4RA6B

Crystal structure of linker less pyrococcus furiosus l-asparaginase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
125
Chain Sequence
MAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords L-asparaginase
total genus 41
structure length 125
sequence length 127
chains with identical sequence Q
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ra6B00
2P2NA 4RA6B 5K4GA 5K45A 1JJAA 2P2DA 4R8LA 2HLNA 4NJEB 5HW0A 2WLTA 1O7JA 4Q0MA 1JAZA 1ZCFA 5DNCA 2WT4A 4PGAA 3PGA1 1HFJA 5K4HA 2OCDA 5F52A 2GVNA 4R8KA 1AGXA 5I4BA 1JSLA 1WNFA 1IHDA 4ECAA 1HFKA 1HFWA 1HG1A 2HIMA 4RA9B 3NTXA 5I3ZA 5I48A 1ZQ1A 5DNDA 5DNEA 1DJOA 3NXKA 3ECAA 5K3OA 1WSAA 1NNSA 2JK0A 1DJPA 1HO3A 1JSRA 5CBPB 2D6FA 1HG0A 1WLSA
chains in the Genus database with same CATH superfamily
1W4BA 3ADBA 3OIYA 4G37A 4YRCA 3O26A 4QUIA 4RVDA 4JEHA 2C8KA 4XQEA 1G17A 1NG1A 2ZBVA 4Y0NA 4AJKA 2JGNA 3EXG2 1YS6A 1ORIA 5CDFA 121PA 3CY6A 4NR0A 3JASA 3PDCA 3P0EA 4C7VA 4XARA 4E7PA 1ECLA 3KAPA 2B92A 1PR0A 5LQUA 5C80A 2GD6A 3FE2A 3MG9A 2ZJ5A 4OXYA 5TS2A 2XQJA 4I5GA 1XELA 2BKVA 3PFGA 4WK4B 3RJTA 1NSFA 3IC5A 3GT3A 1DT3A 1P7YA 2Y1LA 3NVMB 3E9CA 1DC7A 4RTKA 2RHHA 4P3YA 3PQ8A 3TH5A 2VI5A 1DQPA 3BIXA 3VVCA 1MJHA 1X80A 3JRWA 1BXZA 3LAWA 4MAFA 3ZE0B 3AVXA 2NV6A 2JCGA 2O2DA 4KMRA 4V1CA 2W0MA 5AW1A 1XIVA 2VT2A 3D3JA 1WHTB 3P0IA 3KB8A 4TXMA 3F5SA 5CIWA 1IPEA 1HF3A 1XI2A 1DADA 3A2NA 4QE3A 1AB5A 4D1YA 3AKZA 4TTTS 1RWBA 3PP8A 2HHHB 1E4EA 4PSVA 1E8NA 1H1LA 2Q46A 1JALA 3BF7A 2YR0A 5AXCA 1H94A 1I6MA 2W6CX 1JJBA 5FADA 4IDCA 4GVPA 4N48A 1DG3A 1BE8A 2VFAA 2ZRKA 3OA2A 1TZKA 3GJXC 2HGZA 2WHEA 4JJZA 3UMGA 5DP2A 3WNZA 2FMTA 1G38A 1E3LA 2R7LA 1ODIA 1POXA 3PFCA 1IBRA 4JH0A 5G1PA 4IVNA 4KFTA 3LPNA 1ISHA 1LBIA 5AM4A 5BWBA 5FOQA 4LF4B 1GUYA 2DPMA 1I2AA 2Q5LA 1G2QA 1O5TA 4BX9A 2E5LB 2FZEA 1Q14A 4CIYA 2I65A 4MVWA 2B1RA 1Y3IA 1Q0ZA 2ODPA 4BVEA 3H5AA 5IBPA 1E89A 1OZ0A 2NP7A 3VNUA 1OWLA 4JEIA 3GI1A 3JQBC 8MHTA 1XKTA 1N5RA 2Q3LA 3GMSA 4GNKA 1RQPA 4RSRA 4C6TA 3G9TA 1NBWB 4HH3C 4LKOA 4INOA 3THOA 3RCBA 1S6YA 2ZUBA 1FU7A 1YBHA 2YJ4A 1JQDA 2H11A 4MW4A 4PC7A 3FFTA 3T9CA 3TTYA 4LNUB 2ZVQX 3CBQA 3KE8A 2A4MA 3FYDA 1M34B 2GEKA 2F8LA 2QA5A 3G2PA 4BQPA 4ESHA 1IZ8A 5JBQA 1ZXXA 5FLKA 2BLLA 2I4LA 1W0JA 4DDUA 4XPIB 3A9SA 4BKOA 4ETMA 3AFGA 4HEA6 5ISMA 4ENVA 2RSLA 2VWGA 3O1LA 3U09A 1KEUA 2ZXEA 3VH3A 4JSRA 2Z04A 3IQDB 1FLAA 1D0SA 1NNSA 1QCDA 2LPMA 2WZBA 1SK9A 1HT2E 1VJCA 1QWSA 2UXBB 1JAXA 3HKDB 2FJPA 1JZQA 4TT8A 1IHUA 4GMKA 2E6KA 4JXXA 2ATEA 1RJWA 4Z99A 4N3CA 2DHQA 4RPGA 3VV2A 3GGDA 1XDSA 2V6IA 4Z8YA 3RV3A 4IDFA 2TRSB 5CNIA 4ABTA 1Y4SA 5K3EA 2EFJA 3TM5A 4Q01A 3Q1LA 2XKKA 1SCNE 3GLTA 3CURA 4M60A 2I7VA 4HLDA 5KWIA 1UBGA 1B41A 3I37X 1P5FA 4URHA 1V43A 3RVSA 4BCBA 3FUTA 4Q1DA 5LJLA 1CF4A 3AVYA 4MGHA 3K0AA 3INGA 1WNFA 4Z1MD 2B8JA 1P80A 3ZZTA 1F06A 1FFXB 3RLIA 1KQOA 1RWQA 5F3RA 3ESZA 3VX3A 3LSYA 4JJFA 1K6JA 2VJCA 1G4HA 5AVJA 2RJNA 4AS3A 5TIIA 4MQ5A 4CXMA 4ILEA 1B8NA 3Q9UA 4OU5A 1P5ZB 5B3AA 2R8PA 6LDHA 3WK6A 4XYMA 2AA3A 3JQ6A 1JEEA 3G9ZA 2EJCA 3KLMX 2ZSDA 1MIHA 2VC2B 2X86A 2CW5A 2LV8A 4LZNA 3ST7A 2VUHB 4JJKA 1SG0A 3B9RA 3JSAA 3SQNA 3W9YA 3ZZ1A 1FMFA 2A9RA 1IEWA 4I3HA 2AR9A 4M1OA 1ZJWA 4NYJR 4RK0A 3UJDA 2DLDA 4GYKA 2X9QA 3HNRA 4MVJE 1NN0A 1OILA 1ADJA 3DR3A 2VDQB 2BMFA 1H2ZA 3BWYA 3COVA 4IO0A 2WZDA 1QZ3A 3COYA 3L0CA 1SUSA 3I1IA 3JW8A 2OV1A 4HQRA 5LWQA 3OCUA 5FH9A 2JGRA 1JJVA 3E70C 3MVEA 4I2VA 2VRCD 5FBWB 1SIOA 4WWHA 3WDLA 2PGAA 4J16A 5KVAA 3E05A 1WHSA 1KQ3A 2PSSA 3WA6A 2R00A 1OI3A 3V1TC 2BSAA 1N9KA 4H08A 1YJXA 2NUAA 3DVQX 3R0ZA 3ZJYA 4CYMA 4BWFB 2WJPA 5CB8A 3CZRA 1RMTA 2I1QA 3WTCA 1USUA 3GBPA 4JLPA 4KRYA 4JBNA 4EF6A 1V39A 3E82A 1CDOA 4M22A 1NF3A 3I2FA 3ICWA 3R5FA 3A3NA 4RYDA 3IP6A 3RE1A 1OIWA 5JWRA 4BGEA 5KX5B 1GPNA 1Z8NA 1E0AA 2JIQA 1XVUA 4LKRA 1SOAA 2AD5A 1GZ7A 2PLRA 3NCTA 1L1QA 4WOKA 3UIEA 1FVFA 2IYEA 2XTAA 4RMJA 1ZAYA 4GXNA 3KR2A 4RLHA 3RK4A 3CNOA 4QDZA 1U8YA 2J3EA 2LCQA 1KTIA 3ND7A 3PWZA 4DDTA 5KVVA 1XZNA 2I54A 2ONYA 4DSAA 1RZRA 2Z6UA 3V7FA 3R3SA 1FP6A 2QORA 1M1YE 5TMDA 1ESMA 1QUEA 1C50A 4HAUA 1CYDA 1GL9B 1ZOPA 2F43B 2Z2XA 3Q10A 8ABPA 3IP5A 5CVCA 2FSSA 2HZBA 2P2GA 2JI8A 4FT4A 2PUVA 1Z5UA 4JC4A 3HB0A 4QUHA 4CJXA 3C0KA 4E13A 1CEXA 4CFSA 1VBNA 1OAKA 3JAWA 1OBVA 1A7AA 1LPNA 2GCOA 1H2FA 3QOFA 5LQSA 3RKUA 4IJ5A 4IWXA 2Z8XA 2RJOA 2WYIA 2XR1A 1WMDA 3HBJA 3JYPA 3EW7A 4P82A 5IARA 2FRDC 2DAPA 1OH8A 3TKLA 2CT8A 4C2AA 4QRHA 5AVYA 1Y7IA 5A3JA 2E3JA 2JBAA 1RWOA 1CE8B 2CLSA 3EPKA 4DUGD 4HWRA 1VPTA 4QT0A 3KJZA 1XVLA 1ZIXA 3CX6A 3VR4H 1BKDR 1QB8A 4WHMA 3U48A 1JB1A 5LU8A 3B82A 1H65A 2RBKA 2IZOA 5JS2A 4JENA 3BULA 5IH3A 4DJEC 1TO6A 2XDYA 1GU7A 1PTJA 4GI2A 3WGKA 4MQUA 3R20A 3AI1A 1D4ZA 2R79A 1DG9A 3AJAA 3RS7A 4J4TA 5CR9A 1XTBA 1E79D 3LO5A 3WSTA 4NK5A 1O95A 4KUHA 4NJMB 1YR7A 2DPGA 1AB6A 4QNMA 1YZTA 4GOKA 4JOBA 3RRZA 3O47A 3UCFA 2D1SA 3DUFA 3C48A 4L8GA 1RAFA 1UBMS 3GCGA 5K3SA 1KSGA 3T3HA 1W76A 3DM5A 2ZSBA 3LWZA 3KXDA 2Z1MA 4WX2B 4YWHA 5T41A 3V4LA 1IULA 2OTCA 3G2HA 4CM9A 3IB3A 4L75A 5AOAA 2C2ZA 4CN8A 2D6FA 2P68A 1MDFA 2QLFA 1RWXA 2A9KA 2IE0A 2FPGA 2VDRB 5C18A 2ZFUA 3TAUA 4IHJA 5C1BA 4XB2A 1P1CA 3QFTA 1GDTA 3R7SA 1TKCA 1I2BA 1K86A 3BGOS 3PL5A 3LO8A 1UBTS 1EWTA 2HOQA 3N59A 3PRJA 3GDFA 4KIJA 2IUFA 1ULUA 3B5IA 3S44A 1O6GA 3GLFE 3I2IA 1ACMA 2G1KA 4ZRNA 1NI4B 2YMLA 1E2FA 5JARA 1QZUA 3R0VA 2XJ9A 1EBUA 1T3HA 3KPWA 3PHCA 3E8SA 3NPAA 2VXYA 1L5FA 3OP1A 2AK3A 4LJ8A 4YUYA 4HEHA 5KEIA 4IW3B 3WGLA 2XMSA 3ZGZA 1GA1A 2JRLA 1U0NA 2NSYA 3AILA 5CX4A 2VQ6A 2O5EA 1OMOA 1YWGO 1PFKA 2XECA 4IHQA 3V42A 3HEBA 5BWMA 2OV8A 3I83A 4AP5A 2EL9A 1AX9A 1B15A 1BVHA 1K7XB 1M1ZA 3PKIA 4R9VA 1X0XA 3RADC 1C80A 4H6WA 4G01B 4DJ5X 2XCRB 2G1PA 3ILYA 4K9PA 3SZOA 3GLGB 4R1QA 3R23A 1CR0A 3DJYA 3HADA 2VP2A 5BSFA 2XTNA 3ODGA 2OA0A 1XMVA 2C3MA 2ESRA 3KQKA 4WJKB 5ADHA 1X1TA 3EXIB 3L4BA 5H3HA 4QDTA 1XV5A 1E3IA 4TOIA 2A35A 2F1OA 3FMVA 1QLWA 4OQEA 4YRLA 2O0HA 1MJFA 2DPYA 4MPDA 3FTEA 2HLDD 2QOEA 1A96A 2BW0A 5FBLB 4DV6B 4TMYA 1EXDA 1YBAA 2EKZA 1J5XA 4S1WA 3FOWA 2I0FA 3HM2A 3RFVA 1RAGA 1NX9A 4H3HB 3S81A 4CM6A 3LKVA 4J1NA 4QPDA 3FLBA 3R9KA 4BIMA 5KMGB 5K0EA 1H22A 2KHZA 2WJ3A 1GJRA 4JDUA 3QWHA 2NUBA 3SGLA 1M5UA 2OAP1 1CUXA 4B74A 3GPCA 5DOVA 5EIXA 3T4XA 2P3SA 3C85A 4L72A 3FDXA 3QWBA 2XT6A 3W5UA 1ZK2A 3S8YA 2ZPUA 1NI3A 2LDXA 1QANA 4FS8A 1A9ZA 4PFSA 3T7CA 2FGJA 2MSLA 1SUDA 2ZRFA 3HJHA 5M29A 2O8BB 1AF7A 1SULA 1YZVA 4LV5B 4YX9A 3MUFA 5BV2P 4II3A 3RS9A 4G2NA 4K9MA 4ZYLA 5K3AA 4FNAA 4ONEA 3WIOA 4ZYVA 2DHCA 1TRHA 1KDVA 1RXVA 3KZVA 4NDAA 1GZ3A 2IDMA 3HR8A 3NDBB 1N8SA 4PX2A 3FTCA 1SVWA 5JXGA 2XHEA 4MW2A 4UVDA 2OM6A 4UE2A 4L3WA 4QG3A 2XITA 3LRPA 1RBZA 1N3YA 3X44A 2CHEA 2D2VA 5L9AA 3QKSB 1N2ZA 3VHRA 5JIBA 1GZ4A 3P9KA 4IOMA 5DBIA 2CFIA 4Q37A 3KLOA 3FAZA 1R12A 5AICA 3JWPA 1KARA 3NT2A 2CD9A 2AF3C 3GFFA 3N75A 1P62B 1M2NA 1INLA 2HBZA 3DWIA 1VE9A 2P2SA 3D0KA 3GXBA 2I9KA 4NC9A 3HYTA 4ZYXA 7MDHA 1DPFA 1SC3A 1KOFA 1AS3A 3GVCA 2BMVA 3GLIE 2ZSKA 1F4VA 1QYCA 4UNQA 2XRMA 4QYIB 1YB4A 2Y1DA 4ER0A 2PEZA 3OEED 3IUSA 4GKBA 4BO1A 5DF1A 4IJVA 1ILEA 1AN0A 1ZN8A 1JG1A 2YMQA 4ITUA 3TJRA 4EMBA 3EGXB 1XB2A 3T7JA 1EGHA 2WJGA 4YRSA 1BE0A 3DMYA 4IIEA 5CVDA 1UMBA 4DPKA 3CVUA 1JKMA 2CLIB 1PCXA 3BB3A 3PRYA 3VOBA 1AN9A 2PLFA 4QOSA 2DECA 2FZCA 2GGSA 1NJSA 1ODLA 2COKA 2MR6A 3KYDB 3LWDA 3UXMA 4PQGA 4E1VA 3QFRA 1UK8A 2AEJA 4JNCA 2PX0A 2GK3A 1AQJA 4DLRA 1L5SA 1I14A 1MT3A 1XCMA 2X77A 3PNOA 4KQ2A 1FQJA 3H2SA 3E0XA 5BURA 1MF7A 1N5DA 2AMFA 2QRGA 2WINI 4P3OA 3SXUB 4KFRA 3P71T 1W0JD 2DETA 1HFWA 1H1LB 4J0DA 1PV2A 2JLYA 1HWYA 1XVIA 3IOBA 3V7YA 1R8XA 1J9GA 5CG1A 4A8JC 4WKGA 5EERA 1IN1A 4PO1A 4BQRA 2F4VB 4GWLA 1JE0A 5CJJA 2FF7A 2XY4A 1Z6XA 2XQKA 3IS3A 3AEYA 4HD8A 1BDIA 4J0CA 1U7PA 1YIAA 5EKTA 4EA8A 1PD1A 5EIBC 4UVIA 4NBVA 1ZU5A 4EI9A 4JP8A 5HKAA 4J94A 5HCNA 3GYBA 5JYDA 2HIHA 4GECA 2AG1A 5ALJA 1P8JA 4M7OA 1Z82A 2UYGA 2CLOB 1SHUX 2B4QA 3K0SA 2BCGY 2R6CA 1YL6A 2XA2A 3HDYA 2WKRA 4Y7CA 5CTJA 3QVWA 4PZCA 1QLHA 3N76A 1SKAA 1U8ZA 2A0KA 2RG7A 1Z6PA 3A4TA 4JL6A 4MROA 4NZZA 4WKNA 3ZI7A 3HCDA 2G5GX 3EFOB 3N2NA 2GUGA 2ZUTA 1NBAA 2F3RA 4GP9A 3QMPA 3U61B 1YVUA 2HW8A 3DM9B 2ZREA 4I5EA 1VPWA 1NQ5A 2LWIA 3GVHA 1LS1A 3IT2A 2J3HA 1Y98A 4ZO6A 3SLGA 5FPQA 2XGSA 2NOAA 3PI7A 2V7VA 1HE4A 1JJIA 4U2EA 4DY4A 4WSOA 1MPTA 1F8GA 3OJXA 4ZC1A 3I5YA 1NXPA 1ZMRA 2HA0A 3E35A 3ZHZA 3EF0A 4J0FA 1XCPA 1BFUA 1R2QA 3IEIA 1SVOA 3TQIA 4UZFA 1QIMA 2FOIA 2R84A 2K7FA 3R9WA 3OFSA 2G1UA 5FI3A 5IK2D 3LC1O 2NO6A 4Q4HA 3TLYA 2L82A 5EEGA 2KPOA 1XRPA 4YRZA 1ODKA 1XZFA 2JFNA 1JAIA 5K4AA 4FMDB 4D8XA 1LFDB 4OXKA 4BKUA 2WP0A 1U1IA 3M1LA 3PF8A 3TE6A 3T3NA 3FLMA 3OY2A 4GC5A 4RJ2A 3MTAA 3CVYA 4EHNA 3OQNA 4R2HA 2JFFA 1WABA 3GLIA 1T0IA 1ZOSA 1XCLA 3DAPA 4KR2A 4BN0A 2QR5A 4HNUA 1DIRA 2X9VA 3D4OA 3NR2A 2P6PA 3LQQA 4Y9UA 3A2MA 2I2XB 1P2SA 3I6MA 4GKVA 5ADWA 3VHXB 1CRZA 5J4VA 3VOSA 4GYYA 5PNTA 2JEYA 4TMXA 3WJ7A 3V8VA 1ZEJA 4UE6A 5LKRA 4HAYA 1J0CA 3JYQA 3U7IA 2B4AA 5BNIA 1CETA 3DWGA 2NADA 3QI7A 2WD9A 4HNRA 1VYVA 4NWIA 1IG3A 3PHBE 5DCLA 3CVOA 2OB1A 1S8OA 1E1QD 2BTQB 3DYIA 1QPZA 3AKDA 1Z8FA 2YWXA 5KX5F 1OD6A 1QCYA 5F21A 1R8JA 2ZYSA 5KINB 2BUBA 3CH7A 4Z4CA 2OFOA 3G6WA 3S1AA 2MYNA 2PUWA 3AP2A 3H04A 3HSYA 3I8OA 4W8OA 5K0GA 3DCYA 3B3FA 4E07A 1XMQB 5IJ9A 3IP1A 1PEYA 2JI7A 4BVGA 4TTRA 4F12A 5KTTA 1XDGA 5CD9A 2GDZA 4CG2A 3ADDA 3WGHA 4UCWA 4YDRA 1RWVA 1NDHA 4CKWA 3PITA 2AJTA 1A9RA 4HNAA 2HMTA 1QB7A 3CQ9A 5FA6A 2BUAA 5FF9A 3M70A 4AZ3B 1Z17A 4EZBA 3ZIAD 3FR7A 3GUVA 3QZUA 1RPNA 4AK9A 3SXPA 3DLHA 1T9DA 1GTVA 1V3UA 4NQZA 3GA0A 4URXR 4GKKB 1JS1X 4MR8B 2AUMA 5CTAA 3ZNNA 4GX0A 1ULSA 4II2A 2NO1A 4B2PA 1QAOA 1M0WA 1Y3DE 3LV8A 1H69A 1YXMA 4WV3A 4J6EA 4RQUA 1DAPA 2EQBA 1V1RB 2WIDA 2ZBFA 1QTIA 4YT5A 1PFUA 1XGKA 4KSCA 4CT4B 4EG8A 3H83A 4J0EA 3ZY6A 2D1TA 1F8XA 5T8KA 2QRKA 2ADOA 2OD2A 2PE5A 4CCWA 3U7EB 1VMAA 1ZHHA 4XTCS 5HG0A 3NTLA 4TTAA 1NRIA 1YI8A 3ZY4A 1KJ8A 5I7FA 5JC8A 4Z4GA 2GN2A 3T7DA 4OHYA 3NTVA 4M7WA 1BHO1 1PF7E 4XLZA 4IM7A 4EZIA 3LD9A 5KNCH 2Y1XA 2X5KO 3E0QA 3MJRA 4FOOA 3TEJA 4CM9D 1P1IA 3O3NB 1L7OA 5KUTA 3HY6A 4FUTA 3R74A 1Q7RA 3F7OA 2R7KA 3OIUA 1QR2A 2NVUA 5BQ5A 3SJZA 4QU0A 3T0IA 4JU9A 3AEUB 3NKLA 4DGSA 3NNNA 4F7DA 1LLDA 3ZHBA 1MLDA 4ZRDA 3PQ7A 4QTXA 4J29A 2FK7A 3L8HA 1XX6A 3MAAC 4TLLB 1IWBB 4KV7A 5AXDA 3L4KA 3CSUA 3C45A 5DPMA 1UJ5A 1YS1X 3JCZA 3M1IA 4PS0A 2PRKA 1COWA 2NT4A 2QT1A 3TVDA 4WXHA 3M0EA 4J7AA 5DYYA 4U2GA 1EZZA 4P08A 5K0FA 3NUQA 3VSAA 2WWGA 4EUFA 3PUIA 4H0NA 3PD0A 1LB1B 5EC8A 4AY2A 4FEYA 4QFMA 3LBAA 3A2KA 3NRJA 4RH3A 2EWVA 1QWOA 1WO8A 3PS9A 3HU3A 1RU3A 2DFVA 1MC4A 3DLTA 4HFJA 4P98A 5JI2E 3C97A 5E7MA 3KQUA 1NLMA 4QX6A 3TI7A 5L7YA 3KQYA 4LJRA 1AGPA 5I7SA 5B1IA 2H1VA 1DOAA 1T3ZA 3F9RA 3R24A 4WEOA 5TB5A 4DBVO 3ZDXB 4CMEA 4QASA 3BWXA 1T8UA 3WISA 3ZU4A 2XVMA 1DQZA 3II6X 4QOFA 2H1OA 3A8TA 4L6IA 5DI3B 2VHUA 3C24A 3SQMA 1XP8A 4ZN6A 4M8KA 1P1KA 4RH1A 5FUBA 1K3FA 4FE4A 1W75A 1W88A 3DTTA 1WZIA 1U5BA 4H7DA 2I78A 2IV7A 4C4ZA 1J8MF 3UAYA 2VUUA 3MRXA 3SLKA 2DQ4A 4F3YA 3IQGX 1RAHA 4TL9A 2EU8A 2QGZA 5KOJA 3J7AC 1E4VA 2GBCA 2ZJ8A 3TOVA 1XCJA 2HLDA 3C1AA 2V9ZA 4O1HA 3TINA 2BFFB 1S2GA 2X2EA 4M0DA 4IWNA 4UQOA 3FJYA 3JQFA 4GH5A 3PD1A 4QXOA 4JLDA 3TGLA 2PU5A 3NDPA 2P6RA 1DIGA 3I2HA 3WGNA 3MBIA 2VS1A 4MKZA 1V4BA 1EA5A 4PQFA 3BOSA 5DWVA 1QIEA 3B13B 4UOQA 4ZQGA 4ARZB 1UINA 1E6KA 2F48A 1EFPB 1AS0A 3QPBA 2JAXA 3UT0A 3L8DA 3T5DA 4EHDA 4KQJA 3ETHA 1I1QB 1O89A 1VJRA 3NC4A 4NBTA 1E5LA 4PQEA 4F21A 4NXMB 4KXVA 4AJJA 1YB7A 1TO2E 5CB0A 1NBMA 5BWLA 1AZSC 1EUYA 2R4TA 3RUCA 2PUDA 1R6UA 1MO2A 5B6PA 1OJ7A 5FA5A 1D03A 3U56A 5DYIA 3GP3A 1KEVA 2BVNA 2QL9A 1Y89A 4FDMA 4W7SA 2WHXA 4DBLE 3RIHA 3HWX1 1JG6A 4HAOA 1U2PA 3ILHA 2J3KA 4RWZA 4JP2A 4KNWA 1L7XA 5JHGB 3NKVA 4GQIA 5K8CA 4V0MA 4J91A 1NXVA 1EJ0A 2OUIA 3C14C 5FBQB 5HGJA 1GPDG 1F0PA 1OLUA 4JQOA 2J0UA 2F17A 4IJQA 4CF6A 3VR4A 3DPUA 2GWHA 2G71A 3K3PA 3QXGA 4IIGA 3X2EA 3G23A 3HFSA 2CLKB 1XZPA 3DBHB 3H9BA 1YKFA 3UAGA 4MNTA 3R8CA 1UPFA 4G1FA 4MS3A 4AL4A 3KR0A 1DOHA 1UPAA 1X19A 1XSEA 1GUDA 3OEHD 4WY8A 3TX2A 5DHTA 1JXOA 3DDWA 4F8JA 5JBNA 1U7DA 5I47A 1O97D 2HK9A 4CE6A 4HAZA 4EL5A 4PLTA 4YGYA 1A2KC 4XH9B 2VYVA 3A3YA 4JMLA 4FBGA 4IIVA 1K92A 1JFSA 3CWCA 2FE4A 2ZAYA 3EFHA 2C4NA 3ORFA 2XVAA 4BO7A 3CMMA 1USWA 3D0QA 1GGMA 3G2JA 1CRQA 1E4EB 2VPQA 3STWA 1IHOA 5C46F 5ITVA 4I1PA 1A9PA 2IVFA 1C7JA 2DERA 5FQOA 4AG6A 2DUUA 2FWPA 4UM9D 4EKNB 2H59A 1D4AA 2XE6A 4V24A 5H80A 3SFVA 2IQIA 1QRUA 1TJ3A 2CCJA 3QK7A 1VKRA 3VYUB 1CQZA 1V9LA 4JJ7A 4LDJA 4U6NA 3TG2A 3MTEA 5CLGA 5ALVA 2PGLA 3B9PA 2J7PA 3DQPA 1CVLA 3OWOA 1NASA 3HI6A 1U02A 3LF1A 4I4TB 2JCBA 2FV8A 3B5EA 5EWJB 3GBSA 4AG5A 2Q7DA 1EP1B 2G9RA 2XVXA 1G8PA 1HTBA 4X62B 4MS4B 2L17A 1ZQ1A 3AW8A 2VVTA 4EY5A 4D44A 4J8PA 3KKPA 2ATVA 5AQEA 1KQNA 4EB8A 1WP4A 3HJUA 2M6LA 3TD6A 4F9EA 5J23A 3OQOA 4L16A 1BC5A 3P26A 1HT0A 1SBIA 1LQTA 3WL7A 3AJ8A 3I92A 4CI0B 3C16C 4DIDA 5K4GA 2EAUA 1CC1S 2POQX 2UXCB 1M83A 3DC2A 1NVBA 1RWKA 1QQ6A 1ZL0A 1OC2A 2YV3A 3A0UA 1K63A 3PEUA 2OCYC 2PH3A 3DP9A 4L0MA 3FNBA 1HDZA 3KFLA 5T67A 2BFCA 4PS1A 2W42A 3KZ1E 1J07A 1YTLA 1PV4A 1QP0A 3BF8A 1G9TA 2I3ZA 4UKDA 1Y42X 4DLBA 3SOZA 3V4FA 4RK4A 4B4OA 4TRRA 1ZUHA 1XO1A 4EK9A 3WIDA 2I4NA 4HBGA 4S35A 1DKNA 3T34A 3ZJ4A 5AIBA 3UATA 3Q9SA 3V55A 3M4YA 5CAEB 1Z4PX 3EAFA 2WF7A 2CNNA 3H9CA 3C1OA 3LQ2A 4BE4A 1OAOA 1ES9A 3NTRA 2VH5R 2B21A 1LRJA 3TUJC 2TMGA 3WK7A 4XUGB 1IOWA 2PKYX 3IAM1 5EPOA 1YQUA 1KZHA 1X39A 3DXYA 5DRYA 3RFFA 3ZXUB 4AWBA 4CM8A 4DG5A 2Y93A 2Y9PB 1PFGA 2GVZC 2HC9A 1UANA 2RH8A 3L7BA 2G9NA 3TIFA 1V8FA 1VHTA 3H5NA 3IJ5A 4G97A 2ZUEA 4BYGA 821PA 4CCYB 4HWTA 1E5XA 2YIMA 1GR1A 2H6EA 3P1JA 4G5XA 1OH5A 1NNEA 3HXQA 1ESCA 1NIPA 4PCUA 4Y9TA 4AZSA 4O2BF 1U6KA 1QGUB 3LDAA 4QA9A 1NLFA 1I51A 4Q3EA 4TGLA 4TXHA 4OQLA 1JIKA 5T3UA 1PZHA 5IZ4A 3V3KA 1JTFA 1U04A 1HR0B 2H5IA 1W6UA 3N70A 6REQA 4DR3B 2KBEA 4INZA 1H2XA 1P2DA 3ROZA 3OH8A 2ZBUA 1KTVA 1MEJA 2QM7A 1H2YA 4EFDA 1UZUA 5HJ2A 1WIWA 1BE6A 1O3YA 2J3LA 3IBFA 4IXMA 2P6OA 1ZFNA 4IIJB 4QARA 2EFEB 1JXAA 4KXNA 4LA4A 1G9XA 1GITA 3T7KA 5LOVB 5C4IA 4D0GA 1P81A 2XKAA 3R5KA 3RS0A 1P6XA 4I1IA 4NCIA 3AKEA 1VBMA 1Z36A 4FOLA 3BL8A 3IP7A 3K0HA 3DBRB 3NKFA 1OE0A 2X0IA 4UU1A 1JIVA 2DBZA 1L5VA 2FX2A 1YI1A 3CCFA 3ZZMA 4PZYA 1Z4MA 3TXYA 3MJHA 4QUBA 2VHWA 2PFSA 2B7CA 2WFZA 2X3FA 4E11A 1UDRA 2B99A 2G1AA 4HZUA 3EGDB 1AV6A 3KJHA 4BBAA 1UJ4A 1SBNE 4KDFA 1R8YA 2GTPA 1ZOOA 3HJCA 3BUSA 3SICE 4PW0A 2G83A 3ZKWB 3ILSA 3LJKA 1ZPDA 4UTNA 2P9TA 3BB1A 2J85A 5HKBA 2CB9A 3OM0A 4UVGA 5A05A 3V9AA 2FMXA 1EXWA 2GFHA 2XQIA 1WF3A 2FW7A 3WMRA 1UP6A 4GIBA 4U9IS 2DJ5A 3AFHA 5G4LA 3ECSA 1G59A 3AR3A 3CT6A 2P2CA 4K1LA 1NF9A 1NIJA 1P91A 2HB6A 2VAXA 2XOKA 4MUKA 2YHIB 2OESA 1LTQA 4P22A 5AKZA 5KNDD 5DCYA 1SQ6A 5DGXA 3IDFA 3LC0A 3ZHYA 2CDNA 4G1MB 4ZEOA 2NT3A 3VMFA 3HWWA 3ZVMA 4Y6SA 1BA2A 1JU4A 2IV3A 2J59A 5HKKA 4DCGA 2FMUA 1FS6A 5DTMA 5HXAA 2GJAA 2OCGA 2G4CA 1E2JA 2OORC 2UZ1B 3F5MA 5FJIA 2YXBA 5LD2B 1E60A 5EEHA 1Q0UA 1TCVA 3EPRA 1P4RA 4RLSA 1X15A 2ZU0C 4KXXA 5CA0F 1GCAA 2BFFA 2ZDGA 1WB9A 4MUNA 1E96A 1FVHA 1NJ1A 3CF6R 4D74A 2WWHA 3ZGLA 3N1UA 3TL3A 1AY0A 4QOJA 4Y9DA 1P6UA 4IDQA 3W6OA 2JJQA 3RWOA 1CFZA 5ALTA 4A0FA 2ZCVA 3TKAA 2GXSA 1NQUA 4MH0R 3MMSA 1YE5A 4JB8A 5AW7A 1TTTA 4FJ2A 4P8RA 3ITNA 1XA3A 1S1CA 1EWKA 4HNSA 4UDOA 5LA6B 4EO7A 4W5QA 1G3MA 4ZYUA 5BPHA 1R00A 2QTNA 3ZPXA 2XTMA 2P90A 3D5EA 5FDFA 2PGDA 4ZCLA 5EMNA 2WWWA 2CXXA 4HZUB 2FEMA 2H4FA 4IGAA 3U5ZB 1KRWA 4UEKA 5BSWA 2JKZA 2QVXX 3RQSA 4CTOA 1B74A 1DTEA 3K8ZA 4IDAA 4BO8A 5A06A 4N3BA 1W8IA 3EVGA 4OP1A 6YASA 3QOYA 1XAHA 4G0ZA 4RVNA 5A7HA 1E2MA 1YRHA 3SQOA 5K8IA 4O2BA 3AQIA 1O9HA 4TQUS 1F0NA 1BDHA 5FOXA 3FH0A 4DQUA 2XZDA 4DDHA 1WSBA 2I99A 3A14A 1BQ4A 3O8QA 3RUHA 3JX9A 1B8PA 2YFQA 3Q3IA 3Q3EA 2H7YA 4GI1A 5FTNA 4WBNF 4YIHA 5A6VA 3MPOA 4F3KA 1ZGAA 5THQA 1MOSA 1RMQA 1WCIB 4DSUA 3VU9B 4KHPB 4KDRA 4G1CA 2Q6KA 2WYWA 3O8DA 4KX3A 3OQVA 1NUAA 4WD3A 4RPKA 1M34E 4IYRA 4QQ8A 1X7WA 1XZDA 4DIEA 5I48A 1GNRA 1WBDA 2ZTMA 2AJCA 2XUAA 4R5MA 1EBBA 4GP7A 4DMMA 1ZVMA 3I5MA 3QYFA 1B14A 1UAGA 5LXTB 3U4GA 2H1SA 5KYWB 4L50A 2XH8A 2V7UA 6GPBA 2P4UA 2XEDA 4BNJA 3TFOA 3KYBA 1TIPA 4DLKA 1ECGA 2F3SA 3T94A 3WNCA 3THWA 2ACKA 2CXRA 5AOBA 2BGUA 4LHYA 2Q5OA 4PICA 4D92A 1NAIA 5SZIA 3M6AA 3INTA 1XDDA 4ZDJA 1TMKA 1U8TA 1TIBA 1ATIA 2NZJA 1WSWA 2D5CA 3V34A 2JVIA 3LX5A 3OU2A 4JT4A 3G8DA 3FOEC 1P7ZA 4WLVA 2DQSA 3QA3E 2O4UX 4UHKA 4ZAWA 4UCQA 3S8MA 3WP0A 1M2VB 3IQEA 2YZGA 4IOLA 1EHYA 1ONSA 3X2SA 2VDUE 4DA6A 3DOJA 2J6CA 3HP1A 3ASUA 2JLXA 5DX1A 4Z2YA 1AH2A 1B7GO 4PAMA 2JLWA 1I7PA 1UDAA 3SFZA 3BCSA 1ZXBA 4Q93A 4LMRA 5ALFA 4O4HB 3S28A 3KJEA 3C1UA 5FAXA 2ZDHA 3KZKA 1TTHA 1PR5A 1V8OA 2WKWA 3INNA 2ZAOA 3LLUA 3QNMA 2ZW9A 3I6QA 1CQIA 2VJQA 1AXRA 4D3YA 5BR1A 1C7EA 4QJ3A 1J8YF 1V0JA 4TUYF 2BMAA 4HX9A 2IIVA 4JNKA 3DDOA 3O8NA 1GZSA 2UYHA 4D8VA 1LRLA 3NASA 3VMMA 1E5QA 3OZCA 4UBJA 4B35A 5A4AA 2GCPA 3U7HB 1G41A 4CV2A 2QQ0A 3TTSA 1QVWA 2HV8A 3K0FB 4ARBA 4UBOA 5HZMA 5FHQA 3LZDA 2CV0A 2D8MA 2V5AA 3OO1A 4V03A 3KALA 3KBOA 1R6XA 3LI2A 1L4EA 3Q8LA 3ORRA 3LW8A 4ASUA 4ZI7B 1NBME 1XMOB 1SEPA 4JJEA 4RXMA 2W8BB 2GOYA 1QGED 1WDKA 4WN3A 4ZOBA 4ZT2A 5HSGA 1JX6A 3P5BA 4ZGBA 5MN5A 1WW2A 4EL0A 2IKSA 1E5DA 3IUJA 4AYXA 1P72A 4M4SA 1ZMTA 4LJAA 4IP0A 3DEFA 1AKUA 4YJGA 3VR6D 5IAJA 1R9GA 2DUMA 3GRRA 3BFPA 2II6A 1TUBA 2X2FA 3K1AB 4OI2A 2AGVA 3ZCQA 3BGWA 3IOMA 1LCIA 4V38A 3WA7A 4FC7A 4HG2A 4QEDA 3SX4A 2I6UA 5BOSA 4YRJA 4MVJP 5AWFC 2N3ZA 2JJ2A 4R2MA 4NK4A 2VPPA 2BHSA 2R1TA 4G0WA 1RKQA 2QTLA 2PNFA 5KNCA 2VJAA 3MWEB 4RSHA 3HUUA 4XFKA 1I5EA 2WP8J 3I2YX 4PO8A 1NN3A 1IG0A 4MV4A 2JCYA 5TQ0B 2GHRA 3ZBQA 1ESEA 1I36A 1LWNA 2NU7B 3ZG6A 3VAAA 4HQNA 4ZJPA 1TMOA 5LDHA 1G8HA 4ZO9A 2GEFA 1Z5OA 1JMKC 3K15A 3DLBA 1PS0A 2G06A 3VHLB 2GZMA 2BTEA 4BMNA 3LUFA 3TMYA 4KMSA 3C2QA 1HXHA 1N6PA 2YJZA 3M7IA 5AUQA 1B8OA 3IHTA 3ZHRA 2BEKA 5BV7A 1SZJG 3GPDG 2H1HA 4IH9A 1CUVA 1V7CA 4AI6A 2ETVA 1NKSA 1V7ZA 1OAAA 1YQWA 4GSYA 4JKOA 2DWQA 1DDIA 2GSWA 3DZDA 3H3FA 4R51A 5K05A 1K5GA 3CH5A 3HVKA 3W5IA 3UAVA 2C4MA 2FRXA 1H2WA 2IVZA 2J3MA 2AFVA 1ICIA 2QSZA 2I1VB 1OC4A 3RVDA 4YYEA 2XBLA 5E9AA 4ZVPA 2IP2A 4M98A 2ZB3A 1XPJA 4EARA 2WZQA 2V3WA 3CLSD 2QYOA 1J23A 1AKRA 3DWFA 2HPHA 2WJIA 3FIJA 3GN2A 3QI2A 4IHJF 4TMTA 5FFMA 3RC2A 3ZK9A 4DWOA 1L4FA 3AR2A 4IDDA 2FUG1 8ATCA 1KMCA 2H4WA 5DHAA 4CV3A 1P77A 2Q1WA 2O4CA 3D9QX 5E3IA 2DCUA 3ZWXA 3CLRD 1Y6FA 3R5JA 2Z2JA 3CLUC 4DM4A 1LZLA 4RNDB 3B9QA 3CVXA 4R31A 4HSGA 1OI4A 2Z6VA 4JX8A 1U2QA 4I9GA 4L28A 3IRVA 1PFVA 1QBGA 4B32A 1OTXA 3DL7A 1M8PA 2BGMA 3AY3A 5KVSA 4PCVA 4HZGA 2EW1A 3F5DA 4H0CA 5CEFA 5C8VA 1ZWLA 2QVGA 4AO7A 1MOZA 3UG7A 2EZ4A 2PIAA 5CT9A 4N5DA 2CBGA 4CR8A 4YMGA 2GK6A 3C6ZA 2A3RA 1JQ3A 5LMZA 1G3RA 2O8DB 1FJ2A 3NM6B 4DXAA 1J2JA 1D8TA 4KKXB 3LT2A 5DU2A 2QW0X 4A23A 4FYYA 2J0VA 3DBLB 2LUOA 3LG2A 4OFXA 2ZZKA 4BJHB 4HDKA 4E1AA 4O59O 4Y18A 2IL1A 2G4VA 3LQRA 3M6IA 4IRMA 3ETNA 4L9RA 1ADGA 4EP1A 4RF4A 3QE0A 1UK7A 3VV3A 2PN1A 1Z0FA 2BZGA 5BMVB 4RD6A 1EVKA 1WW3A 2DT8A 3MWDA 3P9SA 4J0QA 3NWJA 4ALLA 4QEZA 1MIOA 2PVPA 3QY9A 4KO3S 1GDDA 3QVSA 2ODBA 5FI0B 1OZFA 2F67A 3OOYA 2IS1A 4PTZA 5BR8B 5ALXA 1PP4A 1YJCA 2QI9C 4GX5A 2IPLA 1EX6A 1U9CA 3QEKA 1GUZA 1UBEA 2IYNA 2XOXA 5A9RA 2ORED 4OKSA 4HHEA 5HS4A 2OCIA 1A76A 2JH9A 3BMXA 1W581 1N2IA 3DB1A 5AM5A 5FPYA 3ZNOA 4EA7A 5ECGC 3F1KA 2F43A 4Y1GA 4EF5A 1MEOA 4KC0A 2O54A 2EGUA 5SY6A 1DKOA 1HI9A 3HU1A 3M5WA 3RUDA 4Z3KA 2XYGA 1FXUA 3G85A 3GGSA 4FYIA 4H7KA 4PYRA 1UFRA 2X0KA 4CKEB 5H4GA 3IODA 3U7GA 3LDGA 3SYRA 3S2UA 3AETB 2NPOA 3HBLA 3FG9A 3GLHE 1ND6A 1DAKA 2BD0A 3AESB 1D5CA 2ZJ1A 3KPYA 3VDRA 1W5SA 5JFOA 2QIPA 1I7NA 2Q99A 1MC5A 2PMCA 4F06A 3EEOA 3PXBA 3VX4A 3U7RA 4U9UA 1Q50A 2I7DA 4RYLA 2PYIA 4U6SA 5ILQA 4BMOB 4W5RA 5EINA 4ADSG 4B48A 4B6EA 2OWDA 5F2KA 5I8ZA 3NGLA 4YQFA 1Z7GA 1I01A 1IEQA 2E1RA 3CU5A 3MWDB 3GHHA 5LP6A 5F3DA 2JGAA 4RZ3A 1NULA 1RJ9B 1CBUA 3O8RA 1AGXA 5EWMB 4BX8A 1SU8A 4GRDA 3RT9A 1KXZA 2E5FA 1YACA 4B6OA 3WMGA 2WVJA 4YMSA 4ZTUB 5HILA 4JT8A 4JUCA 1LI4A 2BBSA 4PPNA 2MSWA 1V5EA 1D2HA 2M1XA 1RSZA 3LKBA 4U7WA 1CRLA 4GKAA 3QVLA 3RGWS 1ZH2A 4XSHA 1FW6A 3NV9A 3UWPA 3RVRA 5BUSA 5JAHA 2PL5A 4O25A 1NDUA 4QDXA 4EW3A 3RYTC 5CDUA 2J6BA 5J58A 4OX9B 2QMQA 1P0MA 3EQ2A 2MINA 3MIZA 1CS0A 1GOTA 3O4VA 3V4PB 1RYFA 1L8OA 1M7HA 2YCLA 3O1IC 4JD5A 4S2EA 4N47A 3RU3A 1LSSA 9MHTA 1XU9A 4Z9XA 1IXSB 3K0FA 3ROKA 4NNJA 2QM8A 2WJZB 1KNXA 1C30A 1O08A 1X7XB 4U7HA 1Y3FE 4NZPA 4G1UC 3A06A 1YHNA 4C7KA 1T8SA 1UXKA 4GWGA 1P3DA 5G2OA 2V6FA 2QR2A 3RYFB 5JU6A 2Z09A 2VJKA 3N0RA 3P9XA 4TV9F 3BTOA 2VYQA 3DE4X 4H35A 3C6KA 4LGVA 3WZMA 4UM7A 3D0RA 4K40A 1V7QA 1O94D 5EYPA 2XYPA 2DTDA 2AN5A 4L8VA 1WL8A 5IVIA 2O07A 2Q0HA 4KLAA 5G3YA 1HZZA 4ODIA 1CQWA 1T8TA 3JPYA 3VO1A 2K2QB 3DHVA 2UU9B 4XJXA 4JOSA 4A8HA 3WGOA 1RKBA 5SYMA 3V48A 1P29A 1U7XA 3TRKA 1IK6A 4XCVA 4M88A 3W8NA 4CUKA 4GZLA 3G1WA 4XVHA 2NQ2C 1JECA 4P2GA 2PT9A 1U6IA 1EYZA 3MB5A 4MRPA 4MDEA 2NUPB 2YJTD 4RHEA 5A1JA 2BY4A 4HUQB 2ZAGA 1IVNA 2FR0A 5FIUA 4D80A 1P1JA 1SXPA 4G36A 2QVLA 3F98A 1O95D 4MJ3A 4N0MA 3HACA 5EUQB 4UXJA 2LNDA 3R77A 4Y1RA 1SURA 4M8IA 4F4JA 1YCFA 4M1EA 1Z2CA 2V58A 4UUOA 2Z98A 3S2FA 2Q4EA 3GGJA 2QTGA 2XTJA 1JFLA 1ENOA 1L8XA 1VJ5A 2RIPA 3N5KA 3C6BA 3W1EA 3U1TA 3COZA 1CUSA 3T3EA 4B6FA 1D7OA 1KWKA 4LQCA 2XXAA 3KX2A 1ZVJA 3COWA 4NSNA 5L7TA 4O3MA 4KE6A 1ZH8A 2W4QA 2FEOA 4OV6B 1C9KA 1Z2DA 3VBCA 2O5CA 4HWPA 3NYWA 4Q12A 4Z0TA 1E7YA 3N86A 3D6FA 5I9IA 2QGFA 1TNDA 1QFZA 1RT9A 2IITA 3ABIA 3TSOA 3TJMA 2I03A 2Y1EA 3OCVA 5M34A 2LCIA 1VE3A 1I6KA 4F4CA 2IJGX 1GPYA 4CKEA 3NAQA 1G3IA 4OXRA 5GV7A 2D4HA 3OCWA 4N12A 5EY5B 3P5SA 3LHSA 1CZHA 5BSMA 2GPTA 4MEJA 3MB8A 1KJYA 3QVUA 4BFLA 5GIOE 1DHTA 4PEVA 1X42A 1KC1A 3NG1A 2P0YA 5FEMA 1E64A 2QT9A 5C8XA 3OTWA 1SXIA 1QGDA 2DBQA 2QTCA 2ZS8A 4JN6B 4UMEA 4H16A 3E5MA 2OBFA 1QX4A 2VDWB 3W5AA 3DLCA 5ALRA 3H1AA 1LV8A 2ID4A 1UP7A 2RHOA 5IN4A 2RHMA 4BNGA 4YTEA 1Y7HA 5AI6A 1RAIA 2CMFA 4NABA 1FS5A 2XXBA 3DVLA 4I7EA 1XZKA 5DYNA 1E1MA 3LCCA 4PGAA 4UTVA 1SC1A 5CUQA 5CNMA 3L0DA 3PQDA 4I36A 1Q7TA 3QIVA 4DLUA 4YT2A 4Q5IA 4I8XA 2HQRA 1ECCA 3C3KA 4UULA 5FTWA 4R98A 3VPXA 1J0EA 4DXHA 3NTXA 5A4KA 1FFYA 1N5LA 3KFXA 2EQAA 1ECJA 3EIFA 2JHAA 2O8NA 1VGQA 2C8LA 5FOUA 2PV0A 4G25A 2VXCA 4KX5A 1D9XA 3IUYA 3V4OA 2FWBA 1NT2A 2PL9A 2NO4A 2JJYA 3QKSA 4QHTA 4IDGA 2ZYDA 1WUHS 3X1KA 3Q0TA 2OZKA 3GEPA 4NE2A 2YY7A 1OLUB 4JA0A 3OKPA 2PO7A 1DRKA 1RABA 2ABWA 2H7XA 4MK4A 1Z6QA 4O4LA 2F3TA 3I6ZA 2C92A 2FE1A 4J16C 4BCDA 1ZY2A 1JILA 1V9SA 4FI3C 4E5MA 1IVSA 2RHWA 2Q2WA 5CHEA 1G0NA 2Y1FA 4Q1BA 4EAAA 4X0EA 1ELOA 3MTGA 1HYGA 1P73A 3EFEA 3OD1A 5CIQA 3ZVLA 1DRUA 5KHLB 2PUEA 2NU9B 3S5UA 3RTDA 4U2CA 4EFMA 3C7TA 1KZGB 4YV0A 1T1EA 2CHQA 2H2WA 1NQAO 2OD9A 5KWEA 1BW9A 1GQRA 1H0SA 4WXMA 3QUBA 5T5QA 4LTNA 4KAAA 1QFYA 1JR2A 4AJIA 3KUDA 2ODAA 4WADA 5J2TB 2PHZA 4IIFA 4DQKA 4WESB 5LN1A 2H63A 3TTXA 1GTSA 1Z7EA 3CSSA 2WWVD 4ALKA 3DULA 1NU8A 2V9CA 3N0VA 4Z8XA 2XYQA 3BERA 1ZGCA 3ZH2A 3PNQA 3ZDRA 4DLLA 3IEUA 1G6Q1 1MB0A 3WWCA 4YUXA 4Z0HO 1GNVA 5E7IA 2BH2A 2C2YA 4G4SO 4YCAA 4BFYA 4BKRA 4AQ7A 2XHZA 1D4FA 5HIJA 1H9AA 1GQOA 2R1UA 2A9FA 4BEBA 3AMVA 3DMTC 4KE8A 2IOFA 2XDWA 3L0BA 4LHWA 2Y67A 3R40A 4U63A 4AKHA 3GRVA 3W2TA 2DWCA 1YS2X 2Z57A 4B34A 1JKJA 4OJNA 1YAJA 4G4IA 1SCIA 4RY9A 3IAEA 5H7XA 4CDRA 3DEJA 4NMHA 1PUIA 1E5TA 2FFRA 2QYTA 1ESNA 4AX8A 3QVOA 2QLNA 5C51B 3OM9A 3AWIA 4NCXA 4OFZA 4XQGA 3E5NA 3G2QA 1NPDA 1RLJA 2BMJA 3G68A 2A84A 4MCJA 4HEJA 3EFOA 3OC6A 4US1R 3DOUA 1XRQA 1H8HD 2FZ5A 1VQ1A 3MGCA 4DPLA 3IMCA 3A9RA 2V0CA 5EOVA 1ZESA 3RS5A 2ZIXB 3EXFB 4OK3A 2AH5A 3DBOB 4UREA 2XNSA 4AP9A 2QZSA 2JS7A 1A8IA 1W25A 4V3BA 2X8BA 2GM9A 2WTAA 2R3SA 1Q1GA 4Z7QB 2UVDA 2D4AA 1OZHA 3AVOA 4KYTA 4CU5A 3KK0A 2QAIA 4EMUA 5BVGB 2HMAA 2I6FA 3SKVA 5TQVA 4HVCA 2QJFA 1OXXK 5JSYA 1MOQA 3RS2A 3M1AA 2A5GA 1WE2A 4DDKA 4OMDA 3G1UA 5AVTA 4PGHA 5JAZA 3A28A 3OPYB 4NG5A 4NLLA 4E5DA 4RJTA 1BGXT 1MRNA 3CIFA 5D5HA 1HKUA 3WGIA 4UNRA 1PT6A 4KPGA 1Z56C 4ZK6A 2O1WA 4KPUA 4OHFA 1NNLA 3R09A 5FNVB 1XNGA 1PL6A 3EVDA 1CJUC 5IJ9B 1TJYA 1EFRD 2WJAA 3VYSB 5D3QA 3SSMA 3CX3A 3KM0A 2NSLA 1E3WB 1NMXA 1Z7YA 2VH1A 3R6GA 5GMOA 4ZAXA 4J0KA 4TWJA 3L6CA 3E61A 5JCOA 1X7YA 4TVKA 2QG6A 2ZYHA 3TNJA 4JYPA 2I2BA 1EK0A 3AL0C 4KKVA 3DDZX 1U31A 4CLRA 1TGVA 1AQUA 5DLYA 5B1YA 1Q7GA 2FKAA 2FMIA 2G25A 3H8SA 4RTRA 3C70A 3K70C 1DX6A 1IHXA 2J5KA 2O0JA 1VLJA 3G0BA 3TQFA 2XOKD 5KNDA 1CUUA 3FHJA 3WLSA 2GZSA 3E2PA 2E48A 1I0ZA 1WY5A 4PSAA 1E59A 3OZEA 4LJSA 4QTZA 4UCXA 4WCFA 4XEUA 3DNFA 1MQAA 1SUAA 3OCYA 4Y98A 3F6YA 3SQWA 4WAUA 3GAMA 4N8DA 4D8YA 5FWNA 3I5XA 3ANNA 4X20A 4EG3A 4G8DA 2G04A 5EXDA 1T29A 2C7QA 5F12A 4GGMX 2QSYA 1U0LA 1Q20A 5KHAA 3DKPA 4AYWA 5JD6A 1NKTA 5DGTA 5KJ6A 2JZNA 1WM1A 2PDAA 3NEPX 4OUKX 4WTOA 4GLLA 5DM4A 4DVGA 2Z6QA 4LX8A 4B2LA 5JXJA 1JIIA 4G4SP 3RFUA 2X4LA 3KD3A 3MRTA 1RM3A 2B37A 3WR5A 5FUXA 5KNBH 4ZHQF 1Z34A 5C3UA 1CX9B 1T5TA 1PR4A 4AKEA 4CMBA 3BAFA 1CPYA 1OU0A 2BN4A 2AI1A 1BN7A 4URWR 1Y1TA 2CHVA 2ZSFA 4H15A 5TX7A 4US0R 3TYXA 4GBGA 4FDLA 4HF7A 1RPJA 1CY8A 2H7VA 5B37A 3JAMA 2VDWA 4KO8A 2AOXA 3K6RA 4U2FA 4B3SB 1R15A 1WTCA 1E1YA 1WUTA 2Y71A 3MRSA 2BSQA 4FZ5A 4FYHA 4LZZA 3KJXA 3E53A 1T6NA 3R5TA 2AI2A 3T1VA 2J9GA 3WG9A 5C3MA 2C82A 2CFTA 5ITZA 4DMUB 3W7VA 3WYNA 3DT9A 4HFNA 4WGFA 1QRDA 1UT6A 1X2EA 2XLBA 4AD8A 3DZCA 3EVNA 5JJIA 3TQSA 3VYVA 2Q0SA 3OOWA 2XWBF 2CL6X 1NYTA 4LJYA 4R41A 1BEEA 2ZVJA 4N8EA 3AKCA 1LKZA 2EP8A 2PMEA 5A9TA 1OREA 3WB1A 1U3VA 5KYXB 1HFJA 1D2NA 3AH8A 4XLTA 3K5HA 4XVRA 4F96A 5EE3A 1SKYB 2ACVA 3V8BA 1ZW6A 5DV9A 5LLSA 1KP3A 1W88B 3MWGA 1F8FA 2PY6A 1AUPA 1CR2A 3QLJA 2V7BA 4TRMA 1D6JA 1ULHA 2Q9AA 2XAAA 3DOIA 4GM1A 4XUCA 5FI5A 2GM5A 3BCRA 1SD5A 5D2CA 5JC1A 1MHTA 1MBZA 3C7KA 3CZ4A 4ESOA 5JD5A 4KQ9A 1VMDA 2HJ9A 1J2RA 1T1JA 3JQFC 5FD8A 2OUKA 5HIMA 4D9FA 3H5WA 1NT4A 5CFRA 5DBHX 4P86A 3UMCA 1K4YA 2ZG6A 1L4HA 1YBFA 4R9UC 2YMPA 3I9MA 3AVPA 4L6AA 4W9NC 2I91A 1M34A 4QG7A 4MJLA 2ZSUA 1XRRA 2JAUA 2Q6OA 3WB0A 4K26A 1VJDA 2ZUSA 1YA8A 2A9VA 1Q5PA 1GFIA 1U3WA 2HMWA 2YWHA 2Z9BA 3EGXA 4WBSA 3MTIA 3I4CA 5ICGA 2A5FA 1TF2A 1WZNA 4RLFA 3A6HA 5DNEA 2ET6A 4JBXA 4BN5A 4KDEA 2YJ5A 4DN6A 2BE7A 2QB5A 3LGXA 5K3CA 1GEEA 4NYIR 2J7PD 4HSEA 2B7LA 2C5LA 3SAJA 3U4MA 5MF6A 4DB4A 2WC1A 5DNYB 3M1YA 1CY7A 1K7SN 4UHBA 4ZXFA 3U3KA 1U9IA 4IL5A 3LOUA 3HDQA 3ACDA 4D4MA 3HBMA 1E77A 3KJNA 1QGZA 4HPXB 2X1VA 4F5EA 3ACCA 1IYZA 1EXNA 2OSBA 5K9ZA 4L8LA 3QF7A 1T1SA 2D54A 3ZLBA 5FNZA 1F17A 3U4HA 3U44B 3F7TA 3SS9X 4EI8A 1GILA 1K8ZB 3NIWA 2IEZA 3E3MA 4LHSA 2FJUA 1KE2A 4IGEA 1UBSB 4PNPA 4C7BA 3HLKA 4LHVA 3UUFA 3DAGA 2DULA 5B2FA 1JLMA 1LSJA 1FJGB 3M9LA 3L84A 3DZHA 5WRFA 1WF6A 1C4KA 2Y2UA 3F4LA 5I9NA 2CSXA 1PWZA 3AETA 1CIPA 3L7JA 2PSJA 1CJSA 2GLXA 3EBOA 5EHQA 2DFDA 4JZKA 4KQEA 2VQFB 3VR5D 2H2GA 1D0VA 2WJHA 3LQ4A 3G5MA 3FVWA 4M1SA 5KU7A 1SKUA 2J3IA 1NATA 2VP0A 4GBJA 3E9YA 3C4JA 3F8TA 2FW6A 2Q3DA 3IIEA 2P5YA 4OREX 4UEWA 1KAOA 2Z2IA 3HGTA 5JDCC 4KAFA 4L4UA 3RSZA 1S1MA 2OB2A 2BGKA 5BN3B 4EHBA 3TTTA 5G0UA 4A27A 2IBTA 4D5EA 3M3PA 3PGLA 4LOAA 4MZDA 3L8YA 1KS9A 3I09A 4GZ5A 5FNVA 5REQA 1J70A 2GPBA 3OUTA 1YQ9A 3PTLA 1BVYF 2WYUA 4HFRA 3D2AA 3FCSB 1TXGA 4HRYA 4TUYB 2NVUB 3KHSA 1BWQA 3A6DA 3BXFA 3IPXA 4MWGA 5SY9A 1IC6A 4Y0VA 4BAGA 1V11B 2FG5A 4BNKA 1WVIA 3LQKA 5L3SA 1VKNA 4EGAA 1EVQA 2WW8A 4I8IA 3S6JA 3BGDA 2DUNA 9LDBA 1UEXC 4IDPA 4PG6A 2H1CA 1RCUA 2NM0A 3UGKA 3DYVA 1L7PA 4FYJA 4X61A 3E2MA 4Y6OA 1OW3B 4QEKA 5CDYA 1Y5MA 3S0JA 2JI9A 3PYXA 1WCWA 1IRIA 2G17A 1DVRA 2A94A 1PWHA 3P27A 4JB2A 2DG2A 4EYOA 3H4IA 3D6MA 1TI7A 3VR6H 3N05A 4PAQA 3GPLA 5J40A 3PUVA 1SUFA 3ZXSA 5BNTA 4Z4EA 2G80A 4D3FA 1MG5A 4MDYA 4EA6A 5HTOA 4GUDA 2WTBA 3I9LA 4LSZA 4WASA 3OY7A 4X97A 1KZ6A 1VI2A 4A2PA 4XWWA 5TV2A 1RC1A 2KJQA 3WZ2A 4IFEA 1BIFA 3ANSA 1LY1A 3B1FA 3L1UA 3PCRB 4Q7LA 2CHUA 5G41A 3GRKA 5KQRA 2HF9A 3GO4A 4TQGA 3C5HA 4HVAA 3VVMA 4ERXA 3A10A 5TLSA 1R9JA 2CKMA 1JQLB 3UY4A 3BD9A 1OLOA 3EPLA 3R9IA 3NXKA 4YT8A 1U7TA 5H16A 1GLNA 1F9EA 3KTAB 4WOBA 5NLLA 1FYWA 3I53A 4OLBA 3O4FA 1QKIA 2X23A 3HCRA 3Q0EA 5CH3A 1Z2NX 1F2UA 4DV0B 1OJLA 3NHAA 4MP6A 1OWNA 4D8WA 1RIFA 4LECA 5KREA 4DKJA 4OQZA 3EQZA 3OCCA 2EX1A 1SXHA 1FP4B 3UJBA 2CJYA 1YJAA 3BHJA 4PANA 1J90A 2WOJA 4Q00A 1I10A 4Z9YA 1EG7A 4R0MA 4KK4A 4J2TA 4M8SA 1F0KA 4R1OA 3KTFA 4OHCA 5DXAA 5IJAA 2QL7A 5CLLA 4XVQA 2BE9A 2O5RA 4Y3UA 2FEXA 1SVUA 2DC1A 2AFIA 2JCXA 1GV1A 4L5YA 1PNVA 5DISB 3SBDA 4IAOA 1AO3A 3QYAA 4K6CA 2J4CA 1NM5C 2RI1A 5T7BA 3IDZA 3OQ1A 4NJMA 1EJBA 1UFVA 3COJA 3G17A 1A9XA 1C0LA 3QNUA 1M3SA 3OZAA 3M6VA 4P4NA 2ZRLA 3TSCA 3U62A 3DFUA 4U3JA 3A05A 1O6CA 2E85A 4QULA 2H4HA 4ZGGA 2BGGA 4EMTA 5YASA 3O21A 4WBNA 2FPOA 4IMPA 1RBYA 4TLCA 1H5NA 1QX3A 3GP5A 5LZ9A 1MG0A 2H51A 2JA2A 3AJRA 4KH1A 1W8DA 5DGHA 4DANA 3GLFB 3A6EA 4OJMX 1LPPA 1IN6A 2J4DA 4D9MA 4F7WA 2YXNA 5AOCA 3PPWA 1K1EA 1RWMA 2UYOA 4LWQA 4S1VA 2GS9A 3N74A 3UC9A 1IBKB 4DEVA 1QYRA 5CURA 1NQWA 1D6MA 3G9XA 4H4DA 5J3JA 5E6RA 1ZJ4A 3R3ZA 3W78A 1HY3A 1XKLA 4MRVA 1VHQA 1B6SA 1ZW1A 2Z5GA 5JXWA 2E4VA 3PDWA 2PGIA 3WLPA 2Q6IA 1OXBB 4C03A 2NG1A 3A3OA 4DCNA 1H5UA 5L95A 3GB9A 4X1IA 1DV2A 3BA1A 3K4PA 4ZOLA 4EG4A 2HWYA 2JHCA 3CUTA 3KQWA 1WB6A 5E4TA 3RV4A 2PKCA 5AD1A 4XOUA 1TZMA 5CXSA 5TPZD 1H66A 5CHYA 4YAGA 3PJRA 1RBMA 3KKQA 5EA2A 2B69A 2G82A 3HU2A 2QRPA 4EY6A 2YXDA 3OLCX 1KPGA 3HABA 4B31A 1DIBA 2CZGA 2C8VA 1E79A 3FLEA 4YJ3F 3BJIC 2VCHA 4NBLA 5CBKA 4PVDA 1OWPA 1ZGHA 5C5DA 2YOFA 3VM6A 5DN9A 4NEHB 3HGMA 4TTSA 5EIAA 1G5PA 3AJEA 2GEVA 4UC0A 3OFKA 1G7CA 1NN5A 1YOBA 2X3UA 2PZKA 3GZTB 2VSQA 2P65A 4MKGA 3SBOA 1DC8A 3ME5A 5G40A 4RPJA 5K3BA 2ZETA 4P34A 3M6XA 4I9FA 2QX7A 2X0JA 2YWFA 2RONA 5JZ9A 1GPMA 4Q3DA 4YASA 5E1BA 3U60B 5JS7A 3NHUA 1KO5A 2NXWA 3T0FA 1XJQA 1ZA2A 2XD9A 3HYRA 4F3CA 2RI0A 3GR6A 1AZTA 4R2IA 4I8DA 2KSQA 3IXMA 3EWNA 5CH5A 4MRNA 2MMGA 2WSLA 2YRWA 3UAXA 3TR6A 1BG6A 4M9XA 3REFA 1P18A 1Z5NA 4V0QA 3GK3A 3H7AA 4ZTBA 2BTOA 4RS3A 3WBBA 1PT8A 3AC0A 4DR6B 3H2BA 4PWZA 4D6XA 1DKQA 3U7FB 4C4AA 4EH1A 1XA4A 4MV9A 2DUWA 2JFWA 4Y6PA 2R44A 1VKOA 5JTTA 1MPXA 1FVXA 4HDSA 2NX2A 4P33A 4CL8A 3P45A 5EP1A 4B75A 2EJUA 2XRFA 4EW6A 5IJWA 1Y1KE 1Z07A 5KVCA 4MAMA 1L5WA 3ER6A 3G9UA 1M9NA 2ZK7A 2X5OA 4HUTA 2AN4A 1M72A 3PEWA 4TMFA 5CLHA 5JISA 3RJMA 1L5GB 2KW5A 5B7GA 4G63A 5CLJA 1DXOA 2NZUG 5AW8A 1P4SA 2BC9A 2OP0A 5C7LO 3NBMA 4OGKA 1YRAA 1OV6A 3JZFA 4EG7A 3MWJA 3ZWPA 4TKVB 1XFAA 3G82C 3SC4A 4EKYA 1ORDA 1PQYA 2QZ9A 1SU4A 3EULA 3U7QA 2FJ0A 5FYQA 3IIMA 5BQOA 4G23A 4JVLA 4EHJA 3T3GA 4AS2A 3L6EA 3U3OA 1VMEA 3FPCA 4IVQA 1XZAA 3HMQA 4YFVA 1RVDA 4C05A 2HA2A 1JWLA 16PKA 2AZTA 2QMYA 3ROQA 3QPUA 4S0XA 5JEEA 3PDJA 4DC0A 2IV2X 3FSGA 4YCJA 3T8YA 3WS7A 1QHFA 2DH5A 3K0CA 4JWTA 4WOJA 3S2SA 4CHGA 1J49A 3G13A 3I9KA 2O23A 4A4DA 1TT7A 3L6BA 3V1UA 3OM8A 3ZKAA 4MQFA 5DEOA 5I4CA 1ZM7A 1NONA 1G5RA 1YONA 3DT6A 4KFCA 2VP5A 3A1UA 4KN6A 2R8OA 1OTYA 5B1SA 2O20A 2VAVA 5EYPB 5HKKD 3OCJA 1DLJA 2BKUA 3F6RA 1IM5A 5DYTA 1NTRA 1ZRMA 4NJOA 2O2HA 3LQYA 3ZV7A 1Z39A 5IAEA 5KJ1A 3IUMA 3TM4A 1QTRA 3M89A 4LZWA 1YZFA 4XIGS 2JARA 1QHIA 5DFAA 3BMNB 4LGYA 2I66A 1L4MA 1IRXA 5EPEA 3M8KA 4Z0PA 4H7JA 2DKFA 2FUEA 1PJSA 1GRVA 4Q7MB 5FPTA 1S3SA 1TIKA 1JEOA 4W5WA 4RTLA 2H85A 1WOYA 1LDNA 2ZEJA 4YJ3A 4CZ2A 1T15A 2WILA 1L5QA 3JARA 1IN4A 4JI1B 2MJLA 3KDPA 5F5NA 2H57A 2CB0A 4MWTA 4UAGA 2QPLA 4PG8A 4MUEA 3AV3A 3QKIA 5EE0A 1KY2A 2OO3A 4M8LA 3TVYA 2R8BA 1NVAA 2VCEA 3PUXA 5CCBA 4RHYA 3HBFA 4RMIA 4LXIA 2HSWA 3OZGA 2HD4A 3MCTA 1EFVB 3VSBA 4D9HA 2IPXA 4IHJB 2FUG6 3OHMA 3PFIA 4R16A 2F3QA 2IF2A 2JFGA 2Z56A 2N42A 4N7JA 4ZOAA 4BU0A 2EFDB 3HXKA 1Y4AE 5TQ2A 3WL3A 3I1FA 1RI4A 3L4BC 3PNSA 5GJCA 2YVLA 4X84A 5KSZA 2I33A 3RHZA 4TSFA 2PX5A 3HL0A 3VA7A 2ODNA 2HMVA 3ZV3A 1P7WA 1AKNA 3O75A 2ZS7A 3GPIA 4FSHA 5LUAA 5FAKA 2ORVA 2Y0PA 4QM6A 2WTNA 1GL3A 2YV1A 1FW8A 4LXTA 2X0FA 2QMUA 1YR8A 4QUKA 3GDOA 4TPKA 1WHTA 3WRXC 2P30A 5FWDA 1QONA 2QN6A 1XZMA 3LYUA 1Y5RA 5CX1B 1Z6ZA 2X5XA 3I3SR 4Q3AA 5BO5A 5TEVA 1XRLA 4FJ0A 4W7IA 4P4LA 5IU6A 2AMJA 4XQ9A 3Q3HA 4OLJA 1EP3B 2H2HA 2POCA 3MUOA 3QTBA 1O0CA 3KXLA 4U8GA 4CKCA 2O8CB 4BTLA 3BEOA 3F71A 1YIOA 3GV0A 4LRTB 4HX5A 2CJFA 1F2TB 2GD1O 4HXEB 3EG9A 1WWKA 3TQHA 3GJ8A 3MSCA 3UNXA 1Y63A 5A4JA 3K9LA 4MVCA 5J43A 1ORHA 1Z2PX 1C3VA 5I7UA 4NCAA 2FNAA 1CJTC 4CR6A 1DXQA 1N6LA 3QV2A 3EXIA 2WUWE 4HNHA 4ZALA 3WKDA 1H3EA 1F7VA 2NACA 3B7PA 3UTDA 3TB4A 4CLOB 1VB3A 2WM2A 2OCLA 3AL3A 4GOLD 4HVTA 1G8KA 1CK4A 4URZR 4Q9KA 3EODA 5JSHA 2Z8YA 3WJAA 3K72B 3TL2A 3VQTA 5ADVA 1CUHA 1RS0A 1YQQA 2GJKA 2ILVA 2Z58A 3CEPB 2VDLB 1RADA 2QN8A 3OU7A 4RE6A 1NU6A 5DK4A 2K87A 3DCIA 3Q11A 1OWMA 4AG3A 3H11A 4Y6LA 3MLBA 1QH8A 2MMCA 2Z2KA 4P84A 3UM9A 3D7LA 1Z2AA 1N25A 1BX1A 1T6XA 3T7SA 3UMVA 2NW6A 2O8DA 2P0AA 4B3BA 4ER3A 1TUEA 4L02A 4PX5A 2IUYA 5IT4A 1A82A 4O29A 3QE4A 5EIEA 1W6RA 1GG9A 1WXEA 2RDMA 4OXIA 4RA6B 3T5BA 3VC3A 3U6BA 3DL4A 1XKQA 2HLNA 2NU9A 3PWTA 4TS3A 4MLPA 1I13A 2FVYA 2VUTA 4HMOA 3PIRA 4HS9A 4HUQA 1ZH4A 3JWIA 2HV9A 5IEJA 4M0KA 2KM1A 3BBLA 2BYTA 1JZTA 2A30A 3AK4A 2C57A 3PSAA 4RUKA 4BJ1A 2IS6A 3BQ9A 3JD1A 4XRRA 4LJLA 5HDQA 2QTTA 1WG8A 2PV7A 2CNDA 4EHLA 1KH2A 1XF1A 2JH3A 2A9JA 1Y37A 5F98A 1TGYA 3IEPA 4HXFB 2YRFA 2IA5A 4JLVA 5JMPA 3SYLA 3TOZA 1ZC4A 1LBTA 1XG5A 1THMA 4NL4H 1D07A 4Y2GA 2JIBA 1AM4D 4BX0A 4TV9A 1JR4A 1PAUA 4N0EA 3QMMA 4TYYA 2JFHA 4AMGA 1ENPA 2AZMA 3VR2A 4D02A 2JIOA 2JK1A 3P2IA 4QJ5A 2RI6A 1NQVA 4G85A 4HMQA 5HE8A 4D4IA 5K99A 3MOGA 1V35A 1DTWB 5JAOA 5K4HA 2A86A 3BE5A 3BE8A 3EQ6A 4PHTA 4C2TA 2BDTA 3R7FA 4BVHA 1JI3A 4QJ4A 3RSSA 1IXRC 5L3QB 4KN8A 1WOMA 2ALJA 4P83A 2FXIA 5B2EA 5K8LA 1W9MA 1PZMA 1CQPA 4TLBA 3U3DA 2I2WA 2RHRA 3GT0A 3TEFA 4L8FA 3O0DA 5CH8A 3LX4A 1STOA 1VDZA 4UJ3A 2A2ZA 1PW5A 1EFRA 1C1XB 1E3QA 3EZLA 2QIOA 2A67A 1V1JA 1PJBA 1RXIA 3NCHA 2WVAA 3LX8A 2VA9A 1QAMA 3RUIA 2FPRA 4MCAA 3MD9A 5AKKA 3VKHA 3KDSE 1GA6A 4UXIA 1QHHB 3EGWA 1OFTA 3S1LA 3U4QB 1T9CA 3F6PA 4RU1A 4ZT6A 5IWCA 1JNYA 5DN6D 1VXRA 1ZCAA 5JVDF 2C7RA 1GFZA 2QROA 3CVVA 10MHA 2YKGA 4ZDIA 5I4IA 4RFSA 4XLLA 3T5TA 4EJ6A 3NIBA 2ILTA 1TB4A 3RKRA 3BFJA 1WETA 5C52B 2HLPA 4X8MA 3LQ1A 1O94C 4FCVA 3ZY2A 4D99A 2CCGA 4GOND 1WPGA 1BROA 1JSCA 3T3OA 1C9NA 1NBOA 4ENWA 3ZWWA 1NBHA 3RTGA 1Q92A 3WE7A 1HKHA 5IAKA 3ZHOA 1AO0A 3PQ3A 4XSVA 2OV4A 3TSAA 3SYMA 5HOQA 4URVR 3IVAA 2IXBA 2P41A 5JJCA 4MP3A 4ZT3A 3L1JA 4AY6A 2QMHA 5U4XA 3MBOA 3PUHA 1A8QA 5HNKA 4YS6A 2IZZA 4PGFA 1M5TA 2NYRA 3B6ZA 4WECA 3V1NA 2QJWA 2C96A 3CJRA 4YMHA 1A8UA 3BIJA 1XD8A 1E6LA 2M2IA 3DL0A 3QG1A 2HNKA 2XNHA 2H9AA 2ZI9A 3FWPA 3N2KA 2P4SA 1YRQA 1PEDA 1WXGA 4YREA 3RI3A 1FSPA 2X42A 5EP3A 3D6UA 5DI3A 3C3AA 3D6JA 3L7DA 1LJUA 3VZDA 2GTIA 3PRKE 1EM8A 2YWBA 3RVJA 2WHYA 3AOGA 1UR5A 1Z74A 1RKVA 3A9WA 2GT1A 1GN8A 4ML3A 4WCFC 3K9CA 3KT8A 3FIUA 4LJ7A 5BV8A 1CYEA 3AY7A 4CTNA 1TUBB 5F77A 4JVMA 1JDNA 4LYFA 5GQSA 5DT9A 4GPTA 1L4YA 3N53A 3MT9A 4BV3A 1PEKE 1TLTA 2VQSA 1E7SA 4QHYA 2XZOA 3W3ZB 3RHTA 4XEHA 3SBEA 1RQRA 3SHFA 2ZWVA 2VHJA 2PLWA 1XZEA 3DMDA 3ZDEA 1B43A 2UYQA 3VAYA 1M2KA 1MJ5A 5ULLA 3ZD7A 3CEHA 2RD2A 4FMBB 1TADA 1YQDA 1EHIA 2I29A 3NDRA 3C7CB 1KSJA 1K3UB 3OT4A 2OBNA 4N3GA 4O2AA 3RF7A 3VR3D 4AP6A 3C1TA 4KR3A 4D0RA 3N8NA 1THZA 3QBTA 2J3JA 4EUNA 4RIFA 4F3RA 2YYZA 2EHJA 2OFWA 3ULKA 3Q85A 4BLRA 4YJFB 3RVOA 5JUWA 4HGYA 3GGPA 2O6LA 4BOYA 5BWOA 2H2IA 4QHSA 2ZRDA 7AT1A 2WIJA 3HB9A 1BCSA 1MQ8B 4IXTA 3DZ8A 3EPPA 3PD7A 2Q4RA 521PA 1BFDA 2JJ1D 2VHZA 1EVIA 3FVTA 5DWQA 4R84A 4Y8VA 3UMSA 4JFAA 5A5VA 2DLCX 1U5AA 1RHRA 3EF1A 3H99A 4N6NA 1WULS 1TK3A 1ZJZA 1MJGM 5HRUA 3RUFA 1YF3A 4BJ3A 2F1IA 3M6MD 4QDKA 1A77A 2E21A 1N1DA 3H65A 3KQMA 3RUAA 4E12A 1JHVA 2BAGA 2IOFK 3FCCA 5FBKA 1XLTA 1LVHA 1YZKA 2HN9A 4EA9A 4BKPA 4UTOA 4F8EA 1X74A 4JASB 3SIWA 4A6PA 2Z4RA 4DR5B 1DJPA 3LCVB 2P4HX 5I8WA 4BLVA 1MB3A 4ZI5A 2ZRBA 5A4IS 4Q02A 1DEHA 3DMFA 3JAKB 4N6OA 4H6XA 4J49A 3FWNA 1TL7C 1TYDE 3HXPA 2O59A 2XNDD 3BMOA 5DLDA 3ZEIA 3BL5A 3IO3A 4NOKA 2XBMA 5K6TA 2P62A 4Z54A 2EFYA 2HWKA 5KYUB 3W8RA 4FHGA 3BX1A 2Y3IA 3MYYA 3ZHCA 4TSKA 5IT0A 4RKWA 1GTL1 2AFHE 2VT7A 4OY3A 3FRHA 5JATA 4K2AA 2VYND 3MRVA 4GR4A 4O5AA 1Z4KA 3SF8B 4CGYA 2FLWA 3G1TA 4KQMA 3MNFA 1XMIA 4IGKA 1TKBA 1TQHA 3C8MA 3PTAA 3I1JA 1NZDA 1OI7A 1FRZA 1JW9B 3DVAA 4CLXA 2QUKA 1ZRHA 2W4IA 2ZIFA 2PXXA 1VDMA 4DA9A 4DUZB 1E8MA 1UT8A 1XEFA 3N2EA 3N0WA 3STYA 3BXGA 1IXYA 2EOAA 2QLLA 1W47A 4CM7A 4GVXA 1Y6GA 3JQ9C 1UJBA 2IOYA 1Z0IA 5C1OA 1RTKA 1BGVA 3DFZA 2JLVA 1T4BA 3CZ9A 3FN4A 3FRJA 1N8TA 1FMTA 5E1OA 5DHRA 2A88A 5DN6A 3UPTA 5L3VA 1W2HA 1Z29A 3KVOA 4ZMSA 4ZOCA 3Q7QA 3FLAA 3GLVA 4F85A 2IY8A 3ZZNA 1I3OA 3ORQA 4F72A 4UZEA 2OG2A 5HPYB 3QMWA 2FFBA 2YWJA 3LUAA 4WUTA 4ZA2A 2PX8A 5J4HA 2VL7A 2A3NA 1AA6A 4QBKA 1E9AA 1U2GA 4AJ4A 2WVGA 4MQMA 3ZJVA 3ZTTA 4J1QA 4BPRA 2RBGA 2Q9CA 2WAOA 3V4RA 5KYTA 2V5VA 3IBYA 3JZAA 1CUZA 2NV0A 2RGAA 4HH4A 4DV3B 4CKBB 3KOYA 5JQGB 1WKBA 2H3HA 2PWPA 3DFIA 4C7OB 5BOVA 5C8YA 1W0KD 3DVAB 2X3YA 2WABA 4DCUA 2BI7A 5EWMA 3CKYA 5EUMA 4NECA 2PXHA 2VYVD 4BGIA 1ZD9A 5LP1A 2RGDA 1Q6ZA 2AL7A 2BBWA 1UBUS 1EIWA 2G67A 2YIVX 3RRMA 1P9OA 1VA4A 2CD7A 2MYTA 4G5QA 2DHDA 1NJ8A 3MMZA 1KVQA 4OQNA 1NVUQ 4TN1A 5B3JC 5E0KB 2SICE 3RRYA 2H52A 4JBWA 3KKMA 4IICA 1D7AA 2DMRA 4N0QA 2E9SA 4UNSA 1LDEA 3NONA 2GF0A 4UTZA 2W6ZA 1NV9A 2VR1A 3W7BA 5K03A 1G66A 3LUHA 4R1TA 3WHPA 3GP8A 4JIMA 4BL5A 3IO5A 1T34A 4OOFA 1LZKA 3RTBA 2PS3A 1QV9A 2CXOA 1JLSA 2JW5A 3I45A 4N5MA 4RANA 1PVOA 2ZSEA 4J1SA 2E87A 2H5LA 4R8SA 1XCBA 2YZKA 1IBMB 3EZGA 4FGJA 3B53X 3ZGYA 3BTVA 1X8KA 2CYCA 3NFYA 4H1VA 5JJ5A 4DIOA 1ZGGA 1SZDA 2FQXA 1NW7A 4RF2A 3VR3A 5A0VA 3MZ0A 1KDZA 2Y76A 3BH0A 3C87A 3JWEA 3QXSA 1CQXA 1EWRA 2WG0A 1WMEA 1OH6A 4W1PA 1DMSA 3VZSA 4KIFA 1A50B 2FN4A 2NU6A 2UKDA 3AF5A 3UGQA 2RGRA 4J3FA 3MXTA 1HORA 1DUSA 1E6WA 4HLCA 1QU3A 2HEIA 2ONCA 3L0OA 4UHFA 4OHZA 3LK6A 2E4ZA 4C0QC 3ZGNA 4UTPA 1E2PA 2VAPA 1KKLA 3QKTA 3QPCA 1V2HE 4FYVA 4LVNA 1E9RA 4MV1A 1J2EA 4B7AA 1VL0A 1F20A 3WAKA 1XALA 2DCMA 2VNJA 2PKQP 3PT9A 4GLFA 1OT3A 3O90A 1A1SA 5L7WA 1RZUA 1G21A 3DL2A 2GRJA 1KSFX 3D4IA 3THXB 1BKYA 4IF6A 1KP9A 3V5NA 2CBXA 3CLKA 3WRWA 4CEJA 2RGUA 2O52A 4WZBA 2O9JA 1C0KA 3W4JA 4E2ZA 4KGVA 5LD2C 2P4EA 4XGRA 4ZU3A 3PYLA 1I0IA 4EABA 2GK4A 3EYAA 1IWOA 1SHJA 1LLUA 4D45A 1ZJJA 2FQWA 3MMPA 3KQNA 5JAMA 5HKLA 1ST3A 1O8CA 1VCMA 2ECQA 1U1EA 4L0CA 5JNWA 5LU9A 1V11A 5EJ7A 2CFOA 1LI5A 2LDBA 2WD7A 1SOWA 5IC5A 2ZYGA 3P20A 5HK8A 4M9CA 5EKUA 1L4LA 3ABZA 2VSNA 3X1ZA 3E1GA 1L1RA 1C2TA 4CI9A 1Y8AA 2JIZD 1C2YA 1DJLA 1LDBA 3AOEA 3H4VA 1L6RA 1NUHA 3I04A 3BK2A 3DUFB 2YVKA 4XM2A 4EBFA 5LMUB 3K6KA 1NLUA 2QEQA 2A58A 1K8XB 1J9EA 5IP5A 3G7UA 2ZANA 1G21B 3GFPA 1P0PA 5AM0A 1MO6A 4MVJA 3ZD8A 1O77A 3OEYA 4XB1A 4YCLA 3MJFA 1QG2A 2BF4A 4F86A 2F7SA 2OXRA 3H5VA 1DB3A 2YL2A 1VI6A 3B2QA 3IDAA 3ONVA 4EJSC 5LQMA 1Q3TA 2CJWB 1M1NB 1O0BA 2VBCA 2C9DA 4XYLA 1TM2A 2AW5A 2FRDA 4ZVOA 1GZDA 4YPFA 4DDMA 5JNLA 4ZJYA 3MS4A 3PNBA 1F2DA 3AHHA 5EZYF 2HRZA 5HF8A 3C98A 4BEJA 5KQMA 1FFAA 4EPXA 3DLAA 2IXTA 2C5AA 4RMGA 2I55A 2FCAA 3IVRA 1Q15A 4PV7A 1UK6A 5C7OO 4GVLA 1XLVA 4EUSA 1Q44A 1S0UA 2BEUA 2PSDA 1N2OA 3ZCRA 2RGGA 1QOPB 1NDQA 3MWFA 4L4ZA 4TLEA 4RACA 2P7IA 3HZOA 3PEEA 3H42B 3IHWA 4OB7A 2PG3A 4YJFA 4BVFA 4JXKA 3U6KA 1OSNA 1Z9BA 1C30B 3ASZA 4GLJA 3ZZUA 1PSWA 1V48A 2REBA 1WA5A 1U90A 3D31A 3UN1A 1EP2B 2YJGA 3O9MA 3QENA 4QUAA 3P9QA 3ZS8A 3RDPA 4WMLA 4CQMB 1R6AA 4XAQA 2W2KB 1YR9A 1JB9A 3DFFA 1OYVA 1P5RA 2WBLC 1FY2A 1DBQA 1O1YA 5ILOA 3QWAA 4LVUA 2WIGA 4OH1A 3HDJA 3OJOA 1SZCA 1RC0A 1UFKA 1KH1A 2VDOB 2AKAB 1EE9A 2J7KA 2P2DA 4UBMA 1KK3A 3SOPA 1FEZA 4ROSA 5HQTA 4TTJA 5IULC 1AK1A 4IF4A 2ZIUB 4E14A 3HNPA 3BJEA 3RO7A 3SSAA 1JDPA 2PBFA 3B6KA 2J31A 3RSOA 1ECPA 2F1KA 2CVPA 3DZJA 3F4BA 2VBGA 2B83A 3WBFA 3H1GA 4C04A 4ARVA 2IY7A 2CNWD 2EBUA 3VC2A 4JSYA 1KF0A 4PC2A 1J2UA 5LSAA 5HJEA 1QRAA 3C8ZA 3CW9A 3NWEA 3K7EA 2P5TB 4HDMA 4DL9A 4W6QA 3KYCB 2F4NA 4KUGA 3TUZC 1HDEA 3EXEB 5ENDA 3FDZA 1G5TA 4M86A 1LJLA 4B84A 1CEYA 4BYMA 2V74B 4JHXA 5HUHA 5TMBA 5IDYA 4AJ9A 3FCXA 2PH7A 1XJWA 3E4DA 5JECA 5AXBA 4OLFA 3Q15C 4NZYA 1NGSA 2WYVA 3DFMA 2FSIA 1JTEA 1XQ9A 1XVVA 4WBXC 3LFTA 2QLJA 4I55F 5TRTA 1DIOB 1XYGA 2QZPA 4O1MA 3E3OA 4C0BA 3QHQA 3DSRA 3B1ZA 3NORA 5JWHA 3S7ZA 1T0HB 2HGSA 2VLBA 1I7LA 1E2UA 3NIDB 4PVCA 4IGFA 4RIGA 2IQ5A 4EX6A 4JQZA 4AAYA 2DFPA 2O3JA 1Q91A 3ND8A 3R7AA 3W6NA 4KGDA 1QDEA 3WYCA 3C5VA 3GJ7A 1XDWA 2X19A 5CT6A 3FI0A 3ZDBA 1JHPA 3QELA 3QEBZ 5HYVA 2WTMA 1TO1E 1QRSA 2J0QA 2HA5A 1TTPB 3HS3A 1QE0A 1D8AA 3R5XA 4E51A 4LMAA 5E2AA 1WMBA 3B70A 2GEDA 1SIUA 3EDCA 1QHXA 5AKHA 8OHMA 4D26A 3ZHTA 3ASYA 2WG1A 3EUAA 4EHKA 1FU8A 1ZCFA 3U80A 5IDVA 2XNKA 2BCEA 4KFUA 5ECWA 3ISTA 3KKKA 3BSWA 4UVEA 3QLVA 1MAHA 4FJ1A 3MERA 4NYMQ 2HXYA 2AN1A 1M6NA 1Z0SA 2CMGA 5CGQB 5TPWA 3TRFA 4DTCA 5KI6A 1GAQA 3E81A 3T9AA 5B4VA 2Q4DA 4IG9A 2HMYB 1CTQA 5EZYA 2VZ8A 1FLDA 1R0KA 2QN3A 4S12A 1U98A 3L6DA 4WKOA 3U2QA 1JWBB 5AHKA 3RWBA 1V3VA 1GUFA 2TYSB 5JOQA 4EELA 1M0EA 3IV7A 5C34B 3U4IA 1CHNA 1G8GA 2G72A 3OCZA 4OHUA 4V1CI 3N6VA 1MAAA 1FUYB 2XZPA 3QGMA 5ICCA 4OCZA 4OQFA 2B98A 1JFTA 3I6YA 4NRDA 3A9UA 1LNQA 1KAEA 2WM3A 4IOJA 3MSXA 5E4FA 1UJ2A 3RROA 3ZDFA 1JA0A 3HPQA 4II7A 1DJQA 4MRSA 5BWCA 3MTBA 4D43A 1PGNA 2CFCA 2J08A 4OA5A