4R9NA

Deor family transcriptional regulator from listeria monocytogenes.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
253
structure length
247
Chain Sequence
NATVDLEQKLEEKFGLEEAIVVATHDMSEEEALNFLAKEAAYTLSKRIAKVKTLGISWGKTIRKFANEFPFIPHKDLTIIPLIGGDLHSNQICYDLKKKMKCHSKYLYAPALVEDTEMKTDLSKNKYISEVLEEGKTVDMAIVGVSSPYNHSTMEEIGYINSEDIEELRYKDVVGDINSRFFTADGKEAKTEINTHVIGLSLEELKNIPTVVALANGLQKKEALVAALNAGLIDVIVITDRMAEYIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo0547 protein
publication title DeoR family transcriptional regulator from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 82
structure length 247
sequence length 253
ec nomenclature
pdb deposition date 2014-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r9nA00
1PBTA 1JT9A 3ENWA 1LK5A 4L5JA 2WU1A 2GNPA 4L50A 1M0SA 3BXEA 1O8BA 3BXGA 3HN6A 1NE7A 2J0EA 4L5IA 4GMKA 3ENVA 3BXHA 2R5FA 3CH7A 1FS5A 4GO1A 5HJ5A 1FQOA 3E7FA 4OQPA 3TX2A 4M8LA 2W48A 3OC6A 4X84A 1CD5A 4IO1A 4TM8A 3CSSA 2RI0A 3ENQA 4OQQA 1UJ5A 1VL1A 3KWMA 1HOTA 4L4YA 1UJ4A 2O0MA 4NMLA 2RI1A 3EB9A 3ICOA 1XTZA 3UW1A 2OKGA 4L4ZA 3EFBA 3LHIA 1DEAA 3BXFA 3LWDA 3E15A 4R9NA 3KV1A 1HORA 1LKZA 3U7JA 1LK7A 3IXQA 1FRZA 3L7OA 2F8MA 2BKXA 2BKVA 1FS6A 4TM7A 1UJ6A 4L51A 4R7TA 3NWPA 1Y89A 3HHEA 3NZEA 1KS2A 1FSFA
chains in the Genus database with same CATH superfamily
4MIOA 4UDYX 4ZVKA 2XW6A 5LLDA 4QUIA 1ZISA 3U5TA 1JHRA 5F5LA 4KXLA 3TLYA 3F9CA 2GM3A 4P34A 4UNNA 2QVBA 2Z2KA 3LQQA 4JLKA 3BXEA 3QJGA 2IUYA 4L8GA 1BJKA 3R7SA 1DXHA 2P4EA 3BXXA 1ZGAA 2BONA 1YZLA 1SD2A 3BQ9A 1TAHA 3UWDA 1L7MA 4EI7A 5C7LO 4X0EA 2KX7A 1Q17A 1YI8A 2W4IA 3K53A 1Y4ZA 3L6CA 4YRQA 3MTGA 1Y8RB 4XB6B 2O4CA 1U28A 1JZTA 4IRXA 2IH5A 4K0KB 2PKEA 4RVDA 1DIRA 2WU0A 3Q88A 4TL9A 1DJLA 3K5IA 5AHXA 5JDIA 3N8GA 5K01A 5JVDF 2BEUA 2H7XA 2Z9CA 3ESZA 3GVCA 3OE1A 2ZE5A 3JTEA 4RVFA 5DWVA 5C4IA 5IG2A 2JCGA 5L7WA 2R5FA 3E5NA 3FNIA 2AN4A 3CVOA 4FFSA 1AVTA 1ID1A 1Q0HA 2JLSA 2V7BA 1FVHA 4TRRA 3BTVA 3EQZA 4O2BF 4MQFB 2FETA 3HNPA 3B1WA 3DLTA 2VDRB 2JGDA 4ZU1X 3SHWA 2O5CA 2GPWA 3Q5DA 1ABBA 1QVRA 3U6BA 5A3RA 4MW4A 2DXIA 3NEJA 3N0VA 1G8AA 1SCKA 1T1GA 1VI6A 3GHHA 2O1WA 3VKGA 1J0CA 2XTMA 2V6BA 1OKKD 4IDEA 5DYIA 2HD4A 5JCOC 1D0IA 4EI2A 2RGGA 4BJ3A 1PT8A 5JVDA 1VL8A 2HC9A 4PYMA 1UDWA 2FKNA 1OB2A 4RGBA 1WLSA 1E1LA 3QFCA 1BHQ1 3D7LA 4P93A 1T0JB 2WOJA 4MYCA 4O2BA 4LJLA 4TWJA 3AR7A 1EDBA 2K7ZA 3K1JA 4TOIA 2HBQA 3FUVA 3MT9A 4L9SA 5EMKA 2DC1A 1G6HA 1YIAA 3SS7X 4Q00A 3ES9A 1M75A 1J06A 1XVIA 1S8FA 4RTKA 1UOPA 4F4UA 1U0GA 1WW3A 1G8GA 3V8NA 3USCS 1Z5VA 1WCWA 4HI0E 2KLBA 3N5KA 3USES 1M8PA 1GQ2A 1R6AA 1LX6A 4HWKA 4U1RA 3TRKA 3PDUA 2AOTB 5GZ6A 3TIFA 1WUTA 1I2DA 1ODSA 3G2IA 2PDAA 3CRW1 1A71A 2PQ6A 1QE5A 3FCSB 5J63A 3R9IA 3WJ7A 1BFUA 1NWHA 3IAHA 1KSHA 1KQ3A 1V48A 4N5HX 4OXIA 2K7FA 4UQOA 2XMQA 5EHGA 1HQCA 4NYJQ 3V1LA 1Z6XA 3D7NA 4BCDA 3NBUA 1QTRA 4H7DA 3ZC3A 4HHEA 3GNLA 2EX1A 4HDMA 3T1HB 5I7HA 1P8AA 4HAZA 3VPHA 4LF4B 2OENG 4YB8A 3OG9A 2C00A 4JS0A 2RGXA 1TYDE 3IE2A 4U7TB 2CVZA 2FR8C 3FSJX 4K9OA 1EXWA 2B1GA 2NO1A 4ZI7B 1J21A 3OUTA 1PQYA 5LKAA 2BKXA 2WUEA 2GPAA 1SXJB 2KW5A 5FTWA 4BKOA 5K0CA 1JFSA 2FMTA 1TZJA 3FPAA 3G82C 4TLCA 1NY6A 5CLQA 4BB0A 2QROA 4PW0A 1OLSA 1P9WA 4BMVA 1Y3BE 1DVRA 1W94A 2NTNA 1YS4A 4X92A 1IZ8A 1P5HA 2W4QA 1NXOA 1JUDA 3WWCA 2D3TA 5HYVA 3VAZA 2CFTA 2JZNA 3P94A 3NM4A 4HPJB 2W6OA 4ND4A 2ZRDA 7ABPA 1DOZA 1EVZA 1MAVA 2H7YA 3W5BA 1CYEA 3O31A 1N36B 2BH9A 2PANA 1QCCA 1W4RA 2QLMA 3HMKA 5U9CA 3QHAA 1R3DA 4MCHA 2XUPA 4AL4A 5K8UA 3WKAA 1H2HA 2JDID 1TQHA 2DKFA 3GLHA 3STVA 3C0KA 1P73A 3WA6A 2PBRA 2XYRA 2Q4TA 1Z75A 1WDLA 3D0OA 4BIMA 2F1OA 3ZDQA 3EUFA 4F0JA 2Q2NA 2WMYA 1NE7A 3KU4A 4BGVA 5DULA 4DQUA 4KODA 5ICEA 4JI4B 3IJPA 1KRXA 1NOJA 1CIPA 3BCUA 4JBXA 2IU0A 2QW0X 4AP9A 3BQNB 2JHAA 2FV8A 2LCQA 1Q14A 1O5OA 4N82A 4S12A 5JECA 5K4HA 3QXHA 5DRYA 4QGSA 4YBRA 5TQJA 5IVHA 2ORYA 4BVBA 3U3MA 4G36A 1P77A 1GZ5A 1XMPA 3O4GA 1YMVA 3GV0A 3OIFA 1W76A 2Q5IA 3PV0A 3PGKA 2P35A 1GFIA 5ITVA 1FP1D 2ZB2A 3CZ4A 4P3NA 5GONF 1HZJA 1E6CA 5DCUA 3L5KA 4BMZA 1NXTA 3ANTA 1OBCA 1VE9A 4I1SA 1CNFA 2NACA 4US0R 1CUIA 1E69A 3S8MA 4RQAA 4JI5B 1TVCA 4FFDA 3IUQA 3FR8A 4M0MA 1TM7E 1RHKA 1RXUA 1TQ4A 5LU9A 1GVNB 1W1IA 4WEOA 4BBJA 3DOEA 4L5AA 4DIUA 5BPHA 1NFQA 5JQGF 1KQOA 1TCUA 1W0CA 2HPAA 1FMCA 2WF6A 3IH5A 2QD1A 3R0QA 3U4QB 1M1NA 1UJ4A 1K0UA 3BEOA 3GJ7A 4ZI5A 5GVSA 4MW6A 4D9EA 4B6SA 3I9MA 3C6BA 3O8QA 5M3BA 1UL1X 3O1JC 1HL7A 4BIIA 3STHA 3A9CA 4LRWA 1G2PA 1BA3A 5GONA 4J0FA 5E6RA 1MAHA 1INLA 3JYHA 3N5CA 1T3SA 3D0RA 1QIHA 1R4NB 1VMKA 2GHTA 1F1BA 3TL2A 2I6QA 3UJ3X 3NTOA 2YOGA 1U5CA 3KUKA 3HYCA 5AQEA 3ZYZA 4EP1A 5I7SA 3T1YB 5F9HA 4C7BA 2PUTA 5KMGA 3K0KA 2LR0A 1BH2A 2VJNA 4UOEA 4ZRNA 4KFCA 4M2LA 3RRMA 4O1IA 5BOSB 5JQGA 4GNRA 3AF0A 3SDSA 2QF7A 3E9DA 4TRNA 2WSLA 4S05A 1I7QB 1DO2A 5KQRA 4LVOA 3VOSA 2C0CA 3VR1A 5JLAA 4A7PA 4MWTA 1PNVA 1PP4A 5IJAA 3SM3A 3UOGA 4Z4GA 4DDWA 4GKBA 4Q48A 1QMPA 3FMFA 4DIBA 1R6TA 1O4WA 1BGWA 5KTKA 4JLBA 1OVMA 1YK0A 4G86A 4B0PA 1DO0A 1RI1A 2QZJA 4N9WA 3ZV7A 1XI2A 2GF9A 5IEJA 1FS6A 3HJCA 2ZDGA 1EZ1A 4MXDA 3H05A 3ZZ0A 1FZQA 2C84A 4WZ6A 4D4JA 1AA9A 2XWBF 1O6GA 3DHEA 3IJ5A 4GF5A 4NZOA 4QTTB 3A04A 5IC4A 3JRWA 1NNI1 4D79A 5IASA 4U0KA 1XL1A 4WAUA 2WK1A 3HCPA 5LJLA 4B4DA 4NAVA 4YI3A 2QMYA 3R3HA 2DM6A 4P2GA 1TD9A 5EJEA 5ED4A 1ZR2A 3F97A 3DCJA 3CWQA 4XD2A 4B2PA 5HS4A 1XP8A 3BHJA 3EFOB 4LUCA 3WWOA 2LXNA 4M9RA 2EBUA 3N2YA 4L3VA 2I8AA 4IIHA 4RSHA 1V9LA 1DE0A 1ZITA 1QGDA 2ECKA 1HOXA 1ZZGA 2X14A 4ARZB 5SZKB 4AQDA 2X0NA 3MJEA 1NURA 4HNSA 1ZVMA 1BMFA 2W2MA 4HN4B 4D44A 5FPSA 1A9XB 3R1IA 4HCJA 4AJLA 4F45A 1JWAB 4PZZA 1BKYA 2A5YB 4KQEA 4Q66C 2BEWA 1ETUA 3WKEA 2QMHA 1PJ2A 1AKVA 3CJTA 2ANBA 4UOQA 1NF8A 2B5WA 3ONNA 4XGQA 1IXZA 1L7DA 4FDTA 4HNRA 4HDRA 1YF3A 3CC8A 3TF5A 4GLLA 2DWUA 4JLUA 1T9CA 1BE8A 3VHXB 3WLKX 4QUJA 1VKRA 2WJYA 4FZ5A 3VAYA 1SD1A 2ZT7A 4QRIA 1FX0A 4BVJA 2FYTA 3E70C 4NPCA 4NBWA 5FPQA 4D80A 1E1CA 1WCIB 4LFAB 1DELA 2DVMA 1R4MB 4CM5A 3HCFA 1KVTA 1ZCFA 2NXEA 2BHTA 1NT4A 4JLDA 3ZE0B 5DM0A 2G0AA 3MPUA 3R3SA 2ZUDA 3L4JA 4UU7A 4CLDA 5M2QA 3U7QB 3P0FA 3JYNA 1R18A 3QU4A 2P3OA 5FP0A 4YQEA 2X5XA 3BZWA 1ZM2A 5CLIA 3DKKA 1RAEA 4MUMA 1VHLA 1A4XA 1A8SA 3A3YA 3BIJA 4I4TB 4R1TA 2XB2A 3F0TA 4JC0A 5JDCC 4FN5A 1MEOA 4O2AF 3JWIA 4Q6BA 5HDQA 3DC7A 3PUVA 4IIDA 1E63A 5JIBA 3AFGA 5IM4F 4G0PA 4MVJP 2LP4Y 4RVNA 2X7JA 1JSZA 2BCEA 4MKZA 4B3RB 3UWPA 1T10A 2I54A 3KKQA 2H1CA 1TJYA 4WLVA 4WLNA 4TQ9A 4HF7A 3SMQA 4R1MA 1CSEE 3RH0A 4O8CA 5ITWA 1VKHA 1U9IC 1H23A 1AN9A 1SC1A 4S1NA 1F4VA 2B35A 1R0ZA 4IIBA 2RGRA 2ZYSA 3HA2A 4KCGA 5H3LA 3GLGA 5AW0A 1CY1A 1A04A 1QCZA 2O9JA 2W2KB 4PAOA 4TTPA 2FWPA 1IUPA 4CEIB 3M81A 1KYWA 3E22A 3LQ2A 3QX9A 4BDTA 5LJIA 4J2HA 1DEAA 4OF4A 5EYPB 1X1RA 3RKSA 3ZLUA 4NP6A 1TMOA 4JDUA 4O2AA 2ODNA 3OTGA 5IM4A 1JB9A 1NIPA 1V7ZA 2VDWB 4UNQA 1R0CA 2VHCA 3FTPA 5F7JA 1EFVB 2P5YA 4EYKA 3AEKB 2PRIA 1E7RA 1XZBA 4I3FA 1T9GS 3V2UA 3RTDA 3NH9A 2QNBA 1NP3A 3TOCA 3CB2A 3O83A 3A9UA 4GBJA 4QICA 4WASA 3NGMA 3WHKA 1GT6A 2HRCA 3OTIA 4YRTA 3UHFA 1SBIA 2W2LD 1UKEA 3EDOA 4P7JA 3H0KA 3TXAA 2BJHA 2XE8A 3DE5X 3D2LA 3T38A 5LD2C 3CNNA 4JEUA 4B45A 5JJLA 3HXOA 3KQPA 1ACLA 2H31A 1H65A 2CE2X 4JLMA 2R79A 3N6RA 1EFKA 2KBEA 2PX2A 3H18A 3ZH9B 5DN6D 1E18A 3K0FB 3ZJYA 2QLBA 4IGIA 4PF1A 3F49S 4ND2A 2D2VA 1DG1G 4V3CA 2Q5JA 3O4JA 4C4OA 1L4YA 1Y98A 1RPZA 4EM6A 3S1AA 2WBLC 1Z6TA 3KKKA 4R6WA 2OV6A 4B2LA 1M74A 1IU9A 1GAQA 2NQ2C 4DLRA 1PVVA 1A5AB 1JIIA 4LJYA 4C6RA 1UBSB 2A14A 3HO8A 3IESA 1LBSA 2ODQA 4DHWA 4FNAA 3RFVA 3C7AA 3ZYCA 4R0MA 3QEBZ 1M0EA 4CLXA 3AZQA 3HJAA 4P80A 4BNVA 1PR4A 4KPUA 4ND8B 4RACA 5AI4A 3ROZA 3W3ZB 4NFYA 5AHOA 3FOWA 3EGXA 5IUJC 3OBIA 3C1UA 2YR0A 1J8VA 3PD1A 1N2CA 5L8VA 1EK0A 2E85A 2AJTA 5K1ZA 3G49A 3U80A 3NVMB 4CQMA 3KTAB 3E9ZA 2EBWA 4JIMA 2RHTA 4NFLA 4R1QA 4TS3A 4RK6A 4YCBA 5AHWA 5IP5A 4EG3A 3RG8A 4AECA 4IBOA 2CXRA 4J6EA 4F85A 4XZ3A 3U0VA 2PLFA 2OG1A 2UZ0A 3U3XA 3GMSA 2WWXA 1ENZA 4ZKDA 3E7PA 3ER9A 2ZUBA 4NJEB 5FO0A 1R64A 1OU4A 3I53A 4YJFA 5KZMB 1GKUB 3TSCA 4YMGA 1IOWA 3VDXA 4MYDA 2H65A 3KPVA 3LPDA 3HI6A 3ZHSA 1OZ0A 2HY7A 4LF8B 4HR7A 1IWOA 1ZUNB 1ATIA 3I2JA 4K81B 2VDJA 3I6BA 5BW5A 3DO6A 2QTLA 3IOBA 1Y1QA 3VHLB 1L1RA 2HLDA 3DW1X 4TWIA 4HPXB 3OLZA 2R1TB 4WECA 3TFWA 1P0PA 3WK4A 4J0DA 3PF8A 4GR5A 1P1JA 1SHLA 3C7CB 4NK5A 1FYWA 1H69A 2QN7A 1RJWA 2PT6A 3GJ8A 3QVMA 5CVUA 5G02A 4WBNF 1JEEA 1XRLA 2NYRA 3DVAA 2IZ1A 1AO0A 3H1GA 5EIFA 1AQJA 3U7RA 1O95C 2PZKA 1CJBA 2J46A 1CUYA 4V0OA 5DGIA 2JLYA 3AR5A 2VJDA 3HV2A 2F8LA 4QXQA 3N07A 3U4CA 1C0PA 1NSTA 1V1MA 3KVOA 3QXSA 4RESA 4YRKA 4B3GA 1N7JA 1P6QA 1CS0B 1TEHA 2F9MA 2R6HA 2CSXA 1E0AA 4CUKA 4FC6A 3AUXA 1XD2B 3KL4A 4IJ6A 4KUGA 4NX2A 4BEBA 5IKEA 2Z3VA 3CH4B 5BQFA 3L6BA 3L49A 4IEEA 3D3JA 2WY2D 1C50A 1R16A 3KOZA 4TMFA 3H4MA 4D56A 4WBNA 1P75A 5KAMA 3MTAA 1JG1A 4G0YA 3PX3A 4DG8A 2E21A 4JXJA 1UANA 1XLWA 4RCZA 2AHRA 1POXA 3FGPA 4H4CA 1XZHA 1S6YA 3GNSA 5BWCA 1A82A 2XKJE 2RFLA 1NN3A 2AEMA 3GROA 2XGGA 2R7KA 1EP2B 3PT5A 3WTCA 3THOA 2C9OA 2RH4A 2W2OA 4GL4A 1YDEA 5J9FA 3V32A 3PCRB 4CM4B 1Q5PA 4L51A 4X61A 4A92A 4EY6A 2ZPTX 5BQ5A 5K3BA 5UKDA 3RVOA 4UEWA 4CCWA 3OVMA 3RRZA 2PR2A 1Y1SA 4RABA 4LRTB 4PFSA 1R0BA 4BNHA 3IAM6 1E2QA 1C9DB 1EE9A 3NHSA 4N9QA 4NDNE 3R7NA 4Q9NA 4L5CA 3HE3A 4KW7A 2Q9UA 1NHWA 1KQGA 5SY6A 1SQ0A 2UXDB 2OMEA 3GRPA 2Z2JA 4PG5A 2OLKA 1COWA 3RYCA 4PQRA 1DDOA 1L3BA 2B1QA 2BBOA 1L6RA 1ZRNA 4W99A 1A9YA 4LMBA 3D4OA 3K9LA 5AO9A 1NUUA 2O3UA 4WCVA 4E5YA 1EK1A 2V74B 3IPRA 4I6EA 5CIYA 2YBEA 4D8TA 3FE2A 3BF7A 1O89A 1ZNQO 4QUGA 4TRMA 1NV8A 4ZO6A 4R1OA 4B6QA 2CMFA 2VWHA 5DGHA 4M0KA 4IXDA 2GN8A 2HBRA 3MTDA 2BPOA 3AVXA 2QKYA 2QE6A 2ID7A 3IDFA 2VYNA 3NORA 3LC7O 2REQA 1Y1LA 2P2LA 5KYXA 1VE6A 4IGEA 1IN6A 3FX2A 1KMQA 2AQKA 3KT0A 4LV5B 4X7RA 4N5DA 3SN6A 4UM8B 5FTNA 2I4NA 3Q6MA 1T3HA 2RMKA 2X5NA 5FJJA 3FFXA 4MKFA 4ZCQA 1TK9A 2I1VB 3UJCA 3EXFB 2FSSA 2PSSA 3A3NA 1QO0D 2PK3A 3D3WA 1SU6A 5LQUA 4QAJA 3FCOA 5ESXA 3ZLTA 3HKCB 3IT2A 1BROA 1HDIA 1XAHA 3MBOA 5EP3A 3ANMA 3FYCA 3RSGA 4EL5A 4DDMA 4ZAVA 4HOYA 4LC9A 2VQFB 1GTL1 4RVHA 5B4UA 1IZ0A 3OE5A 4O33A 4AG3A 3AH8A 4Z0PA 1K86A 3UGQA 3L7MA 1RTKA 2QPTA 3N6XA 4BX8A 5LPNA 4GEKA 3KJNA 5BR4A 1KO7A 2YFYA 4AURA 1CJCA 4G26A 3FM9A 4FGZA 3B51X 5BSKA 1IQ0A 3WAKA 1PFKA 3CM0A 1XPUA 5MF6A 3AP3A 4Z7OB 1B8PA 2E4WA 1Z2DA 4PLCA 4QYIB 3G68A 2YWJA 3AB7A 3DFFA 3Q9SA 2XRMA 1HK7A 1T2UA 2BDEA 4FYPA 3PSHA 3IUSA 3RT9A 1P7PA 2B3TA 3UMCA 3OA2A 4TVOA 2QMEA 4E7PA 2Z2IA 4CT4B 3M6FA 3ECAA 1CEXA 4G4IA 4WZBA 3DKIA 3OD1A 4J1TC 3SG0A 3K0EA 3KFXA 4O4IB 4RXUA 4HG2A 3I0ZA 1NFRA 1GPH1 3HO6A 2I4IA 5JNTA 3DAYA 1ZXLA 2QV0A 4G65A 3GIWA 3M9XA 4BDSA 5AR1A 3FAKA 3A10A 1R3UA 3DOOA 1V5IA 4FQ7A 4DWOA 1YU9A 3FYSA 2E49A 4Z0TA 1Y3AA 2COUA 1RYNA 4P7GA 4DLTA 5E3HA 4J1SA 3BFKA 1IHXA 3HWSA 3COYA 3AHJA 3EWSA 5AI8A 4B7ZA 5JXIA 4FQ5A 2JFZA 1T25A 4E4YA 5HHTA 1XVTA 5DJ5A 4OMUA 1YB4A 3H9BA 2OORC 4O29A 5IT0A 4TTQA 4QQFA 1JF8A 2QY6A 4HPWA 4F2GA 1JB1A 3B3FA 1Q16A 1R10A 2VPXA 2Q2OA 3JALA 3NHWA 3EXEA 3EVFA 1IBKB 1POWA 3B6ZA 5FA6A 3QUQA 4XWAA 5F35A 2R1ZA 1MBZA 1ZMXA 2JIQA 2R3SA 4WJLA 1Y1RA 5BSGA 2RCNA 2JKVA 2QX6A 2OCPA 3U9TA 1W2GA 5A7FA 3I4LA 3OOYA 1V4BA 3FN4A 3N70A 2VRCD 3UC5A 2NG1A 1TEZA 4JI2B 1UBKS 4WXRA 1HURA 2ZJAA 2CL6X 3IR7A 1Y4SA 1EGAA 2D54A 2QD3A 4QBKA 3DAOA 4G67A 4BMYA 1OUMA 3DV0B 2G8NA 2HK6A 1GGVA 2P41A 3OOSA 3E1KA 4ZXPA 1NYQA 3CKYA 1DBSA 1EJ6A 1Q0RA 1N0WA 3GRFA 1P5ZB 3HVHA 3ETLA 4JP2A 3W8DA 4BTLA 4Z0NA 1DZ3A 4D25A 1J2TA 5I7WA 4YJDA 3G6KA 1WDWB 4R31A 3VH1A 1T4MA 3FGZA 5AM4A 2XA2A 3BL5A 4MQFA 2JLCA 1XMJA 2VSNA 1E99A 4MV0A 4OATA 3WRXA 2VYFA 3KJFA 4DNXA 3SJAA 3W7VA 5JCZA 2E5WA 4V24A 4R3WA 2BRUC 2PFGA 2OC9A 4LVNA 3U40A 3FTNA 3JV7A 4JL6A 2X6RA 3COZA 3VU9B 4CQLB 2XMPA 2NSJA 4MRPA 2G82A 4HMQA 1BWRA 4INAA 3UK6A 1F20A 3CUEF 5CJJA 1NWCA 3VDMA 2W6MA 3I8XA 4K87A 4M88A 5TB5A 1CQJB 1TCCA 1SC9A 4FEGA 5CNKA 5JNRA 5JZVA 1U94A 3E84A 1X9IA 5FNVB 1FFAA 1IEXA 2ZKIA 3IVGA 4PCLA 3IS3A 1XTSA 3ONFA 4YJKA 1YCDA 3VH4A 1QQAA 4YREA 1JWBB 1QXSA 2P3QA 1GY8A 1QNLA 1VB3A 2VYVD 2YASA 3E9QA 4KZKA 3UMVA 1KZ7B 1NXSA 2HUNA 1C7EA 4B7XA 3PEEA 1TZMA 2WVJA 1WXIA 2KJQA 1N3YA 5DK4A 3OP4A 1L5HB 2QW1A 2XT0A 2FW8A 1EEXB 1MJGA 1TDJA 1E6EA 2AOTA 3I45A 3S40A 3DB1A 1YS1X 3BMXA 5FI1B 3W3AD 1Z8HA 3K9CA 4NULA 2BLLA 3SOZA 2DQYA 4ER6A 2P2CA 3T7IA 3MJFA 4ZHSA 1CJSA 1A9TA 2GVNA 3EH2A 4CEJA 3G0BA 3P45A 1T5BA 2BELA 1A9PA 3M4JA 1Z88A 4PLWA 2JJ2D 3M3DA 5JYBA 3CB4A 1PNQA 2ADMA 5C31A 3U1BA 4NVRA 2EJTA 4DKXA 3I61A 4DR4B 4ATNA 2XBUA 3BXOA 2W90A 4I0WB 1QIDA 4AMYA 3D1LA 2ETXA 2ZBUA 5BWMA 3S44A 1Z4MA 1VIDA 3DVRX 4NYIQ 3AXTA 2YZMA 1SXJA 1XVVA 5SY4A 2QX8A 5KKCA 3BH7A 4B5KA 3PUIA 5LNK6 2C82A 5AKYA 4GNKA 1E77A 4G56A 3CEAA 5DNAA 3ZW9A 1Z82A 3C85A 2X40A 5CDGA 3B8HA 4LGVA 1VGVA 2C4KA 1QRTA 4P3XA 3PR1A 2Y6UA 1WKBA 5KYVA 2XVMA 5FLEX 2OB1A 3AM4A 4L50A 5EJAA 2ZI7A 4Z53A 2G9ZA 3KSBC 3HI4A 3L4SO 4B6EA 1N7IA 1K5GA 1ML3A 1PGPA 2HA4A 2KQUA 3OCCA 3U2QA 1OV4A 1X1DA 5FBRB 5KTTA 1X1CA 2PPVA 4P4UA 1DIAA 3GRRA 3ICVA 3IQZA 3SLGA 2FFRA 2VHQA 1QS0B 4W9NC 3MFQA 1X7GA 4HWPA 1ADYA 1XNQB 1ZY2A 2HT1A 1QVVA 1W4CA 1DAHA 1Z13A 2ZT8A 4PGHA 4F4CA 4JBWA 3GLFE 4POAA 3LXUX 5KEIA 2G9RA 3CBQA 2BL4A 1KRWA 4ZN6A 2QUJA 2IZOA 3DEJA 3GRVA 1ZJ4A 1CUAA 1MZVA 1R15A 3QV1A 3W5IA 3EEYA 4QPDA 4Z1MD 1P0MA 4RPCA 4XAQA 2AZXA 2V7QA 4KGZA 1WZEA 3D0QA 4LOLA 2XNJA 1N34B 4JENA 4A6PA 4LS3A 3P0HA 4B80A 1HG1A 2PV0A 4R2HA 4FFMA 2Q3HA 3O9ZA 3AU8A 2F00A 3P5BA 2PJUA 4B75A 1FLAA 2FEMA 3HH8A 3ZY6A 4WVLA 4CKBB 3HL0A 5L4SA 3KLBA 1BD3A 3NBQA 3T3IA 3CVUA 3CLHA 4XDHA 4DBLC 4RORA 4ZCTA 2XT6A 3OOEA 1L6IA 5JCOA 1QM5A 1NMZA 3RYIA 1JXQA 3L6DA 5EMLA 3U4QA 1H8EA 3DZHA 5EQJB 4EDHA 4BQFA 2NT3A 3PJGA 1USUA 5JWOA 1DJMA 2F48A 3LLCA 4IHKA 4GICA 1P91A 2IYRA 4Z9FA 1D1SA 1UC8A 2O7QA 2HOQA 3AUYA 3B36A 4MHSA 5DPMA 5IBQA 4IWXA 3C3CA 1VXRA 3OBBA 3ETDA 1R7RA 1TQ2A 4X1YB 1PWEA 1R4NA 1RBMA 5FQNA 3L6EA 5E6UB 4TKUA 3S68A 1U02A 1CY8A 3SXPA 4ED9A 5D3QA 5AKEA 4URXR 3IUMA 4ZO7A 5E95A 2A7XA 4EUEA 2QQFA 1V8ZA 4PC3A 2ZXUA 1ZMOA 4R0NA 3TECE 3EMDA 1C8BA 5BOSA 3LT1A 4WOCA 5G0VA 5HQJA 2O14A 4FSXA 4DMMA 5BYAA 5DSXA 3UWMA 4GM4A 2LGJA 1PNOA 3SSAA 5JJKA 3JZAA 1RWMA 2O23A 5C2JB 2O54A 1BHJA 1RYBA 3NVKI 5JYEA 4IJKA 1D4ZA 1GUYA 4HH0A 1GPBA 1Z0DA 2Q9BA 1SVNA 3JVVA 3QK7A 4HMOA 4MRMB 5I4CA 1H1LB 1O9HA 1PLKA 3BK1A 3FVVA 2H4JA 4WOBA 4WKBA 1TAGA 2EU8A 5F52A 1ZD3A 3OX2A 5FD8A 4ZVLA 3NNNA 3W79A 1SUBA 2QZ9A 4QAQA 1R6VA 1DC6A 3DWEX 2WHRA 3E9CA 4US1R 3J7TA 1LC3A 1OCEA 2FR8A 5T67A 3KKEA 3X2EA 2BBWA 1Q0UA 3NUQA 1W0KA 3EAQA 4BBAA 1B8VA 3T0FA 4GPD1 1HTTA 2YKGA 3NJ4A 2RI6A 1GPDG 2Q9AA 3Q2OA 5ALOA 3TQIA 2C8VA 2NM0A 3DDHA 1FNNA 5ALGA 1S0UA 5AJHA 3RB8A 1QRUA 2JC3A 3PUHA 3QMPA 4Z3OA 1UMDA 3BA1A 4MAFA 2VNKA 5K3CA 2VSFA 3JU3A 3MHPA 4MVXA 4BNUA 5AVRA 2C78A 3QHPA 1XL0A 3EFOA 4EF4A 3AIOA 1GU1A 1L8QA 1YQDA 5GZ1A 1WVGA 2AC7A 1J5EB 2CHQA 1EXMA 4BXOB 5F12A 4ARZA 5CRIA 3MWDB 4ENWA 1M6EX 1NW5A 1GQOA 2IYTA 2O50A 2WR8A 3BE8A 4M7PA 4TLAA 3UY4A 3HYSA 1BU8A 2GCIA 5JQWA 4PFKA 4BNNA 1A9XA 3NM6B 1U8EA 2YN2A 5HZKA 2QLNA 1WB4A 5JW6A 3DT9A 1Z06A 1ETHA 4P5PA 1G9SA 4OHBA 4FUTA 4RV9A 1XPOA 3GRZA 2J6BA 1MB0A 4X97A 3UOWA 1M33A 4JVLA 3ZLVA 1U9ZA 1T5TA 1ZQ1A 3K05A 4YFVA 3MT0A 3VTFA 5C1DA 4WK0B 3QVGB 4I4TF 4F86A 3VHXA 4MW2A 3FHLA 2DU8A 1DAGA 3FYHA 3MCZA 3ZHXA 1P1BA 2NSHA 4YV1A 2GNAA 2NSYA 2CLOB 2GLTA 1QVZA 1R4MA 3N2NA 5B7NA 3ZX5A 3H5RA 2D5IA 2ET6A 1FFXB 4YUAA 4MUKA 1E1YA 2R44A 5FAXA 5GMOA 1JEJA 3O92A 2ZYTX 1RZRD 3GVXA 2YZNA 5LM3A 1K1EA 1Q0PA 1AM4D 3U7QA 4BECA 3KO8A 4RJTA 2ZSKA 3W2IA 5KWSA 2YYSA 5LDHA 3W2EA 2XLCA 5BV2P 4FZ3A 2W11A 1ZGZA 4I4TA 2Q27A 2X0KA 2YHAA 4OOFA 2BH2A 5FCDA 3VNRA 1RXYA 4FILA 5EXSA 1BZYA 1C0EA 2VAVA 3PC6A 3THXB 3PHIA 1T8UA 2JFVA 3COPA 3T7RA 3SD7A 4DCTA 4EJSC 1EK5A 2R8OA 3NEYA 2CNWD 3R20A 3U1TA 1TD1A 4MA5A 4CMGA 4QBIA 3PA6A 2YIVX 2QZZA 3HR4A 2B82A 4QL3A 1GWNA 2GCEA 4ZZIA 3CEPB 4R41A 2CXSA 5E0KB 4C88A 1EHCA 1G3IA 1GNTA 2W2KA 1EFPB 3WFZA 1CUBA 3DLPX 3NDJA 4GXTA 3O84A 2HCJB 4MW7A 2Q3LA 4NCIA 2ZJ2A 4CEIA 1X74A 4LE1A 3ND7A 5BWNA 5BVGB 4OQZA 2WC1A 3OPNA 5H5JA 2NUAB 3OF5A 4YS6A 3AXSA 4N0DA 3EOZA 1VSUA 1CRWG 4MIEA 2YXLA 5KHOC 2IU4A 5CH8A 1U1IA 3ENKA 4X41A 3BGWA 3O8LA 5CITA 2DH5A 2VDWA 1L9XA 4GWLA 4IAOA 5K0TA 1EFVA 3SBOA 3OFNA 3AEKA 4RLSA 3T9DA 5I5EA 2OYSA 4J7CA 2H4ZA 1T3GA 3N2KB 4MVJI 4EFDA 1PFVA 2HRBA 1PD1A 1DQRA 2NTVA 4ZCPA 4Z3DA 2RK3A 1RYYA 4KKVA 4AF7A 4N3AA 1V8DA 3CWCA 1S4MA 3HUTA 5B2FA 1KAEA 2WMDA 2DBZA 2QXYA 4TTRA 4QFBA 4YRLA 1TZBA 3PGA1 2B1RA 2ZP1A 3ELBA 1NUAA 4Q7KA 5CT5A 1VE5A 1MORA 2Z8YM 2PXHA 3W1VA 2J9YB 3PEFA 4X71A 1IAVA 2ZSDA 1NMYA 2A78A 1FDTA 2OFWA 1U0EA 4A26A 1VC2A 5TGZA 4KO4S 4BNTA 3AF2A 4CR7A 2XI4A 6CHYA 2QMOA 3DHVA 2F90A 3F5QA 1GGJA 2F3SA 3NTRA 3A6DA 1E9CA 4GE0A 4O5AA 1RIIA 2ZIUB 4KUHA 1T0UA 2O57A 2Q5QA 3BCRA 3BN3A 2E89A 4WXHA 4A8JC 1ZRHA 4FNOA 5B30A 1L5YA 2XCLA 4M60A 5SY9A 2XCRB 1CYDA 1VL0A 2CXXA 2JFOA 4KFUA 4MH0R 4YASA 5AOBA 4A2QA 4CODB 1NIJA 3VZQA 4FSHA 1P9NA 4F96A 5JNVA 4JZKA 3CFYA 4NBRA 4KQCA 2WIFA 4D0LB 2H92A 4R5HA 2MR6A 1ESDA 1SOUA 3D81A 4JGIA 4YXFA 4DLWA 1E6UA 3COJA 3DZDA 5IAGA 1ODIA 3WIOA 3A1NA 4F93B 1BCSB 3DB2A 4CQJA 1GTVA 3VGJA 2WM9B 4BGUA 1E3IA 2OUIA 2PKYX 2H4FA 2GN2A 3KTAA 5HZGA 2I2FA 1G8YA 4RPIA 2OZLB 2FOXA 3AKYA 3RTAA 1Y48E 2IOYA 4YCAA 1H42A 3V2GA 3DV2A 4YAOA 3DD5A 2BZ0A 2FEPA 3Q3EA 4OY3A 5AW9A 1YRHA 2RGCA 1HDOA 1U2RA 4OB6A 2B4KA 3ZN2A 5ARDA 4DS3A 1BXGB 3IELA 2AB0A 3EN0A 4OHFA 2PAAA 2YV4A 4AMBA 4F92B 1P2SA 2A94A 4YY3B 2A3NA 3GGSA 4JD5A 3WQHA 4D92A 3RW9A 4CN9A 1I2BA 3GUVA 3QSGA 5GJBA 2BUBA 2WT4A 4BV8A 2W8BB 3FF1A 1HUQA 3QX8A 1R0RE 2OZKA 2SHKA 1S9DA 4LN1A 4MUIA 4OP2A 3OMXA 5LQNA 1ZEMA 2BD0A 5E3IA 5JR3A 3KHSA 2R1TA 2X0EA 4V38A 3ZV4A 1E4EB 3QVTA 5HK8A 2RI1A 5DVZA 2C07A 1QCYA 2AMVA 2HQ1A 2J59A 1RHRA 1KI9A 1PFQA 1ZD8A 2A5JA 4LHSA 5JDCA 2JLQA 3VKWA 1KJZA 3PTAA 4H1WA 5KREA 4LY0A 4Y7CA 5U4QA 4K5QA 3I37X 4IV0A 4PNEA 4AO7A 4RX1A 3WDKA 4Z5XA 2R86A 2QMZA 1Y8AA 3NHFA 4O3FA 5AM1A 5GJVC 3EFBA 5CT4A 2E5FA 3NDPA 1U9IA 1E9RA 1XXHB 2C7BA 2XWJI 4KVFA 2FEXA 4ZO9A 3QEAZ 4JA0A 1RW4A 1CS0A 1RWKA 2C5HA 3JYPA 4Q37A 4AJIA 2ZJBA 4IDOA 4KXMA 4QG7A 1XD2A 4U4AA 4UBLA 1F51E 4WCDA 5T4HA 1NTOA 3RIYA 1FFSA 3U60B 1H3EA 4JLOA 4MTLA 2QL6A 1JJAA 4NDAA 4KQKA 3RFTA 1UOOA 2ZTUA 3RK4A 3TZBA 2DKOA 1JKMA 1UBCA 5A4JA 4Q3NA 1MO4A 4OQYA 1OHHA 2R11A 3KS9A 3DFMA 2V54A 3BG5A 2X4LA 4DIDA 1GNVA 5ARCA 5HJ2A 5BSWA 2WU3A 2BEVA 4Y0NA 2CFOA 5CDYA 2VAWA 1XMQB 4DQLA 4GOJA 2VKQA 3OZ7A 1E3TA 3QPVA 3QYFA 4R8KA 5H3CA 5FORA 1RBYA 5F1OA 2C77A 1G17A 3VR5D 3ZWVA 3ZU2A 4CM3A 4YRAA 2ZBGA 4TYPA 4WJKB 2DP4E 1L5RA 4Y1EA 3SZLA 2J45A 4AJEA 2VHUA 5E4YA 4L07A 1TGYA 1XTIA 3MK31 3OQJA 4ARAA 3QBJA 1OMOA 4I1UA 3B82A 3GRAA 4DARA 3TIXB 2W6CX 4NCBA 4LJ5A 1Y3DE 1WAMA 4ITUA 1UUFA 5EERA 3OQOA 4UCXA 2AG6A 2J3JA 1M1UA 3FVTA 4Q9JA 2MTBA 2ASVA 2XY4A 3KWJA 3OT5A 1GGKA 4IYRA 4YP1A 4RFSB 5LBTA 1JDBC 3VH3A 5CDUA 4PWZA 4A8JB 1N2GA 3CY6A 4ZOEA 4EHAA 1U63A 4QPCA 2CMKA 4DCGA 3CZ9A 2IH4A 1BE6A 2WZQA 3G5MA 1OF1A 1BQ3A 1J90A 1TCAA 2X8WA 3N05A 4JOSA 4L8WB 4B71A 4DA0A 4QWWA 3WV5A 1GQFA 4O2LA 4B3BA 2FK8A 1U2PA 1R27A 2IUFA 3NHJA 4GO1A 5C8YB 1WXXA 4IDCA 4OUKX 3LRPA 4IIYA 5JXJA 7ADHA 1Z4OA 3IVXA 3Q7IA 2DR2A 2O3JA 4FR2A 5AVOA 4MQEB 1NXWA 3TX2A 3BA6A 3QFFA 4NC9A 1P5JA 3MPOA 3Q3JB 2WT9A 2WDPA 4X1IB 4X6UA 1A7AA 1OFTA 3DOHA 1LV8A 3IAEA 3OX4A 2JIDA 3F3MA 3EXFA 4KAXA 1Z5OA 1B0UA 3QQ5A 4C4TA 1HE8B 4GPBA 5TQVA 1KU0A 5L3RA 2HW8A 1O94D 3VKFA 3CT6A 3HKCA 1YULA 4AY6A 2BMWA 4QREA 3PQCA 5JMWA 4KJXA 3HEBA 3VV3A 2QUZA 3WGVA 3YASA 1NA5A 6REQB 1ECBA 1C7IA 4X66B 1KVUA 4D3YA 1W1UA 2X8JA 3FOEC 2IV3A 1MB9A 3ENQA 1M7GA 4YH1A 4D81A 1UPBA 3KE8A 4DM4A 1MENA 4O4IF 4F4JA 1J9ZA 4UPEA 2DEUA 4BC0A 2IOFK 4JKYA 1HXHA 1HFEL 1ZN7A 2EV9A 2BGNA 3LPMA 2C2HA 1PYOA 2ZT6A 3PR3A 3NYIA 4RLHA 1RJFA 3BQMB 4U9UA 3R75A 5HJ7A 3L0IB 2XNCA 2DJ5A 3CQ9A 3CZ5A 3REOA 2HL6A 3DE1X 3HB4X 3PEYA 1QQ7A 2WSIA 1Y8QA 4JJGA 4QYIA 4ZJPA 4DXHA 3RBVA 5I4BA 1OSNA 1I10A 3F47A 3ZE7A 4JMLA 3NHYA 4B3IA 2VVTA 3DCYA 3E8MA 4OGWA 1O95A 4JFAA 4MAMA 4ZRDA 4DLKA 1EIWA 1QRRA 1XX6A 4HO1X 1TIPA 1B0PA 3IUEA 4ZMSA 3WBKA 1DBQA 1QJCA 4FFBB 4OHWA 1Z08A 4O4IA 4OIMA 1EZ4A 1FW8A 2WUFA 3K30A 3TZKA 3W6PA 1YJBA 2FSHA 3SBDA 5AK5A 5GADl 3VO2A 5IT4A 3ZJ5A 1RAFA 2ISQA 2QTHA 3LPLA 2DHCA 2Q4OA 4D4HA 3ZS8A 5CCBA 3T94A 3A36A 1SG0A 4K9SA 3KWFA 5JHHB 4R98A 1B73A 3FPSA 3GRUA 4ANFA 3MRVA 4DUGD 4LHEA 4EA8A 1KYQA 4MUJA 1XCLA 1ZVVA 1P6UA 2ZJYA 1PWZA 4F8JA 3VYVA 1J1UA 4EYOA 2QRVB 3M5WA 1MHPA 3P97A 1N75A 4R1NA 5IH3A 1YBAA 5JJCA 3ORFA 2WJGA 3IV9A 4DUZB 2IYYA 4TTTS 2R4UA 3CG4A 2OGTA 5JFOA 3M3PA 1KE1A 1XMSA 1IATA 1K4MA 2QPAA 3E8SA 4IX1A 2B20A 4R54A 4AJ2A 2I3ZA 1VLLA 3QU2A 4CM8B 4XVQA 1XRNA 5COBA 1CJMA 1F0PA 1FX1A 1KEEB 1RMYA 2BR3A 3EA5A 3KALA 4B4OA 4ER5A 4G9EA 2C4HA 3KVYA 1BQEA 1F2DA 1KSJA 3BXZA 3GZNB 5A9RA 3BHNA 1Q57A 8OHMA 1HYGA 4MO2A 3VPSA 4Q7QA 1PGOA 3KETA 1MW8X 1MRNA 3K0HA 3KIPA 2QU7A 4AX4A 1V6CA 2AOUA 2P1RA 3ZQUA 2YZGA 1NRJB 1AA6A 1GCIA 1JZSA 2J3KA 1SFRA 2R00C 2AR9A 2WJVA 2FR1A 2ZAYA 3E9NA 3G88A 4IIUA 4JL5A 3CUWA 3FH0A 4UUOA 4B6GA 1TYCA 3FBGA 3R7FA 4YAKA 4MO9A 1GDHA 1NF9A 1FS5A 5JNUA 1QLJA 3ELWA 1KMNA 1LJUA 4QRDA 3V6LA 2R62A 1JJVA 4D0NA 4WBSA 1DEOA 4RTSA 1TU3A 4LVCA 1SJ9A 4KQMA 2J9RA 1Y6FA 3QNUA 1EIZA 1NXQA 1X7ZB 2MHCA 2GS9A 4U00A 4A73A 1EMDA 1U0NA 1ULHA 1XCOA 2QUAA 2OECA 4L9RA 4EA7A 2B7LA 2RBKA 2MSCB 4CQLA 3VU9A 5G4KB 5ES4B 1VGQA 4FMDB 4EMTA 2GD2A 4HQNA 3SFTA 2HA5A 3S2IA 4F7DA 1JXOA 3HFRA 1DHRA 4NLLA 1T13A 5IMBA 3GCDA 2OYRA 1CQJA 1P3JA 5KOHB 3ESBA 3CHYA 4YAFA 1ZESA 1PS8A 3EC7A 1V5FA 3AVPA 3KOXA 3LOPA 4NEGA 4Y9SA 4RD4A 1X0VA 1AUOA 2GN6A 3A6LA 5SYAA 3IXLA 2IYPA 1E7QA 1QIIA 3C3EA 5FDFA 1OWNA 1JHPA 1ABFA 1RQXA 1VMAA 3Q7EA 3MS4A 4GSKA 4IZHA 4JA2A 4QYSA 5DT9A 4YXWA 3T0IA 4AJ1A 5AVSA 2RK6A 1A98A 1H9BA 3S2YA 2CT8A 4MHTA 1AD2A 3P2IA 4DILA 3A4VA 1BIFA 3EJ6A 3VR6H 1SUWA 2REBA 3IPLA 3H11B 2ZCUA 3PX2A 1XRMA 5T6MA 4QHTA 1L5HA 4BX3A 1FVFA 3UJNA 2B34A 3WYBA 4PSDA 4E5UA 1WSBA 2O7RA 3AO0B 4PLZA 2HNAA 1WNTA 4R6XA 4I4CA 4TTIA 4UVIA 2B78A 3WAGA 1DWQA 3M9LA 3EVZA 4L57A 3UFBA 2ZXEA 3HWRA 1CIJA 2P5UA 3A6HA 4H3HB 1UPXA 4LXYA 4MS1A 4D96A 1EFAA 2WILA 1UP6A 1VBFA 1OKKA 4J1TA 4AQ7A 3CF4G 5ITSA 1PDVA 4OI0A 2FPWA 4AIRA 4XVRA 1GCUA 5TMPA 3F3SA 4K6HA 4W5RA 1NVKA 2W6ZA 3MILA 4AJNA 4AUMA 1EJBA 1B8OA 2BM8A 1L1FA 4CU2A 2ZBDA 1HFJA 1DFHA 3D8BA 4UE6A 1G64A 4YV7A 4GR9A 2ZQYA 2AZDA 3IQIX 1DRWA 5AKLA 3Q7TA 1X94A 2PZBA 1NMXA 3HGQA 2PX0A 1XLVA 1XCMA 4U7WA 1R74A 1E58A 3A9WA 3C3PA 4V0RA 2VATA 1E6MA 2YC2C 3A2MA 4GI1A 2PA0A 4CLHA 4LHVA 1K6XA 1PQ4A 2WAMA 1I3OA 3CVJA 3VPXA 4LKOA 3PXCX 4GGOA 2P9EA 1HEYA 3R6TA 1RXIA 1FNDA 5CB8A 5KCZA 4QM6A 1T1RA 1CE8B 3Q7SA 2OORA 3U4DA 1Z4PX 2EVWX 3E8XA 3EDCA 4PYKA 1ZW1A 1G6OA 4GGPA 1SCAA 2XVAA 1CZKA 2QTZA 1NBHA 1IB6A 4QOJA 3RAFC 3NUZA 3LWZA 3QH4A 4UHDA 3WHLA 4W7IA 1JBKA 1XDGA 2HAEA 1P2TA 3QPAA 1L8XA 4UFOA 5BO5A 2P75A 3ZZNA 4NONA 1PR5A 4LQ4A 2IKQA 1VJRA 2AJBA 4KN5A 4YCJA 3UVEA 3VU3A 4ENSA 1MX1A 3EARA 1QS0A 3ZU4A 3O8CA 1TU4A 2X9NA 1QX3A 1CZNA 4E70A 1FVOA 1AS3A 3I6IA 4JOCA 4MGYR 4YDHB 3WGMA 1DQZA 1ZUD1 3IUBA 4EMUA 4F3KA 1WHTB 5D5HA 4B83A 5KOIA 3FPKA 3S3TA 3PVSA 3E7FA 3IDQA 4Q18A 5TQ2B 5JS6A 3SGLA 5TT0A 4BVKA 2VNIA 2C1ZA 3K9QO 5AIBA 2OUKA 2XEDA 3L1KA 5FOXA 1E5DA 2Z5VA 1U31A 3EVTA 3NNSA 3WIEA 2CJPA 3P0EA 2WWRA 2Q5OA 4JHXA 1RAAA 5AKIA 1UP4A 4V2UA 4IICA 5I5GA 2RHGB 2PXXA 1ISIA 2WLSA 2JDIA 4AUEA 4CKBA 1XQYA 2BRUA 1JFFB 2VNHA 5JZSA 3CVXA 2XR1A 2FW1A 1JS1X 1C9MA 4CCYB 2O0JA 3C8UA 4IDBA 4I50B 2FFAA 4M6WB 2FUKA 1QNFA 3ABZA 4I1YA 3AI1A 5D3MA 1UDCA 5CBKA 1XZNA 1E66A 4LIPD 4DVGA 1E7SA 3SQNA 1N1DA 4MWOA 2VBGA 3LW7A 3O95A 4NAHA 1NVWQ 4U63A 2C2BA 3BFPA 3F8SA 3HR7A 5EKXA 2BWJA 1NLZA 3PGJA 1TVEA 1V9SA 4G0QA 4AB1A 4NH0A 3GMTA 4PFQA 1JQBA 1VJTA 2PMCA 5TDHA 4L28A 1KI2A 1JR2A 4N4AA 2A67A 5KKAA 2JIMA 5BMVB 1L5OA 2O59A 4F1JA 4EVIA 4X1YA 9GPBA 5GINE 5DNVA 2BGIA 2WT8A 1LBEA 4QOEA 5E6UA 3GNQA 1YMUA 4YMWA 3PQ4A 3TMKA 1DKRA 3TNDA 3MMPA 4B9AA 1C7FA 3R7AA 5KQSA 4D9GA 3CR3C 4DJ5X 4Q4CA 3IBCA 2IL1A 3DJFA 2AR7A 3ELDA 2PRSA 3OQPA 2CVFA 2VDUE 1Y5IA 1PVOA 2XGOA 2YX1A 5F5NA 3WGLA 4HC4A 1WDTA 5FXMA 2G63A 3UMJA 3KOYA 1KJIA 2ARKA 1WZCA 1BU5A 2A58A 1Q3TA 2PFKA 1C3EA 4KN8A 3RS7A 3HDJA 1H1LA 1X1SA 1U1CA 4YI5A 3LT0A 2WHPA 3UUEA 1UPFA 2OXIA 5MDHA 5IKXA 2HYIC 1MN6A 4NG4A 4LZLA 4RC9A 3KJXA 3H2HA 4ZZ0A 3HRIA 3PEWA 1I7SB 3JPYA 3L8ZA 2OO3A 3KQLA 3FTFA 2MYUA 4K2AA 3I8OA 3R76A 4A5SA 1CUJA 1SHJA 1TC2A 4OFZA 2I78A 3K9FC 2BTQB 4ZQFA 1NONA 1VYHA 3U3ZA 4G37A 3V4PB 2GT1A 5BSVA 2M1ZA 3U3RA 4KQFA 4JJ8A 4KIWA 2J41A 5KAPA 2GCOB 4RL4A 4ZCIA 4ND5A 2V03A 2ATEA 2JCYA 2WNSA 3CPHA 3FTCA 5EI5A 3S29A 5I45A 4JXZA 5F7ZA 1G7RA 5IN5A 2V3VA 4W1RA 4DDTA 1UZMA 3CF6R 2D4AA 4CIBA 4DV6B 3E5HA 2O6HA 4U2DA 1ECLA 2PGNA 3W3AH 2WZCA 2BFWA 1I5RA 3RYHA 1B6SA 3E03A 5LMZA 1P4HA 2PLWA 1YL6A 1U1FA 2C95A 1EP3B 4ZKEA 3L92A 4C4RA 3JYLA 4NU6A 3W1WA 5I9IA 3WYFA 4KQIA 1NLFA 1ZJJA 2C9BA 2EJWA 3L1HA 3QVGA 4G1MB 4M9UA 2A9FA 4FFWA 3DBLB 2P5TB 4FJ0A 2WF7A 3K9BA 3H16A 3DVLA 1OU0A 1J70A 1XZKA 4HLCA 4JKIA 5FLYA 3K2BA 5EXTA 1RLTA 1Y9DA 2EP7A 2WKPA 1KA9H 3DYBA 3FUCA 3UPTA 3KQKA 3BD8A 4BQPA 4YNBA 2Y71A 4QU0A 3LDGA 1EAMA 1N9KA 1GQYA 1CR2A 1FSZA 4Y98A 3RYFB 1FFXA 1U1EA 2JCVA 2NWQA 5KPJA 5FUQA 1NVDA 1EM6A 2KHZA 3K1TA 4US2R 4E13A 1Z0UA 2C57A 2JGKA 3DDNA 3VU1A 4HP8A 1KY4A 5A05A 1FEZA 3LBAA 2JI9A 2OFPA 2P30A 4MICA 3U62A 4IFEA 2GRUA 4V02A 4EAAA 5I7FA 5K09A 2UAGA 5ALUA 2WFZA 4DZRA 4JP1A 2I6FA 4CT0A 4F3CA 4JSRA 2VLIA 1QV6A 3SJZA 3G17A 3H6KA 3ZQ4A 1T24A 2H51A 1KFJB 3OCWA 1YZVA 1NP7A 4QT0A 1ABEA 3QWBA 4X7BA 4AKTA 2YZ2A 2V7TA 3THXA 2WJHA 4CXMA 3P1JA 1XRPA 1TT5B 1NBME 2WP8J 1IY9A 3G13A 3WWDA 5BUZA 2Y2UA 2XQJA 2C8LA 3QVUA 2FZKA 3ABSB 3N76A 3LDAA 4H1VA 2E1PA 4MWDA 4U5QA 4AUKA 3RADC 3WYDA 1EFPA 1Z5UA 3ADBA 3EVAA 3I39X 5JYCA 3IEMA 3SLKA 5EL0A 1QWSA 2C0PA 5BVGA 4IKEA 5GY7A 1T4BA 2NUAA 3C8DA 1OFHA 4HDCA 3K7EA 3K72B 1O9GA 1R9JA 4O6VA 2HZBA 3IULA 4UDXX 5FRDA 2IP2A 4XD7D 1H4SA 1X8XA 2WF9A 3ONDA 3I42A 3PUYA 4XYGA 3GCXA 3H4VA 4AP6A 4JJ7A 2BMVA 5B3AA 2XE4A 1XYYA 1E4OA 2IUEA 1GJRA 3G79A 3W8NA 5B4VA 1O96A 3FBWA 4I7EA 3X2SA 3FOCA 3ICQB 1W4LA 4RD6A 1NI5A 3DWFA 5BNZA 1ZKMA 1AZSC 3FIJA 3O73A 3GFSA 3O75A 3RDPA 2Q41A 1I1HA 2XITA 2CMGA 3STTA 1PV4A 1PNRA 3WL5A 3HUEA 4KOEC 2HMTA 1YZHA 1IY1A 2PUEA 1IQRA 3TS1A 2F17A 3GP3A 3C70A 3OQBA 4LJ8A 7REQB 3TZ6A 2C03A 4HUQB 1Z47A 4P0TA 3V4VB 1PFUA 3U4HA 1NW4A 4EFMA 3TLKA 4K8OA 5FR1A 1RM3A 1OFGA 3LCMA 1DWPA 4B76A 2VQEB 1TW2A 1BJRE 3MS7A 3GIDA 1SKUA 4CI9A 4QECA 4KE7A 2VDNB 2IK8A 4YTEA 2QW8A 1O5TA 1DRUA 2CFCA 3SE0A 1VPWA 1T8RA 3EZ9A 3QU9A 1L7BA 1ZO8A 3AKDA 4L3WA 1OD6A 4P98A 5EEGA 3H42B 3RUFA 5CXUA 4LX0A 1N8NA 2D06A 3L8CA 4J3JA 4MKIA 1AGRA 3C16C 2WJAA 1Z4IA 3OICA 4QA9A 1V8PA 5FFMA 3TXXA 1U8FO 3D1JA 3WLOA 1VHWA 2X0JA 1DRVA 2IPOA 4BNXA 1NQUA 1IBRA 3LYAA 3WKCA 4AS3A 3S7ZA 3GJTA 1TKCA 4ZT2A 3NP7A 4D4GA 3BMOB 4R71A 3L1IA 4D2IA 2W2VA 1BCSA 3L7JA 3A9RA 1UXGA 3O8DA 4FHDA 1KDRA 3U48A 4AMGA 5JANA 1SBZA 5C8XA 3E7XA 4CQNA 2ZSUA 2CYAA 4LXXA 5LA6F 2OZLA 1H5UA 2FN7A 2VSXA 4F4FA 4OOEA 1OBVA 2AKAB 8ABPA 1R1DA 4INPA 4OVKA 4PYNA 4DANA 1HDCA 5DN6A 5JNWA 4NQZA 5IUNC 4QGGA 1MABA 2PMFA 5LLSA 1NF3A 1RMTA 2OZPA 2WIDA 2Z8ZA 2H5IA 2N0SA 3CRRA 3WWYA 5A4KA 1GP2A 1OTXA 3L1UA 2XKKA 3FDZB 4L95C 4RD2A 2F43A 2MSWA 3C74A 3TLAA 1QV9A 4YRFA 3K09C 5E6SB 5AM2A 1TC1A 3AB8A 2ONJA 1K3TA 2YWFA 4C01A 3G8AA 2W8BA 1ZI6A 2CB9A 4XVUA 4IZIA 3Q3VA 5CFQA 1YU6A 4OHYA 2ZE6A 2F64A 3T54A 1YL7A 4M1KA 2A0FA 3MCVA 5JPDA 5BN5B 3ESYA 1E4EA 4BKUA 4BMNA 3QNWA 2XUDA 5LA6A 2EFGA 2QRKA 4RNDB 1XEXB 3B7WA 1CK4A 4G97A 5IW8A 3RC7A 3THWB 2MT9A 4OLBA 4P8RA 1HDZA 4Y7DA 2EW8A 3P26A 4O1HA 3ANLA 3C97A 1NG9A 1TUBB 1PFYA 4L4ZA 2ZYIA 1S8OA 1O94C 4FC7A 2PBFA 1P1IA 5KJEA 4EJSA 4N39A 3H65A 1KU6A 5A6VA 2VHYA 4A03A 1XXHA 1UPCA 3PPVA 1JDNA 2NO7A 1DAMA 2H1VA 1P0FA 1SXIA 4MKHA 4RVUA 2IX3A 2ODTX 3PD7A 2OA0A 1NLMA 3GLFB 1EAYA 5JCJA 1HTBA 3AQIA 1NL3A 2M6LA 4ZGGA 4TN5A 4BEWA 1U3CA 1YQGA 3Q6NA 3ZQ6A 4KZPA 4WK2B 4EW2A 3ONVA 5FHRA 5JO9A 2B2NA 3F2VA 2Q49A 3F71A 4EG8A 2M32A 221PA 4KR3A 1NMEA 3KQUA 3GF4A 4LDJA 5DMHA 1MZPA 5KU1A 1T36B 2GUGA 4KV7A 3V7FA 5K05A 1JECA 1QX4A 1D2HA 3EDQA 3FVRA 3TM4A 2O8EB 1KGDA 1TM4E 4GYKA 1OYYA 4QOFA 1YR8A 4RMIA 4DWVA 4DEYA 1U2EA 4KDFA 2HM7A 4OJTA 3LVQE 1YACA 2DCUA 3CLKA 3MF4A 4MTCA 5DM1A 4OI1A 3SS9X 3NBYC 1XMOB 4LNUA 2G6BA 5ESDA 3D0KA 4JQSA 2TMDA 4KWTA 4G24A 2G07A 5DTRA 3NH6A 5C8YF 1CP2A 4FHEA 2OPHA 3NHLA 4M83A 4H17A 1VG1A 4DMUB 3R7LA 1G66A 1V5GA 4EK9A 5L3ZA 4GYWA 5FYDA 3ANSA 1JAIA 2HLNA 3S0JA 421PA 4F38A 4JEHA 4WTOA 4DMHA 2BZSA 4UARA 4KQ1A 1RJGA 3A32A 4L5IA 4RFSA 4JEMA 4QJBA 4A8JA 4ZJYA 5GM2A 1RWNA 1AB5A 1TTQB 1YDGA 1UBHS 3DQPA 3G2HA 2NZUG 2YWGA 3QIAA 4JITA 4NZ9A 4PYOA 4GUAA 5AUNB 1JHQA 3H0CA 1IPEA 1OPXA 1B41A 3EW7A 3EGCA 3AWIA 4LYAA 4UZFA 5C8YA 1YS2X 2XOKD 1ODTC 4PZEA 3IBTA 5FEMA 3ROXA 4DLZA 3AVUA 1UEXC 2IYSA 2J5RA 4MQEA 4F5YA 4IH4A 3T5AA 1JDVA 1NJSA 2XCIA 4X1IA 4GKAA 5KYWB 3LHSA 4YN3A 4B40A 1WP4A 2OZEA 1ZCAA 1XU4A 2IDZA 3F7MA 4HGQA 4JI7B 1TJ5A 3GZTB 4FZJA 2LDBA 4PQGA 4CKCB 1G8MA 1CUUA 4UZEA 3PUWA 4TMWA 5JWRA 1QC5B 4KNWA 5DT2A 5EJ5A 4LCEA 1WY7A 2WG2A 3T3DA 3GXOA 1V3TA 1U4SA 2G9VA 5B7PA 1I2AA 1K6EA 2AS0A 2DJIA 3NWBA 3AL0C 5ALDA 2AFVA 4D3XA 4TROA 3D1VA 4XUDA 1L5FA 3JQPA 1U2GC 5KQMA 5DI3B 1DXOA 3HBMA 3NQ41 3IT0A 3N9IA 1E2JA 2CLDX 1CDEA 3JSAA 3X43A 5TC4A 5TVKA 5LQMA 1M73E 1DCMA 3PFCA 3KZCA 1Z38A 5IF9A 1RI2A 2RGYA 2Q0HA 2FWAA 5CHYA 4ALKA 3QUBA 5TPWB 4ZAZA 3IUPA 4LXGA 1J4AA 3VX4A 2FFJA 1RXWA 1U2DC 3RM3A 4QD3A 1ZGCA 1A7KA 1UXJA 4ZV7A 1YD7A 1SEPA 5CURA 1QO0A 2R6FA 4FFBA 1XZQA 3C5CA 4J2OA 4X65B 4YRRA 4OHPA 4UFNA 3FPBA 1NI3A 4QDZA 1NDUA 1JR3D 1W35A 3L0SA 5DSZA 4EW3A 3SKXA 3DM5A 4UFPA 3OM1A 4XRGA 3H2YA 2PMWB 3OCYA 4PAGA 2ZRNA 3R5JA 5BORA 3I2FA 4YACA 3D5QA 3DL7A 4EW1A 4JUIA 5IDVA 3EUWA 3OZAA 4GRAA 5FTMA 2ZTSA 4Q1AA 5E38A 4B48A 4BVLA 1G4AE 1AF4A 2DBQA 3N28A 3P9IA 3P9PA 3WXMA 2AUNA 3WDLA 1H93A 2VRWA 4MDFA 1SIWA 5ADWA 1ZVQA 2P9HA 4LRUA 3LK6A 4OKIA 4YDRA 3LOUA 4F8EA 3IUJA 4N5IX 4TMZA 4B31A 2IP1A 4LDRA 2J9FB 1GKLA 3R9XA 1TFUA 2DERA 3N87A 4S1WA 4MKGA 3PTLA 2JGMA 4K6FA 3KTOA 2IUTA 2QBYB 5TGTA 2Y6VA 4CM8A 4J7UA 1AKRA 3C98A 4ILKA 4MWBA 1ST3A 3P9KA 5ITZB 3TTWA 3ILVA 1XAGA 1MFZA 3A6ZA 2I6TA 2H11A 1E1DA 2GJSA 1RQ2A 4Z99A 3ZTTA 1K3FA 1ZJYA 2JRCA 3CF4A 3E1SA 3EULA 3EA0A 1WCV1 4RFLA 4CIWA 2YWRA 1QYVA 3UT6A 2AZ4A 5GGYA 2JEOA 3MGBA 3B9BA 3F74A 1NVTA 4DKJA 1JL3A 1GPMA 2IYOA 2H59A 3A70A 1Z5NA 2JBWA 4FOLA 5FOUA 3W1EA 5AW5A 1NKTA 4CNQA 3U6KA 3C24A 2O8CA 3CTPA 4FMDF 4OB7A 2A3RA 1EHIA 3A1FA 4QIHA 2RGNC 4LSWA 4W63A 5GM1A 1NQVA 4LFCB 2FGJA 2R96A 5DYWA 4I46A 4ENUA 3KJQA 3V4OA 4PHGA 4Z7QB 3RT7A 2PL3A 1D3AA 1Y6JA 4UNRA 1ODLA 1YO6A 2QYTA 3AUAA 3KSDO 2WWIA 4C30A 8ADHA 1Y33E 3ULKA 2I9KA 4N0QA 1HQKA 3LYHA 1BS9A 4B82A 4IGKA 1CHNA 2FWRA 2Z58A 3RS5A 2FE4A 3W5CA 1MH9A 2BTEA 1RBQA 1SBYA 3BS4A 1BE1A 1DIBA 3EOBI 4AF6A 1T1SA 2IU6A 4GOLD 5BN3B 3RQSA 4L7QA 2VRCA 5IT5A 3TW8B 4M86A 2OXFA 2WKQA 4EF5A 2CV0A 2C3UA 3CGWA 2HHAA 2X58A 3G2PA 3L0OA 3VR5H 5CMLA 1GU7A 5HQ3A 2XOXA 5BN4B 4AMZA 3F7NA 4ENPA 5KOHA 2SICE 2IEGA 5ICMA 3QVJA 1SUFA 3IAXA 4QEZA 3O0TA 3K8ZA 1C7ZA 5C1IA 4YR9A 3UH0A 3HVJA 3DC2A 3VPCA 4IUYA 4CWAA 3TG8A 3QZUA 4TSFD 2ZYDA 5KTMA 4JU9A 1X7WB 3O2NA 5CUQA 3ZEIA 3ZIAD 6LDHA 2AD5A 4RTQA 4N3BA 3L8YA 3LX6A 4BRSA 1CXZA 1PK8A 3ZVRA 5FUBA 4N0MA 5DOVA 5HM6A 3OPXA 1KAOA 2OCBA 3CLRD 3BIFA 1ZKDA 4P53A 1MU0A 2TMKA 4Q3BA 4RW0A 5FI0B 3SX2A 4UOZA 3P9YA 2Y0PA 2QD5A 4K6OA 1WCXA 1YOBA 3IFSA 1JQDA 1N6NA 5EE3A 1Z3CA 4J0EA 1RABA 4CMJA 1JYSA 4H0FA 2BHLA 3PYLA 1T2AA 1OXBB 2Z83A 4DNOA 5JTUA 4N3CA 3GAMA 3OA0A 2CLLB 1BNCA 3G5TA 3LI2A 3FWNA 1UBTS 1E7MA 1GV0A 1SUDA 4XGKA 3RC2A 1YDHA 3TJZA 4H9GA 1SO8A 5CJ2A 2NSDA 2PQ2A 4R40A 4ZT3A 5H83A 2FRXA 2AUMA 2GJ4A 3O82A 4Z8XA 2P2NA 1SKYE 3A6JA 1MC5A 2II6A 3A1UA 3TUIC 4JHLA 2DPMA 2EWMA 2XOEA 2YVQA 3EODA 1XJ0A 1A72A 5LMUB 1ZWKA 2I33A 1Z4NA 2HBYA 5MN4A 1ZMRA 2H1WA 1SAYA 2R1VB 2C8KA 2VYVA 2Z2YA 4PLPA 2YMMA 3V3KA 5K0NA 2IWRA 4CKXA 5AVZA 1WZNA 3WYNA 1Q91A 1OAOC 3UPDA 4CVNA 5B4TA 4Q1BA 4I1PA 5HOEA 2CUNA 3AF4A 5AH0A 3WG9A 5GV8A 4YT4A 1TMKA 4HTFB 1I6KA 2X1HA 4RJ2A 2YV2A 2B4AA 5CLHA 1LK5A 5FV4A 3WGYA 1CE8A 1ONNA 2QX9A 3D4IA 4RYDA 1DSSG 1JIJA 1GXSB 4IIEA 2O5EA 1NOKA 2WUDA 3MD0A 1CY0A 2GAAA 2OK8A 2V7PA 2BP7B 1K92A 2ID9A 2W0SA 4R7GA 4Z9BA 5EIHA 5HUJA 2GXAA 3BXGA 2W43A 521PA 3THRA 4YRSA 5CDFE 1NYRA 1OXMA 1RP1A 2D0DA 1V2HE 1LDNA 2BV3A 3B3AA 3LBIA 4PX3A 3DO5A 2W0MA 1E2IA 2CXUA 3ENVA 2PHZA 4E2ZA 1TX4B 2DWCA 3BXHA 1QUEA 4ZOLF 3JD0A 3RVPA 2EHJA 1IHPA 3LUGA 3GW8A 3OIYA 4OSPA 1H0RA 5DWQA 2R00A 1P4SA 3OHSX 4MHOA 3B1XA 3D9QX 3JWGA 3F46A 1Y5NA 5TQ2A 2NPOA 4OBXA 1QYWA 3QBDA 2XMDA 1PEYA 4LFBB 4EG5A 4TN1A 4TWBA 3CEJA 2O8DA 1L4LA 1OXXK 4UDNA 3ZWKA 5TF0A 5K5EA 3W5AA 5AWFC 4NEHB 5HIAA 1HMPA 2HREA 4J3NA 5LB2A 5BMVF 1M2JA 4PCAA 1JFFA 3MTBA 3EYWA 1R6DA 2IC5A 2JGEA 4BTEA 4Z49A 4CCYA 1U0TA 4JOBA 1R37A 4JEIA 1KEPA 5CVCA 2JD0A 1TKBA 4FMCB 3ZZMA 4ZOLA 1PX2A 1VJDA 1JDZA 2WM8A 4M89A 1A27A 5A2QA 2IBMA 3Q8WA 1FU4A 3UHJA 3J81A 1XCPA 1GFSA 3R7WB 1Q11A 2AFHE 3DZCA 4LPKA 4LXIA 4RZ2A 5CTAA 4U2GA 3I2KA 5FTLA 1WUKS 4XH9B 2WAYA 3N75A 2Y68A 3OZDA 4FNGA 3VUFA 2X4DA 3SHVA 3T35A 3ZV5A 3F2IA 4RKYA 3ILSA 1T1IA 1W88B 4Z1MA 1OH6A 3ZD6A 2D6FA 5C7IO 4I8DA 3IJRA 3TOVA 2G5TA 3TFQA 5BQ3A 1J33A 4YDQA 4E5MA 1Z6QA 3DNFA 5BMVA 2AI1A 3MCWA 2AMYA 4Q5IA 4QGAA 2RHDA 1GYPA 1X70A 5HFAA 4ABTA 1IIRA 1FFGA 1H1DA 3H5TA 2DX7A 1GA4A 3RV4A 1P72A 5F2EA 3DOFA 4RKRA 4IDHA 4K3VA 1C8LA 1KOFA 3JQQA 3TR0A 3HR8A 3H2JA 2H2GA 4UHKA 4XIIA 4LDAA 5BV7A 3DOUA 2WKSA 3H9UA 3ZDZB 3F4BA 1BDHA 2JI8A 3G8BA 4XIGS 3ZHTA 1E2KA 3MT8A 4QYXA 2GZ1A 5EE0A 3JWJA 3PXGA 1FBTA 2I62A 2HK8A 1NUQA 3HFJA 3QEKA 5JXGA 1U99A 2YJTD 3P9ZA 2CJXA 4IOKA 1G59A 2R9VA 3L18A 5C5CA 5T64A 5H16A 1PGJA 3DDZX 2YNMD 1NF2A 4XTCS 3OSUA 4ETNA 2OC4A 1WD7A 1BVHA 5IM5A 1E94E 2H4HA 3K16A 3KE9A 4J0QA 4LCBA 4MRSA 4V0NA 2O7VA 4RGQA 3TOZA 4Y6PA 3BE4A 2BTQA 4NCXA 1VLQA 2CWDA 1M10A 2C8JA 1H4VB 1E2BA 1D7OA 3D6JA 4UCWA 3EBPA 1RRMA 2GCOA 1PT5A 1A76A 1HKHA 3VFDA 4U2BA 1EGQA 1WOMA 1XSEA 2HO5A 2X0IA 5J40A 3UV7A 3JATB 4WZAB 3BMQA 3I92A 3R3ZA 5AJYA 3AVYA 2XTJA 2AFIA 1AC5A 4G1CA 1L7RA 4X63A 1WZIA 4FDLA 1ZGJA 4KEAA 2P11A 5I3CA 4J0CA 3L79A 3ETNA 3QVSA 1K5PA 1B8UA 1UF9A 3FMIA 2WAAA 3RVNA 2JH9A 4XQEA 2BFAA 4LOIA 4Q24A 3BE5A 2B8NA 4PLHA 2GK3A 3QSYA 1C9NA 3HVIA 1M2FA 3A58B 3KAJA 4PC2A 3V1UA 2XUAA 2Q9CA 1RE1A 3TE6A 2JAOA 4DA8A 4EY5A 4YFYA 3BDAA 3FLMA 1E9DA 4K8RB 3NASA 5HDBB 4AVYA 2GARA 1GFWA 5C0OE 4CV2A 1EFDN 2OXRA 3WHPA 2HTEA 4NBSA 2YHIB 1GUBA 4P7KA 3GU3A 4WNCA 1VQ1A 1Z45A 1KJYA 1TKRA 3KUCA 5I48A 1N5MA 4IXNA 1JMKC 2R8PA 3BWEA 2A0UA 3DCNA 1BC5A 2IS2A 3MJSA 4LI3X 5BXYA 4G1EB 1UEIA 2PT7A 5FBZA 2CXHA 4XLTA 3PNOA 2VQ6A 1G1MA 3OJOA 4UUAA 1L5LA 3RVDA 3VMMA 3WSTA 1WHSB 2EKPA 1B0AA 4YAEA 4UTPA 3W6ZA 5HZMA 1YA6A 1NNUA 1U1DA 2ESRA 4RTPA 3X1JA 3QPDA 4ARIA 4JT4A 4K7JA 3TM5A 1JAYA 1FDWA 3IX7A 4IJQA 1YB6A 3C3XA 3IOEA 4R9VA 1QR6A 1ES9A 1MPTA 2VPYA 4JOQA 1WVIA 5CJPA 2ZLBA 2ZR7A 4IDQA 3B89A 2NUTA 1SZJG 4EI8A 1TT5A 1A8UA 1GO2A 3WRVA 2ZRBA 3BL6A 5IXSA 4Z6KA 2FPSA 3AOEC 1GUFA 5LMNB 2BMFA 1UK7A 3FRJA 3I9KA 3PHJA 1MH1A 2HFKA 1KQPA 4EUHA 1X0XA 2A5FA 2VT6A 2XUKA 1D0SA 1U3UA 3OY2A 1SA0B 4BLTA 1DCKA 1RZRA 4DNFA 5FTJA 3OLYA 3WLRA 4G09A 4ZALA 1P4AA 3DMYA 5AHRA 1XDWA 5HW0A 4QUDA 4RTMA 2CLHB 2IPLA 3WO0A 2GFHA 1WUIS 3DBRB 1JHZA 3DEIA 5DLQC 5IXJA 5CD1A 3MHTA 1J8FA 2I3GA 3EXAA 3AETB 4ZHQB 1V96A 2OCXA 3BL8A 4ILEA 5DCLA 5AFSA 1F14A 2YYZA 1T6BY 3ZY2A 1LFDB 1RXCA 1E3QA 4FZVA 3B6MA 4PBSA 5EWLB 2FDCA 1WMDA 2I55A 5I9MA 4TYYA 1H0KA 4D9IA 4CM9D 1R0XA 4O4LB 5LZ5A 3QLUC 4DT1B 1RSZA 2FSUA 4R8RA 3WK6A 3I2IA 2NO4A 4DYVA 1ID8A 1N2OA 3DHNA 7GPBA 4Y9UA 4UPDA 5AW3A 5T4EA 2V5UA 5CYGA 3IDZA 5KNBD 1Y1PA 4G5YA 2BDTA 2FZCA 4HUQA 4I19A 2JCXA 2P91A 1V3UA 1W7AA 3HXTA 3IKTA 1M3SA 5F9MA 1CVIA 2EFJA 2A7QA 2DTDA 1G5PA 2F7SA 2FUNB 1W5TA 1TT7A 1X7YB 1XYGA 1A9RA 2XWQA 3MWEA 3ZDFA 5LP6C 9MHTA 1TRHA 1ZN2A 5H7XA 4IVPA 3E5RA 4LJ9A 4TMTA 1E2MA 1FUUA 3LUKA 3M34A 1FVXA 4OLFA 4LDNA 1Y9JA 1I4WA 1QH9A 1TQ8A 3AEXA 2GYYA 1U0JA 2DPLA 5GJCA 3IP5A 2HX1A 4LHWA 1D2MA 2VJKA 2O2JA 1DAOA 2I4MA 4HQOA 4IGAA 5IVPA 2HLHA 3B7GA 4G07A 3RODA 3ITKA 1ZIXA 1DDIA 1KJJA 1VLVA 3HB9A 4G2NA 3M70A 5H3HA 1TA4A 2OGSA 3G7SA 3GB9A 2GPTA 3V3TA 4BKRA 1N6KA 3BSWA 2GEUA 3G59A 3WBJA 1JFRA 5AW8A 2NZXA 1KOJA 3KVNA 5JO0A 2V6JA 4DEXA 3BMOA 3K73O 1CUEA 3TSAA 1K2VN 4N48A 2HHLA 3AEQB 4A0FA 1UWLA 3L7DA 4ERNA 2WFLB 1TUIA 3TIGA 1H2XA 3NOOA 2I03A 4IR7A 2D1SA 4PSAA 4Q3AA 5DF1A 1UMCB 3IC5A 4GBED 3NWJA 3UGKA 2OXTA 2A86A 1DEXA 3DFZA 1P2FA 2Z8YA 1VIYA 1ST2A 3L8MA 5EPOA 4B09A 2N1BA 1YVDA 3DBVO 3ZI4A 2GTIA 2OXCA 4ZVUA 3STUA 3EDYA 1C2TA 4DA4A 2O06A 5E6SA 4XX0A 2C2OA 4GUDA 3VNVA 1CERA 1ADFA 2VK1A 1RVDA 1LLCA 2QTBA 2LDXA 2VQSA 2X5OA 1SOVA 3JD3A 3BD7A 3DNMA 4PCVA 3UCXA 3W04A 3Q10A 4QVIA 1X1BA 1I0IA 2A0XA 2YMLA 4GE3A 1QYIA 3TEMA 3ZNQA 1KORA 2G7ZA 2VA9A 3PJDA 4H1HA 2YV1A 4IDPA 1MRSA 3LMKA 4JBGA 5PNTA 3T4XA 2GEVA 2RH8A 3TPZA 4PZLA 1XEXA 3F5SA 2HSEA 4W1QA 5AKGA 4J3FA 1JLHA 1LLDA 1B1AA 1V0JA 1DJNA 3F7TA 3R0IA 4LYFA 5D1HA 1M2KA 1B6TA 1EVEA 1JQ5A 1ODJA 1N3BA 4YX9A 4X45A 1TUBA 1T5OA 5D00A 3DHYA 2PUBA 1WA5A 3D8TA 4QUAA 1ZSYA 4OFXA 5A4MS 5E8RA 2RHRA 4MV3A 4MPDA 1C3OB 1ZM9A 1L8LA 2E55A 2J3IA 3E53A 2AHOA 2B5OA 2CGEA 2VO1A 1FUYB 3HY6A 1IPHA 3PTZA 3PT9A 4M99A 4QXPA 4X7MA 4F72A 3VZSA 1J0AA 2WB2A 2BFNA 4WJZA 4BNWA 1ULSA 4ZQIA 1YRQA 4L6AA 1QZTA 1SOMA 3GLFA 3CRQA 1G9XA 1P1KA 3VHRA 5FAKA 4D26A 1TK3A 1QP0A 4FOOA 3P9XA 4RSMA 3JQGB 1KDYA 1EQUA 2G80A 3ISVA 3DL0A 2X8AA 1ENOA 5LZ4A 1XQ1A 4QTYA 2QXTA 3WX0A 1K0FA 1OWMA 1A0OA 1R8SA 1YRWA 3EPRA 4IRMA 5LXTB 4M9SA 1T36A 2H7CA 2IOFA 2YQ5A 4GM1A 3SF8A 1D7AA 4YAJA 5DASA 4BVGA 2O8EA 2FX5A 3THYA 1HY3A 4JU8A 5B58C 5JAPA 5ALWA 4IPTA 1XBTA 1CQXA 4UUPA 2QMUA 3BRWA 3CZMA 4EVRA 4W9MC 3JVIA 1W4BA 5AXCA 2ST1A 5F1YA 2KYRA 4NDZA 4KPEC 1PJTA 2FLVA 3R3UA 4FKBA 4RF3A 1ULBA 4MUGA 4BE9A 5J47A 2I87A 1TCVA 1U5BB 2RD2A 2QT0A 3QPUA 4OO3A 4M55A 5HIMA 5A5FA 2IDKA 5LP6B 1NQ5A 1AMOA 3ZX4A 4CF6A 3WIUA 4BRZA 4NABA 5A5GA 1QIFA 2EKZA 4JR1A 3AUFA 3NV9A 2C96A 4GI3A 4FFVA 4WD3A 1PZEA 3WLSA 1US8A 4EGQA 2Z1NA 3HZOA 3PFKA 4XSGA 4W9NA 2BHSA 3FJ1A 3CE9A 3GJQA 2P67A 1J8QA 3KYIB 3NHPA 4HTAA 1PR1A 2JW5A 4PYLA 3B3JA 4WXEA 4XUEA 3TYXA 5JBIA 4OQDA 2QN6A 1EGVB 4S3MA 4PRLA 3JQ6A 3B6JA 1UJMA 3DEHA 2W58A 4KMMA 3VR5A 5EMHA 5B1EA 3OWOA 1Q12A 1FP6A 1WOYA 2UYOA 3EDRA 3ESDA 3SI7A 1X3SA 3SYRA 2IW3A 1KF0A 4FJ1A 4P83A 3DS8A 3TQTA 1MX9A 4Y9RA 2GDZA 3TG2A 4E1AA 3OUUA 4M4SA 1NRIA 4J2TA 4XLLA 3M6IA 2IXAA 4Y6QA 2I2BA 3SZGA 4E14A 3ML1A 4P38A 4CKCA 4DIMA 1H2WA 1PEKE 3AHGA 4L08A 1FP7A 3QVVA 1QC5A 2QDKA 3AERB 4CRWB 1TXGA 2Q5CA 1T3LA 2VEOA 3LM8A 3PDWA 3PK0A 4M9CA 5ISMA 3BCHA 2H1HA 3P0IA 3WP0A 2R48A 1B43A 1Z35A 2XWSA 3A14A 3AU9A 3H3FA 3PKZA 4Q3OA 5BV8A 3K09A 4M21A 3P4UA 2PPLA 1YR7A 4JJAA 4IS2A 2D59A 4N7JA 2PZGA 1C2YA 4CDGA 1S3IA 821PA 1NSYA 1P3Y1 1M0WA 2GHRA 3ONWA 5E1DA 5JSZB 3MSXA 1K7CA 1M8JA 2UVQA 3C5EA 3LVBA 1HTWA 1AXEA 1ORVA 1YFKA 1SVWA 1MVNA 3H8VA 3KELA 4LG1A 2NVUB 4DLVA 4F1KA 3GFVA 3HDYA 3LDHA 5TPWA 2X1MA 4MB6A 1Z25A 3WSVA 3M4XA 2GRAA 3CN9A 4FGKA 4YRZA 4W6QA 2NU9B 2PXAA 4M98A 4HYQA 5CD9A 4DLNA 1QQBA 4HEQA 4ROTA 1O0CA 1LJ8A 1O94A 1YWGO 1XZCA 4YEDA 4E0BA 2ZK7A 1W25A 4DAOA 5BRJA 3WWPA 4R2MA 1T6NA 4R1UA 1STOA 5JYDA 1H2AS 4WKOA 5A1JA 4P4GA 5K3AA 1XDBA 2NU8B 1Z7GA 1OZAA 1TZKA 3JQAA 3EHDA 3ODPA 1C29B 4ODIA 1FNMA 3KJIA 4DBZA 1ENPA 1ISSA 1EVKA 1FRZA 1LU9A 3MC1A 4BN5A 3H3JA 4KREA 4XGNA 3GI1A 4IKOA 5EUCA 4BFLA 1T8PA 4EY3A 4LHYA 2FE1A 3LK7A 4REQB 4UREA 5ERGB 3WLMA 4NJMB 1A1VA 4I8XA 1UDXA 5E1OA 4MJLA 1E3MA 2O6LA 3Q9LA 4JFRA 3GEEA 3OCUA 1WULS 5CYPA 1N0UA 3ISTA 2CBGA 5IS2A 3WKBA 4EGCB 1JLLA 1QP7A 4E12A 1MA0A 2J9FA 3JRXA 2RGDA 3OQ6A 5FEUA 2PSFA 1MG0A 2WPDD 1OLUB 4BWYA 4CKYA 3SBXA 2I65A 4L5JA 1CZRA 2VTBA 4GL2A 3GO4A 2DR0A 1OLOA 2C3YA 4PZYA 5TMDA 5M29A 3PR2B 2OQVA 2QBYA 1J00A 1FFCA 4TRJA 5ITZA 4HXFB 5EJ8A 1E2GA 3HP1A 1N6OA 4ZK2A 3KV3O 1N2HA 3UB2A 5JSHA 1I1NA 1QGOA 5HBRA 3ZNPA 1PGNA 1T6XA 1DQPA 1DLJA 4B46A 1TMYA 1P7ZA 3HXMA 4EGAA 3BICA 2YIDA 1KYZA 3KKOA 1RQGA 3PCXA 3ZJTA 3DMPA 4DUGA 1ZK1A 2QTNA 5F23A 2XBMA 3R7DA 3IMKA 1NM5C 1DIHA 2W2QA 2QTFA 4RZQA 3S1SA 1RYHA 3VC3A 3BBLA 2IDJA 1RJ9B 2LVBA 1PI3A 2VK2A 1N32B 1D2GA 1CPYA 2OHHA 3BFXA 4RF4A 4WACA 4A2CA 5JJBA 2VHWA 1AKYA 3OU2A 2Y9MB 3PDHA 4E88A 2Q1WA 4OKNA 5EIWA 2R6R1 2YV3A 3D6MA 5AVWA 1D5WA 2FPOA 3SEFA 2WUWE 2JIRA 1L2TA 1WXHA 4PTLA 3NONA 3Q3IA 1U8XX 1EWYA 1NJ2A 1E2PA 2VJLA 4J16C 1VG8A 4DRZA 4UAUA 1Q2XA 1U5AA 1K75A 3JQ9C 4HV4A 1V1RB 2BKEA 3TW8A 1CZLA 1O6ZA 1C9YA 1Z0SA 1PS0A 3O1LA 4LYYA 3VSDA 9LDBA 1QKIA 1SZDA 1EG2A 1QTIA 2QD2A 1S2OA 3DTYA 4BATA 5BN4A 4PQYA 3HJFA 2UXBB 1YQQA 2GXSA 4K9PA 5CT9A 5DWDA 3RFUA 3ZCRA 4KQ2A 1CB0A 3KC2A 4XM0A 3NJRA 3VX3A 3WS7A 4F6RB 3DF7A 5AOCA 4A8HA 4HX2A 1XGKA 3OKFA 1M5TA 1MDFA 1DJQA 1KHHA 1W581 1X7WA 4KN6A 4XQ9A 3RK0A 4ASUA 4F6CA 4Z4QA 2ZG6A 4FU0A 2VQ3A 1U2GA 4QRHA 2E5LB 1SG6A 4YRNA 3PDCA 1BAPA 5AESA 5B55A 2GEDA 5AW1A 2CDBA 4EY7A 3VQTA 1XEWY 3MM4A 1T9ZA 4HJXA 1BOFA 2V45A 5GPBA 4KTTE 4MMYB 2JLZA 4HSEA 1ZQ9A 3OEED 2PEZA 2PO5A 1G55A 4EB6B 1UT5A 5CH5A 2Y1KA 4PYJA 1SU8A 1U2DA 4FYYA 2WE8A 4ZAGA 1K88A 3D4NA 1YUBA 5C9ZA 1YE8A 2JL1A 4Q82A 5JISA 1EDEA 2HBZA 5AT1A 3FRIA 1E59A 1QGYA 3KOOA 4PGMA 5FR2A 4L6CA 4XJSA 3IAS6 3H83A 5KDOA 4LE2A 3RLIA</