4R9NA

Deor family transcriptional regulator from listeria monocytogenes.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
253
structure length
247
Chain Sequence
b'NATVDLEQKLEEKFGLEEAIVVATHDMSEEEALNFLAKEAAYTLSKRIAKVKTLGISWGKTIRKFANEFPFIPHKDLTIIPLIGGDLHSNQICYDLKKKMKCHSKYLYAPALVEDTEMKTDLSKNKYISEVLEEGKTVDMAIVGVSSPYNHSTMEEIGYINSEDIEELRYKDVVGDINSRFFTADGKEAKTEINTHVIGLSLEELKNIPTVVALANGLQKKEALVAALNAGLIDVIVITDRMAEYIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo0547 protein
publication title DeoR family transcriptional regulator from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 82
structure length 247
sequence length 253
ec nomenclature
pdb deposition date 2014-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r9nA00
4L4YA 2W48A 5HJ5A 2RI0A 4IO1A 1KS2A 3ENWA 1O8BA 1FS6A 1Y89A 2F8MA 4GMKA 1FQOA 1VL1A 4L4ZA 1LK5A 2RI1A 2WU1A 3E15A 3LWDA 4L50A 4GO1A 3BXHA 3KV1A 1UJ5A 4L51A 3LHIA 4R9NA 1LK7A 1HORA 1UJ4A 1DEAA 3U7JA 4NMLA 3ENQA 4L5IA 3BXGA 4L5JA 3ENVA 1CD5A 1NE7A 4OQQA 1PBTA 3EFBA 1FSFA 3UW1A 4M8LA 2OKGA 3TX2A 3HN6A 1LKZA 1FRZA 3E7FA 3L7OA 3CSSA 3ICOA 1FS5A 3NZEA 3NWPA 2BKVA 1JT9A 2BKXA 1XTZA 3OC6A 1HOTA 4R7TA 3HHEA 3IXQA 1UJ6A 3CH7A 1M0SA 2J0EA 4OQPA 3EB9A 2R5FA 3BXEA 2GNPA 4TM8A 3BXFA 4X84A 3KWMA 4TM7A 2O0MA
chains in the Genus database with same CATH superfamily
1F2TA 3CA8A 2ZTMA 3PNPA 3QXJA 4PIPA 1DCFA 5FEUA 1CUCA 3GFPA 1ULHA 3L0DA 5H1YA 2R6AA 2WF8A 4U8GA 1G5QA 1RWKA 1RYFA 4FK8A 1XMOB 1KRHA 2ZRBA 3TZQA 4QOHA 4KWEA 5JSUA 1LZLA 3TBKA 3GWGA 4NCJA 3FTQA 4AZ3A 1ZMBA 2B9EA 3B48A 4J1QA 3VDMA 3LPDA 5ALDA 3W1EA 3Q3EA 2WSSA 2ZTLA 2J07A 3PFCA 2JBWA 4P32A 3ZVLA 1Q5PA 3I76A 2DTEA 1NNLA 2ZJYA 3NO4A 4J9VA 2I34A 3MGGA 4OP1A 5KWIA 5GINE 3HXLA 4JVNA 3T5GA 3OZXA 2OXFA 3DHYA 5K99A 3RFTA 4L9RA 1IHYA 1OXXK 2BBTA 3RC8A 4PAMA 2O8EA 2NO1A 3Q5EA 3JQ8B 4L51A 4FOSA 3L06A 5AVUA 4M1KA 4R9NA 3A31A 2W70A 4TUYA 3ET5A 3Q3GE 1E92A 1LQ2A 2ROQA 4WZBB 3RC9A 3WIBA 1FVFA 3QPUA 1ZI8A 3PXUA 3TWOA 1QG2A 3DJFA 1XA0A 4MMXB 2ZYGA 3FKSA 1I3KA 1E8DA 1F8GA 1V47A 4D4HA 1C30B 5DHUA 4UEOA 3WHPA 1A9SA 1JLLB 2Q41A 1QTQA 5GV8A 5BWLA 4II7A 3WLKX 2DKFA 2XT6A 1WBDA 2BI8A 4AKEA 4F7DA 3ELYA 1XP5A 1E9EA 3KOWA 5LYYA 5IAGA 3S1SA 1XPRA 1U4OA 1XVIA 3W2FA 1P2BA 1MN6A 3TZCA 4BLQA 1BCRA 1P2SA 1T6YA 4Z99A 1H2XA 5ALTA 4TTSA 1OGYA 4OHBA 3E58A 5HTOA 1SCBA 3HUUA 1M2JA 3DZKA 2B9VA 3G2NA 1JILA 2QGFA 4J4HA 3NVMB 4Q7EA 5G0VA 2IYTA 4RTSA 3EXHB 3BMCB 4OJNA 2OD2A 4GVLA 1WOMA 1O0SA 4PQYA 1LNZA 2TSYB 4LJ5A 4R2IA 4AQDA 2KPOA 2OM2A 8ATCA 1N1MA 4Q21A 5HW0A 4HH1A 3EBPA 1HQKA 2V5AA 3AILA 1GARA 5EZYF 5FULA 4ZPXA 2KM1A 1TJ3A 3ZZMA 1T2CA 3D02A 3K4PA 2ERCA 3LT4A 3WRYC 3MB5A 1CBUA 4FQ5A 4QX6A 1HLFA 2IH2A 3F3SA 5IYZA 1NURA 5EINA 3S68A 1N78A 3BWVA 3DF7A 5K1ZA 1YQ9A 2BGUA 2GA8A 5HSGA 1I0LA 4Q9HA 3NR2A 1H8EA 3EZ9A 3RLFA 4YV2A 4FZVA 4CMEC 4ZQIA 1Y1PA 1BQ4A 4PSVA 3N8KA 1UK9A 4IWYA 5J9FA 1UINA 2FPGA 3RLIA 2QRVB 1U1CA 3KKNA 3A9WA 3GROA 4TXNA 3SLKA 2NZ8A 2Q1TA 5FBRB 1GGJA 1VLMA 2A35A 2VDVE 5FRDA 1DRWA 2C0QA 3SZLA 4IZ6A 1SULA 5FPPA 1JBKA 1YQDA 3K6JA 5KYXA 3G59A 5ENVA 3GMSA 2QX6A 3EYWA 3A70A 5FPHA 3ACBA 3NPMA 3LUFA 1RLTA 2YV4A 3RBZA 5AKKA 4V0ME 3AI2A 2F3PA 5B1EA 1Q1QA 5EHIA 3TI7A 4B3MB 1NWHA 4ZVRA 4J0JA 3T15A 1L4LA 1G9SA 2Z57A 1HR0B 3DEIA 3INRA 1PR1A 3D8RA 1Z9BA 4YT5A 4IHAA 1RSZA 3NHAA 1FFBA 2X42A 3P2EA 5J1SB 2JBAB 2C7BA 3PCXA 5BQ5A 2QRZA 1U0EA 2WYUA 3ICCA 3O8OB 4AZSA 1M0TA 1XYGA 1K89A 2V7PA 4HK4A 4ZOEA 4C7XA 4I4TB 3VI4B 4XJVA 1R4AA 2PSJA 4FHEA 1AD2A 4M1EA 4RNCA 1V6SA 1CQIA 4JC4A 3T7CA 4CFZA 3ZU5A 2JDID 2GR9A 2VBCA 2QIPA 1Y1KE 2GZ2A 4DJEC 1WPRA 1N5KA 1U8UA 5A7HA 1GLGA 2KE5A 3LGSA 4MUXA 2P2CA 1VZ2A 2VHEA 3OCYA 5JT1A 1U99A 2RHTA 3HDVA 3NVDA 4X20A 4J7UA 5I7AA 3OIDA 3W5AA 4QIHA 1PUIA 4G1VA 1Y3AA 1T2NA 1PNOA 3CNEA 3Q9NA 4XWTA 3PEYA 1J0EA 2ZYAA 3TRHA 1G1AA 2R751 3H2IA 3AOEC 1PR4A 3EWIA 2G06A 1PDVA 5D85A 4H4DA 3WL4A 2RGRA 2AH5A 5FA5A 4DXAA 4W7IA 3CT6A 1JG4A 2VBGA 1CZOA 4ES6A 2MSCB 5HX7A 2Q3MA 4HAWA 2R4TA 2XODA 1R8YA 2OCDA 3ZNNA 4F2WA 2IBTA 3W3ZB 1K8XB 3BWDD 4C78A 4WKNA 1VHTA 4L16A 2QRPA 5KJEA 3DTNA 4YPFA 2HRDA 2HQSA 4Y3UA 1IXYA 5EQDA 4O3MA 3ESXA 5J3JA 3RYCA 4LIPD 3ZWVA 1FPMA 4ZICA 3RRJA 4PC2A 2LIVA 3RK1A 1HTWA 3TI9A 1NLUA 2QGZA 4N03A 4EEZA 3VVBA 3FSEA 4HB2A 3VTFA 3N2LA 4BNKA 1N6OA 2R66A 1ZITA 5DLQC 2HC9A 3BXPA 4ZAWA 5CVVA 1WXEA 4PE5B 2WHEA 2V65A 3KTFA 4M9QA 1VGQA 4CL0A 3O6VA 3QV2A 3I5MA 4E08A 2Q2OA 4X71A 1Z2OX 1QQBA 2XB2A 2PK3A 2PD3A 3EASA 1KKLA 1DWQA 1A9XB 1NW4A 2O2EA 4NWIA 5DNCA 1YVUA 3KQWA 5IBPA 1KBOA 3WAGA 1YA6A 4QWWA 2VPIA 3MUNA 1XTVA 1IRXA 1FK8A 2QQ5A 4NCHA 2Q7OE 4LMRA 4U7TB 3T3HA 2OO5C 3R2JA 3UMGA 4AW9A 2VEOA 4GR5A 1ULTA 3RV4A 3VDNB 1KS9A 4P98A 3JTEA 4ESOA 1DAGA 2RH4A 4HVLA 1MVNA 1C3XA 2G4VA 4JLUA 4NH0A 4JN6B 4OHUA 4FYVA 3D4OA 3KJFA 4DJFC 3W34A 3LVQE 5A0FA 3QPWA 5LZ9A 1HDGO 5KHLB 4NG5A 4IMIB 2YWDA 1LWNA 2AG6A 3LCVB 4P3XA 3GLUA 3NT4A 1Z5GA 2PEYA 1B1AA 3G79A 2RB5A 2W6CX 3NHZA 3MTBA 4RS4A 3SICE 5ICEA 1H93A 3AKZA 2Z1DA 1JHPA 1M66A 3OFSA 4LSZA 2P5TB 2VRCA 1WNFA 1UPXA 1X6VA 4O5AA 3D6JA 2WYVA 2GM9A 4Y2SA 2R2GA 5FI0B 3FPBA 5IF9A 3TRJA 4MGKR 2QX8A 4XWKA 1AQ6A 1G5RA 2MSNA 4M7WA 1BRTA 1GZUA 3QHQA 2FZ4A 3H86A 3P2JA 1YQQA 2IXDA 2BRUC 2UKDA 4XTRA 4J1TA 4GZMA 1ZS9A 1WKVA 3OIYA 4U6SA 1MJGM 3N6RA 4H60A 2X40A 4NZOA 4W82A 2GZHA 3ROPA 3UB2A 1NATA 4BZZA 4B71A 1KY2A 3HEAA 5G0TA 3BS4A 2P6UA 2RKWA 1JJVA 1W48A 4Y6SA 4J2OA 4KXQA 2C99A 3A9TA 1RYNA 1Q84A 3EVNA 4QJ5A 4R2JA 1RE1A 2DCMA 3QBVA 1T3GA 2BP7B 1JAZA 2GEBA 3OHSX 3OM9A 1W94A 2FI1A 2NSHA 4GPBA 4LTNA 1AKEA 3ME5A 4OHVA 5JR3A 3E18A 3GFRA 2GCOB 1TKRA 3PD1A 1H3NA 4KFTA 4LZNA 2DSTA 3CX7A 4UHDA 1CJBA 1DCTA 1T0PA 4GXNA 2H16A 1KKUA 1T8PA 2X3FA 4UVDA 5IDQA 1GA6A 1NG1A 2QJTA 4K7JA 3WGGA 2QG6A 4QQKA 3STHA 1FMFA 1KSGA 3MJEA 3QM1A 1Z4IA 2QROA 5HRCA 3KVYA 4YJFA 4I4IA 4H0NA 1DX9A 3SHVA 1U4NA 2E7ZA 5A62A 3JAMA 4RIHA 3WTBA 2F8TA 1DEAA 3ZWQA 1Q7EA 4EK9A 4QJ3A 1QFJA 3HRIA 3KALA 4BLUA 1ZGHA 2YVKA 3GBPA 4BQIA 1RVV1 5KCMA 1V5GA 1F8XA 3MWYW 3R9XB 1H2EA 1SK8A 2ZE8A 4IMRA 3K0SA 1VCIA 1R0WA 1Z7WA 2O23A 2P0EA 4F85A 3F78A 4ODIA 3ZHSA 2OEPA 3WL7A 2JJ2A 3KTAB 1QJ4A 3R3VA 3DT8A 1GZ5A 1M7HA 2DFKB 4U2FA 4AKTA 1RYDA 4KW7A 4NX2A 4YAWA 2BI7A 3RIHA 1FFDA 4HNTA 4A3SA 1F3OA 4NV1A 4E1VA 5ALEA 3ESDA 2RB4A 1QS0A 3BD6A 4WLVA 2WJWA 4U7FA 3I4FA 4WECA 2PUWA 4Q9DA 2C0PA 4UARA 3WL5A 3PRHA 3TPFA 4WVFA 2C2KA 3STWA 1ILEA 5G0UA 4WBXC 2CMDA 5LJIA 1LBIA 2YV5A 1L7XA 4ZYYA 2KYRA 1QLJA 5C1OA 5FI5A 1VLQA 4TVKA 3IUPA 5DH9A 4RHXA 1R7RA 1T3LA 4IXDA 2VYND 4NYJQ 1G20B 3GU3A 4QE3A 5BN4B 5KVCA 3F49S 1DV1A 4D9NA 1RHJA 3PLAE 2C29D 4LE1A 1D04A 2CHUA 1GRNA 2NPOA 1VJGA 1WXWA 5K3CA 3GNQA 3OVMA 3N8NA 2IHZA 2NUPA 1SUPA 2C5HA 4Q4JB 2H1SA 4XEHA 4PS0A 2FXVA 3BTVA 1XVUA 2G1AA 4RSHA 2GO7A 3AX6A 1WQ1R 2O0LA 3DCNA 3KLNA 3JD2A 2VQ3A 3OI7A 3PCRB 5AKYA 5EESA 3EBLA 4QDOA 5EKUA 1ONBA 1QB7A 2IYYA 4BNNA 2ZJZA 4Z0NA 3VTKA 3GCZA 2GM3A 3CZ4A 1EUQA 2QE6A 1QF6A 2OWDA 1NYLA 1ULAA 4QHYA 1VE1A 4GM0A 4J9UE 4QUGA 4OHOA 5D87A 5AWFC 2VK8A 1RHKA 2C7VA 1XRMA 2E6UX 3FIUA 3SSOA 1LTKA 1N75A 1XEXA 4BO9A 2C7OA 1TECE 1DKMA 1T0JB 1E63A 3I92A 3LLUA 3VR6H 1QGZA 1EVKA 3HJUA 1YZ3A 2QJWA 4FLFA 4YT2A 3BGWA 2GX6A 1X2BA 5DCYA 1RU3A 2X0FA 3TZ6A 4KR6A 2MSEB 2V7XA 2WJYA 4LNUA 4QOIA 3AEQA 4CI0B 1C9NA 3W2TA 2G07A 5JBQA 3RWBA 1KI9A 4B4DA 1E3TA 3INTA 5LZ8A 4ENRA 2O7QA 3A6PC 2WG1A 3ZUPA 3D3WB 5EP2A 3E7DA 1GZHB 3TAUA 3F6YA 1ELOA 3QG1A 2J6HA 2P5SA 1KO7A 5TEVA 4K86A 1YR9A 3CUKA 3T3GA 4I9HA 2XUFA 2PL1A 2WG0A 5D01A 4YAGA 1QGUA 3F8TA 3A7EA 2YVLA 5LA6B 3RFVA 2FR8A 1LVHA 3A28A 3PQ8A 5FL3A 4ZMSA 4AMUA 1DDOA 2QV0A 1BJTA 3C6QA 5L7TA 3KOUA 4DDHA 2Z6QA 4LRSB 1AGPA 1I1OA 3AGQA 2ZBRA 3RVLA 1FBTA 4KLZA 3FUCA 1L5MA 1HOXA 3CB2A 1WULS 2L69A 4JP8A 4XA8A 2NQTA 2WUDA 3AWDA 1R12A 1ZYUA 3ENQA 2FZLA 3K9NA 3L7KA 5IDXA 3CRZA 1ZY2A 2A1UA 2OCPA 2G80A 2DH5A 5TJ9A 3EISA 4QPPA 5J4LA 3OLZA 2BFDB 2VPWA 2ZDQA 1IN1A 3U4QB 1KZ9A 1RM3A 4P80A 3QVUA 2VL7A 4X1YB 3T9AA 4NFYA 1NJ5A 2IK8A 1LF0A 1OA1A 2V97A 3B9RA 3DOIA 3NBZC 3RC1A 3LT0A 2JAWA 3SC4A 2FJUA 1Q0HA 1XCOA 1HV8A 2OYSA 1S02A 1OAKA 1SZPA 2XDWA 1KEEA 3HXOA 1S89A 2DBZA 1RC0A 4INOA 3L0BA 4DV3B 1CP2A 2OUIA 3T1VA 1E99A 1V48A 2XECA 2Z30A 3LQ4A 4CODB 1DIAA 1XNJA 2H8GA 1I4DD 1T26A 2C7GA 3EC1A 5DYGA 3N2EA 4C1BA 5BPFA 3OTOB 3H5VA 4RTLA 3LQQA 3QF4A 1HNNA 1PK7A 4CMAA 4B80A 3IQHX 1QDLB 4UMFA 4UPDA 3OFVA 5CXUA 1XQYA 5JXIA 1FXWA 4XCXA 3KL4A 3K20A 4BMXA 3VSBA 4ZKDA 3E5HA 3T3PB 1J8YF 3MD9A 5HGJA 2UUOA 4C3UA 4OBWA 3DL2A 5IXSA 1OXTA 3AVYA 3W8NA 3TLEA 3HG7A 3DAPA 2Q62A 3GAMA 1H4SA 2OZKA 2PGLA 4WUTA 4XYBA 5JCOA 2WQ6A 3GGJA 5CM8B 2V1UA 3A9CA 3MWKA 2QG4A 4HPJB 2AK3A 3LM8A 4CQNA 1PZNA 2FPLA 2P9BA 5COAA 3V1YA 4QTYA 2UYGA 1JUDA 4Z49A 3JZDA 3UA3A 1QF7A 4JUBA 4BLTA 2GJ8A 4F91B 5DTQA 2WJVA 5DPMA 4G09A 1NWCA 1ZUD1 2MWMA 2IP2A 1FP6A 2ZVQX 3O75A 2O59A 3C6XA 2IHNA 4E07A 3FJOA 2BGMA 2HLNA 1BHO1 3CBGA 3AIKA 3VVCA 1C0IA 2DM6A 1RMQA 1G8AA 2PMFA 4F46A 1CERA 1F9EA 3JAWA 2C5SA 4MEBA 4UPVA 4QTUB 1PWXA 3E4CA 1X38A 4BTEA 3HB0A 3HA2A 4LZAA 1J90A 3FSGA 1I4LD 1NLMA 2NYAA 5GJWC 1GU1A 1TCAA 3ET4A 3ZGNA 1GQRA 3RVPA 5C3MA 3BEDA 1XUOA 1K1EA 5IJ0A 5G1PA 2DHCA 2I2XB 4IR7A 4ZFNA 4ZAGA 4MUFA 4A8JB 1MU0A 2IEIA 1SUAA 1ZX1A 1EFTA 2NXJA 3HUDA 3ZHOA 1PLKA 2Q7XA 3N9IA 5LMCA 1MBZA 4D4IA 1ORVA 1NAHA 1REQB 1R3DA 2EHJA 2I4NA 3I64A 1T0UA 3GV0A 1C4WA 3U7QB 3EG5A 5AVZA 4AS2A 1M67A 4LSMA 2ET6A 2QD5A 2A67A 2WLSA 5E0OA 4X91A 1DQNA 3C7CB 1H9BA 2VZ8A 2YJTD 3IDSA 4AL4A 4LI0A 1PL7A 1L5ZA 1E7QA 4A82A 6REQB 3M2PA 4ZYUA 4C7VA 2QRJA 1AH2A 1SELA 4BMCA 3RFFA 3T61A 3LC1O 5HMLA 5LWQA 3HGMA 1SCKA 2QYHA 4AQ7A 3Q7TA 2MR5A 2EBWA 4FR2A 1QRDA 3CHYA 1SGWA 2FAXA 2X9NA 1NP6A 3CE6A 4G1UC 4U5XA 2QP9X 1TA9A 5EUMA 2D6FA 4Q5IA 2FNAA 3WBJA 3DMDA 2ACEA 4KYIB 2OV2A 2X2PA 4A16A 5SZJA 4N7MA 5CA0F 3KXPA 3LFTA 1EUDA 4ZV7A 5KVQA 2VTDA 2C2WA 2NMVA 4TMTA 2PO5A 1NIJA 4P3KA 1QH1B 3WIUA 4EW6A 1QHEA 2OHXA 3MSCA 5BQXA 5JALA 2C94A 5DHTA 5LN1A 4M8LA 1YV9A 3EIOA 1TF7A 1UBOS 2Q2WA 3PHCA 4HNHA 1L8XA 2J7PA 1N9GB 3BA1A 4ZREA 5T3UA 3LDAA 3VVMA 5CURA 4B17A 1KSHA 4C0SA 5LD2C 3D8NA 4AXXA 1UZMA 3T0FA 3IV7A 1PJ2A 2QLFA 1U7UA 4HH3C 1K88A 4QLOA 3TW4A 2B1QA 4I9UA 1UC9A 2MSWA 3K0BA 3MA0A 4RHFA 4AS3A 1FDIA 2HV9A 2M1ZA 3L7JA 4GU5A 1Y7TA 1K5DA 5EXXA 4MLCA 2H07A 1O77A 3RK0A 1M8GA 3A36A 2ZYHA 4KRXA 4WDQA 2Z09A 2Y1LA 1JDBB 3PQFA 1J49A 4PSUA 3HBNA 2HF7A 3PXBA 4O1MA 2H2FA 1RAGA 2VUSA 5JBNA 1AB5A 5K20A 4OMUA 3HDYA 1VI6A 3HU3A 5EIEA 5AMXA 4BLOA 1UBUS 3X1KA 4WBNF 2JS7A 2YV2A 3WRXC 5K4GA 3FGOA 3IBYA 3UK7A 2C5EA 3DOFA 1WHTB 1EP3B 2Z0MA 2P9FA 3JWHA 3BJZA 1R4NB 2CJXA 2OY0A 4FOPA 5L4SA 5AP9A 1XLWA 5C1BA 4FLEA 1G21E 2EOAA 2XTMA 3UXMA 2ZXUA 3DCJA 1X8KA 3DM5A 5ENDA 3NVKI 3ROQA 4H1TA 3MOGA 1VLJA 2WSLA 1KBZA 3V1LA 4IYRA 2R6GA 4B74A 2WZBA 1NJ6A 3QXXA 2N1BA 3OLCX 4DGQA 4F9EA 1ZRHA 1NVUQ 1ZINA 3ZCVA 2B1IA 4XRGA 2BSXA 4L4YA 4G5YA 5P8WA 2FZGA 1TFUA 1LDMA 1YB2A 5CVJA 3ROZA 3FNHA 3SEZA 1XRSB 3ANTA 4D0RA 2UXCB 1JIIA 2C96A 1GAQA 1FTNA 4DLXA 3WL3A 5ALSA 3LPCA 2P91A 3WGQA 3CUUA 4RTMA 1ENZA 2IU0A 3AKDA 4MQFB 1LPMA 4B3JA 2DGDA 2MJLA 4FGSA 2PX3A 4ITRC 1PR9A 3FGNA 3QOWA 1V6AA 5ALKA 2QXUA 1SOAA 1JF8A 1QK4A 4ZCIA 1TZBA 2H7VA 5FLKA 1ZAKA 2C20A 4ZT7A 2AOTB 1NZDA 2OFXA 2PPLA 4MHTA 3N07A 3SQMA 3G2IA 2FX2A 2B4QA 4IZHA 2ON6A 4EEXA 2HPZA 3OIVA 3OJCA 2O3QA 3DPSA 5ALWA 3WZLA 5HDBB 4P2GA 4Y1RA 2HCRA 4JXZA 2PQ2A 1ZVKA 2UZ3A 4HX2A 1NKTA 2XEXA 3HCWA 4X3OA 2VDPB 5A3JA 2QVLA 5KYWA 3D3QA 4X95A 4CTOA 5KJCA 3H6KA 3G2QA 1BXGA 1HTBA 1KI3A 2JEYA 4XPZA 5B1DA 3ZGYA 3OQVA 3QVGB 3I9NA 3V9AA 5KNLA 221PA 4FYPA 3U5ZB 3CRQA 3TUJC 5KYYA 1NM5A 4OGKA 2H31A 4ID9A 1EP1B 2XNKA 3OEWA 3KJNA 4M1SA 1LJLA 1E1DA 5KYYB 1JFLA 3KEFA 4GLOA 5T7BA 1F38A 3MT9A 2F3RA 5BV8A 4DQKA 4PWZA 2YJ4A 1I3MA 1K75A 4GBGA 3RIGA 5IAOA 1NF3A 2DLNA 4LY3A 3GXBA 5D86A 3LTNC 4RWZA 1PX0A 1BYUA 3TPZA 3CFYA 3KBOA 3WLSA 4IHJB 4LGYA 3RUDA 2B2NA 1VL5A 2P6RA 4H1UA 1JXOA 5AKGA 4MP6A 3I1IA 2VYFA 3TD6A 4EVRA 5J2UB 4AZ0A 3UJ3X 3ROXA 4U4AA 2VJKA 1N2ZA 3T52A 3NTQA 4KQFA 5IZCA 1EK6A 5HQ3A 5JATA 4BE7B 2G0AA 2H1CA 2H54A 3TVDA 3Q8WA 1QIGA 3DEYX 1U2EA 5K05A 4QRDA 3K1AB 4J3JA 4L22A 1XELA 2FYTA 2P3LA 4NNJA 3IQIX 3IMEA 3K70B 4B6RA 4AMBA 3A6ZA 1N2EA 1ONPA 3DAOA 1SIBE 1MH1A 2IW3A 4F5YA 1PR6A 5B3JC 1IJEA 4XX1A 1OZ0A 5CJ2A 4V1CB 2ISQA 3ZLTA 1RHMA 1JT9A 4GZ6A 4L74A 3QPDA 4ZXPA 5FAKA 5K6AA 4JQZA 3TGWA 5A06A 3RKSA 2QBYA 2QMUA 3JQAB 1OBCA 4MKGA 3R5FA 4B34A 2MMGA 3RSSA 4DSTA 2JLZA 1I30A 1EBBA 4OB6A 3MCAA 4BZXA 1AUQA 3TBHA 1X70A 3WNDA 2IF2A 1KQOA 1RKBA 1E18A 2QV7A 4G5OA 1SPBS 3U6KA 3D4LA 1E9RA 1Z45A 4PSKA 3S0JA 4A73A 3FMIA 4L0CA 4DCPA 1EE9A 1ZMRA 5EGSA 2C54A 3HSYA 2C03A 2XV1A 2XA1A 1FRQA 1AKTA 4MQ4A 4EB6B 2HWYA 4FR5A 4UNNA 2N3ZA 2XTZA 1CJKC 2AIRA 4FEAA 1NXSA 4RPGA 1S2GA 5I9LA 3HP1A 3RU2A 1X14A 2A0FA 3PHGA 4JI3B 3OAAD 5FFMA 2XGJA 2AEFA 2VJDA 4PRYA 3AP2A 3AKCA 3QX9A 4QRHA 5EJGA 3RE1A 1Q0UA 4ETIA 5M29A 4ZOLB 2F1KA 4EA8A 2R2AA 2WWYA 3I6MA 1AKWA 2K7ZA 3GG2A 1E5VA 1XN1A 3FVWA 4V0NA 3S4YA 4IINA 5ANRB 3A25A 1EVYA 5CA0A 3VR4H 1NVFA 2CL0X 3IBTA 5A4MS 2Z4SA 4RD2A 3LT1A 3B51X 1LBEA 3FFBA 1N3YA 3QYPA 5FAXA 1EE2A 1E3LA 1XL1A 2H4HA 5FUWA 1ZJ5A 3IULA 3QLEA 4E21A 5LQNA 4B6FA 1BEEA 4MZDA 1RHQA 4LKOA 2O0HA 2JI6A 4U9IS 1A97A 4QASA 5JQWA 1W5AA 1UEIA 4WKPA 5IAKA 2VWHA 1CUDA 1Z33A 5DM60 3IA2A 1PLJA 1GPBA 4CMBA 1VYTA 4BO3A 2Q5IA 4Z4GA 4YEDA 1D5WA 2E0IA 5K0JA 2BY4A 3AT1A 4U3JB 5CG2A 1TZKA 3E3NA 4PYKA 4WXRA 4XM0A 5TQVA 3WQRA 3PVSA 1L5HA 4CUZA 1HLDA 2RGGA 1RWXA 1AE1A 2BGLA 3N59A 2NUTA 5JC1A 1ZUWA 1MZPA 2NADA 4FHGA 2C8LA 4J29A 1T3SA 2C97A 3EK2A 3I1JA 5EWJA 4EDHA 1XOIA 5G0WA 2FSFA 2X76A 3A6JA 3G8YA 5BQ3A 2XQGA 1ID8A 3LGAA 2FPKA 1WDMA 2NQ8A 1G6Q1 4M3NA 1BKDR 4RHYA 3U9LA 3MMZA 4CLOA 4H27A 2PZ8A 4WERA 3NRCA 1IAQA 2NYUA 3HWWA 4XCVA 2I6UA 4E3ZA 2E55A 5JVDB 1PJAA 5ECYA 2R7NA 5IAJA 4MINA 4B2IA 1NQAO 2GK6A 3H65A 2V1XA 3EEQA 3CLSC 4OQDA 5JQGB 4FILA 1EH5A 2ZTHA 2QK4A 5C5EA 1A82A 1NBEA 2WHPB 3IRUA 4LKRA 1EB8A 1CE8B 2D59A 2AYYA 1YCGA 1ZIPA 4IH9A 4L85A 4U2GA 1OWOA 5CLHA 5H80A 4BXOB 2XKKA 3KUCA 2HLDD 4BKUA 1U5BA 4BE4A 5F2NA 5JZBA 3P0JA 1OZAA 4NFLA 3R3ZA 4EHDA 4XX0A 1VZ3A 4BS9A 4I99A 3O03A 3T06B 4EWLA 1IQ0A 1VYHA 1Z5PA 1U31A 3EGDB 5LB4A 3FUUA 1YS7A 1G4UR 2AEEA 1TQ8A 5K0ZA 2QT0A 4BLVA 4ZZ1A 4HB3A 2ZK7A 5KVVA 1PFQA 4KPYA 3K0AA 5EVJA 3CLUD 3FKJA 4B76A 5KEIA 3DZJA 5CFPA 1WMFA 3MJDA 3D2AA 3NAQA 4QU9A 4WEOA 5FPTA 3UT5A 2QYOA 5JRJA 2H00A 4ZVQA 3ONEA 4RDXA 3HLYA 3E84A 1E8NA 1ULUA 1Z0JA 1P6XA 1TYEB 3TVTA 4V0MA 3VOSA 4NPCA 821PA 4CETA 5K0FA 4LJ9A 5A0TA 2WAXA 3PX2A 3QBTA 2FPPA 1KE1A 1DEKA 1GTL1 1XZCA 1CDDA 1L7QA 1RRPA 2R79A 3FF4A 1ISSA 4KB5A 4BAGA 5IKPA 2JIDA 4YJHB 2LDXA 3UIEA 1JRLA 4G26A 4IJUA 1V2GA 2VIIA 2DT8A 4IICA 5T5QA 1JDSA 1F8FA 4IQ8A 4C76A 1NVVQ 3AU8A 1Y8RB 2D5IA 1PJ3A 3WYNA 4CLXA 1ZICA 1GZ4A 3GQBA 4QC2A 7REQB 2ESRA 4BGUA 1JPNA 2R1ZA 3I28A 5EGNA 3S40A 3W3AD 1T1EA 5L9AA 2MU1A 1ZK4A 2Q9UA 2FG5A 1XZIA 3AM3A 4C6SA 3T5PA 2QN2A 4X45A 2DXIA 4PY2A 1GPJA 4NK4A 5EJFA 3R5KA 1R0BA 2PRYA 2B99A 1KMHB 4OPMA 1IQRA 3UYLA 1I7SB 4RJTA 3C5CA 2B5WA 3HABA 1P1IA 3WGMA 1QK3A 3IDOA 3COPA 4N41A 3ONVA 4C08A 5MGBA 1DPFA 4JYPA 1SMKA 3EUWA 4TL7A 4BN5A 2FF5A 3LX4A 1FNBA 5EIAA 4MVJG 1RABA 2FWMX 5AESA 2WQZA 3SZRA 3L1VA 1GZSA 1YU6A 5HYVA 1K8ZB 1MUUA 1QQ7A 1U1IA 1J2RA 1UMDA 3OOJA 5E9QA 4JVSB 5E3HA 4E94A 3EPJA 3DSRA 3OSUA 5U4QA 4ZALA 3DNFA 4CIYA 3A3KA 1GA1A 4LDPA 3PDUA 4LUCA 4B4OA 1HORA 4HF7A 1N9ZA 1Y3FE 1EUCA 2IHVA 2IZ0A 1U5AA 4UUBA 5BT8A 1ECJA 1T4CB 2QT1A 3SY8A 3SM3A 4OOEA 3VR2D 5B6PA 1LNQA 2IXEA 2NXCA 4YRZA 4F6RB 2HK8A 2WG2A 4PZPA 4D8UA 2JJYA 3E70C 3KOMA 3TDNA 2K6GA 3TMAA 4AJJA 3TLMA 4O4IA 2IVZA 1NP7A 2P3SA 4YRFA 3V7FA 3NALA 3EQ7A 1BA3A 1OMOA 2PNFA 1CK4A 3VZPA 4GT1A 4A2CA 2FLKA 1FW6A 1COWD 1VA5A 1FNNA 4Z6KA 4NC9A 2RGXA 1HE1C 3CH4B 3K2EA 1Y5RA 2H4FA 5DGHA 1F4LA 1R0KA 3TTWA 3ZY5A 3FOBA 1M54A 1UIMA 4IFTA 2P2GA 4IDHA 4GEKA 2PU7A 1XDDA 1KXZA 3CONA 3RTAA 4PM4A 2NSDA 1XMXA 2BD0A 2G8NA 5MGNA 1DAMA 1ABEA 1H4VB 4NYIR 1U8EA 4QPDA 3PBKA 2XSZA 4PX9A 2KX7A 4YI5A 3CC8A 4UBJA 5AW2A 3ER8A 3KDAA 1X1TA 2CDRA 2A7QA 1T9BA 3OTQA 1RPJA 4DCVA 4HV4A 3O2NA 2RE8A 1XZ8A 1N8NA 4QTXA 2O5RA 1V9LA 4I50A 3IEMA 1Y4ZA 3CO5A 1T2UA 1T8WA 3BFXA 1TA0A 2HM7A 3ILHA 4J0IA 5AXDA 5HXAA 2B37A 3C0KA 2GARA 4E31A 2MSDB 2HL6A 1OXKB 2IKSA 1O87A 3OZRA 5I3CA 5K0SA 3ITKA 4LXHA 3WSWA 2H2WA 1QGAA 1ZEMA 4R2WA 5BUCA 3DXYA 5EMLA 4ZI5A 3UY4A 2JIBA 2BJWA 4YLGA 3E82A 1MA3A 2QJOA 4PFJA 3OPXA 5CCBA 4GRIA 3KTOA 4RF5A 3ZWBA 3WJAA 4ZT2A 3KYBA 3G2KA 3F6BX 4P38A 5HKOA 1FDUA 5EJMA 2ZUTA 3Q3IA 2SBTA 1Z0IA 3H8VA 1ADFA 4RPIA 5I7OA 2LKCA 4AP6A 1D6JA 2ACVA 2IPNA 3M0EA 3IVXA 4L9SA 1IC6A 1VB3A 3A6GA 2GYYA 4QU0A 2K5UA 5DYWA 5EQFA 1G2QA 1OASA 1YS2X 4JVOA 5F7JA 4EY7A 3PTAA 3QVWA 2Y1XA 1P6QA 3REQA 2IOYA 3ZIDA 1Z2PX 4D43A 4D9IA 4EABA 1PJRA 2WB4A 4KXVA 1XT6A 3W9BA 1GWNA 1UJCA 1D9ZA 3FFAA 2VJBA 3WLQA 2WABA 1VPTA 4E15A 2HJ9A 1U2DA 4TYMA 4XUCA 3JR7A 1AKYA 3UMBA 3M6WA 4QXAA 4I1VA 4D0NA 1H22A 2XR1A 2Z95A 3OICA 2O0JA 4Q03A 4Y9SA 1VBMA 2X0DA 4HS4A 1EDEA 4AMZA 5BNIA 1AF7A 3PUVA 3H87A 4Y0AA 3W06A 4MW1A 1YKGA 3GEPA 4XSHA 4JBNA 3WDMA 3ONNA 4ER0A 4YX9A 1XQWA 5J2TB 2BEUB 3PDIB 2BEWA 5ALRA 1O03A 4OXQA 3OKCA 2WD7A 4W99A 4XGQA 2JCSA 2WUFA 3VC7A 1DC5A 5FL7A 3ZWMA 4FE3A 5BSGA 2B5OA 1ICEA 3M70A 4XYEA 4RA6A 1QZXA 1Z6TA 3L49A 2ID7A 5JCJA 3V1NA 2IS2A 2YYAA 1UCFA 3H3XA 3QKIA 4N5MA 2HCJB 1US8B 3DAHA 3JQBC 3NDRA 3P20A 5JNVA 3P2IA 1SCNE 4LHWA 2Y76A 4QEKA 1N2JA 1VI5A 2BFFA 2JBHA 3LYLA 1WVGA 4PO1A 5AT1A 3RKUA 2N1MA 4TYYA 4IIJF 1TF5A 4BMYA 2X41A 3U81A 2IYFA 1KZ1A 4DB2A 2WTXA 3AKYA 4WN3A 4OJKA 5FT9A 4EW2A 2HT1A 3IE1A 2GESA 1JQLB 4P0QB 5CXSA 2OA0A 1T5OA 2A3NA 2VP0A 5D6OA 1H5UA 1X7XA 1H0KA 3TLKA 2VNKA 2PKEA 1Q44A 3PFFA 4N01A 5BWMA 2V59A 2G5CA 4DLAA 2ZSIA 2P7HA 1CS4C 3LT2A 4NSNA 3DTVA 4EB0A 4Y1FA 1A2BA 5DEOA 2OMEA 3W5SA 1C7IA 1KIMA 2B1GA 3IPLA 2FRDA 4XDHA 3VBCA 3EGWA 3PQ7A 2ZTVA 3NDBB 1KP2A 3EHDA 3R0VA 4O2AA 2VNAA 4HYEA 1N5DA 4ABTA 4XM1A 2X13A 4IQ4A 1NBME 3RS4A 5GZ3A 1G2IA 1I1NA 3QYFA 2QUBA 3U9TA 1OH7A 1VHWA 1E1CB 4DWWA 1DGQA 3A4TA 4LV8B 3W2HA 4J0HA 2QP4A 1FDSA 3PK0A 2J3QA 5TGTA 1MP0A 1PQYA 2VF2A 4TSFD 2AG0A 3AU9A 3I4LA 1ENOA 2WZDA 5ECWA 3K3PA 1O54A 1YOVA 1XTUA 2ABWA 3GEBA 1UBEA 3HYTA 4O4JB 2L18A 4O1HA 5FOSA 4QYWA 2FMIA 2PS3A 4FN4A 5CLGA 2PMBA 2R96A 2REQB 3RYHA 1ZNXA 2H9YA 1FC0A 3C3WA 3IQZA 1MJFA 4DQLA 1KQGA 1H94A 4K87A 4DJ5X 2FPUA 1VJ5A 2RH9B 4D4GA 4FJ2A 3EUEA 3RGWS 4CTJA 5LU8A 1X19A 4A6DA 4UAGA 1USIA 1P9WA 2D2EA 2GBLA 4BEVA 4ER6A 1TJYA 3HJGA 5D2CA 4UTOA 3SI7A 3OP1A 2BMVA 4QXMA 3HRKA 1QOQB 4YIHA 1WUIS 3FZQA 1XN4A 1D7AA 2IA5A 5KWVA 4X84A 3VNQA 3QX8A 5KDOA 2D54A 2Q9CA 3AJAA 2CHFA 3LI2A 1DQPA 1JECA 4IS2A 4OL0A 1MX9A 4LOAA 1VMAA 3OOWA 4JH0A 1V4VA 2HADA 3ASUA 4PEVA 3TR6A 3LPAA 1DFHA 2R8BA 4AROA 4ARUA 2YOHA 1JEQA 4FGKA 1F6BA 4GQAA 4FGLA 3ZDFA 4V1CA 2OAQ1 1DELA 3NMUF 1J99A 1DLIA 1HUQA 3TEJA 4B3HA 1YAJA 2ISCA 3ODGA 3W5VA 5JS8A 1CEEA 3FTCA 1QHIA 3B78A 1WSWA 3PRJA 1VKZA 2W6OA 3A14A 4V0RA 4NDNE 1KY3A 1PTJC 4ITVA 3KIPA 2VDRB 5BMVB 5KS2A 3GLFE 1KRXA 2OKCA 1UT5A 1MO6A 3K7EA 3UB4A 1IN6A 3AF6A 1N2IA 4JT8A 2YHSA 2IOFK 3AR6A 4HN2A 2EZ9A 2VZ9A 3L79A 2G28A 3GGOA 4JI6B 2CVOA 2QR5A 3BXHA 2UZ0A 1RAEA 1DOZA 3BE8A 5CT4A 3TOSA 2VSFA 1MTOA 3U7RA 3GEHA 3H4TA 4NI5A 2NXEA 5EMNA 4KHZA 2GFHA 3QNUA 4ETWA 3QKUA 1PUXA 1UZLA 1XJCA 2UXDB 4PYJA 1ZVJA 5FFFA 4MDFA 1VYUA 4KVAA 4RMIA 1E2LA 1LTQA 3TNFA 4A8PA 3CUTA 1QVAA 3JAKB 1QF9A 5AIAA 1WW2A 5CPFA 2W93A 1SVOA 1W36B 3OURA 2FE4A 1I1HA 1U8ZA 4HX5A 4QO7A 4DXDA 2XBUA 1YVRA 2J6IA 2PSDA 4QQFA 2R86A 4JLOA 2PUTA 2P0YA 4BTLA 3H5OA 3WDSA 1A2QA 1RT9A 2O1SA 1SH7A 1Z5ZA 2QORA 3G9ZA 4AJ1A 5CVTA 1ZM3A 2JJQA 4CR6A 1E79D 2W0MA 1BVHA 1R0YA 4N0DA 4COOA 5K8TA 4JI2B 1JTFA 4HFJA 4CIXA 5LXTB 2ORVA 3NHFA 2YIDA 4GBJA 3OZ7A 1B8PA 4DADA 1F51E 3E9EA 4F21A 3ESQA 3X1XA 4ZVMA 1IEXA 1WTAA 5LP6A 2EFDB 1V95A 2A1TR 1ZM4A 3E03A 3MAAC 4K1XA 1A9OA 4I81A 4UTXA 1XZHA 3G9QA 3IBCA 4PQFA 3WSVA 4DIFA 3EJ6A 5DGCA 1L5NA 2VJQA 4FBMA 3NKLA 4XWAA 2IEDA 3LX5A 1DUSA 3JD3A 1VSBA 1XVVA 1XDWA 5C4GB 4KV7A 5E1MA 2TMKA 2ZU6A 3H4VA 2ID8A 4GAEA 4YHBA 3GRCA 2GJSA 3BULA 1DU4A 3E9ZA 4C7OB 3FWZA 4G0YA 1DWUA 3F1KA 3ZHZA 2FWBA 2J3JA 3BT7A 4DWOA 3SYKA 4GX0A 1XRJA 1C0KA 2A4MA 4K46A 1K97A 5ES4B 2BKUA 3RVSA 3FHOA 3NM6B 4JQSA 4GSYA 2D2FA 4MWGA 1ZH2A 5JLAA 1PWHA 1TU3A 4ZVLA 4EMBA 4JWKA 3L7IA 5JNUA 1FX0B 1BDHA 3IEIA 3RIXA 4KLRA 2RGCA 1KGSA 4GLBA 2XCTB 1KNXA 2ONCA 1TJ5A 5LU9A 3WL6A 1J8VA 2I7VA 2DOKA 4WINA 5CB4A 2G63A 2OCKA 2PUEA 1I0ZA 3DWIA 3RRYA 3UA4A 3ROFA 3GIDA 3ROEA 2PUAA 2GPNA 3I3OA 1JLRA 1RJ9B 3IUYA 4YRIA 3I0NA 1X1BA 3NTOA 3IR5A 1Z26A 2O7SA 3B6IA 5LLSA 3NBUA 3R5JA 1NBMD 1IHOA 4I0WB 4WMLA 3RJMA 1VHLA 2F1HA 4BWYA 5I7UA 4X85A 2GCIA 5LMUB 1M76A 1ZONA 4DVGA 3ZGZA 4RKRA 3CRMA 5A71A 1I5EA 3Q15C 3LHSA 3OZWA 3FOWA 2VAWA 3QU9A 3KT6A 4HRYA 3VC2A 1BH6A 2X4DA 3UK6A 4GZLA 5E9WA 1A9ZA 4LQCA 3ZQUA 4MVJF 1GZ6A 4K0RA 5KNBH 5DGTA 4OJQA 3AHIA 1M8JA 5EQJB 3C8MA 4M0PA 4NENA 2ZCJA 4UNRA 2X5KO 4KFCA 4E13A 4IDGA 1MQAA 3RRNA 1H1TA 1IY8A 4ZV4A 2FOLA 4HAUA 4YMUA 1DTSA 1R5OA 1SD5A 1CB7A 1PWZA 4DL9A 1XD2B 1L5FA 2FH5B 2QRMA 4DUZB 2FPRA 4IL5A 4FX2A 4JLJA 3R7NA 4LVUA 5EEGA 2BTQB 4D9JA 1W44A 1U2ZA 1T9ZA 1XZJA 3Q7QA 3CJRA 2IITA 1J2UA 2DAPA 5AK0A 4X62B 3F3MA 1GNPA 1YDHA 1NJ8A 2GEUA 3M1IA 1U7PA 4P5DA 1JFRA 4ZC1A 4EITA 3FAZA 4X92A 2VPYA 2BISA 1OXMA 5DW3A 5G02A 3B5IA 4Q05A 4CM8B 2E4YA 1TAGA 2Q28A 4FMBB 5DK4A 5ENZA 1UM9B 3OAAA 3EIHA 4NMWA 5E9AA 1TUBA 4UE3S 2AX3A 3UW1A 4CM4B 2H65A 2XE4A 2JI4A 4FGJA 2Q3BA 4MAFA 3P94A 4UE6A 1KDZA 3TQQA 4BL5A 1KYIA 5IH7A 2UU9B 1ZH6A 3ECCA 4RJKA 5BV7A 3NHWA 4L3WA 4HP8A 4JR1A 1PK9A 3CT4A 4XPIB 4ZU6X 2XB8A 5JJIA 5JS7A 4IRXA 4DMKA 4WNYA 3IE0A 3IAS1 3RWOA 5FPYA 1KDRA 1JEOA 3CURA 2E4WA 3BILA 4YROA 3GY0A 1E3WB 2WPNA 1TW3A 1OZGA 1PEKE 2NZUG 2QU8A 4AO6A 1A69A 4B35A 4TKZA 3AY3A 2O5VA 2O8BA 3BWXA 1JIXA 4GGMX 2QN9A 3AR3A 1D1PA 1G7TA 3DKIA 4TROA 3UAYA 4A0QA 4PNHA 4L5BA 3CKKA 3UXYA 5KSPA 1G21A 4A2PA 1Z2EA 2GS9A 3GVHA 3ANMA 1ZLXA 2VCYA 2COEA 1TO2E 1YK0A 2HWXA 3TFQA 5TPZD 3OC6A 1T15A 3L40A 2FHPA 4N5NA 3RDPA 4E70A 3E2MA 4CEHB 3ESCA 2CXSA 3DAYA 2XKBA 4ND7A 2IDZA 2WI8A 2H18A 2EP8A 4LDJA 4EVQA 4Y2HA 1MORA 4P2BA 3I05A 2VXOA 4RULA 1SBHA 2BHRA 1ZGZA 8LDHA 5JFGA 3CWQA 3T41A 2FRVA 1G7RA 3KEQA 2CSUA 4GOXA 4QHSA 4TT8A 5H4HA 1ZMTA 4Z2YA 3TDMA 5DP1A 3VC1A 3NPAA 3V97A 3IPYA 3VC3A 4U7PB 4FFSA 2I2DA 4A6EA 4ALKA 2W90A 3TUZC 2YS7A 2J9XB 3BEOA 3F46A 4PCVA 1FP1D 3ZV5A 4C3VA 5BUSA 3WB9A 4KWCA 2ZBVA 1NN5A 4WCDA 2L2QA 5AOBA 2XRMA 1B15A 1U7DA 3AYZB 1KETA 3GAZA 1P33A 2AI2A 4O63O 4KIJA 2BLNA 2VR1A 4AY6A 4GKBA 2YVAA 1QIHA 1KYQA 2ORIA 4I14A 4C1NA 3LSTA 4EMUA 3I72A 3V8EA 5EOVA 3BMQB 4QNRA 1Q17A 2QPTA 2QVGA 3AF0A 4RSRA 4BJ1A 1FQKA 1GKYA 2P4QA 3E0XA 3LY5A 4IJMA 4D5GA 4BQEA 4K2HA 1JAHA 1KJ8A 3N2ZB 1Y3IA 1NX6A 4FOOA 3K9HA 5D5QA 3R8FA 4ABYA 2OLEA 3QU2A 1AY0A 3BSWA 4WBSA 2HOQA 5LYJF 5EJ8A 4BC1A 5DI3A 1H66A 2Y92A 3PC4A 3WMWA 2P9CA 3MHPA 4LOHA 1EQAA 4YJ3A 5F5XA 4AK9A 3QELB 3VV2A 4YRNA 3TF5A 4FCVA 3QVTA 5CT6A 1OFVA 5D51S 2ONJA 1EJ6A 1T1IA 4BP3A 3MAGA 1DUIA 2AG5A 1SA0A 4BNIA 2EJVA 4PZ9A 1XB2A 3KZ1E 3R0JA 2GEJA 2HHCA 3ER6A 4IG9A 4ZGWA 4L76A 4JEUA 3B9QA 4HRAA 2H08A 3LGXA 2RHJA 2QLMA 3H83A 2R47A 4R0NA 2CCJA 2IPXA 2J5XA 3AR9A 4ZJYA 3MAJA 3DW1X 3WRYA 2A84A 2OCIA 2PKQO 1RLUA 1XLUA 1OFHA 1R8XA 1RYMA 3CLTD 4NJEA 1GGHA 4BAZA 5C80A 5KX5B 2VPXA 1EJ0A 5F1PA 1JXAA 1FJGB 3ZWOA 2F9LA 2WOJA 4Q4AA 5DBFA 5LUBA 1A27A 1CDZA 1CZRA 1GKIA 4MR7A 4YO7A 4AJLA 4CMEA 2AEJA 5CH3A 2IJGX 1GXSA 2KS6A 4AP9A 1GFZA 1EGQA 3GRVA 4EF6A 2VF7A 1H2FA 5CT8A 3NBAA 2XDQA 2GPWA 2QEQA 2ZPAA 3GHHA 1X9IA 4R2HA 1TADA 1URPA 2ERXA 5BSTA 2BGIA 2GD6A 1Q74A 4XUEA 1N3LA 1GFIA 3KQUA 1J24A 1OC2A 3ICOA 4F9GA 3UGTA 2H29A 1T9HA 3ROKA 4PFSA 4QARA 1CQZA 1MXHA 5F9HA 3LAWA 4KQ1A 4DCCA 1Z25A 5C7OO 3MJ4A 2OZVA 2DUJA 1PCXA 1X39A 2AC2A 2GH1A 2QS9A 5FF9A 2YMMA 4FFBA 2PGNA 2XOKD 1E6MA 3I12A 5CVUA 4QFBA 4CG1A 4QUJA 2JGDA 2BEKA 1WCWA 2CNKA 2YJZA 4EBBA 5I7VA 1LBQA 3ZGVA 1NBAA 3TGPA 1S1MA 4NJMB 4KE9A 4YP0A 2H0QA 4RY9A 2C9YA 1HQDA 3M5CA 3HNPA 4TTQA 1XRNA 1LX7A 5K0LA 2QXTA 1D0SA 2WJ6A 5FWYB 5L6LB 4EY6A 3OUUA 2G82A 2D0IA 1TLLA 2Z3VA 2RHRA 2MCFA 3KLOA 1C1HA 4IOLA 5HKAA 1L4MA 4OYLA 1E0JA 1D1QA 1Z6QA 1K2VN 1FLNA 5K8IA 5HRAA 1AQYA 2VOEA 2PL3A 3KHTA 4Z1MD 1CX9B 3BOSA 4Q6BA 2PYDA 1T2VA 3S3TA 4BNJA 3B1FA 1IY9A 7YASA 2ZI5A 4LJ7A 1TB4A 4OU5A 4OREX 5ALJA 5GZ1A 3IKLA 5HE9A 3ST7A 3AOEA 4UUNA 3B89A 3W77A 1TCCA 4C06A 1V11B 2QVZX 1T2EA 5I9NA 3Q8MA 2PUVA 4Q1BA 4ZI7B 1VRCA 1WLYA 2IEAA 3O7WA 1X1QA 2ZATA 1VPVA 3NHMA 3AP1A 1Y4UA 2I2WA 3BMNB 3K8YA 4K3VA 3FVRA 5FBHA 2ZB2A 3SCZA 3TQHA 5F7OA 5SY6A 2HSGA 4NU6A 4RV9A 4L9AA 3K0CC 4ZAVA 3UJ9A 3ZV7A 5ALFA 2YJ6A 1EIWA 1S0UA 3EXHA 1JHVA 2CLLB 3GHYA 4Q01A 3ROMA 2FQ1A 1HG0A 1XZDA 2GN8A 3IFSA 3D7LA 4YCBA 1L5SA 3PU6A 3ZD9A 3SZ3A 2G9RA 1Y0BA 5C8YF 4ZQEA 2O0KA 2HU7A 4LHVA 4F4CA 2HMUA 2Z4TA 3WNQA 4WRRA 5E1OA 3L7AA 1C7ZA 5SZKB 4AKGA 1YO6A 4HLCA 1PN3A 2QQEA 4KREA 4OQEA 5FOUA 2D7JA 1SD1A 4J3FA 4XKJA 2JW5A 1QQAA 4KN5A 2G5TA 4HH0A 2IUTA 3PI7A 4E7PA 5CJJA 1QZTA 3GBVA 3VDXA 4OM7A 1NI4B 1RXYA 4GFDA 3OQNA 3EXEB 2OO5A 4MCJA 4XR9A 3HMQA 3R3WA 3F6SA 4Q4DA 5J63A 5NLLA 2DCUA 4C5BA 4OXRA 5EUCA 1JEDA 1DJQA 3BFKA 3BSFA 2ZT6A 3N86A 2HCBA 2H7CA 2QUAA 1A4IA 3M49A 1WUTA 4J76A 3GJ3A 4MR9B 4CDRA 5J23A 4FW9A 2J0SA 4AUKA 2CE2X 2WM3A 1DX6A 2CF5A 5E38A 3TLGB 3B1YA 1IHDA 1FW8A 3ZV6A 3SS7X 4GZ3A 1LFDB 3INYA 4PRLA 4BV9A 4CLEA 5JZ9A 4HQNA 3CXRA 1DKPA 1O94D 3D6AA 4HXGA 4MS4B 1NZFA 1UUFA 2J3EA 4JENA 1EGVB 2Q50A 1GPNA 3MBIA 1KYZA 3UT0A 5WRFA 2EXXA 2EX0A 5CBPA 4AUEA 2ZBPA 4X1IA 1YFJA 2OBNA 4F1JA 1VOTA 2F64A 1AXEA 2ZIXB 3A4VA 5FTLA 3V2IA 1KOGA 4XFKA 4GOOD 2RGDA 1E2FA 4CN8A 2M9MA 1QIDA 1WPGA 2WU3A 2YY7A 4XAQA 2RGYA 5AKIA 3UBMA 3QEAZ 1H1DA 3KPUA 2DLDA 2QM8A 3F47A 4I4TA 4D0LB 2QY6A 4KPUA 3ITEA 3P9YA 5BURA 1L7OA 2ZRGA 2CNDA 2BRUA 4C3ZA 1XJQA 2CLEB 1V37A 2C1XA 3WKEA 4KMMA 4WK2B 1C2YA 1COZA 1GFWA 1P62B 2EKZA 1JU3A 1L5WA 2ZJ6A 1YE8A 3F8SA 3OMWA 1HF3A 3K70D 1G9TA 1GRQA 1JDPA 5KJ1A 2X15A 4G5QA 2QJRA 4P93A 3ZQJA 3CNLA 4ZVOA 3T7DA 3DDWA 4NZMA 4MW9A 1GV1A 2Y66A 2QOEA 1YASA 2ODAA 3ZXXA 2E4AA 5JARA 3FHLA 3BQMB 4ML3A 4TZ6A 1T8RA 3FCAA 1JHOA 2F3UA 1QFSA 3JQAD 3A1FA 4Y6GB 5CFRA 3ZJ4A 3I9V1 3NHUA 4UUAA 3UUFA 1QV6A 2BMWA 3M6LA 4JQOA 4NL4H 4B85A 2J7KA 5DE3A 1P7WA 2IZ7A 4EAAA 2NVWA 1CUEA 3VR1A 2BFCB 2G8LA 4KYTA 5K3OA 3KXLA 3F1LA 1JPVA 1U7XA 4D81A 5JXWA 4LXYA 4OKNA 3IP7A 4Z53A 1BW9B 1RTKA 1SVKA 3PC8C 2BHLA 4JBIA 2J0UA 2P1DA 2X0JA 3BJMA 1D9XA 4D3XA 1JALA 1TT7A 2Q1YA 2WU4A 4L73A 3I5XA 2RONA 2GSDA 3DUFB 3A0RB 2NU7A 2UUAB 4W5WA 5DX8A 4X6LA 3ZQ4A 2W7TA 3AR4A 3PUHA 5G1NA 4P3YA 4YAIA 7MHTA 4YALA 4MWEA 5JYCA 3HU2A 3QI7A 3H8JA 4O4HF 4OQXA 4S2UA 4EHLA 2BOVA 1A4XA 3LBNA 2G9VA 2WZQA 3WOHA 2L42A 2EL9A 3GFTA 3AONB 3LY9A 3GLSA 2O8VA 4E6EA 2A92A 4Z3DA 2ZM5A 3TCKA 1TXGA 2HA3A 2O7RA 3C97A 4TWJA 4AN1A 2JG3A 1PJZA 4GYWA 3EC7A 2ZQ5A 1II8A 4XD7D 1Q1AA 4LXIA 2BCJQ 2PO7A 1JQAA 2WYOA 3O3CA 3R41A 4QYXA 2VH2A 3O1IC 5JO0A 4FYHA 2G08A 2QTFA 3MCTA 4RW0A 4FC7A 2ATVA 2JCYA 2GEVA 4UCWA 2P40A 5CNJA 1YQEA 2JFUA 4MHOA 4M7PA 5GY7A 3DL0A 4ENVA 2NNWB 4TQAA 5TMPA 4RTKA 4FPXA 1M1YB 4XUDA 3QWHA 4OLHA 5F2OA 4B3TB 1QUFA 1E9SA 2AFHE 2OTCA 2VZLA 2JLWA 4Z4EA 4QGSA 3HB1A 1OPRA 5EVCA 1LV7A 1N7HA 1A50B 2NP7A 2ECPA 1TU0A 3F8WA 1SY7A 3EZ6A 4J1NA 4C5CA 5B6JA 4CI9A 3LA8A 5DIFA 1SFRA 3QLUC 3STVA 4P0TA 2R00C 2JASA 1E1RD 4OHXA 5IJXA 5F3RA 3LIPA 3CKMA 3GZ4A 4BC0A 1C7FA 1H8HA 1H69A 1NXWA 2PQMA 1XZLA 3COVA 5CX1B 4EKGA 1YBFA 3S8YA 3EULA 1WR8A 1B6SA 2GHIA 1QGOA 1ABFA 4DLNA 4HUTA 4YRBA 3NNDA 4GM4A 1KI6B 3M4JA 2NYVA 2YW9A 1U94A 1RCFA 3LBAA 4GKJB 2WICA 2IQ5A 4L75A 4CT0A 3MOSA 4IV0A 1V25A 1NYTA 4IOKA 4NBVA 2PE5A 3SVLA 2C4VA 4JOSA 3R8CA 5I4IA 1P1KA 2VHCA 3LPMA 1HL3A 2R87A 4IUCS 4BJ3A 4N9WA 4BZPA 5KJFA 1XTZA 2PX8A 4JLMA 2Z5FA 3P27A 4OQLA 4R7TA 1SN7A 3FTNA 2WYHA 4NBWA 2D5BA 4P84A 3TOZA 4AWBA 1UR5A 3HSKA 3UAOA 1RW4A 5CFLA 4HWOA 1Z8NA 4HDSB 5LOVA 2Z8ZA 3BQ9A 3Q9UA 1S2DA 2IH5A 4F1WA 3HEBA 3SYTA 1ETHA 4P7JA 3Q8XB 2C2XA 3NBKA 4Q3DA 4DIMA 5FUXA 3DKRA 5FNVF 3JRNA 1DAHA 5IKXA 2BBWA 4ENWA 4OFZA 3ROGA 1Z34A 4CKCB 1PGJA 3AF2A 1RDFA 3HJFA 3Q7EA 2FWIA 4D7AA 4CNBA 4KXMA 4LTMA 2OGWA 2Y3IA 3QH4A 3TKAA 5HK9A 3R9XA 1ZH8A 1QZZA 4LS3A 3HJAA 1NUHA 3L0IB 2Q1XA 1N2SA 3IT0A 1YAHA 2ZXEA 2HBZA 1Y89A 2YWHA 3DT9A 3H0CA 3I2IA 4LN1A 3BXZA 1QR2A 4DR1B 1X1SA 1N2CE 2AW3A 1EDDA 2MOKA 4I6EA 1VKNA 1WXHA 3W05A 3A06A 3QHPA 2IGBA 4C4SA 3B1WA 3FTPA 5E8JA 1BG6A 3H04A 3KAPA 3G7UA 5LR6A 1KOFA 1N2HA 2H4ZA 3O3OB 1G6HA 1S2NA 4Q47A 2C3PA 5JNLA 2HNBA 1WPXA 1EA5A 4JJKA 3QYAA 2ZUUA 2YQ4A 4GP6A 4WNIA 3REOA 1GTJ1 1CVRA 1N2GA 4IWNA 5IFKA 3NCHA 5HIIA 1KOJA 4D3DA 2IZ1A 2DULA 2ODTX 2A9KA 4HDCA 1GNVA 2VYQA 2F17A 4RPLA 4AF7A 2IEGA 4CCWA 1O97C 3X3HA 1TD9A 1W5FA 1GNSA 4AJKA 3UJBA 1SCDA 3HDGA 2G0NA 3GDWA 4IKOA 3ZC3A 4ZZ3A 2IYUA 3E9CA 2JVIA 3IALA 4HDNA 4D4KA 4L57A 2AJLI 5GONF 2H51A 1Q0SA 3KFVA 1JSZA 5JJKA 3CO0S 4HGOA 3DXXA 3FOFC 1E9CA 2OG2A 1DTWA 2NZVG 2OE2A 1IOWA 1CZKA 3UOWA 2HRRA 1USUA 3WIEA 3H13A 4DKXA 1N4DA 3DE7X 4QYIA 1G3UA 1NBMA 4EA9A 4LJRA 4F6CA 1RRGA 1DXYA 1RIIA 3RROA 1WW8A 2HDWA 3CKYA 3TN7A 1KEZA 3I1FA 5CNIA 2ZUDA 1ISIA 5IANA 5HM8A 5JCZA 5AUQA 1XHLA 2NU9A 3DBHA 4BNDB 1T2AA 1W46A 2JFNA 4DMFA 2IH4A 3QX3A 4PYIA 1MB3A 1NUSA 1XDGA 1PZFA 4JKIA 3OQOA 1KA9H 4IUYA 3OHPA 3FPGA 3ADKA 4CF7A 1ZVQA 4S1OA 4AJHA 3KVNA 4G5FA 5CM9C 1J09A 5DTRA 2JL1A 1M2OB 1BE1A 1RWWA 1T1GA 4XASA 2X8AA 5EZ5A 3C48A 4B6GA 5DXAA 1A9RA 5KAMA 5FV4A 3AJEA 3I9KA 1JDZA 3FB1A 4GLLA 5CFMA 2IOQA 3I1YA 4EJSC 2AD1A 2I8AA 3IELA 3N39C 3PLRA 4M8KA 1NNSA 1ULZA 2FPSA 2IIBA 3FPCA 4UDYX 5HHTA 4K9QA 1Z6GA 1XAGA 2EAUA 1EHIA 2J3DA 3CW8X 3OBBA 4UHEA 4ZYZA 3N2IA 4GNRA 2OK7A 4OQMA 1P44A 2GZAA 2ONYA 4WKBA 3OMLA 2CMGA 4QOGA 4LQDA 1R4MB 4TS4A 4ZHQA 5A9RA 1R6TA 2I4TA 2R7MA 2XXJA 3DM9B 5G40A 1E59A 1RPTA 4I5FA 3GGSA 5TQJA 1SEPA 4KRFA 5LA6A 1CZLA 4FJ0A 1RMTA 3C98A 1PJLA 4RPKA 4YBRA 3TNJA 1NMQA 1SKMA 1WG8A 2VP6A 3VR6D 3ZCUA 4I8XA 4O4HA 5CYOA 2H1VA 2W2QA 4GRAA 2BFEB 1GUYA 2GDJA 3NCTA 3L41A 2G76A 1ZD1A 2J9RA 3A6LA 1TI7A 3ELUA 3JY6A 3VJMA 3G89A 1SBQA 2BAGA 9MHTA 3GLFA 3BRWD 4Y6LA 3SXPA 3TLZA 1LPNA 2D5AA 1T8YA 3SXUB 3L9XA 1KZ4A 4MPTA 3WY9A 3JCZA 3OF3A 1TCBA 2CHQA 4FJ1A 1XMSA 3U39A 3AEKA 5K4AA 4H7PA 3MJSA 5D3ZA 4CTNA 1CJMA 2GCGA 2O8CA 1KFJB 3QA9A 4E11A 4BN4A 1SC6A 4E5MA 3I61A 4PG6A 1LB1B 3BH0A 4ZT5A 1JIJA 3TMKA 4B75A 1UZNA 1WB5A 2IXBA 1IQUA 5L51A 1XPOA 2I66A 2XLCA 3QY9A 4UKDA 4DG8A 3BGVA 4G0MA 3OUZA 5AVJA 4DCSA 5CITA 4FONA 3VPBA 4R1NA 3MRSA 4OI1A 5CUQA 1I6WA 3V33A 4PN7A 1YFKA 4ZPJA 1ZM7A 3GMIA 1H05A 3GOQA 1KJYA 1XP8A 2QWXA 3IQEA 4JUAA 4QG7A 3ZLJA 3UXHA 1UZUA 1KI8A 1IZZA 1YC2A 3IAEA 5JS6A 4KIGA 1HC7A 3UHPA 3WQHA 4GOMD 1R9GA 1UJ4A 2IYLD 4R6WA 1HEUA 2GRUA 3DEFA 4IGAA 1YH3A 2W5UA 1Q16A 3ERCA 4ME6A 1AIPA 1GSIA 1KZGB 2FFJA 4C0XA 5AUNB 1MIOA 2C2ZA 5K03A 1I3CA 2EFGA 2Y2UA 4LDAA 2D1TA 2I8LA 3B3QA 4IXNA 2XOEA 4WXYB 2YMLA 1Z39A 3D5EA 5F51A 5PNTA 4CV1A 2GDZA 2DFLA 2JIQA 3BKXA 5ALOA 5LMNB 3FBWA 1DAFA 1JKMA 2O8EB 5GAJA 3ZK8A 2P5UA 2VATA 2Z9DA 2PXAA 5ALMA 3BE6A 4H7IA 1EXDA 1FSGA 2NACA 3MZ0A 1KR5A 3NYWA 4KVZA 3W4JA 2EHDA 3LCJA 1VKHA 4HATA 1JDTA 1ZMXA 3U3ZA 1GSHA 2OWEA 4ARAA 4L3OA 3OZAA 3O94A 2EG5A 3WRXA 3TIGA 1PZEA 4V3BA 4ZT4A 2VT3A 2Z2KA 3C6MA 4HEA6 2HT6A 2E4UA 1W19A 2HPHA 3B3AA 1RKQA 4PHTA 3TD9A 1F7UA 4CBVA 2CB9A 5TMDA 2MYUA 1SVLA 1QAMA 4DMHA 5SZIA 2FK7A 4ND2A 3EDYA 1ZGBA 3FCXA 3SZOA 1XZBA 3NJ4A 1SUIA 3H9CA 3V34A 4P3NA 4XIFA 1FYXA 4KOEC 2Z5LA 1FNSA 1WP4A 1XG5A 3QIVA 3K4QA 3ZZUA 3VTZA 1OZFA 3KKPA 3GDHA 1U9JA 3DR3A 3QVOA 2WUVA 5JBIA 3IMCA 5KC9A 1E1NA 3RD5A 5AI6A 2H4WA 4UHHA 1P4HA 4F5EA 4ZMRA 3DOHA 5A0VA 3GUCA 4QD3A 2FW9A 2W2LD 3IT3A 1KE2A 4YRMA 1XTRA 2PZEA 1T25A 5ERYA 1JNYA 3OZSA 1P60A 1PV2A 4QUBA 3KFLA 4A36A 2G1KA 3OTGA 4J0GA 1T4BA 3EMKA 3SQNA 1FX1A 5FPQA 2C57A 5D1HA 2EEZA 3JVDA 4DLKA 3SR0A 4YUVA 4H1VA 4C0AC 3MMPA 1PT5A 1RBQA 3V46A 1L4NA 1THGA 4YCAA 1JFSA 4IGEA 3WV4A 5IYZB 3OIUA 3Q98A 2D0DA 1MQ9A 1Q15A 2X1VA 1UBTS 3SR3A 3CZPA 3EODA 1FFXA 3O4VA 3Q10A 2I76A 1M8FA 4DLSA 4KSCA 5JAIA 1L9XA 3PR1A 3V42A 1E58A 3HE3A 1YJAA 1S3FA 2NN3C 3BH7A 3OCCA 4ERNA 4UTNA 3A3NA 1U2TA 3VYRB 3ZEIA 1W88B 5FD8A 2PH5A 4PC7A 4YWJA 3NX4A 4ZJUA 2FPGB 4CCYB 3LMKA 1KSJA 4Y0VA 3PNVA 2HD4A 4D2IA 3KQHA 3CCBA 1O4VA 4L8FA 2P69A 3TTTA 5BR8B 2Q27A 2G83A 1UPBA 3T9DA 4N3GA 2AJDA 1Y9AA 3LO8A 1RLOA 3DZDA 2BFNA 3IXLA 3M6XA 4NE7A 4BWGA 4D9GA 2QZPA 4Q39A 4RFVA 1V1MA 2AS0A 2AR9A 3DVSX 2XUGA 4E4RA 3TEMA 3H4IA 4K6HA 3VO9A 4KJXA 3W90A 3U09A 1EZZA 1VJCA 1GTMA 1L7AA 3H3JA 2OV4A 3GRKA 4TLCA 3PDHA 1ZGGA 4X00A 3EVZA 5DYNA 3JSXA 1JJIA 5EIOA 4RM2A 1Q2UA 1DL5A 1KAHA 5CEFA 2NO9A 4WNAA 2XTNA 2V4ZA 5ITVA 4QPNA 4D8YA 2ENWA 5BYJA 3MM4A 4MPDA 8MHTA 1BGWA 4DR4B 4E2WA 1NDHA 1SHUX 4BMZA 2P41A 3BGDA 2VNHA 2BW0A 3V2GA 2GF0A 1CQIB 4JK3A 4UNSA 2FPWA 2CDCA 3DTTA 3I2KA 4H77A 4RKQA 5AKEA 4A4DA 4A6XA 5KTNA 3EDCA 2ADFA 2GPSA 3V4LA 4YP1A 3S2YA 3LVBA 3CR7A 5DYIA 1CRPA 1NQOA 4X20B 1ZK0A 3K5HA 1K7FB 2X0EA 3ODPA 1QC5A 3HVKA 1NL3A 2YNMC 4GDMA 4HZGA 5B3JA 3EA4A 3TS1A 4B43A 3AY6A 3EAFA 3FKQA 3I34X 1P4JA 3GJ5A 4OVKA 5KQLA 3ZOKA 1AQUA 2FEPA 2J5KA 1NJFA 3SIWA 2H5EA 4MKZA 3UXEA 4FYJA 1AQIA 1VG9B 2IPMA 2VDMB 1ZUNA 4DXHA 5CXQA 1CJUC 1WMBA 4MCHA 5MN5A 5H16A 1KMIY 1N5MA 3C8ZA 4NE9A 4YNBA 1FTWA 1Z4OA 5ILOA 4EA7A 3EQ9A 1UQRA 4W1QA 1CJSA 1OX4A 2NO7A 4JAVC 2HEGA 1TVMA 3K09C 3RYCB 4Z3KA 3VI3B 1NQ5A 2Y0BA 1Y8CA 5K8JB 1ZHOA 4WA8A 3FYHA 1EXNA 1UDCA 3D7KA 2IPLA 3HP4A 3Q72A 3M6FA 4PLWA 1ZOLA 1PF7E 4Q1EA 4RTNA 1J97A 3PD0A 3T9EA 2R8YA 1UBRS 9ABPA 2AOTA 4LYJA 3LKVA 3CZMA 1QPGA 1ZD3A 1DRJA 1KVTA 1W4RA 3KKEA 1AURA 2X8LA 1RJEA 3RBXA 3QU7A 3DD5A 1RAAA 3U7EB 3ZVKA 1UL1X 2GCNA 5JH7B 3FZNA 4TN5A 1UBKS 1FTSA 1GKUB 4CM9D 4MCIA 1NVVR 4PAWA 4S04A 1QWSA 3U80A 2XOXA 3IL2A 1LRJA 2WDPA 3JZAA 3TSYA 2W43A 1GCGA 3AEXA 3MGKA 3VOBA 4KUHA 2OCGA 4D9CA 2RAUA 4RM3A 5AW3A 5B12A 4W6ZA 1C9MA 5ES3A 1U1GA 3BZUA 5IM5A 3QU4A 2PBZA 4LGVA 4BKQA 3G7NA 5F9FA 1MPXA 4BP1A 2ZIWB 3SHQA 4HAYA 4UE2A 5FA6A 4QA9A 1KMQA 1JWAB 3UPTA 1G66A 2I87A 4AZWA 3B13B 2IHBA 4P7KA 1TL7C 2GPAA 1IB6A 3FUWA 3I5UA 4I5IA 2DEUA 3NEPX 1JYEA 2C9OA 2GO1A 4C0WA 1L7NA 1OBHA 1Z6YA 2PRZA 1S6YA 2CNWD 2VRNA 3A27A 3D0KA 1DO0A 3I52A 4W8GA 5J2UA 4UVHA 2PGAA 1G8GA 3SIXA 5CHYA 4ZQGA 5HNKA 2PXHA 1DAIA 2AHOA 1S4QA 2FFRA 1X1DA 3IX7A 2FEKA 4HGRA 1T36A 3IAAA 4HUJA 3EGIA 3K53A 1SB9A 2YIJA 3L7DA 4KQWA 4OHMA 5G4LA 1UJ5A 1X1AA 3WAKA 3ZWKA 1NC1A 2WIDA 2G7ZA 3VU9B 2DE0X 2LCFA 2QMZA 4M8NE 2XDYA 4ZIRB 3BWMA 3WIVA 4P4SA 4PLYA 1MNQA 3BK1A 2SKDA 1WVIA 2G5PA 3PFGA 4HAVA 4MKXA 3WQBA 1KKMA 2A57A 3BDIA 2NTYC 1QZUA 4NCXA 1EP9A 1VJTA 1NT2A 3KS9A 2K4MA 3ZY4A 3LH5A 1T91A 3A05A 3WMXA 1SBTA 4XCQA 1HE2A 3HKEA 3UGKA 1H1LA 4X6UA 1HYQA 4NPAA 5K0NA 1MO5A 5ICFA 4H1WA 4QO8A 4TMYA 4BFWA 2QDKA 4YJFB 4M76B 4AS1A 1Y6GA 2ZSAA 1P1CA 4GI2A 3IV6A 1H0SA 2GTHA 1RYHA 3C3BA 3ZW9A 4GNKA 1NQVA 4CIWA 3AUUA 4NAUA 3HPRA 2JHFA 3EPHA 5DB4A 3GNSA 4G63A 1RWOA 2AN3A 4LOLA 3A32A 4YMTA 1GN9A 1HTTA 4P33A 4G1FA 1DHTA 3BRSA 3OY7A 4GD3Q 3WK7A 4FX5A 1YRLA 3IOBA 4MTCA 3WB0A 4ILEA 2BKEA 2OHHA 1XMIA 3PQ5A 4H4EA 4Y9UA 2CXTA 2P6PA 1KYWA 1LI4A 3RUAA 4B73A 4JSYA 1JIUA 2HJHA 4TZKA 2JLYA 3V80A 3O8QA 2BN4A 3ND9A 1UBJS 1A8SA 3ZK9A 1MOQA 2KHZA 1QMPA 3KQNA 1P2TA 2ZRHA 3CRRA 5JSYA 4RD1A 2AQKA 1QS0B 2PA0A 3VGJA 3WWPA 4AUNA 1MH9A 1YR7A 4GOJA 4Z86A 2QUZA 4J0FA 3LW8A 1KDVA 5TJHA 2YX1A 2P78A 2OBYA 3PFNA 3MHTA 5AW0A 4FQ7A 1HI9A 3A04A 1AF4A 3JW8A 4RK5A 4AN4A 5KYTA 4U3JA 2IYQA 2O3TA 4JI1B 1Z17A 2FJPA 4GGOA 3VPSA 5GIOE 5CYFA 1NG9A 3WKAA 2I4LA 4P53A 1W0JD 3ZCXA 1F0KA 4DQVA 5FX2A 4UQOA 2VHTA 2LBPA 4WH0A 1Q7CA 4C0HA 2FSHA 6Q21A 1ADBA 1Z07A 2OHJA 4Y2RA 4LF5B 3KWMA 1AM4D 3FNFA 2G3YA 3DE5X 4JYZA 5KOHA 1J0BA 1E1RA 4JP3A 4R51A 3ZYZA 3KLMX 4W4TA 1YR6A 3VR4D 3ESZA 4YECA 3VKGA 3JASB 3B1KA 3LCCA 2W4IA 3OTHA 4AYWA 3BJEA 1MIHA 2QLLA 3P0HA 3MT8A 5BWOA 3G0HA 3OUTA 1O58A 5H83A 4MPPA 4Z9YA 2CWDA 2ZJ1A 4N3NA 5CVCA 3L7CA 3AUJB 1QHNA 5JVDA 3EW9A 4LJ6A 2VBFA 4N18A 1I6MA 1PS0A 2EYUA 4ZAXA 4XVHA 1CETA 1SU4A 2ACKA 4WFKA 5TE9A 3STUA 4C4XA 2FN7A 2HRCA 3AL2A 4NOLA 1O2DA 1GEEA 4M9CA 4H6PA 1IVYA 1TK9A 3N0RA 3QI2A 4MCAA 4QULA 4AWXA 3AERA 2CYCA 3PHBE 3AVUA 1G5IA 2E1RA 4QT0A 3PXGA 5JY1A 1XI2A 1N8SA 4GX5A 4LNUB 2XWPA 3AEQB 3FAKA 4L8GA 2YIVX 4XEUA 4LRQA 2J08A 1MG0A 1XTTA 3F5QA 3HMKA 5KPDA 1HYGA 3COSA 4WVLA 2PGJA 4E1AA 4KZPA 4L5AA 4MUJA 1AMNA 5U4XA 4JLBA 1NVEA 3NWJA 4L07A 2C4HA 3FTDA 3ZV3A 4KJZA 1N0HA 2MSLA 1QGUB 3ENNA 3CG4A 4IGIA 5AW6A 5HP4A 1KYXA 1XNGA 5G53C 2Z8XA 3TD2A 1EI9A 2HAEA 3AIMA 1ZEJA 5I45A 1WUHS 3PEUA 4FMDB 5DZSA 1CY7A 4AM8A 5JPCA 4X8HA 5A3QA 2V7TA 5L4NA 2EWWA 4N8SA 4LGCA 4C0JA 2YR0A 2FETA 2VF4X 1QG4A 4WACA 3B1XA 1WE2A 5AW5A 1ATIA 3PLNA 3OQ6A 4CV0A 1B4DA 4WGFA 1YRWA 2A1UB 4DANA 1U3GA 1A8UA 4AJEA 3U4CA 4YRPA 1DBVO 3ZLBA 2FXIA 3IUEA 4UFNA 1GHTA 3DS8A 5F35A 4G86A 2XJ4A 3DULA 1CR4A 1QYDA 4IOMA 5DMXA 1K5PA 1V5FA 2HN9A 3D54D 3V4VB 1R8SA 3L1KA 4BBJA 4R54A 4EPWA 1D7OA 4G9EA 3RRFA 1PEAA 1DV2A 1Z74A 2D5LA 4TMWA 5HIAA 3TKLA 5J4HA 2A88A 2HBQA 4RF2A 1KEEB 2RHHA 5LM3A 5K4HA 5IK2A 3JARA 2WT4A 4H7JA 4JC0A 3M34A 1ECLA 2ORYA 3P9RA 4LECA 5BRAA 2ZYDA 3WK9A 1PYGA 4YB8A 4IRUB 1MOZA 2XUPA 5K2MA 3QF4B 3RUEA 2VT2A 3SD7A 3R8XA 3PI6A 2I2AA 1XBTA 4OB7A 1KVUA 3BYZA 3SDSA 1ZW6A 3ETHA 3T5BA 4EJ6A 1ORHA 4LDNA 3H2JA 1V41E 4EG7A 2NU8A 1J2YA 2C59A 1S2MA 3FLMA 3WGUA 3G2HA 1T4CA 3IP6A 1SHJA 1QORA 3AUTA 3MUEA 2E6KA 1E2GA 1G6KA 2BIFA 1O5OA 2GD1O 2Q3HA 4FNGA 4MNTA 2MYPA 3ZY2A 4QZVA 2O7VA 4F6RA 2AV6A 1BN6A 4LK2A 3SOZA 1KTVA 1DDIA 1RACA 2WA1A 4U2EA 3EVAA 2NTNA 1J42A 4UJ5A 1IHXA 2CMKA 1NUAA 3H1GA 2P77A 2OQVA 4M6WA 1E6WA 3T9FA 2CLOB 3S2EA 5KYXB 1LSOA 1U0TA 4QPCA 3TB4A 3DEKA 3EPLA 2AC4A 1OHHA 2HIGA 4LMAA 1Y4AE 4UFPA 3AR7A 1M1YE 2VHVA 4UBOA 1RNLA 3GLIE 2POCA 1Y3CE 4IX9A 4CM3A 3JAWB 1UPTA 2WSIA 3SC6A 3DLTA 1GUAA 1SU6A 4OL9A 2PWYA 3LOUA 3KR1A 4BJ6A 3FDJA 2B8TA 3LDFA 5KTKA 4XFJA 3RSOA 4YA6A 5ICSA 1MFZA 4FGUA 4YAEA 5IJ0B 3ACDA 5JANA 3RS7A 4M89A 2H59A 5ALQA 1QO0A 5CPBA 4JA0A 1FEZA 3GUYA 3PYMA 3NJ8A 3PNKA 4PXSA 4AP5A 5B64A 1P8AA 2HA2A 1P19A 4G81A 4QAQA 4XARA 1JU4A 2AFHA 3QX7A 1X8LA 1UKAA 1RWQA 5T4EA 4BBAA 4D3ZA 3AZQA 3RJZA 3G0DA 5JZMA 3NHYA 4KXXA 5FO1A 4JBLA 5JMPA 2R8OA 1CD5A 3ABSB 3K15A 1VYVA 4Q16A 4NULA 3U62A 3IQFA 3EUAA 2DJ5A 5I7FA 1T8SA 3T1HB 1U4SA 1WSBA 4AAYA 4CKZA 1P4GA 3FOEC 2Q2QA 5AM1A 3HBJA 4E51A 5J2TA 1I3NA 2C8VA 3GFQA 2JRLA 2C92A 3E5NA 3VPXA 4QPJC 4QVGA 1S3IA 3L9WA 2E4VA 1RQPA 4PPQA 1YR3A 2ZTSA 3GN2A 3HN6A 1XEFA 3AF4A 4DBLC 1MJGA 4FSDA 1FL9A 1NYQA 4NFSA 1C8VB 4JKOA 3J81A 1EHYA 3UAXA 1A71A 1EUDB 2PR2A 5B3LA 5C4IA 3VU0A 5SZHB 3RRBA 4W7HA 1M73E 5AHXA 1G9XA 1UKVY 4DR7B 1E2BA 4BCCA 5AKZA 3GFVA 3UYKA 4MP8A 3OPYI 4KO2S 3RWMB 3WBKA 2HHHB 1BXZA 3U3JA 1D6MA 4MJLA 3G02A 3DONA 4HLUC 2WIJA 4NAHA 4PTLA 5JE8A 1OREA 4HVAA 4CCSA 4CRWB 4Z2AA 3EIQA 1X7DA 1YU9A 3LW7A 4ND8A 3ISTA 2CUKA 2GKSA 4HNVA 3L0ZA 4XYLA 3JQPA 4KE8A 2BHNA 2XVAA 4EFMA 3P4XA 1I32A 3KZNA 4GOKA 4W5RA 2AE1A 1X3SA 2SKCA 2JK0A 1AKNA 2LPMA 3L0CA 4MV9A 4BJ5A 1PTJA 4HTFA 4OQ4A 4OGGA 4UEJA 3C4JA 1KP9A 3OH8A 4C2AA 3TECE 3HCRA 2F1IA 3CCCA 3A58B 1A9YA 4OHKA 4KSBA 3V4SA 1RAFA 3KQPA 3MWEA 4PZ0A 3GFOA 5HUHA 4MV7A 1P0MA 2C31A 1N2CA 2Y67A 4PIMA 3DDNA 3DHNA 3W4KA 2ZM6B 3ZKAA 1INLA 1YDEA 2AKAB 2V4UA 1ZCZA 4RO0A 4JQYA 2ZWPA 4O2BF 4PZLA 5I9TA 3X2EA 2WIBA 1NQUA 3HP7A 3O31A 1GYPA 1L5QA 1VP3A 4P4UA 3VR3A 2PBFA 1IXSB 4ZQBA 2Y0CA 1ZIYA 1TGVA 3MXTA 1PVDA 3P9SA 5CW1A 3DNPA 4C22A 2UZIR 3UJAA 4B44A 1K2WA 3I6IA 5BRJA 4N7RA 5B37A 3FMFA 1DX4A 1HT1E 3NC4A 2WV9A 3K30A 5CT9A 2JARA 3LNCA 2VTEA 3MQFA 3SHOA 1E2QA 2XAAA 3NHBA 5KKCA 4I55F 3MUFA 1QHYA 2P9JA 2GYUA 2E5LB 1ODFA 4ZO8A 1E1CA 2XVXA 1Z4KA 2X9VA 4LC0A 3UMSA 2ZJ7A 1ISHA 4DS3A 4IKEA 4DTIA 5CDUA 3THRA 5FHQA 4Y9DA 3ZDRA 4X65B 1W0KD 2VWGA 3V8RA 1GQYA 5FOXA 4UEQA 5KQGA 2FEOA 1K6XA 2QRKA 3E3MA 4Q9AA 3L7LA 3WLEA 1K6IA 3QFHA 1YE3A 3TRKA 4B2PA 3MF4A 3M5PA 3U13A 5FDFA 1I9CA 2R5NA 2EJBA 2RHMA 4BDSA 3FSRA 3VO1A 3Q8KA 5KI6A 3ENVA 4Y8VA 4X8LA 4B3BA 4ZRMA 5JFOA 2PX6A 2V58A 4PLFA 4Y1RB 2W2PA 5DYYA 3RQSA 2EG9A 4QKQA 1LQTA 3TSCA 5A6VA 3LZCA 4I9NA 4XYMA 3DZHA 3BTSA 3M5WA 4J0QA 5LBTA 2GPBA 3SKYA 2QQFA 5KYWB 2Z8YM 4K3UA 1EB9A 3HB7A 2ZROA 4WXMA 1DJMA 3VVLA 4KDFA 2Q99A 4P34A 1XD8A 1BXGB 3IHLA 3QMVA 5C32A 3USCS 2IYSA 2A94A 4D6YA 5IASA 2FZ5A 2QI9C 1KQFA 3CLVA 2I99A 1NN1A 1SOWA 2YYZA 1ZPDA 2HB6A 2JAOA 3AFNA 2YHIA 3DZ8A 3P19A 4LRYA 2I5PO 5CIWA 3CE9A 3KT0A 1ZU4A 3H2HA 4I8IA 3RVDA 3R5TA 1O57A 2R7KA 1LLUA 1LLFA 4KVFA 3THWA 3AVQA 4CW7A 1QGDA 5C8ZA 1O95C 2H0RA 2YN4A 3PT9A 2ZJ5A 1H6AA 3H42B 2ZJAA 4DHWA 3GRYA 1UFOA 2W6PA 2AG1A 2WWXA 3LUAA 4WN9A 3H0KA 1B0AA 3IAM1 4ND6A 3ESAA 2G1UA 4JXJA 4P92A 1T9GS 4QFDA 3WGOA 1NR1A 4D46A 1N1DA 3UMCA 4DNFA 3F71A 3IGFA 4AZ0B 2DPMA 2XQVA 2QN1A 5SV2A 5HQ3B 2XAUA 3WE7A 1IVSA 1P74A 2WAOA 3MTIA 4XLLA 1DAPA 1UBSB 3NETA 3GAFA 4QUIA 4UEKA 4HB0A 3RUFA 1MV8A 3CLRC 3UVEA 4N7JA 2GM5A 4G0PA 1R27A 3LV8A 1IDOA 1LSUA 1SUEA 1UJBA 1VIAA 3KQYA 4UVIA 2NWQA 3X1ZA 2GN1A 4N49A 5T8KC 3RUPA 3C87A 4AB1A 2HO4A 3V1KA 2V74B 3B1JA 3PGKA 3CMMA 3EXIA 3FFXA 5IDVA 4F2PA 3IR7A 3BXEA 2JCVA 4KQHA 2DT5A 1HYEA 2ENUA 1JSRA 1RFLA 1WOYA 1IQPA 1ZJZA 2F48A 2FW1A 4GR4A 5IVDA 2QBYB 5EXEA 3FPHA 5DNEA 4A0HA 5CLFA 4C0LA 2N9UA 5ALPA 4A5SA 4B45A 5BSVA 3WV5A 2VDQB 5DP2A 2JLUA 4DDVA 2V0NA 3CPHA 1R0CA 4EKNB 4D3FA 1E94E 2HK6A 2ZI7A 5J5A