1F2QA 4PRBA 4DEPC 1YMHA 1CF8H 4RGMC 2X6MA 3P73A 3BYYA 4P57A 1NMCC 2PO6B 4K3EL 3QXUA 2NR6C 3RWFA 3BKCH 3VGDA 4OM0L 4E5XA 3GMPB 1CQYA 3HNVH 4X6FA 5EIQA 5HBBA 4YHPB 4QXTA 1VGKB 2R0KH 4HC1L 3F6LA 2F53E 1F3RB 2CUHA 4IRJD 4JN2B 3PNWA 2V5TA 4ODUA 3RVWC 5CEZD 3QDAA 4JANA 5IF0B 4MXQD 2R0WL 3UAJC 5ACZB 3WYRA 3QEHA 3V6OC 1UXWB 4NZTH 4I1NB 3JTTB 1F3DJ 5TFSH 1QNZH 3CU1A 1RHFA 4RNRB 4X98A 2HLAB 5JQ6L 5H35A 1QD0A 3RDTD 3I9GH 2DDQH 5A2IH 5E7BA 2Q8BH 3EFFA 3VXUB 3L3DA 4M62H 4BZ1H 5F3BA 3HNVL 1IQDB 1EH9A 4PBXA 1X5HA 1MNUH 4EN3B 5C92A 4DCQB 4F58L 2UWEF 2HJLB 3C9NB 4J4PD 4J7RA 1PKQB 1T80A 1R0AL 5IHZB 2H32A 3VFSA 4L4VD 2V2TA 3R8BB 4OGXH 3X13B 2OP4H 3NIDE 8CGTA 1EAPB 5D7SL 1I8LC 4LPCA 4GW4A 1JYNA 4P3WA 4JJ5A 3RTQD 3TIEA 5LWYH 4U7MA 3DTXB 4M3KB 5J12B 3T4AB 2AXHA 4KI5F 1BFSA 4YDVA 4HUVB 1XMWA 5CINL 4OZFB 5K33A 1L0XA 4LDEB 1RVFH 5I76A 1PW3A 5BJTB 3OX8B 3JSSA 1NCUA 4FQXD 5JHDD 2CK0H 1QLRB 3TWCL 1F4WH 4Y4FD 5SWSA 1BD2E 4D3CH 1DQMH 5HGDA 2NNAA 4K23H 2VABB 1L7TL 2DWEA 5D96C 5A3IC 1NEZA 1BVKA 4OLVH 1U6AL 2R2EB 5CUSH 5D7LD 5D7KE 4HUWB 1T21B 1I3VA 4N9GA 1URLA 5I19H 5DA4A 3QFJE 1HHJB 2D4DA 1E0OB 5TF1L 1F8TH 1JGLH 3KHOA 1EJOL 1VERA 4UV4L 1ZS8A 4UI2A 2R29H 1I75A 1UM4L 3M1BA 3VFOB 3GHBH 4M6OL 4LHUG 4PJHB 2VXSH 2QSTA 3LIZL 4NQDE 4G8GD 1ADQA 2BNUA 3G04B 4M1GL 1J88A 2HN7B 2CDFA 1H0DA 4R2GD 5FHAH 1ONQB 2W59A 3HLAB 3QIUD 4R6UA 3LKPA 3BPLC 4TVSa 3OKEA 1U3HA 4MXWH 2G2RA 3MBEB 5GHWH 5KZCB 1FV1A 1QSFA 2VXUH 4JPVL 5E6IB 4E42B 1YEEL 1Z9LA 2ICWI 3HZMA 4HKXA 4PJEF 4H88H 1BD2A 1HHGA 5DK2A 4PB9H 5FGBC 5ELIA 4DGIH 2R1YB 3FQTA 3MCG1 3RJQB 2O5YL 1EO8L 3JWNC 4QOKD 4YHIA 2NX5A 5EA0H 2ZP0T 4R4BB 2CXGA 1A9BA 2AXFB 5DHYA 2UWEA 5TGBA 1KNOB 1MCEA 2CK0L 3NVQA 2FGWL 1A6WH 1YJDH 3HI6H 8FABB 2OP4L 1FBIH 2VC2L 3TV3H 3PG2A 3ARRA 1SYVB 4YGAB 2F74A 4JEGB 2EDOA 4TQEL 3RL1A 3ULUF 5AEAA 3X14B 1P7HL 4HWEL 5EBWA 3I84A 5F7HA 3OKYA 3KWWA 5I73B 4MXQC 3QXDB 4XWGH 4F7MB 5IT2L 4QKXB 2IQAB 4Y19E 1NDMA 3B5GA 5E5MA 5T1MB 1GYAA 2NW3B 2AABL 3JVGC 5JXAL 5KSBB 4IBLT 1JIBA 5C08E 4FABH 4KJWC 5DJ0A 1KYOK 1M6OB 2DICA 3LAFA 1DN0B 1OLLA 4LCYA 2PO6C 3MFGB 5C2BH 1I1YB 2NY1C 4OM1L 1U0QA 5T1KA 3V5HA 3PQYD 5J1TC 1A5FH 1UZ8B 5ADOH 4PGDB 4LLVB 4XWOC 4LLWB 4I0KA 4U6XB 4PRNA 3L3HB 5E2JA 1HYSC 3VFVB 4PJ9B 5JHDB 2A6DA 2AJUL 3HR5B 1NCBL 1KC5H 3TN0A 3MRCB 1LE5B 3F12A 3ZMRA 3EHBD 1OQOA 5EZOH 2WIIA 1TNMA 4H26B 4M6MH 5DRNA 3FFDB 4M7JL 4HS6A 1TTGA 4XAKE 1BOGB 5IBLC 3DX9A 5C6WH 2QBWA 2KZWA 3DGGA 3LSOB 2GEEA 1LK2B 4LAQL 1AKJB 2CIKB 1RZGB 4PJ7B 4BZ2L 2C4FU 3T0VA 3QI9C 5HVGB 4XVSL 5F9JA 3D2UD 4JQVA 2IQ9H 1IC1A 1NGZB 3P9MB 3V2AR 5EUOE 1X4YA 4FQLH 2VZOA 5IMKA 4RFNB 3BEVB 2HAZA 4CADA 2D7TL 4F80A 3BXNA 1J12A 1AGDB 5I1GH 1FGVH 4LNRA 3O3DB 1NKRA 4YAQA 3WNMA 2P5WE 2VMFA 1RZKH 4LPVA 1YYML 4DFIA 4JKMA 1U8JB 4NSKB 5FYJE 2H45A 3I3DA 3U79A 1DVFB 2DQHL 1MY5A 4XVJH 2P49B 5F89B 3IDNB 4LEXH 4NDMA 4L3EA 4QNPE 1F3DH 5HI3C 1ZLSH 4ZUTA 3P77B 3GMNA 3VXSE 5TDPA 1AO7B 4HPOL 4NKOB 2FEEI 4LSVL 2QR0B 5CMAB 1NBYB 3AAZA 4IDJH 3UC0H 5AYQA 2P42B 5D96B 4YO0B 2W07A 3TLRA 4PS4L 4UZGA 1BJ1H 1NFIB 1A6PA 4JFEA 1R5VA 4V1DB 1NLBL 1MRFH 4M4RA 3AREB 3BKYH 4UU9A 5DRWA 2V17L 4Q97A 3QDJD 3H9HA 3V79C 5FV2A 3AB0C 5BO1L 4HAFA 3U46B 3FFCE 4U0QB 4GG6E 4G42B 4LSTH 4O5LL 2BNQB 5EU4A 1C5DB 5JXAH 3QCTL 3VXTA 4FQLL 3VXNB 5D4QA 1C5BH 1LO2L 1F02I 1TVHB 5CEYA 2ED8A 1YEIH 4JZOA 5BOZG 5ANMB 5DMGC 1Q38A 4MNQD 4KKBC 5DEGA 1ZA6A 4CMMA 2E7LC 4R0LA 4K3GA 4GXVL 1KFAH 3K4ZA 1F4XH 4NNXB 1M05B 4M8QB 3L3OA 4OJFH 1W0VA 4KJWD 1A6UH 2Q7YA 1A6WL 1YJDL 3BPCB 5SV3A 5CHNB 1KC5L 1J05B 2PNDA 4QGYA 5A16B 3BAEL 2BSED 4MCZA 4MX7A 1SM3H 2C3WA 1HKLH 1EX0A 1CG9A 4Q2ZB 1FNSL 3OR7B 5ID0A 5FCSH 1CICB 2CGRH 1WEJH 2A83B 5HDBE 1HXMA 4GKSA 3FAXA 3MZTA 5B39B 5GGRA 4I0PD 2WBJB 3ZDYF 1TZIB 3WIIH 5FYLD 3MODH 3H0TB 5D2NE 15C8L 5I1AA 1CLYL 3IJYA 4HIXH 4LVHC 4Y88A 3W5MA 5HYSG 3QULB 1FYTB 2C7UB 1IC4H 1NJ9A 1T66C 1FNAA 5DVNA 3EOBB 1UQSA 2FL5B 3OKNB 1AFVH 5BMFL 3KNBB 4M43H 4JQVC 1UZ6F 4KUZH 4I2XB 4WRLA 3B9KA 1WWAX 4JKWA 1XGQB 1CGTA 2F54E 1TZGL 1RPQA 1ZOXA 1UM5H 5KSAA 5EG6C 1E27A 5DJAA 2DMBA 3U0TA 3G6DH 1NCAH 4EDWH 4TQEH 2IH1A 5FCUH 3SDAD 4DN3L 1I8IB 4JB9L 5D71H 3G5YA 3EJYC 4PGBB 4LDOB 1BLNB 3LRSB 1PYWA 4X4ME 3HB3D 4MS8C 4NYLB 2DQGL 5AZ2L 3MBXH 1OTUC 3GSRB 1FGNL 5C0JB 3H6JA 4HWZB 5IMOA 4K71C 4F7PA 3CX5J 4M02A 4XPFH 2FECL 5SWZD 4HULB 3HR6A 4C54A 4NNPL 4V1DD 5J6GA 5CWSA 5EUKB 3IKKA 2DM3A 2B0SH 5I2IA 5E8PA 3G6DL 2VKWA 4O02H 2QHRL 4DFHA 1EBPA 4FS0A 3LZFH 3KXFD 4OLWH 1U8PA 2OTWA 3O3UN 4RFNC 3WO4C 4WFHD 4P2RB 4ZS6C 3IT8D 4QRPE 5D7JA 2VDRH 5I6XB 1ZXQA 3K80A 4D0CB 1DUYB 3RWIA 5DRXB 1P9MC 2G5BA 2P24B 3D0VB 1TQBB 3KJ4C 4YHLL 5BXFA 1VPOL 1GZQB 4P2QD 1MVFA 3B83A 2NMSA 4NFBA 1ZWIA 3RBGA 2EDNA 5JR1L 3O45A 3H9SE 1FQ9C 3D69A 3C60C 2VZVA 4XAWL 4LKCA 5J06A 3O0RL 5L6YL 3PGCA 4D94A 1XZ0A 3ROOA 3BPOC 2A6KA 1IFHH 2E3VA 4Z7WE 2COQA 1MHHA 3ORJA 5I17B 3BDYH 2CXKA 4RMRA 3WFEL 1I1FA 4PJHF 3MYJB 4H8WH 4X5LA 2GIYA 2XT1B 3V0WL 2A6IB 3L3JA 1ORSA 4FFVD 5BZDA 2M1KA 3BKYL 3W0WD 1PFCA 1QNZL 2ZKHL 1MCOL 3I6LE 3OJVC 4XX1G 2XI9A 2CKNA 1A21A 2HVKB 3GI8L 3ECBA 4PP2B 1DBML 2MQ0A 2CKBB 2L7UA 3ALPA 4L4TB 3K4DA 1UGNA 1BQLH 1FFQA 1Z5LB 5M94B 5GGSY 3WJJA 1MJJB 1ZLVH 1TDQA 3S34H 1U3HD 2O5ZH 2UYLA 4QYOA 1OGTB 4J6RL 1W0WA 4RQQB 2D7QA 4QRPB 1IAIH 4I0PC 1FCGA 1J0ZA 3U6RB 4YXKH 1G9NC 4LU5H 2Z93B 3MGTB 3MRHB 1FFNA 5DK0A 5E56A 2ADJA 2EIZA 4LCWE 3DX6A 1U42A 3HZYA 2XFXB 3WLBA 5B38A 1I9RH 4L1HA 3ZHDA 2GY5A 1P7QB 5EUOA 3HPLB 3KPMB 3EDDA 3G6JE 1EXUB 3VFRB 1H5BC 3BRGC 1DANU 1PLGL 5C0AB 1SJHA 4FQQA 2OL3B 1NUFA 3MCLL 4RBPK 5D7IE 5C09A 3WJJC 3KPSE 1UWXH 2N7AA 2BVPA 2J8UE 3HTLX 5FAAA 3U0PA 5GRWA 1RJLA 4D9QE 4ODWA 4U1JB 1SEQL 5BRZB 2DBLL 2UV3A 2X4QB 4NQEA 2Y07L 5F7KC 2IFGA 1TPXC 4LMQE 1AR2A 1FVEB 5IKCB 2L7JA 4W81A 4HKZB 5C6TH 4DGVH 2AJZB 4H5SB 1JPGB 1GGIL 4UIKL 5GJTL 2XA8H 4U1MA 3PHQA 4JFDE 4ONGL 1I3UA 1Z3GL 5I1GL 5BVPL 3Q2CA 1XGUB 3I6GB 2HKFL 4Z7VB 5KANI 3J7HA 5T1DH 1A1OA 4HT1L 4K94C 4Y1AB 1Y18A 4RMUA 1ZHLB 3OJMB 1INEH 1J86A 4GRLA 4OCRL 3ZTNL 1SVZA 4N1EA 4TNVK 4X5XB 5D1XC 1A6ZA 3GUTA 4M1CD 4BQ9A 3FB6A 4HBQA 4UUJA 3MO1A 1QBLH 4YHYB 1T1YA 4OZHB 4PJFB 3BP5B 4PY7B 3EYFB 1DZBA 1OAXH 2CLVA 2FX7H 4HFUH 1RJZB 2FIKB 3UZEA 3VI4F 4YXLL 2VQUA 4NZUL 4JVWA 3M8OL 4YH6A 1VKXA 3GKWL 4XP4L 5EWIH 3GJFH 4Y4KA 2PW1B 1DEDA 1QEWA 4OZ4A 4Q0XH 5IHUH 1WC7A 1A64A 2VL4A 4MNQB 1U2HA 3WUWB 4FTVA 1KCUH 3VFNA 5D1QD 5DD0L 3OB0H 1ITBB 5DYOA 3V6OE 4JRXA 4PGEB 1FRGH 4WEMB 1IT9L 5A40E 4Y4FB 1QBLL 4OLZH 4NQXB 4WW2B 3TJEH 3CU7A 4PYGA 3C09C 3QEUA 4JRYD 3BKMH 1HDMA 2XTJD 4MQSB 1NANH 2PYFA 4HF5L 1KULA 5HDOA 4NO0D 4FTVE 2C3GA 3V52L 3KPQA 3S96B 3QIWA 4NPYA 4RX4D 4M6NH 3IDMA 1I1AA 4FXLA 1C5BL 3HUJA 4L4TE 4XCNB 4Y5VB 4KK9D 4F9PC 2O61B 2IANA 3S36X 4HIJA 1LD9A 4J3UA 2QQLH 1WBZB 3TPUB 3VRJA 1IAKB 5E24E 5EZJB 4XCCL 3LKQA 4BSVA 2ZCLL 4LVEA 3BQUA 5FIEA 5DD3H 3ZTNH 2YKLH 5E5RB 3LN9A 1AQDA 1RK1A 1VGEL 1B90A 3WFBL 4MDIA 4R26L 5FUCE 1HCVA 1U3HC 3L6FB 1KBGL 2AVGA 1JF1A 4O2EA 4FQ1H 4LCWB 1U8NA 2OSLB 4ONGH 4J8RA 4N8VB 3CZFA 4Q74A 4KKLC 1W72A 4KDTA 3QUZD 1D3CA 1O5DT 3OKLB 4KPHH 3TZVA 1Z9SA 3UJIL 5JPMB 2EDLA 4FQJH 4R4FL 4JHBA 4U1LB 3KDMA 3SO5A 4FQ2L 4NCDA 5D7IB 1DUZA 2XWJA 4CMHB 1A7RH 4Z95L 1RURL 5F6IC 4Y0GA 4WV1C 5F3HB 1CXEA 3FQXB 4RISH 1S8DA 5E0QA 1DL7H 3LMJL 4L3ED 1MJUL 1LDPH 4R96A 2I07A 3FB8A 3GIVA 2EXYD 5T3XL 4MXVE 1A7PL 4JN1H 2W0FB 2BMKB 2WP3O 1OOAA 3IJHB 5JPNB 3CVHA 1FGNH 1JN6A 1KACB 4PJ5D 3V6FB 2W65B 2F53B 4JFDB 1G9EA 1JV5A 3B5TA 3UTQB 3STLB 4KQ4H 3LS4L 4BK4A 1U58B 3D3VE 4JFED 4OZGA 5FGBA 3QIUB 3G6JA 3O81A 3FN0H 4JHZA 3X11B 4JR9L 1CIUA 3VD3A 1S3KL 1OCWL 1P5VA 2YA0A 3SE8L 1IBGL 3BMVA 5IM7B 2QQQA 3CC5A 3VFPB 4PRDA 3PWUB 1KJ2B 3L95A 4ZPTB 5ADPH 1JZ4A 1MH5A 3RL2A 3O4OB 4HZLA 2BXZA 2GJZA 3N1PC 2YPKB 5DVLA 2E9JA 1CT8B 1TVDA 4NQDA 3FQNA 1MFAH 2CD0A 3B6SB 3MV01 5CEXA 4WU7B 5C0BA 5JDSB 2NXZC 5DUPL 2Z0BA 1LP9A 1G7PB 3QDGA 2EE6A 4LARH 1T2QH 5HHNA 3PDDA 3QNXA 4XZUB 4PJIF 4Z8FL 5IB2B 1U8IA 3T8XB 2X4NA 2AEIT 3GJFB 2ADGA 5CBEB 4Y4KD 3WD5H 4YHLH 1FIGL 5IUSA 1EGJA 2A1WL 1JMZA 3C5JA 4G6AD 4FZEH 3G5XB 4N0FA 1T1ZA 1IAMA 1ZLWH 3KHQA 3VD9A 1K4DB 2AERT 3BUYA 5DURD 4BZ1L 3A67H 3SJVA 3WFHB 1FYHB 1FDLL 5IJVB 5INDB 3GSOB 4I4WA 1DBAL 2PXYC 4UT9L 1DJSA 4GKNB 1NSNH 1EO7A 2A6JB 4I2XE 1G7JA 3TPKA 4IIQB 2YK1H 4RA0C 5JLZA 4YDKL 3D18A 3GEWB 1QG3A 4QRRB 3BDYL 1MCWW 2YUVA 4Y2DD 3G9VA 3BIAX 4JDVB 5HDBF 3SE3A 1EUTA 7FABL 5F72S 2LVEA 2ATPB 2O5XH 2BNRE 4LSUH 4JHAH 3MLYH 4WWKC 3SJVD 3D2UA 4Z0XB 4U0RB 5E8DH 3ZE2F 2DI7A 3DRTA 3NIGF 3AMKA 1UM6H 4YGVA 1RURH 3JXAA 4GMSH 4F2MB 3BKJH 3AS0A 3G6JF 3OB0K 4P23A 5LKNA 1U95A 2R2BA 5C6PB 1FVDA 3KXFA 4G9FD 2LQRA 3WDIA 2HT3D 4K7FB 2I60L 2XN9D 3RVVC 5E00B 2AK4B 5DJ8A 5FECA 4GBXC 1OP3K 1D6EA 5BS0B 3EUUA 3T3ME 4KROD 4PV9B 3P0YL 1P84K 3P3YA 4XMPL 4HS3A 4MQXD 5CP7A 4AENA 2HJFA 5FO9B 4XH2A 2VLJE 5IVXE 4S10A 1D5XA 1GVIA 4P2CG 3GHEL 1E4XI 4RWYH 3GSXB 3G5ZB 3PDOB 2ITDB 2V2WA 2VOTA 1MPAL 1Z9MA 3HC4H 5D2LB 2AQ2A 1KIPA 4OBRA 3JUYA 5IVXA 2NZ9C 1OTSC 5SWQB 3ROLA 3O6LL 3VH8G 4MA8L 3EOTL 2WM0A 5JW3L 1T3FB 4WDIB 1UYWH 2FH6A 5AYUH 2ICWA 1N7ML 1HKLL 1KJ3H 4NO5A 3DIFA 4NN6B 1YPZF 3FL7A 2X44D 3NCFB 2UY6A 2FSEA 2VN4A 4NRZB 1GL4B 2VIRA 4XWGL 2VLKA 1JPFB 5DQ9B 4L5FL 4PJ9C 2NY3C 3MJ7A 1F4XL 1T89A 3O6KH 1J1XL 2NY7L 5B39G 2VIRB 1U8QB 3PJSA 3QJFA 4L8CA 3MJ6A 2FSEB 3MRDA 3OAUL 5C0EA 5BV7C 3PHOB 4JKPH 3DIFB 1CICD 3NH7H 4MB4A 3MRNB 1U3ZA 1NC2A 1YY8B 4L8SB 3ZT5A 3VFWA 2BDNH 2EIBA 3L5JA 2V5SA 4LSPL 3I2CL 4EBQL 4KK5C 2AI0L 5KVDL 4R0LC 2EDFA 4WFED 1CQKA 5IVXB 3MRIB 2OLDA 2OTUB 1W72L 1C8PA 4WNQA 1TTFA 5CZVH 2BOCB 2PCPA 3EOAB 3MLUL 3THMH 2W0KA 4O51A 2VAAB 1ZMYA 2DQIH 1MSPA 4XVTL 3RA7H 1EEUA 4LSSL 3P9WB 2ICES 2AJSH 5BV7B 4NO0B 3BJ91 5E94A 5GGQH 1H3XA 4XH2B 2AEWA 4JFXB 1ADQL 3DX7A 4ALAH 3BEWB 1CZ8L 5FKAB 4RX4A 4KI1A 1BQHG 2JJUA 3NCJL 2BX5A 1YYLL 4GXVH 5DJ8B 1A6VL 5E00A 1JNNH 3WXVH 4YE4H 2DQDH 5F9WC 1C08A 4ORGA 2BSSB 2H3NB 2IF7A 3V95A 4TVPE 5IMMB 3INUH 4P23B 1UC6A 3IU4L 2R2CA 1P4LB 3BESR 3SDCC 4M03A 4WUUE 2NY4C 3O2VL 5HGBB 5ISZD 2KPNA 4JFOA 1OM3H 4Z0XA 5DD1H 4TUJB 5I1DA 5KVFL 4JDZB 1N7MH 3T2QA 2FR4A 1E4XH 1ZVHA 2XKNA 3QUZA 4I48A 12E8L 4Y5YB 5DLML 4Y2OA 4Z7QF 5JORA 3I85A 1CDBA 3D18B 2IBZX 5JLZB 5DJ2B 3WUZA 5A43C 1KENL 1Z2KA 4HLZG 1G7JB 3Q3GA 1GXEA 3QAZB 1DBKH 4YC2C 4EXPX 2EXWC 3SDDB 2HH0H 5INDA 5IJVA 4ZUVA 3F7YA 3HCVA 3ZDXE 3PP4H 1K4DA 1YY9D 2OBGA 4PLJC 1ZA3B 1KN2H 1I8KA 4BKLA 1ZVSB 3GMLA 4UOW0 2R4RL 3FQUB 1MHPH 4H25B 4DWHA 2XWTB 4AYFA 3N0PB 2F58L 4NP4L 1AC6A 3QWRA 3TNNA 2LTQB 3KR3L 5JXED 3T8XA 3F7RA 1GGBH 3DURB 3JV4A 3TYGH 3HAEG 1IARB 2PTVA 3QNXB 4XZUA 3DVGB 1SEBB 2AJVL 1ZHKA 4YIQB