4RA6B

Crystal structure of linker less pyrococcus furiosus l-asparaginase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
125
Chain Sequence
MAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords L-asparaginase
total genus 41
structure length 125
sequence length 127
chains with identical sequence Q
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ra6B00
5K45A 4RA6B 4ECAA 5HW0A 5I48A 5K4GA 5K4HA 1JJAA 3ECAA 1JAZA 3NTXA 5F52A 2P2NA 5DNEA 2WLTA 4R8LA 3NXKA 1JSLA 5CBPB 1HFJA 5DNDA 1ZCFA 2WT4A 1HO3A 1WLSA 2HLNA 2D6FA 4Q0MA 2OCDA 1WSAA 5K3OA 5I3ZA 1O7JA 1JSRA 1HG0A 2GVNA 1ZQ1A 1IHDA 4NJEB 3PGA1 5I4BA 1HFKA 4PGAA 1DJOA 1HG1A 1DJPA 1HFWA 2HIMA 2P2DA 1NNSA 4RA9B 1WNFA 4R8KA 5DNCA 2JK0A 1AGXA
chains in the Genus database with same CATH superfamily
1HTWA 1V16B 4NAHA 3COZA 1O57A 3EULA 4R3NA 4NPCA 9ABPA 1JDPA 1XO1A 3FPCA 2QL6A 4WLVA 1TMGE 2DFLA 3OC6A 1H66A 2EKBA 1L5RA 1Y6RA 3CX8A 2PWAA 3EG9B 5EZQA 2GEDA 1RXUA 2X3YA 1FVXA 3DULA 4G5SA 1FDVA 3FSRA 4M83A 2W6ZA 3QKRA 1P9RA 3BIOA 1YCGA 2XB6A 2P4HX 1FSGA 2RHLA 3E3AA 3HFRA 1RTTA 1MUUA 3KC2A 2X58A 5E3HA 1HKHA 4LBYA 5I9BA 1N9ZA 1B8PA 4US0R 3EFBA 1OIWA 1VHWA 2O2DA 5KSWB 1ORDA 4LRTB 1XRPA 3QEJA 2JIQA 5B1IA 1ZN7A 2FNAA 4N76A 4RK6A 4Y2JA 2B4TO 2CL5A 2IITA 1A77A 2P3OA 2ZUUA 3CPSA 3ETJA 3LQRA 5HIMA 3ZLBA 1I9CA 4UFPA 5DP1A 1ZWLA 3PB3A 1DWPA 3MUNA 2HA6A 3ZU6A 2BKLA 3PXGA 4IDAA 1JXMA 1WMSA 4RY0A 4KR6A 3LRPA 4FHCA 4QD3A 4UTOA 1A8SA 1J1ZA 2KSQA 2QDKA 4UUOA 3ZJVA 4XDGA 1BCSB 1USUA 2ZKLA 3UICA 2M9MA 1Z17A 2J8ZA 2OHVA 3ACDA 4UU0A 1Y3FE 3KYIB 2BMVA 2EAUA 5D1NA 4PPFA 5EN4A 5ALNA 2EQ5A 3FIJA 2I2XB 3ONDA 1XLUA 1T10A 2CFSA 2HYDA 3PDUA 4HX2A 4BZWA 2VT3A 4F91B 1AF7A 4E22A 2EWWA 5JY6A 1D4ZA 1MPTA 3G9QA 3LQ2A 3MRTA 2DPYA 3DR3A 3MRVA 3NVAA 4IDQA 4RE5A 5DYYA 5ABPA 4I4CA 4X64B 3VSAA 1QKIA 2B8WA 4KDFA 1A0OA 3T41A 2VDWA 3GFTA 3A9WA 4QXAA 2F1IA 3J81A 3DLHA 4TUYF 2Q07A 2Y9PB 4AQDA 3PUYA 4W5WA 2KM1A 1Q74A 1OFGA 2M98A 3ZDZB 1O5TA 2D4AA 1LSUA 1WX1A 1I2BA 3N59A 1WDKA 1EVKA 3DYIA 1G8HA 2HT6A 2VYND 4LJYA 4AUEA 3FAZA 3LRXA 4DLXA 3TS1A 3CO0S 2NPIA 3K5PA 2GN6A 3NOXA 1MO2A 2FN3A 4JZKA 4MPJA 1JDTA 5FQNA 3T9EA 2CJWA 4XIIA 4W9RA 2HFKA 4JS0A 2BTQB 4CR7A 2GPWA 1OLOA 3RODA 1OU4A 1FNBA 1WSWA 1V16A 5MFZA 2ZJ5A 3N2GA 4PNHA 2V6MA 4CG3A 3I9V1 3OX1A 1Z62A 2C7BA 2VT7A 3V2HA 1WVMA 2XYGA 4IUBS 3QMMA 4DYHA 5BV2P 5IXJA 2ZUSA 5KSYA 2EIHA 5DKFA 5SZJA 1DAOA 2ZJBA 3FJOA 1QGZA 3NHPA 3KKNA 4IOJA 3CC8A 2ZT7A 3OTHA 1EBUA 5KTRA 1AJEA 3KB6A 4JELA 4M99A 1XKTA 4RMIA 5LBTA 4C2UA 1XTTA 1SWVA 2YRWA 5JJLA 1PR2A 4AS3A 3KT3A 4DMFA 2CJFA 3ABSB 2F43A 4G89A 6REQA 3K6JA 5D8DA 3GEMA 2WD8A 2QPLA 4OM7A 2Q5JA 3AEZA 1HL3A 1QTNA 1YS2X 5CT5A 5E1MA 4XB1A 4HN4B 4AJLA 5BVGA 1ULTA 1JEYA 4Y1GA 3LDGA 1FMJA 2WTXA 2PL5A 4FYJA 3TMYA 3WRYA 4A92A 5KQPA 1MLDA 3R7WB 3E0QA 1P8AA 3DT6A 5ARBA 3QPCA 2XE8A 3X2SA 3N9IA 1L3CA 1REQB 1UBGA 2RG7A 3A6DA 3GZTB 1O6FA 4HTAA 3TB6A 4BEWA 1R6VA 2Q1UA 1HR0B 2NXEA 1JQBA 4LV8B 3K0FA 4J0IA 1CY6A 1ZJ5A 2IQIA 5FWAA 4MDFA 3RDPA 1U0LA 2NUBA 4R2MA 4QYIA 2XZOA 5GJBA 4NCAA 2XUKA 4B8ZA 3HJAA 2ASVA 2Q1XA 2AG8A 4F4UA 2D2IA 2A1TR 2KJQA 4X44A 3BERA 5HZHA 3UJNA 1IHOA 1H0KA 3BXGA 4A1FA 4GPBA 1B14A 1HPLA 1K3TA 2Y0PA 1NXOA 1SHTX 5AJHA 4CDMA 4D4IA 4EDHA 4HGQA 2A9PA 3I72A 1JU4A 1JR6A 3JQEA 1R10A 6PFKA 5BQFA 4DLKA 3Q0EA 4YCNA 4ER3A 2P6NA 3LSTA 4GHWA 3AH8A 1ZPDA 1U6IA 1KI4A 4D0LB 1UXOA 3HUFA 1JEQB 1LS1A 4UE3S 2F3PA 3ZXSA 4BWYA 4Q4DA 3QLUC 3ORSA 1JHAA 3ZK7A 1Z28A 2YX1A 4JP3A 2NZ2A 5ICCA 4EL5A 2DHDA 1W75A 1JL3A 1L8QA 4AP5A 1XDWA 4FU0A 4NAVA 4RVOA 4XJXA 3MWJA 4ZO4A 3W7AA 3OESA 4G0MA 4I1YA 4JLDA 4P35A 1AGYA 1H6CA 1QIEA 2YS7A 1DL5A 1TW2A 3G0IA 3QPAA 1W35A 4KO4S 4LCEA 3ZJTA 4MA0A 2XLBA 4DJAA 1XYYA 5G0VA 3H16A 1TZJA 1LCIA 3DOEA 3FCSB 4IXTA 4UTXA 5B58C 3NH6A 2XWSA 5NLLA 2F59A 1YMVA 1ZFNA 3OJXA 2OCPA 3MMPA 5T5QA 1RPAA 3FGPA 4Y30A 1U8CB 3WJ7A 1YJ8A 4HDNB 4EG1A 4JJ8A 1BFKA 1UH5A 4C29A 3SVLA 1P1BA 3EIWA 2BFPA 3I6QA 3ZWXA 3ZU2A 1UOQA 3IT1A 1A95A 3G17A 4UAUA 4UUMA 1RHUA 1VCOA 1K5HA 3H0EA 4UZSA 1ENYA 3JQFC 5H02A 3FROA 5DRTA 2Y1FA 2X8AA 2P0YA 5GJCA 4LCJA 2C83A 1MABB 4OI1A 4PAWA 3ILSA 4KGXA 5K0JA 1NWHA 1OILA 1TTHA 1KTVA 4JUDX 2Z6AA 4H3HB 3VO9A 2IOYA 1XL1A 2FHPA 4B7UA 4NCKA 3SZOA 3H2GA 3ZVNA 1N57A 1W30A 3W2FA 2DBRA 3KUDA 1O54A 2GCOA 2NM0A 1LBQA 2D3TA 3CXUA 3W8DA 1OZFA 3R6DA 4M36A 2IY7A 4L85A 4HRAA 3TQHA 1QX4A 5FPSA 4X6YA 1WB6A 2FEXA 2H7CA 4G36A 2FDCA 3ZDBA 1VL6A 1PVVA 1MR3F 4MZXA 2AH5A 2ZSEA 4QOJA 4WZBB 4WKGA 4ZKDA 4G0YA 2GJ4A 2XTZA 5A5FA 1QONA 1VL0A 3HFGA 1VL8A 3OOHA 4PC3A 1L7DA 1KZ7B 2DG2A 1QOZA 4DLVA 3SFVA 4LDAA 1G3UA 3A9CA 2BUAA 3GVCA 2V5UA 2ZIAA 1ADGA 2ZRDA 3E53A 5FORA 4B48A 3PPYA 4IO1A 5C7YA 4CKEB 1IOWA 2E4UA 1WKCA 5BSKA 1EX9A 3JD3A 3O95A 2W4IA 4E33A 4F9EA 3U4MA 2M1ZA 1NMYA 4BKPA 5B64A 1QO0A 2FSFA 721PA 1M6VB 4YHBA 1GFIA 1MX5A 1V3TA 3RBZA 5JVDF 3AUAA 4QXQA 4LFCB 2WR8A 1BE6A 1N3BA 2QPOA 4JVNA 4N6NA 5JAOA 1P0FA 2PBZA 2UDPA 5AOCA 3BMOA 4HEJA 2H1WA 2FZ4A 3BJZA 3KJNA 4UEQA 3AW8A 4KR0A 1Z3CA 1ZD9A 1YB4A 4HZIA 1V8ZA 4ESVA 1LRLA 2YV1A 1GDHA 2Y0BA 1ZYUA 4ETMA 1RJFA 2XCLA 3WZLA 5CNIA 1D2RA 1AS0A 5HIJA 3W1EA 2IQ5A 5C8VA 1GVHA 1XYVA 2H7XA 2ACKA 5BRJA 4Y6LA 4TZ0A 4GOLD 1MXFA 4UHEA 5FTNA 4R6XA 2X4LA 3GYBA 2JFXA 1DX9A 3NCTA 4UASA 2VJAA 3ZCRA 4W5OA 2XZPA 1E92A 4DPKA 3S27A 2XMZA 3CF4G 2NU6A 3HUTA 1MOSA 1H0HA 5FAXA 2F4VB 4MCAA 1ZGGA 3AY0A 3PZRA 1G20E 1L4GA 2GBIA 3QW2A 4LFBB 2ZRFA 2JAWA 3ZE1B 2PG3A 1RQRA 2ENWA 2Q5FA 4I81A 4KQ6A 1YL6A 2WMYA 4DTIA 2YZNA 1OZGA 1TVMA 2AA3A 5COQA 4BWFB 5LZ2A 4PC1A 1RRCA 1KQNA 3P1JA 3SM9A 3OP4A 1J07A 5EVCA 1CYDA 1M7BA 4HLQB 4YGYA 2XE7A 4KN8A 3D3JA 2BEUB 2RK3A 3R5KA 5ULLA 1K9SA 1QZXA 2A2ZA 3T4PA 5EP2A 9ATCA 4GNRA 5EIAA 1V48A 3BTOA 5CBPA 4JROA 4YJKA 3CT4A 5BMVF 3DUFA 3KOUA 3O3NB 2EDCA 3GDFA 5ERYA 1NV9A 2HH9A 4TLBA 3M1IA 2Z2IA 4AN0A 5D3MA 1KU6A 4NXMB 4FFVA 2GFHA 4HX5A 4G09A 4BNHA 4D2IA 1QCDA 1XBTA 1YS1X 2GCEA 3PGLA 1P4RA 1ZLYA 3D59A 2VJOA 4M0PA 2AXPA 4N4AA 3FPFA 3NNNA 1KE2A 5JHHB 1Z4QA 4G81A 4KVFA 3STYA 1JA1A 1W85A 4JIMA 4TWIA 4RF3A 4YUZA 4UCXA 4F8YA 2YIJA 4MUHA 4PZ9A 3DDHA 3S40A 3GEIA 3RABA 2ISCA 1IJBA 1ZA2A 2PGJA 3FI9A 3NBQA 1XCGB 4NXNB 1QUEA 2HL6A 4NDAA 3C6ZA 4BE7B 2IOFA 2WD7A 3CH4B 4LKOA 4U1RA 2FZGA 1RC0A 3CSUA 5H68A 2RE8A 3PCRB 2CXQA 2WPDD 3HLTA 2ZUTA 3LX6A 2ID8A 2KX7A 3CRQA 3RC2A 4L7VA 1VBMA 1BDBA 3FSEA 2OAP1 2Y92A 2YINC 3L92A 3JQGB 4H3KB 4RA6B 5DXAA 1JSZA 3KZ1E 4AJJA 4I6GA 3GLFE 4REQA 1JZQA 3JATB 3R3SA 4MCIA 4FBMA 4JI7B 5IXSA 2PGDA 2QN2A 2QMZA 2YHAA 3RS5A 3WI7A 1IJKA 1OFUX 4Y2HA 2JBWA 2TYSB 2XCIA 3BFXA 3VDRA 1RBQA 1R27A 1Z2CA 3U4IA 5LMUB 5G0UA 4QFMA 4HB0A 4WFJA 5IEJA 4QIHA 5THXA 2C2ZA 3S8MA 3DBLB 2WFLA 5KNBA 1T6XA 3AYZB 4Z86A 2XYHA 4PANA 4AQYB 1TKBA 4EX6A 3B6ZA 2I22A 3AI2A 3VSCA 5F3RA 2IT1A 2JS7A 4FGUA 4XW2A 4OHXA 3UXEA 4BNFA 4DR6B 3UPTA 4JQYA 1YRLA 1FX1A 2QL5A 5BXQC 1FNSA 1XF1A 4LJRA 4OQNA 2Z9CA 3KP1A 1KXZA 4QNMA 4L8WB 4E30A 2XXAA 2G0AA 3BGIA 4IWNA 4OU4A 2PUDA 1GSAA 3TINA 3ABZA 4URXR 3ASZA 3RUHA 2ZR7A 3KM0A 1ZNQO 2JASA 1IL0A 4TMVA 1ZONA 2VNAA 5EZYF 2WSMA 4Q03A 1MIOA 1PK9A 4J7CA 2P6PA 2D2VA 2O1SA 2WFLB 1G4UR 3HJHA 4FGZA 4Q1FA 1GD1O 1OXMA 3EQ6A 4X8MA 4TTSA 1OAAA 3VR2A 1UZLA 1K4MA 1ZW1A 2VP9A 1OBCA 4MX8A 1JI0A 3DOOA 5T64A 3SIPA 5C31A 5HJ7A 2PUVA 4AUNA 3N0RA 2HJVA 1E2EA 1K8YB 1S5PA 1IVNA 1ZUHA 3D4BA 1I13A 1UPXA 3KELA 4YRPA 1DAMA 2X0DA 4QTUB 4CIYA 1GUDA 4JLJA 2RJOA 3BCUA 2Z8YM 2C3PA 2G80A 3F5DA 2CYBA 3V97A 4UBOA 2G04A 1XF9A 3BGVA 1VHJA 3L1JA 4EHIA 1C3JA 1B73A 3CUTA 3E7DA 3AF1A 1J23A 3NP7A 4RD2A 3NATA 1TQ2A 3KSMA 4TSFA 4ZYXA 3G5AA 1U0FA 3LCUA 1S8AA 2O2HA 5AW2A 4KMOA 3BM5A 5FRDA 4AY4A 2R96A 3WYDA 2CEKA 1Y0BA 5DPMA 4C43A 1LLCA 4IG4A 1RBMA 2QNIA 2BP7A 1Z34A 2QV0A 1SHJA 3W04A 5K6AC 1HM5A 3RC3A 4JN6B 3OE1A 5LL6P 4UBIA 3QF7A 3JSAA 2XZLA 1OYWA 1O6CA 1JDBB 2FMKA 2OD2A 3QPDA 4KVZA 5EXXA 3R74A 4EGSA 3LUAA 4XFKA 4JLWA 4CKCA 4MVXA 4WNAA 3RAPR 1USKA 4RSHA 2HEGA 3DOIA 5KOJA 2QF7A 5DNUA 4FFBA 4IFIA 3MMXA 3R5TA 3RYIA 1SVKA 3PJRA 2RKOA 3B7PA 4LWOA 2HWWA 4M7WA 3UNXA 2C84A 1NA5A 2PFSA 4L95C 4S3MA 4TQUS 3LLUA 2ZWVA 1JEYB 5DZSA 4HWPA 2C9BA 2FW6A 3IUNA 4RD1A 5DMXA 3F98A 5EEGA 2FR8A 3OH8A 4OU5A 2XMPA 3LOQA 1K7FB 3ZGZA 2FUNB 2F2TA 4NH0A 1I3NA 4FMDB 1P39A 4DRXA 5FOQA 1J4AA 3PNVA 1E79A 4CM4B 5DWVA 1SC9A 2J1LA 2Z56A 2VH1A 1S9DA 4IHJA 3VR5A 4K9SA 2ICAA 1RRFA 2VJQA 3UY4A 1F2VA 1PG2A 3CPHA 5ITZA 1U2TA 4L6AA 4KTTE 4I19A 3GV0A 4NBLA 4MWTA 4AURA 1U9IA 1NJ2A 3DDOA 2R8ZA 1KP9A 4JI2B 3T0IA 2FE4A 3CUUA 5I9IA 3DMYA 1RE1A 3I01M 3CR7A 2PQ2A 3VDQA 1M5RA 2O4UX 2XT6A 2FWNA 2AN5A 3PHBE 3HYTA 4FK8A 2PL1A 1YI1A 4PO8A 4D4LA 1BJKA 1DG3A 1FX0A 1O03A 2XOXA 3IR5A 4M0KA 4WUTA 3WAJA 4QUJA 1JXQA 1ZWKA 3DTNA 3P2MA 4GDMA 4DEVA 1JMKC 2JH8A 2UYGA 4WOBA 3SM3A 3GU3A 5K09A 4H4DA 1YOBA 2D06A 4RLSA 3OE4A 4C89A 2J3QA 1R0WA 2OZEA 1CG6A 2AIRA 2PYIA 1Z0JA 5B1YA 5I5EA 2B8EA 3OM0A 1Y3AA 4YYZA 3BF7A 1W4RA 1XD8A 3QFCA 3R8FA 1JPJA 1P4GA 2HPVA 3G59A 3KHUA 4NY1A 5F21A 3M8KA 2CF5A 2EZ8A 2O1EA 4TT3D 4LOAA 3R0QA 3H84A 3ZIAA 1M1NA 4GMKA 3ESYA 5K51A 1KPIA 3OQOA 3LCMA 4E5DA 2FOIA 5CEJA 1UAYA 2MSKA 1F7UA 3KYJB 3U3KA 4XUGB 1VMKA 2BF4A 3L6UA 1DHRA 1U4SA 1X9GA 4R8SA 5AUNB 1LPMA 5E3JA 2Q1TA 3A6HA 1W0KD 1KSHA 1Y81A 1QHFA 3HP4A 3NANA 3PEFA 4J0FA 2B82A 1XN4A 2D5IA 3JQPA 5D5HA 3QFHA 3SF8A 3HEMA 4EQ6A 3BL8A 3CVWA 4MUEA 3PC8A 4HNSA 5JS1A 4PRZA 5L95A 2YWEA 4IQ0A 1Q6YA 2FI1A 3EPRA 3H5LA 3NHJA 4F2WA 5JU6A 2AOXA 2J9FB 4W7IA 2FPLA 2DPLA 4KIWA 5H3LA 1FRFS 4BPBA 5AJYA 2XDYA 2D5AA 2ZJ7A 2HY7A 3RNLA 3T7KA 3OJLA 4DA0A 2XQKA 3ODGA 1H3EA 4GAEA 1Z36A 3I2GA 3OU7A 3SJBA 1GTSA 1PFKA 2LR0A 3LY5A 4EG5A 4FLMA 3K8ZA 1HE5A 1I7PA 2EGHA 2H31A 1RPTA 4GPZA 1MD9A 5FNVF 1C9KA 3UIEA 2C9ZA 2XJ9A 4EYQA 4JJ4A 1VKHA 1UMKA 2JZCA 2XLCA 2ZJ4A 1QRAA 3H83A 3U5TA 2FFQA 3O8QB 1CJMA 4G1MB 4D4KA 1KIAA 2I5PO 4LSWA 4AS2A 1E2HA 2YDXA 4QAJA 4QWWA 4HVLA 5I7RA 1GZSA 5FHRA 4IFBA 3HBAA 5M3BA 2F8MA 2W00A 3WGZA 2R7NA 5AOVA 1OTXA 1K63A 3EDRA 3ML1A 2H1SA 2HD4A 3VR6A 3GLIA 2OK7A 3HCPA 1DIHA 2FSUA 2FPWA 1DINA 4OP3A 2GD6A 3IEXA 1VXOA 2JB9A 2BGRA 2ZJ0A 3V8VA 2PD3A 4DM4A 1AURA 1N34B 1DKRA 3AR4A 3RRYA 4INAA 1E4EA 3DVAB 1A5AB 1EIZA 5U4XA 1RYEA 1K7XB 3JQ8B 4LDZA 4X7MA 3GJSA 1XWIA 4B31A 1DCMA 1ZNZA 1G21E 4MPRA 3D0RA 1OZAA 3B1VA 4M9UA 1JLKA 2EZUA 16PKA 4DRYA 4FINA 2ZJZA 4ZA2A 1UM9B 3CUSA 3D54D 2BDEA 2OQIA 3LPLA 2P0AA 2IS6A 2DBQA 1EFTA 5IABA 3SAJA 1A9XA 1DFIA 3OLQA 2CZGA 4WXMA 2JI4A 2B8NA 3C14C 1Z73A 3U3JA 5A7FA 1DVRA 3GVPA 3N2KA 5ECYA 3GEEA 2D4HA 3SZLA 4C0QC 4YMTA 2QYTA 1NJGA 4GPD1 1D9ZA 1GPLA 2F1OA 3MGKA 4FYMA 1CR1A 2OVBA 4ZD6A 3I3OA 1AZSC 1MN6A 3E4CA 3LA8A 3BPSA 4TROA 3DE5X 3RVKA 2BTEA 1IQPA 2VQDA 2VH5R 5TPZD 1R0KA 2V98A 2X9NA 3FR7A 3TWOA 5J1SB 3QV2A 1C2YA 1RRPA 2WD9A 2XY4A 2ZJ2A 4YT5A 2FSGA 4BNGA 2XUPA 3R5FA 3LPDA 1WV0A 3Q9SA 2A9FA 4XTCS 3A1FA 2J3DA 4LVUA 2CC2A 3AKCA 2DKNA 4DA7A 2GWHA 4N03A 3OUZA 3ZU5A 4YDRA 4KNYA 2WICA 2QAIA 5KX5F 3LY8A 2GK3A 4X93A 2KBFA 4OJKA 5DX8A 1U1CA 5C53B 2FWBA 1CFJA 1ZZGA 2BFNA 3IESA 4MRAA 2DWQA 4HWGA 2IPAB 4K9DA 5HK8A 4WZ6A 1FIUA 1SU6A 2VPWA 3OUUA 2G09A 3G2KA 2RJ3A 2GN4A 4QGAA 3K4QA 2P2NA 3H05A 3MW8A 3VOAA 2VP0A 3GJ8A 2CZCA 3O4HA 1BD4A 4GX0A 1LH0A 4MGYR 3L7KA 4YRBA 5KKCA 2Y1CA 5EIWA 3EA4A 4I55B 4M1EA 3TDKA 3GFPA 5FBKA 1MB3A 5GOZA 1TKRA 1XZMA 4JT9A 2YWDA 5HCNA 5JS2A 4A10A 4ENSA 1E4YA 2IF0A 1GG2A 3PR1A 4K88A 1DFHA 1T9ZA 2Q5QA 1UFOA 3IURA 1Z18A 4M9RA 1RWWA 5EE1A 3VPBA 1JLMA 4ENVA 4R1PA 1OLSA 2YZ7A 3L8FA 4R9RA 1J2EA 1DAEA 1S8OA 4IXMA 3GZ4A 4PAOA 4UHBA 1EGAA 4N7JA 1DQNA 3V2IA 4A8HA 2AKEA 4PF1A 1K06A 4BO2A 2FK8A 3DQZA 1MAWA 5F77A 3UAYA 2UU9B 3UATA 4GMDA 5DI3A 1NTOA 1XEFA 3WYGA 2JFNA 4A3SA 5B7NA 2RCYA 5KOHA 3PPWA 4L6CA 3G9XA 5AKKA 2OEPA 2ZCJA 3ND6A 1GPWB 4A0FA 4N12A 2GF2A 5KJ1A 1XXHB 4GI2A 3NEJA 1GYQA 5CDSA 3IE1A 1VYUA 1X0VA 3FDJA 5IX8A 1I51A 3TLEA 3T1VA 5A04A 4ZQHA 1M83A 4PG5A 5EC8A 1XXHE 1A72A 1UQTA 2YJ3A 1GA4A 2DPXA 1RPJA 4MDEA 1KI9A 3BGOS 1VA5A 1L4KA 1LFDB 3QX3A 4MKXA 2PRJA 4M98A 3TKLA 1X7XB 4QGSA 5C32A 1X13A 2HF8A 3E84A 1MP0A 4YAWA 2V4MA 3WQQA 5F98A 3IBFA 3ADDA 1BTOA 3WSVA 4RTNA 3LHSA 3UPUA 3OECA 2HKIA 2QUJA 4XPIA 5ALXA 5K0BA 1HDZA 5TLSA 2WF9A 4RTQA 3X0DA 5JAZA 1Y6JA 4KQGA 4MYCA 4TXLA 4E21A 1CYEA 1I3MA 2B4YA 4M87A 2AMJA 4XYLA 2QNBA 4CIAA 1LBIA 2BD0A 3IP3A 2HF9A 3EF1A 1KO7A 4KDRA 4ES6A 2FG5A 4J03A 4MAFA 3WISA 2VVTA 4TS1A 4W6QA 3OZAA 1II0A 1QM5A 4LRXA 3IA2A 1JIQA 1CZKA 1ILWA 3G2PA 4CKEA 3NNDA 3CE9A 2JFYA 2JIMA 5JIBA 2OXIA 2HT1A 1UK9A 1V9CA 4DLYA 1MIHA 2GM4A 1AQLA 2JL1A 1XZKA 1GU7A 2ZULA 1N6RA 3AHFA 5E38A 4B80A 4DY4A 3AC0A 3ZJUA 2N47A 2B0CA 3F9IA 3EYAA 2IPMA 1FDSA 4MUXA 2AOTB 3ROZA 3LOUA 2FAXA 1U2ZA 4ZWNA 2RIRA 4CHTA 5K3OA 4Q4LA 1N5LA 4JEMA 2FPSA 4IHJF 1NQAO 1JYFA 3SDZA 2VPZA 1RHKA 5ADVA 5K0CA 3KSBC 1ZR4A 1Z5NA 3FPSA 2DFNA 4QO7A 2B34A 3HK2A 3N5CA 3NUGA 1Q7BA 2DB3A 3ZE7A 5LN1A 1EP9A 3NRCA 4IQ8A 3QKRB 5BNIA 4C01A 4Z4QA 3LNTA 5L3RA 4RACA 1SWWA 1NI4B 1J8YF 5FLEX 2DQKA 4EEXA 4YV7A 4KPEC 3AT1A 2C5EA 2I76A 2FR1A 1R8JA 1L8LA 3GP5A 4UAVA 3GT0A 3PQ2A 1IY2A 4JUAA 1ZUNA 4ZO8A 1ZCZA 2CLOB 5D3QA 3A4IA 1E3TA 1NRXA 4J3FA 3R3VA 1TRHA 2Q4EA 2I7CA 4L72A 4QPDA 3USCS 4IJ6A 5CH8A 2PZKA 3MEQA 2ACVA 1U02A 3BWEA 1UUFA 1CUUA 4TV9A 2WV9A 1TFUA 3UJ9A 1R6TA 1HZJA 3K9BA 4HAWA 4ND1A 4F56A 2XX3A 2V7BA 3D4NA 2EZ4A 5K03A 3FUUA 3O2SB 2VZEA 2ZUVA 3JAWB 5LWHA 1W4AA 3EOZA 4L3WA 5DNYB 1N5OX 3QSGA 4HJXA 1B0PA 1VJDA 3A3PA 1V37A 5ENVA 4CLOB 1U28A 4TMWA 5FCDA 5AKJA 3H75A 5J2UA 1EX1A 2HQOA 2Y99A 3N0VA 1YQGA 2HU2A 3BD6A 3QEMB 5BNZA 3ZWOA 4OX9B 1M6VA 3MWDA 3QA9A 4DR5B 4GYWA 2IRWA 3JD1A 4PGMA 5ALDA 3ESAA 1JWLA 2BKXA 3LBAA 4LDPA 2C9DA 4S0ZA 4TKZA 1E2KA 3EVGA 1RWPA 2B2XA 3GGSA 5AJVB 4E5VA 4UOZA 2EXXA 1M74A 5JI3E 4WDRA 1RXSA 1M1ZA 3AUUA 2W6JA 3QX9A 1BSVA 4J4TA 5AKZA 1YONA 1U0NA 3OA0A 2C54A 3FF4A 5HIKA 5AQ1A 3BXPA 4MYDA 1KETA 5AVXA 3EQ2A 3IVXA 2OFXA 1W46A 2OFPA 1BW9B 2JFPA 2OORA 4Q1VA 3TPFA 3WMXA 3HBJA 2DHEA 2KS6A 3FFWA 5GZ3A 3AILA 3IHLA 1RI3A 4LVOA 4MV9A 4QGBA 2NO0A 2PUGA 4C6RA 2XOEA 5JJ5A 3MCUA 2CFOA 3KSAC 3H5AA 3M34A 5DX0A 4B9EA 3PFCA 3DV9A 1DC7A 2BH9A 1GL9B 3KEFA 4J6EA 3G6WA 1G8PA 5IZCA 1D1TA 3F3KA 4LYGA 4LJ6A 1A76A 3I52A 1W36C 3SX2A 4YJHA 2RHTA 3IERA 1H23A 1E6WA 3H9BA 1RAFA 3OQMA 3LFTA 3C1UA 3T5CA 1JW9B 2B25A 3R7LA 4ZVUA 4PYKA 4QG3A 4Z7JA 4NJMB 1G5HA 4GKKB 4QM6A 2REOA 1YHYA 4H7JA 1TE2A 2Z30A 4WJKB 4RD4A 2CNNA 3TW8B 4BQNA 1NW8A 1AH2A 9GPBA 3RFVA 1NWCA 2P35A 4JY7A 1LNSA 2XODA 3QYPA 5TXGA 1UC8A 1GUBA 4KWHA 5AJTA 3DHWC 3WLSA 3EZNA 3HLYA 3HXPA 5CBPB 5KU1A 5DHSA 4FI3F 4O2RA 2F43B 3U4GA 1T9DA 2MDTA 1OTHA 1AU9A 1FP7A 1NX6A 3QOFA 1SXJE 4QUAA 3L1KA 4YP0A 1EP1B 3QFFA 1KDRA 2C59A 3ONFA 4LY6A 1L4YA 3RG8A 4ARCA 2YC4C 3VKHA 1G1MA 1XZIA 3QELA 4K9QA 1P73A 4G56A 3A7EA 4M3NA 3QOYA 5D6NA 2PTGA 1Y3CE 5IJ9A 4GM1A 4C04A 4MOWA 4NU0A 4J3JA 4QBHA 3IKVA 2UVPA 4JNKA 4CTJA 4ID3A 2CVHA 1Y9JA 2HSJA 3PC8C 4RK4A 1PGQA 4C7KA 1B8OA 4ZCRA 1HE8B 3P9XA 2IYVA 1ID1A 1L3IA 1OAKA 1YAHA 2O1XA 3W5BA 5KNBH 1MO3A 1ZH2A 2JH9A 4RXMA 3U26A 3VR6D 3OZGA 4I4TF 5AP9A 2P67A 1OHHA 3I6IA 4LNUA 3TL2A 4ZDKA 2R6HA 5JYBA 1FNNA 1E2JA 1RC8A 4W8GA 1UMDB 1X7ZB 4LFAB 4R2IA 1GPDG 4M76B 1JT9A 1R5NA 2HC9A 2A4KA 3OJOA 3KSUA 2H5JA 3CU5A 3K32A 5FDFA 2PWYA 3LNCA 4OHBA 4Q6BA 4N8SA 3EISA 3TFWA 4NE9A 5JC8A 2WAAA 2OCKA 3KUKA 4NS4A 1XWFA 3LKDA 4HP8A 1Y6QA 4PX3A 3SZMA 4PQRA 2VKTA 3CRMA 3FW1A 1UIMA 1NNI1 2BEJA 2PH5A 1NFFA 3BSWA 4WOCA 3TRDA 5JCZA 2E82A 3ROGA 3L7CA 4LPSA 3NHMA 1UDWA 5GGYA 3NBYC 4E3WA 1CY7A 2VYVA 3RSCA 1EBBA 1N7HA 3HKEA 1NP6A 5EGNA 2FEWB 4JENA 3FAKA 3E9RA 2HZBA 1FPQA 1TZBA 2Z58A 3IOYA 3UXYA 1PW7A 4CM3A 4JXKA 3CZQA 1EB9A 1WUYA 1IZ7A 2XJ4A 2V54A 2YMMA 2O3RA 3TRIA 3JQAB 1T4MA 2QV7A 3M2TA 2C3OA 2B30A 3BQNB 1BVRA 5EA2A 3ACBA 4RX1A 1JKJA 1UMBB 4RJ2A 5JAIA 2W6PA 4O2BA 4ZOLF 2PBRA 2DBYA 3HA3A 3I92A 1X8JA 4FCVA 4ZT6A 3GEGA 4PV7A 2BDUA 1J56A 2WNIA 3ZBUA 5JAPA 3TLZA 3TOSA 4RXTA 3SLKA 4PGGA 1Z0ZA 5HMLA 4DW8A 1I3LA 5AHXA 4C0HA 3CF2A 4MUBA 3UV7A 2V96A 3W34A 1E2UA 4C06A 2ZAIA 4K9RA 3U1TA 2I1VB 2O06A 4MICA 4GKJB 3EODA 1UFVA 2TS1A 3F96A 3VOBA 2VS1A 3G5TA 4W82A 1IZ0A 4TX1A 4I4IA 7YASA 1VI5A 2Z1NA 1E3QA 1NY6A 3HCCA 2YFKA 1DAGA 5H70A 5EMNA 3UWSA 5TC4A 2V58A 3GXBA 1FRNA 4Y2GA 4Q1AA 4FIDA 4TWZA 5D87A 5CM2Z 4BNDB 3EPPA 4KG7A 1LV8A 1D4OA 1U0EA 4MUFA 1NKTA 3WDKA 2WSYB 5EMJA 1T9KA 1L7PA 2ZJ6A 4O8ZA 1CR2A 2BBTA 4HF7A 2Q6OA 3IRVA 3HO1A 1LI7A 3D1JA 3IQXA 4GLJA 3CONA 2E1RA 3TLYA 4DSZA 1K5DA 4LRQA 2AL7A 2FVXA 3P2IA 4WCFA 3KOOA 3MWEB 1BX1A 3FYTA 4K81B 5FAKA 1KMMA 4O6VA 4RTRA 1ZR2A 1E7MA 4EUSA 1PD1A 1EZ1A 4E09A 3UFXA 4OK6A 1TYCA 3AV3A 5E4FA 4R9VA 4FYVA 4QO8A 3ZZ1A 4CQLA 4RMJA 1GNTA 2XUAA 4OXIA 2BRUC 3CUWA 4EJ2A 1VI2A 1F17A 3M5PA 4RDIA 5EHNA 3ZR4B 1ZRSA 2YWJA 3BXOA 3LX5A 3ZY6A 5KINB 2IH5A 1E1MA 1YZKA 2GA9A 2IPXA 1TF2A 1PJRA 3E8SA 1XRJA 3A1DA 3GJQA 4H31A 5K8LA 1UBOS 5DVZA 3ER9A 1CJSA 4LI3X 1YRBA 4FGJA 2HMUA 3U80A 1AY0A 5LQRA 3RS8A 1HLGA 3S7ZA 4BLUA 4DAOA 2JLUA 3T1YB 1S2DA 2D5LA 2E2WA 3D8HA 1D0IA 1U0SY 2ZT5A 3ONWA 4MTCA 5DTEA 2AK2A 4QC2A 3TEMA 2Y27A 1U5BA 5DLQC 4U2BA 3U1BA 5K8UA 1MENA 1RAIA 3VC1A 1SVUA 2LP4Y 2Y1KA 1HFEL 2DFPA 3PX2A 2LIPA 3HNOA 4JB8A 3TRKA 4FFSA 3U7RA 5EL0A 4DF3A 2HNAA 4DSOA 2QU8A 2R11A 4AG5A 7MHTA 3ZGOA 3RAFC 4FXOA 3UJHA 5K0ZA 1XZCA 1ZN9A 4TSFD 4WY2A 3S2IA 3WWZA 1A71A 1ZSYA 1HH4A 1YCFA 3A1VA 3L41A 3QTLA 2PWBA 4D0RA 3WAGA 3QMWA 2NAPA 3VJLA 2WT9A 3V1KA 5EWMB 5KEIA 2PBLA 4YXWD 4M1ZA 2G3YA 4QULA 2BCEA 3ROQA 5HM6A 4L9WA 2CXXA 2QTGA 2W8BA 4YRMA 5JISA 3Q2OA 2J6IA 1Y8AA 1BXGB 5K20A 4X62B 3SXUA 1GNVA 1U94A 3CURA 4PVDA 4YLEA 4HDSB 5J4YA 3V4RA 4DE5A 1LY1A 2P8JA 3PXBA 4FHGA 3DMNA 3X1XA 3VR2D 3UANA 4KXWA 2IS1A 2WWFA 3HCNA 3RPEA 3LIPA 1P3JA 4QEZA 3KZXA 1WETA 1RMTA 2BOVA 2JEOA 1EKXA 4M7PA 4KUHA 4ZOEA 2H48A 1OREA 2H1IA 3KTFA 3JD2A 5EMMA 2XRFA 3H3XA 3ZN2A 4CKYA 2BGGA 2WAOA 2P40A 1IQ0A 1EWVA 1PUIA 2WWGA 2ZR9A 3E1GA 2ZT6A 4UMEA 2XD9A 4KWIA 1P1HA 4BWVA 5JH7F 2XGJA 5IVDA 4M89A 4A0HA 4D9EA 4X85A 1COWD 3GLFB 4YUVA 2FZLA 1H2FA 2MYNA 1K8XB 4DMUB 2WHXA 2Q1YA 3GRKA 3H42B 3K94A 3VNAA 5TMPA 1RS0A 3GDGA 4I1IA 2FLKA 3DV2A 4UZFA 3PX3A 2AX4A 2I8CA 3Q41A 1M1YB 1Q12A 4NULA 5HJEA 2ZRKA 4HPJB 2G67A 5HFNA 4U2KA 3RTDA 3VU0A 2ODBA 1WLYA 3C7DB 1M75A 4N49A 4Z7NB 3DXXA 4YAOA 4Z51A 4MYSA 1P0QA 4KIGA 4ZEXA 4EPXA 3CEPB 4B6RA 4MIKA 2W2XA 2VRBA 3HXMA 2VXOA 1YBFA 5AW0A 1O1YA 1AUXA 2EZTA 2BJHA 2AMVA 3NONA 4U3JA 3CMCO 1YHNA 1YJBA 3MTBA 1VGRA 1BFUA 2PZLA 5LNK6 2AI2A 2H0RA 2VDNB 5DH9A 5A0FA 3KLBA 4QGHA 1CV2A 2P77A 3KCNA 3VQTA 5ENDA 1TT5A 4XVQA 3F6RA 4ESOA 5KYTA 1EDDA 1LDGA 4ZRDA 5DM70 3DLIA 4PICA 3ZBPA 4POOA 5BN4A 2O8EA 3L8DA 1K4KA 1K4YA 2CNKA 3V2GA 3W5DA 2ORIA 4UHFA 5EGSA 3FRHA 4JMPA 4I9HA 4QG7A 1E63A 5CJPA 3V33A 4GR9A 3WGKA 4AWXA 1CNFA 2XMSA 2CDNA 3QMPA 4CWAA 5COBA 2PJDA 2O1WA 3WG9A 4MS3A 4WI1A 4E5NA 1EWYA 2N3ZA 2X9GA 3MTGA 5TMEA 2FSHA 4EVQA 1V5IA 4R40A 5H3HA 3G5MA 4C2AA 5JZMA 2J32A 2GNOA 2IW1A 4JH0A 1K2WA 4UBLA 3K8YA 4YMSA 1YCDA 2QM8A 3NWEA 4YROA 1CY8A 1IUKA 2WIDA 3DDZX 4RFVA 3RJZA 1GSIA 5T4HA 1EUQA 1QGUA 1X1SA 3LUGA 1B0ZA 1F0NA 3FN4A 3PFBA 4MW7A 3BE5A 4OSEA 2BFFB 3L4BA 1KIFA 5CLJA 2E21A 4FX2A 4ZEVA 3QEOA 5ED0A 4PFJA 3DEZA 2JGEA 4EI9A 3IMFA 3E0XA 1BNCA 1ZHOA 2PZJA 2H1FA 2ZXEA 3KTAA 1JX6A 1E4VA 3EZ9A 1HSZA 4KW7A 4LWZA 4PW0A 3TIFA 4IUYA 4D0NA 3UHAA 1R5BA 4PGFA 2WHYA 1E61A 2PNFA 4L28A 4TZKA 4B3JA 5H82A 2Y6VA 1PI3A 1ZM9A 3DFMA 4QVGA 2QGNA 3EY4A 4EF5A 3EX7C 1PYGA 5HDBB 2ZKIA 2VCEA 3IVMA 2V74B 3A9SA 1V3QE 1Y33E 3BRCA 2ODAA 3Q85A 5BN3B 4LOJA 1XROA 5IAJA 1JR2A 1YB1A 4H17A 1MORA 1NIJA 1T1GA 4DCPA 3HCAA 3OLCX 1HT3A 3CEJA 1VB3A 1VLQA 1NAIA 2JANA 3KJXA 1SA0B 1Q7EA 3EUAA 1P0CA 2G40A 2PMCA 2V3WA 3HJBA 3KYCB 4H1VA 4P6VF 4RIEA 5AI4A 2G9UA 5TMBA 4YYEA 1DQZA 3A4NA 4NYIQ 1A96A 2FOXA 3W8EA 3OPYB 3TZ6A 4UTPA 2X5JO 3E82A 3BMXA 1PBTA 3I2KA 2P6OA 1UDCA 3JAWA 2X3FA 3AJ8A 3GH1A 1BCRB 1KDZA 4OYLA 2HF7A 4NYJR 3RC9A 4EGFA 4MV6A 1F0YA 1T6YA 2O20A 4JSRA 4CU2A 3DE6X 4DV2B 4K6OA 2HIAA 3IIEA 4X91A 5HR5A 4CPDA 2QRQA 3FWNA 3U9TA 5EEHA 5IDQA 4NABA 4BVKA 1V7CA 2XWBF 2AQIA 3K0BA 4RF5A 5CX1B 2PE5A 2HI0A 1CUWA 3IKTA 2G1KA 1IHUA 1KZ4A 1HNZB 1NVMB 1YS9A 4ETIA 1N1DA 5EJ8A 5G4KB 2FKNA 2R9VA 5CLIA 5BT8A 3N8NA 4MV3A 1QCCA 1UK6A 2H8GA 1TZCA 4WLFA 2Q8QA 4AUKA 3NWPA 3ND7A 1M76A 1QCYA 1DKOA 1TLLA 2WOOA 2ZTLA 4GOOD 2ZQZA 4LJ7A 4F86A 2A1IA 2ZJ3A 3ES9A 3WKBA 2XB2A 1FNMA 2L69A 5DT9A 4XVUA 3FLEA 3G1UA 4MUJA 1E7WA 421PA 5J2UF 2NSHA 1ZJWA 1KO5A 1P33A 2DFDA 2GT1A 3GVXA 4L8LA 3DEAA 2AQHA 5KTPA 4QBIA 2UYHA 3AR8A 4IIJF 4HWOA 3PVCA 5EXSA 3UAGA 3IQGX 4HGRA 3G89A 3S2FA 4QL3A 4HNTA 3IPCA 3C4QA 4LZAA 3WV5A 3FYSA 2VHVA 3B5IA 3CR8A 4NOKA 4BZPA 5MN4A 3I3SR 4Y2YA 1MO6A 1TUGA 1WXWA 1E32A 2ID9A 2DX7A 2PT5A 3PXEA 4GGOA 3TCKA 1KOFA 2AQKA 4CM9D 2BUCA 1NJFA 2HA7A 2Q9CA 2JIZD 3OLYA 3PCTA 4K6GA 5ALOA 5M34A 4DCJA 4LXXA 4Q9LA 1WWKA 2AZ4A 1EPUA 4F0JA 2O2JA 3NBKA 4TYYA 2YOHA 3H2JA 5IN5A 2IUSA 2A0YA 4X66B 3EEOA 4HN2A 4DC9A 1HEYA 2Q62A 3BT7A 3TLMA 1YQQA 1P18A 4BX2A 1VZ2A 1GZ7A 2Q21A 4I55A 4ME6A 4NENA 2A5DA 3I23A 1TEXA 3PF9A 4EO4A 5BNFA 4JD5A 1CEQA 4DA6A 1NYLA 4BFYA 3X3HA 3HBFA 2ZJOA 3Q1KA 1IBMB 1DOAA 1NP3A 2A9JA 2WA1A 4MQFA 3S81A 3O8BA 4CMKA 2APJA 1SCAA 3H0CA 3ZEAA 4HQOA 4LHZA 2WAYA 1D9XA 3L9XA 3BZBA 4CVNA 1JP7A 3EZFA 3SR0A 4A0QA 2FPMA 3OPVA 3JQBC 1DC4A 3PQCA 5F1PA 5FBQB 1ISMA 3MMZA 4CKZA 5LD2C 1U2EA 3Q3JB 3Q98A 1OI4A 2XRMA 4KUEA 1OYYA 3IEIA 2IV3A 1QH8B 1W8IA 5BSMA 1GPH1 5IF3A 1VI6A 2F48A 5EWLA 4JOBA 1ODSA 1MEEA 1YJXA 3GG9A 3KXDA 3L1VA 1NDUA 4XWAA 5G1OA 1WOMA 5GTDA 4D02A 3K6SA 4H4CA 3C5EA 1E1LA 1RIFA 1OIXA 2YV4A 3TW0A 4OHPA 1CJCA 1U90A 1C8LA 3ORYA 1PTJA 4IYRA 1KEUA 2UVQA 1YDWA 1WCWA 3EWAA 4KKVA 2C1EA 4JSTA 4TLDA 4ACBA 2QENA 4DXHA 3LL4A 1PWZA 1SUSA 4I3FA 1EDOA 1U8YA 1UZUA 1HY3A 2E4YA 4MV5A 4JI4B 4ARZB 2WTMA 3E9CA 3SZRA 4V2UA 3OQIB 1Y98A 3L7NA 2GRJA 2IPOA 3PEYA 1FSSA 1ZHHA 4GVXA 4DSTA 5AVUA 5G02A 3R3YA 2W9XA 1B74A 1SCQA 2FWAA 4OAPA 1DPFA 4P4NA 4V0QA 3RRZA 4E2FA 1B26A 2HQSA 3GAFA 3N3BC 1MG0A 2IZ5A 3QBJA 5NULA 1VKZA 1SXJA 2WYIA 3JQ8A 4IV0A 1P1IA 2BPOA 4NBWA 4X20B 1ATZA 1LPSA 1N6OA 4PLWA 3SFTA 4BUJA 4KLRA 4LW8A 4MRVA 4GU5A 3W6UA 3FCXA 2H2WA 1MZVA 5EUQB 3ZJ5A 4CLHA 2EG9A 1DP4A 1L4EA 4U02A 4NARA 3WP1B 1KP2A 1GGVA 1T9BA 5T7BA 3AI3A 3CY6A 3WBJA 4ZDJA 3Q6IA 4FFRA 2IXGA 5CFPA 4AO8A 1CY2A 2JK0A 2Y77A 4HEQA 4QU5A 3SKXA 1UT5A 1LRJA 3MHTA 1K68A 2O57A 1NSTA 2PL3A 3W79A 1Q1GA 3OVMA 4IXWA 1WOYA 4CEHB 5JSYA 1YK0A 5K0NA 4EARA 5B57C 2W6JD 5JQWA 3DD1A 4G1CA 4GIBA 4X92A 4KV7A 3BRQA 3I6MA 1G6Q1 3FVVA 3OKCA 3QITA 1NXSA 1TLTA 5EFOA 5CT4A 3THSA 1QO0D 5BORA 3BXZA 2W6ID 2B1QA 1JQAA 2QVZX 2XWPA 3ODPA 3P71T 3IEUA 5AW4A 3KVYA 3FY4A 1BJRE 1H42A 4IEIA 1H1DA 2J33A 2ZTHA 3QXXA 4C1BA 3AERA 4NJEB 4PIVA 4MO2A 1FP4B 2FQXA 4D44A 1QFXA 3C8MA 4HMPA 4QDKA 1TPYA 1EG2A 3HJGA 4P0TA 1G9XA 2BFDA 2JEYA 2O0HA 3INGA 3NPAA 5K5EA 3THWB 1Y9DA 4JEUA 3B51X 2FP4A 2MSNA 5DTQA 2IDJA 2YFYA 2ZQ5A 2CUZA 1GTMA 4FNOA 3ETEA 5B30A 3BF8A 3HB0A 3AM3A 1W6RA 4O0LA 3UHFA 4GZLA 1IWOA 1Q84A 1YU9A 2L19A 3ESBA 4FMCB 4FR0A 4Q3CA 1AT1A 2QORA 4CLOA 1F38A 3TX2A 4MVJI 3ZY4A 1AF4A 2VCHA 3DKIA 3G23A 3PNSA 1WVGA 1QYXA 3NRBA 1U81A 1RYYA 1YC5A 2B21A 3BEDA 3QKUA 2GJ9A 2XE4A 2B8TA 4K3UA 1ZNWA 3PA6A 3LRTA 2AKYA 1XJ0A 4CKWB 2PGIA 4KJXA 1V7PC 3ASYA 2R6DA 3GLFA 4Y6OA 2CNBA 4I8DA 1XX6A 2I8LA 1THMA 1L5YA 4KOEC 3AJRA 1LC0A 5DCUA 2PXXA 3DHNA 1OT3A 3KB8A 1YZTA 3DB1A 3EGXA 2WZCA 3FMPB 3DD5A 1SKQA 3DWEX 4MKRA 1XC7A 4PCAA 3WGMA 3TBKA 4Z3KA 3F73A 1ZK2A 4ZVSA 3ZI4A 1XDSA 2OL4A 4I8IA 4R8VA 1ZCJA 1KARA 5A62A 5CA0F 3H17A 4NDNE 1OH8A 1U7DA 1ONPA 1XMIA 4D57A 3SK0A 4Z99A 4HXEB 5J4HA 1MCZA 3UAZA 4GGMX 4TTQA 1R6BX 1DRKA 1RLUA 1TZMA 1LSSA 2BLLA 4ND2A 4B6FA 4Q7EA 1WXHA 4FNAA 4Q12A 5G3ZA 1K7CA 5AUPB 4OCZA 3ZNOA 2AT1A 3MTDA 2JJYA 2WWWA 3NT5A 5EIOA 2NGRA 3ROMA 1NLZA 1SAYA 4LEIA 3U3ZA 5JSZB 3ZW7A 3PLNA 1RCFA 2P9GA 4ENUA 2WQ6A 1IN1A 2GPBA 2M1XA 1GU1A 1LSOA 3CNEA 4EBBA 4I0WB 3E7PA 3WZMA 4ONEA 3OIFA 4BIIA 3Q72A 5F73A 3SEZA 5JUWA 4X1OA 1LA2A 3AY6A 3L4EA 3MCZA 1KR5A 5FQOA 3GL9A 3H2YA 2F1RA 3VC3A 3VC2A 1E4OA 1K5PA 1N78A 3FJYA 1HORA 4O4LA 2JGKA 3GT3A 2I8AA 2ZWMA 1QCZA 2Q99A 4RTKA 1DKQA 3T4EA 2J08A 5TR9A 2VWHA 4G9BA 4NHOA 4LWQA 1YRWA 3TG2A 4P4UA 2RH9B 1P31A 8ABPA 4E5PA 4E94A 1KRHA 1T0IA 4A5OA 4JI3B 1YJQA 2I80A 4MPDA 3VR5H 1J8VA 1H2BA 1QFMA 3VYVA 2ZYHA 8LDHA 2QR2A 2P4EA 2MTBA 2OESA 3V9PA 3G0HA 4DCNA 1LDMA 1WXGA 4NZPA 3AHHA 4UEKA 3BS4A 1KKUA 1P4JA 3KXKA 4FMPA 3RRXA 1WF6A 3WWYA 5KVAA 4QDZA 2P62A 4KDEA 1T4GA 3QUTA 3MF4A 1V1MB 4HEA6 2ZBRA 1M2NA 2ETVA 3DZJA 5IAEA 1IVSA 3E3MA 5HW0A 1NBMA 1OVGA 3EG9A 2CBGA 4A7PA 4CL3A 1A8IA 5TVGA 1JJBA 4MQBA 2VSOA 2ZVJA 2QR3A 3O1JC 4YR7A 4G5QA 3HYRA 2PAFA 2EF0A 4LA4A 1KFJB 1Q7CA 1Z6YA 4MQ6A 1QHNA 4KH0A 4DIDA 4BO0A 5BV0A 5JQGA 3BX1A 4KDCA 2IH2A 1XZPA 3ROKA 2R6GA 4UTNA 2B0JA 2NWQA 3WWOA 4B35A 2JGAA 2XTAA 2GBLC 5B4TA 5J43A 2NZVG 2OCAA 2PSJA 2CE7A 3H11A 4KQ9A 3DZBA 3TLGA 2HTEA 4A2WA 2GPJA 4H9GA 4RNDB 1Z5UA 4ILEA 4ZI7F 1E3SA 2OGWA 2VJMB 3EASA 4JL8A 3CTPA 3W3AH 2GR9A 4L1KA 5H3CA 3JPYA 2VSYA 2UZ0A 4TQGA 5D3ZA 1JRLA 4R0MA 5HUHA 2SHKA 3CVOA 1GQ2A 3LUFA 5EKDA 2YVKA 4MJXA 3S44A 2OLKA 4KX3A 3L7LA 1T8YA 5ITWA 2GBFA 3ZHCA 1PJCA 4ZCPA 1DT5A 2CLLB 4KXLA 5FA6A 4L22A 2Q5EA 2ZRMA 4TTJA 1T3HA 4Q4HA 4R1OA 4OYYA 1F5SA 5TPZA 2R8BA 1WSAA 2V55B 1QOPB 4P4LA 5E7JA 4YT4A 3BULA 3KV1A 1IRXA 5BSHA 1VPWA 4M0EA 4EP1A 1G8MA 3I76A 4BVJA 4CLRB 3D9QX 3HV2A 1G66A 2CLDX 4MKFA 5ENZA 1XA4A 1Z2AA 2FPGA 4M1WA 2DAPA 3F7TA 5AXCA 3URMA 1T6NA 1T8TA 2WG2A 1M33A 1O87A 2AC7A 1IPHA 3TI9A 4AY5A 4HDKA 5EG5A 5KIAA 3KZOA 4OV6B 3B3AA 2H11A 3OTGA 4UFNA 4LYFA 3B6KA 5C1PA 2R2GA 2V6GA 3DE4X 3N0TA 4N0MA 3UPDA 2FX2A 1VRCA 2R84A 1Q1BA 2J3EA 1PNRA 5CW2A 1PLKA 1TJNA 3GLTA 4EY5A 2IEBA 2QAJA 2X2PA 3C5WP 3ROXA 1CRQA 2KBEA 1PP4A 5E8JA 1NMZA 3RASA 1LTQA 1Q0HA 1POWA 4OSOA 5A4IS 4DCSA 3GLVA 1IOLA 4TPKA 1UXHA 1DAFA 1EWRA 3ZE9A 1KWGA 1CZOA 3KV3O 5H59A 1RHRA 4OH1A 4K6CA 4W1PA 1SCUA 2NSLA 1R37A 4F06A 4KAJA 3X1DA 3IDSA 4B4KA 4WJZA 4GSYA 1IE3A 1MV5A 1JAXA 1HT0A 2WSBA 4UQLA 4WZZA 4MV4A 4KQXA 4G3XA 1SVSA 3QMVA 4HDKB 3VZPA 1E89A 1SD1A 1FFXB 3KZCA 4MGEA 5DTMA 2B36A 2A5YB 4OMFG 5E8RA 3R3XA 2HQ1A 5E9QA 3U17A 1A3CA 1OBHA 4QDUA 4FQ7A 4WESB 4XJSA 2Q7DA 4JQSA 2DHQA 2XB9A 1GPYA 3RSZA 1CLUA 1E5XA 1Q0RA 3LY7A 5DNVA 3P27A 5JMTA 3U7GA 1C0IA 1N2XA 1U7WA 2H9YA 2ZS9A 3EDQA 4RSGA 3IDAA 1FXSA 3S1AB 1T5LA 5CFLA 2ALJA 1OWNA 1DELA 4FBLA 5IVKA 5F3WB 5AOBA 1YB7A 3RS3A 1D0SA 3W3AA 3Q9NA 3TM5A 4O63O 1Q7GA 1RM0A 1A1SA 3CZ4A 5ICSA 1RCUA 3W2HA 2XQJA 2HQBA 3LQ1A 3LC1O 4X6XA 1K27A 2NN3C 5EHGA 1ZVKA 1T0BA 4TRJA 4EW1A 5LDHA 4TZ6A 4QBTA 1R0BA 1DGQA 1FSZA 4IHQA 3D7RA 2Q2VA 5I7SA 3U1VA 2C2YA 4EH1A 5E2AA 1EJ2A 1FFGA 1IBRA 1CUHA 4OD0A 3FKSD 2PMDA 4P3NA 1A5BB 4LYYA 1ML4A 4KQHA 5LZ9A 1QIGA 4B3MB 1MHTA 3QWIA 4HPXB 4W5QA 4B4DA 3DBVO 3JRXA 3JQBA 5D3KA 4QASA 3TM4A 1Q21A 3CQ9A 3LO8A 4J29A 4E70A 5JSQA 1GZUA 1D8AA 2C07A 4L16A 1UPFA 4J7XA 3N86A 1M2OA 1ENOA 3UJAA 2K2QB 3MOIA 1YR9A 4AJ1A 1VGQA 1NRJB 2DJ5A 4QSMA 4DV4B 2Y68A 2QD2A 4YMIA 3WO0A 1PR5A 1Z83A 2B5OA 3IAM1 4R8KA 5K0FA 3OQPA 5BP7A 4ZQIA 3ZD7A 5CG1A 1PF7E 1YJAA 4YALA 3L6CA 4TT3A 3KEGA 1WDWB 3H5VA 3IA7A 3O84A 1GITA 4JEHA 3UB2A 1NX9A 1K75A 3T61A 4CEJB 3MCTA 1BKDR 2QJWA 4FDLA 3IIIA 1MC5A 1XRQA 4I5EA 4L4ZA 2AJDA 1QHIA 4WN9A 3UT5B 3TUZC 4ARBA 2O7RA 1NNLA 1T8UA 4S1OA 3CRNA 1DV1A 4IJWA 3LBYA 4YJGB 3S8EA 1E5QA 4B7AA 4LBVA 1KU0A 5JDIA 1JALA 2BJVA 4J0DA 3WGNA 2R66A 1P2VA 2EG5A 3KR9A 4FNMA 4OF4A 621PA 1X7DA 4BNKA 3DMHA 3IIMA 4F96A 3FHTA 4HS4A 3OAAD 5K3BA 4CM7A 2CXTA 1VSQA 3ZIUA 1ODJA 1PS9A 2Q3LA 1UR5A 1NQTA 3DM5A 3MJVA 4WNCA 4KLNA 3A4LA 2WJJA 1OKKA 4DB2A 4FFLA 1VHQA 3VRHA 2XCUA 4YI3A 2BM1A 1IXSB 5E9WA 2DCMA 2VP2A 3ENWA 4D9CA 2DJIA 2ZE7A 1FU4A 3TZHA 2GSWA 3CBQA 2FUCA 3PD7A 3PWSA 3COPA 5H5JA 1A69A 1NW6A 2K87A 1CS0A 2QRPA 2SKDA 4IIEA 3VC7A 4OL9A 3ZDQA 2EKPA 4W8OA 5PGMA 3WTCA 1O96A 1VSVA 2CL6X 1GPAA 3H6KA 4H15A 4JKIA 3BKWA 2EDAA 2GYYA 2HHLA 3L0DA 1VSUA 2YRXA 2I6TA 2QVBA 3AY7A 4H7IA 1TEHA 1ACLA 4RE6A 2W42A 4QLAA 3W1WA 1C3LA 1R4AA 1C8KA 4FE7A 4BO8A 3EMBA 1Q14A 5C5CA 5JSKA 1QE5A 2ERCA 2NIPA 3MILA 3N5KA 5IT4A 1QG4A 4WEOA 3AMVA 3R3JA 4MR9B 2AMFA 2X0RA 4O0MA 4UUAA 2YV5A 1DX6A 1E66A 3KSDO 5EJ5A 1WUJS 1EVQA 1HF3A 3NWBA 4QUBA 3OCVA 3F5MA 3LQFA 3BTVA 4PU0A 3NBUA 5EVJA 1SU7A 4C4AA 4EZBA 1BKYA 2GAJA 4DDTA 1Q0QA 3NDPA 4HLCA 3D6VA 4BVHA 5A02A 3QBEA 4IWXA 4CIDA 3WLTA 1TJYA 2DLNA 3U4AA 3ZY5A 5DYIA 4RLHA 4GBMA 4BL5A 3L4JA 1N32B 1FYXA 5AW5A 2PGNA 1II8B 4K03A 3OQIA 3FNFA 1MA3A 1R3DA 3RSLA 5LJIA 3FNBA 1BEZA 3NASA 3OSZA 3L06A 2FEOA 3PP8A 4IMIB 2VL7A 1U7UA 1B8VA 4GF5A 1J0XO 1W44A 3ORHA 1Q44A 2Z5GA 5AKLA 1JQJC 3A37A 2JFUA 1AV7A 1VJ5A 2PGOA 4FSHA 4NOLA 5AM4A 1GUZA 4CCAA 2PMKA 2AW3A 2QG6A 3K0AA 1DX4A 2DY1A 3K9CA 1L2TA 4IV5A 5CA1F 1HYBA 4GL2A 2BGJA 4GSKA 1MFZA 3GLQA 1G42A 1DDGA 3EGWA 5G4KA 3CX3A 1A9OA 3UMMA 3ZHUA 3BXHA 4ZGWA 2AZMA 2QDXA 3C5VA 4DCTA 2O4CA 2Q3BA 3TRHA 3RIMA 1PJBA 3NG1A 3UT0A 3CLUD 2NO4A 4KO3S 1X7XA 4JIGA 5AW3A 5FADA 4INZA 2C2MA 3HRKA 5L3VA 2ZM6B 2XXJA 3EN0A 4JKYA 1M2VB 2QLMA 4L5BA 4QUHA 3WLMA 4C6SA 4ZQCB 4P32A 4O2AF 3BHJA 3S5UA 4LVNA 3T5MA 3WFZA 3DWGA 4JHXA 3MJFA 3RU2A 1WXFA 1JEDA 1V1RA 1WS6A 2JBHA 4F60A 4KIJA 2G0TA 1EFHA 3QQPA 1J8DA 3MOGA 2JGDA 1QHGA 2ZSKA 2X41A 4S0XA 3HWRA 2V4ZA 4IGFA 2I2BA 1G18A 1PZNA 1Q0SA 5JE8A 1GAJA 4Z8YA 1H5UA 2JCVA 3WDMA 5MDHA 1NM5A 2NO5A 2ZRNA 3DOCA 1JEAA 2H1HA 4IIYA 3DTYA 3N2LA 2RH8A 4M0UA 1N2IA 3IBYA 2JGFA 1IXRC 3KYCA 4G5YA 1QDUA 3AF0A 4JT4A 5FUWA 2GZRA 3UC5A 1EM8B 4C07A 1T4CA 1VBFA 4C0LA 2QRJA 4J4HA 4LY3A 2O48X 4CCSA 3UMYA 3HABA 2H1RA 1X39A 2J9ZB 2XZDA 1E1NA 2R8OA 1MGOA 1EP2B 1SCBA 5BUCA 3PA8A 1NFQA 2XUDA 3T9AA 2ZYUX 1WPQA 4D82A 3E48A 3B1FA 3BSSA 5AVTA 1DJNA 1UXGA 2HJGA 4PQYA 3OEYA 4N40A 1JFFB 1T9GS 1N92A 3EZ7A 3KOMA 3D5QA 1DARA 5FFMA 1DXYA 1L7RA 3UA4A 4LXGA 1H2YA 4F92B 5DOVA 5JCOC 4KRXA 3GMSA 5T3UA 2FXIA 4A1OA 4E15A 5BXYA 3MN1A 3EF3A 3EHDA 4H7PA 2X1LA 1XQ6A 4MLDA 1FVHA 2CCKA 2PIDA 4ZHQF 2XOKD 4H08A 5AVVA 4ZPJA 3LD9A 2B2CA 1KSFX 4A2QA 1PJAA 3WK8A 5F3DA 4EF4A 1ZUD1 1HETA 4CL2A 2GCNA 1LEHA 1KAGA 4PN3A 3ORFA 2QUZA 1M6HA 5IC4A 1VOTA 4E0BA 2WYUA 3AR7A 3G82C 2YIMA 1TECE 3PDCA 3PYLA 4UU1A 4C6TB 5TQJA 3IBCA 1SIBE 2ZSFA 1XRSB 3PHHA 3UMRA 5GONB 4QODA 1E2MA 5F5NA 3WA7A 3L02A 4F1JA 4ZZ1A 4PHGA 3M6XA 1E1RA 4YQYA 1B6SA 1SCNE 2YKGA 1SBQA 1GNQA 2A59A 3HB1A 2PCJA 2GK6A 4M7OA 4BTVA 1SN7A 2QPTA 1T1JA 2REQA 4BQSA 3N70A 1J39A 3QU4A 3EGOA 4LNHA 1OGYA 3MZ0A 3OY2A 5K4GA 1QR6A 1CQXA 2I6XA 4RGVA 5CNKA 4OGGA 3TXAA 2JVIA 2VEOA 2NUTB 2CV0A 3V4SA 2AHRA 2P5YA 1L1QA 1V26A 2X7HA 5B7PA 3HL0A 2ZUFA 3EVEA 3MS4A 4CG0A 4CEIA 4OHKA 2QX8A 2QN1A 1Z8DA 1MRNA 4OQYA 4CU5A 4MI3A 1PJ2A 4ESHA 2Q41A 3B85A 3UQYS 4DMRA 1NW9B 1SUCA 4RJJA 5C18A 4D92A 1GAEO 1FU8A 3H8VA 5KCZA 5L40A 4FDAA 2VC2B 3TRJA 4WEQA 4DM3A 1AA9A 1M2OB 2OO7A 5LQUA 1LI5A 1Y4DE 3CNOA 4DDVA 4IQ4A 3U13A 3RS7A 1TUIA 2PSDA 2SKEA 3EXEA 4XUEA 4DXDA 1ZOIA 1TFRA 1I4DD 3FI0A 4RVHA 5SZIA 1FDTA 2PCLA 1U5CA 4CN9A 4ZTBA 2Z04A 1UQRA 7ADHA 1YMQA 1ZEJA 3M7IA 2OPHA 3SQDA 4DBVO 5IMBA 3EIEA 1NF8A 2AFIB 3LLMA 3HVJA 1GP2A 1VE1A 1ZL0A 4WMLA 4AP6A 3K96A 4RVCA 2OC4A 2RKWA 1E1CB 1Y37A 3HN6A 3U48A 1RPZA 4RDXA 5J4KA 4Z0TA 1KRWA 3QKSB 5DNWA 5A71A 3R09A 2HRRA 5LLDA 3JZIA 2K6GA 4AUMA 2KB0A 1EVJA 2PU7A 1O6GA 2OBLA 3FHOA 5HJ2A 4I50A 5FOWA 4DQDA 3GROA 2PRZA 1FRZA 3W8NA 2XNSA 2GDJA 3KVNA 3W2GA 3I1YA 1L5SA 2JCBA 3HSSA 4BU0A 4IKPA 4KLZA 3NM6B 2IJGX 2QNRA 4EZIA 5HZKA 3PCXA 2VA9A 4LIPD 1BS9A 5B6IA 3KQHA 4C0XA 1QV6A 3RUFA 3KKKA 3IDZA 1I24A 1PG5A 4LOLA 3UJBA 4ALLA 1PGOA 3ZNPA 3UK1A 1BQEA 4HZGA 1P2DA 4R68A 4IICA 2QYHA 2JRCA 4Q21A 3KYDB 3ORRA 5DGTA 3ANSA 1MH9A 2YQ5A 3WLRA 2O8BA 2B3DA 1QYCA 2VPYA 4RPGA 3TOZA 1M1YA 2DUMA 2VCYA 3USES 2AG6A 4F1WA 1QLJA 1CIJA 2ESRA 2BHRA 2NZJA 2R8YA 5AKEA 3PJEA 3ROTA 4O4JA 3H1TA 4RD6A 4DEXA 4EUNA 4QT4A 4OXKA 4XOUA 4AZTA 1Q7RA 4EG4A 3Q1LA 3SE7A 3L7IA 4LVCA 1E9CA 1RR6A 2NO1A 1XIVA 4AMUA 4HDAA 2J85A 1AKRA 4L27A 4KGDA 1MRSA 4KNWA 3U7JA 4QYTA 1PV2A 2RK4A 2QT0A 1U0GA 1E1QA 3JU3A 4CTOA 1GKYA 3U0VA 3ZGXA 2HR1A 1N3YA 2VBFA 3GPIA 5E95A 3L4SO 3HDYA 2JFZA 3QKIA 4KO1S 5ALJA 4QT0A 2ZPUA 4D97A 3AM1A 2QW0X 2ATCA 1K2VN 1SPXA 1B3RA 2NTJA 1YQUA 1QQTA 1HQYE 3IB6A 4Q6WA 2EARA 3DAFA 4J90A 3GP8A 1ONNA 5DSZA 4IUDS 1CUYA 3C43A 3L01A 3AEYA 3AK4A 2GWRA 1A8QA 4OHOA 5FO1A 4B73A 3USZA 1BQ3A 1X0XA 5BR1A 5BSRA 2R68A 4IGIA 2IP1A 5J47A 3QTTA 4Q3DA 4EB0A 1GIAA 2A1UA 1D1SA 3OURA 1Y4SA 2KHZA 1C30A 1X7YB 3M6WA 4MQEB 1WD7A 3IKLA 1GNPA 5K2MA 1EUCA 3RYFA 1KNQA 1VL2A 2YYSA 4BX3A 1SOWA 3EXIB 3MC1A 3DR5A 4GLBA 4J1NA 5B3LA 4BMOB 4YEDA 2ET6A 1J9GA 4QQFA 1PZHA 1LX6A 2E49A 5GM2A 2I3AA 4EUFA 1UK7A 2Q45A 3N1UA 3BREA 1JG6A 2ZVQX 1JQLB 3NMUF 3LT0A 1FW8A 3FTCA 4DCUA 4AMGA 1P3DA 2A67A 2YUTA 2CSUA 4J9UE 4BRZA 4DQUA 2EWMA 2ZGVA 2GD1O 3IUJA 1R16A 4I50B 3TZEA 4HQLA 3AF5A 2J3MA 4F4DA 2PN1A 3PUHA 2V7WA 3H1EA 4XX0A 4FXPA 1MAUA 5TF0A 1DKNA 3AFMA 1GY8A 2C4HA 2VHJA 4D43A 1NG9A 3VNBA 1AUOA 3MG9A 3C3YA 3IQZA 5DCWA 1KE1A 4RF2A 4LUCA 1ZJYA 5TJ9A 1JS1X 5KWIA 2Y76A 4CKBB 4FFDA 1BX3A 1UQUA 1HO3A 1JLRA 4LGYA 5KOJB 2VDLB 2REXB 5FJIA 4YPVA 5A0VA 3OOSA 1FMTA 5GY7A 3L84A 3GWZA 1YR3A 5I8WA 3GH3A 2BGLA 3K20A 4PPNA 3IAFA 3V42A 4WDQA 2EW1A 1F60A 2ZIEA 3FKQA 1SBHA 3VVMA 5IAOA 3IC5A 2WIFA 3CLRC 5BQPA 4KREA 2ZIXA 2JIOA 1UDXA 3ZE8A 1Y6GA 4HXGA 4C30A 1QIHA 1U2PA 3MJTA 3EIHA 4QPJC 3IAM6 4R5HA 3CM0A 4II2A 1E6MA 3D6JA 2FPKA 4FMDF 5FOXA 1R88A 1WR8A 2NU9B 3P0JA 2CNOA 3ZHRA 1VMDA 3PE4A 4O2AA 5IYZB 5CX4A 3RUIA 3ETHA 2FWPA 4HH0A 4PNEA 1U9ZA 4U0KA 2QR5A 3QNMA 1RU3A 4BGEA 1WA5A 3I0NA 3UCEA 3R9IA 2O3SA 1AZLA 2HV8A 4HLDA 1BCSA 3KTDA 1PVOA 3N2IA 3NJRA 5E2BA 2PKCA 1RHMA 4FUQA 1E3MA 1AVTA 1N0VC 4MR7A 5H81A 3TIGA 5HK9A 1VYHA 5F9HA 3GOQA 4BMZA 3DDCA 1GJRA 1GN9A 3CX6A 3EWSA 1RVV1 3WWDA 1JE0A 1GG8A 4QUEA 5LA6A 1Z15A 1C3VA 1SHLA 3I05A 4WZAB 4RY8A 1Z5ZA 4RL4A 3OG9A 4FKMA 2EKDA 3OHMA 2SICE 3M1YA 3ZVLA 3TLJA 4Z6KA 3S2EA 2BEUA 1EWQA 1N2ZA 2VN8A 1KJIA 2J6CA 2PXAA 1M0SA 2ZAYA 3SYKA 2E7ZA 5CFOA 3AVVA 3DUFB 4XYEA 4ZEWA 2IZ7A 4ZIRA 5HVNA 1XRRA 4BC0A 3WMRA 3IVCA 4MB0A 5KNLA 3GD7A 1F20A 5TRTA 2Z3WA 4EKIA 1DCTA 5E2IA 3PD1A 3WBKA 2VYNA 1RXVA 1WTAA 4ZJUA 1TMKA 2H4FA 4G8BA 5K3FA 3KSZO 4TXJA 1QU2A 2IOHA 3S2ZA 4R1QA 2QPAA 4EJFA 2G28A 1XNHA 3DLCA 5FTKA 4AECA 3K70B 3HY4A 4HDSA 3DYVA 4C7XA 2R0QC 2JPDA 1L4FA 4D8XA 1I3CA 1CS0B 2PM8A 3D7SA 3UH0A 3UBMA 2Q3HA 4PIPA 1H1LA 2HRQA 2QRZA 1VJ1A 3NHYA 3QPVA 4GX2A 4KR7A 3FB4A 2E18A 1UEXC 1KSGA 1ZCBA 4ZAWA 1AGNA 3E22B 5CCDA 2PKEA 4LZLA 3RT1A 2NXWA 3OKFA 4KXVA 1FJGB 3PDWA 3CIOA 2DT8A 2DR3A 1KF0A 2QE7D 3EC2A 4CMEC 4YUYA 1CEEA 1ECJA 3DGFC 4J0HA 4RA6A 1LFAA 4FZ5A 5LJLA 2HSGA 5EUCA 1FDUA 1I1NA 2IX9A 1F1JA 1V6SA 4O2BB 1Y7TA 4M60A 3KPYA 2Z3ZA 3OETA 1QTIA 1Y3BE 3F78A 4X95A 3GJ0A 3GO4A 3PNYA 1O8BA 4L76A 3UGKA 1QAMA 3NI2A 4Q93A 4AZ3A 2R7KA 1YFKA 4B3CA 2LWIA 2A6PA 2FP4B 4LSMA 2WFAA 4DOMA 5KC8A 2GLTA 3JASA 4IVPA 1STOA 2GJ8A 2O3QA 1MEOA 3F8TA 4H35A 4F85A 2B7LA 1B43A 4Z1MA 2CHQA 3H9GA 3NHUA 1ZHFA 1A7UA 2IXFA 2II6A 1CUZA 1JMVA 4DR3B 4GR4A 1X8KA 4HJRA 4WLNA 5C7OO 1N8NA 2A9RA 1OF1A 2ZUBA 1A2BA 3HDGA 1DJPA 1P3Y1 3MVEA 5JWRA 5F9FA 1E20A 2JHGA 5F1YA 2Z4RA 2ZUCA 4TWBA 4KQFA 4P5EA 1W88B 4MUKA 2PPLA 2PFKA 3M4ZA 2ZU6A 1K8QA 2QRGA 3GZJA 2POCA 2OECA 5GV8A 3OI7A 3Q3HA 4ZAVA 1UPBA 4IJUA 1IEVA 2WILA 2WF5A 4WXRA 1ZOLA 3I6YA 5DHQA 3TNYA 4OOEA 3RU9A 3QVXA 1X1BA 3LE8A 4MDHA 2C77A 2GCOB 2QN8A 1QO7A 1W19A 5E9AA 4EECA 5CB8A 4N5NA 1ZIPA 4TYWA 1Z7EA 4UQOA 4FOPA 4D96A 4RJTA 5EWJB 2FF5A 4IH1A 1BU8A 2NO7A 4MR8B 3IAAA 3P9SA 2JAUA 3G85A 3FFTA 4QOEA 2JW5A 5A3RA 2Q1WA 4JUFA 1NMSA 3OCJA 1TQ8A 3PEVA 4XGNA 4MV0A 3C39A 6CHYA 3I2HA 1T9GR 1U4OA 4RV4A 3ZLVA 4CF4A 3LP5A 2O8VA 2V8OA 1JR3A 4LECA 4BMDA 4C0JA 2YVUA 3DMFA 2P68A 3DAHA 1WW3A 3LDHA 4NBVA 2W98A 3MINB 1JQ3A 3AL0C 1XMJA 4QBKA 3A1EA 2YBEA 3F47A 4MJ7A 2ZBDA 2PMFA 4J1QA 4QXOA 5TF4A 4N5DA 2R87A 3TR6A 5ALVA 4K8RB 5BOVA 3TO5A 3V3TA 2JG3A 3E61A 1OX4A 3ET4A 3IVAA 3JWPA 3IAEA 5KQLA 1PYDA 5LU8A 3AFIA 3SG0A 2P6MA 1WY5A 3N0XA 4PG8A 3SDBA 2GHIA 3IALA 3WMGA 3UK7A 3QXJA 3A04A 1CE8A 4Y2RA 3I9JA 5BWNA 5K9ZA 1T5HX 1WKBA 4KODA 1WUTA 2WW8A 4NCNA 3GOHA 3NBFA 2ST1A 2VA8A 4YGXB 3LDFA 2UZ1A 1ECLA 3BQMB 2CLHB 1M66A 2G70A 3KB2A 1I9GA 3O8LA 3E1SA 3MBOA 2PFGA 3JQRA 1BRTA 3K2EA 1OYOA 2H51A 4Y8VA 3HBLA 1Q0TA 1U2QA 4JJEA 4HYTA 3ZUGA 3KDSE 2ZAOA 1RKVA 4O4LB 1N6PA 1GFSA 1NE2A 3HCBA 3OIGA 3R77A 3MQFA 3JR7A 5ALGA 1QVAA 1JU3A 4KVAA 2WP8J 1KFCB 1TVKA 1JWAB 3ESDA 4JP1A 4NWIA 4TS4A 1IJFA 1Z7WA 3LBIA 3H04A 4BJHB 1ZOSA 3QKWA 2XMRA 4HUQB 1OWOA 3F9CA 1YR8A 3TTTA 4L4SA 5LA6B 4HKTA 1P4AA 2NXCA 4NTZA 3EQ8A 4US2R 5I6DA 4MI9A 2OWEA 2YJ4A 1OWMA 3K31A 1IN6A 5A4MS 1UADA 3C6KA 3GIDA 1N25A 1XVIA 4G24A 1IK4A 4I66A 4NFSA 4YO8A 5EFZA 3SP1A 1BIFA 1ZG3A 3UA3A 3ZHTA 2A9VA 2P2LA 3TE6A 4DSNA 3S2SA 3IKMB 5KYXB 2CD7A 2KLHA 3VGJA 2J6BA 4YJ3F 3CF4A 4FW8A 3DGEC 1U6JA 4LZJA 4WCVA 5GZ6A 1P72A 5DYNA 3UWMA 4DC0A 1XVLA 2BZ1A 1F06A 5BSFA 3W3ZB 3GG2A 3WK6A 4AW9A 4K2HA 4O1MA 5BR4A 3EWIA 5A6VA 2JGJA 1K7EB 1RWMA 1ZK3A 4B84A 3FOEC 1WB9A 3JQFA 2BHLA 4LHWA 6REQB 3BJRA 5HKLA 3VZSA 3OJFA 5IUNC 5F76A 1I94B 4JC0A 4M0LA 1ZH6A 1YI0A 5JSHA 2ZB4A 2WOJA 1TO6A 1EFKA 4R8MA 5KOIA 3EGXB 2VJMA 3ICQB 1Q17A 2Q4OA 4YC7A 2D7JA 1B15A 1QS0A 1SC4A 3N76A 1AKNA 2XDQB 1N2CE 3B9PA 4JP5A 3A1NA 3W6PA 5FHQA 5CITA 2G72A 5I01A 1SBZA 1Z7GA 3E8MA 4UKDA 5COAA 3ZV3A 4OP2A 5HSGA 3E1KA 1GRVA 3ELBA 3WTBA 5BSGA 2VWGA 1M5UA 2QQ0A 3M4NA 2VRCD 4R5MA 2AC4A 3DXYA 3IDFA 3LKVA 4H16A 3TOXA 3LCVB 2HMTA 1GKUB 3FMIA 2FRDC 2XOKA 2PKYX 3MJEA 2V3VA 1HG1A 5JAQA 2ZBFA 3G68A 5CD9A 2R7LA 5JR3A 3FTEA 3E7FA 2VPPA 1ONSA 4ZHQB 3DV0A 5BWBA 5FX2A 1N77A 1Z4MA 2O0JA 4L9RA 2XAUA 3DFUA 2R25B 2VT2A 3ZHZA 4A8JC 4M49A 5EQFA 3Q0IA 3DW1X 4B3BA 1I0LA 2DBVO 2ZRLA 1L1EA 4RKWA 3HVIA 3OF2A 3WRWA 4X84A 1GR0A 1DBIA 3LWZA 4XOIA 1TO2E 3ZOKA 5LVAA 1OI7A 2KLBA 3KHTA 2A5LA 3T1OA 3INNA 3UK2A 1O94D 2AOTA 4YMHA 4FYXA 4NQZA 3QLVC 3N2EA 1UBSB 3PHLA 2O2GA 4MHSA 1E7QA 1U3GA 4I9UA 2JGIA 1ARZA 2JLBA 4F5WA 5K05A 2PLRA 3BWDD 5AUOB 5BWMA 2OFWA 3CNQS 3IDQA 3P5SA 4LZNA 3UT6A 2OV6A 2H07A 3O5AA 3QXSA 3SQNA 3TSAA 3NTQA 2HA4A 3PNBA 1FK8A 1LPOA 1FU7A 3CLUC 4JJIA 1BGXT 4EELA 1Q0PA 4EL0A 4W5NA 5BQ3A 1FQKA 2W5UA 2Y93A 4CODB 4TV8B 3R4VA 5T6BA 5A4DA 3R7WA 3MD0A 4N3AA 1IM2A 1QK4A 1YR2A 1NR1A 1VQ1A 4UULA 3EE6A 2C8VA 3HDHA 3BWXA 3ZV7A 5ADUS 3HN7A 4HR7A 4MS1A 1O94A 1NDHA 2EW8A 4L4RA 3RR2A 3GAZA 2P9FA 3HUEA 1RJDA 2IE8A 3C45A 1HA3A 2FKAA 2Q9BA 3KJFA 4ZCMA 1L5ZA 2ABWA 1H6DA 3QVKA 4XPIB 1ABEA 3C4VA 2NV6A 2OQVA 4DN6A 3JPWA 4JC8A 4D3FA 3ECCA 3ZXYA 1CUDA 1D5CA 5H4HA 4BPRA 2GPAA 3LHKA 3O73A 2J9RA 3WC4A 3ZHSA 1DO2A 1XNQB 1P5FA 5FD8A 5KYGA 3DHEA 3BDIA 3I58A 1WXEA 3LPNA 4N0DA 1TZ2A 3NTUA 1ZIDA 1XK7A 1OY1A 3C1AA 3D2LA 4Y9DA 2UUBB 2R62A 1B4DA 1UOEA 1XCLA 3GRFA 3M9LA 3ONEA 1UKYA 1YR6A 4MRNA 3HJTA 1X92A 4UATA 5EPEA 5KYYA 2XA2A 4XM2A 1H2AS 2OGSA 1LI4A 2RJNA 1JHXA 2XYVA 4DG9A 4Q4CA 2HIGA 1ID8A 1CERA 2I4LA 4Q7MB 3ABQB 4G97A 5JXGA 4M9CA 4H7HA 3PUVA 4LMAA 1UK8A 4WGFA 3U7QB 4GFDA 2XCTB 3UN1A 4L0QA 5EZSA 3KFLA 3RVLA 4AF6A 5L9AA 1RKXA 4UVGA 1QYDA 4MS1B 2LBPA 3X1KA 2FMFA 4OIFA 1DC5A 1CQIA 2BUBA 2YBDA 3UCXA 3ZC3A 2WYWA 1U1IA 3A3NA 3NX4A 3LSYA 2QVXX 4RHFA 4EVSA 3C6MA 1JAYA 1ZO8A 2DLDA 2G5TA 2I6FA 4GE0A 2FPIB 4NK4A 4EQZA 4EVRA 1H3FA 5AO9A 3UUFA 4G25A 1MQ9A 1Y3IA 3LQKA 1M34B 5AVYA 2R4TA 5CX1A 4AO6A 4NIMA 3WRXA 4XWWA 4I8XA 4BU1A 2QQEA 5DLDA 3HH8A 3GFVA 1DFGA 3ENVA 4JYPA 4IG9A 1WHSA 2AFHB 3U4CA 4AJNA 1KHHA 3PSHA 4CMBA 2CHGA 2MSLA 3F5FA 4TMKA 2RCNA 2PUCA 2ZRBA 4J0CA 2MSCB 2VZLA 4HWTA 2COKA 5CB6A 3OZCA 1NBIA 1RYDA 3CZCA 3G3EA 3HCOA 4WL0A 2SKCA 3NBMA 4CQMD 3OLZA 4NZYA 4CQMA 3NTRA 4E14A 3HM9A 1QGAA 2YY6A 2Q4BA 1T3ZA 2BMJA 3P9YA 3D4IA 4O4IF 1YE3A 2GEVA 5JXJA 5J2TA 1G21B 2J46A 3S2GA 1Q92A 2IEAA 5MF6A 2OR3A 3SYRA 5BYBA 3A1TA 4I1SA 1SELA 1GZ5A 2FPIA 2HM7A 1DTEA 1KEKA 1ZN2A 4N9WA 4WY8A 1E0DA 4O02B 1TTTA 3V4FA 1IXYA 2WJGA 5LQMA 1AS3A 1M2WA 2BVNA 4L15A 3TNDA 2QSZA 1GZDA 4DY6A 1UBEA 4AS1A 1PKEA 3PG5A 4MYTA 1R0YA 1S89A 3HA7A 1WZIA 2RGEA 4ZV7A 5IM5A 1J97A 3BEOA 3C85A 4IQGA 4PHTA 2X42A 1XHFA 3C41J 3DZDA 1SKUA 4HAUA 2QWXA 2C94A 4UM5A 5LP6A 4F21A 3NOQA 1NBAA 4GRAA 1FFSA 4R71A 1VKOA 5M04A 4JR2A 4UCFA 4KFSA 2Z4SA 2P3SA 4TRRA 4Q1CA 4CQMB 4EGCB 1LLFA 3O2JA 1NRWA 2C4TA 3FGZA 4BLRA 3TH5A 3B6JA 3E22A 3V7WA 5C1OA 2NQTA 4BV9A 5FWYB 1KK1A 3HR7A 1TYBE 3U3DA 3WE7A 1NJSA 2AGVA 3I8XA 4M6WB 2PX8A 2NTYC 3A4VA 3GARA 3KKEA 4NCXA 3B7GA 4DYDA 1T5BA 4ZVLA 1SXJB 3GBPA 1YASA 3BIFA 3ID6C 4HLUC 2CXOA 4NKRA 4UC0A 4CMEA 4Z4HA 4ASUA 3UW3A 4YR9A 4X1KB 3T15A 4XEHA 1WBDA 4EJ0A 1JG2A 3E8XA 1YWGO 2GXUA 3KG2A 4N3GA 2QW1A 1X1QA 1T4DA 5I9LA 1UJMA 4HN9A 2PD6A 1KOJA 3UVEA 4YDHB 3MCWA 1OAOC 1ZRMA 3BG5A 4CUZA 1JR3D 2E4VA 3F6BX 3WIBA 4MARA 3KZKA 5DM2A 1PHRA 1APBA 4JI0B 5JPCA 5K8TA 2HOQA 3EQ9A 5SZKB 4RO0A 1W2HA 4LZOA 4NU5A 3KZVA 5HIIA 2EYUA 2F3UA 5EXPA 5BY2A 1E2NA 4D3YA 3COSA 1B1AA 1YBVA 2BZSA 4I2VA 4NG4A 1ZJJA 4TKUA 3KKMA 5EKUA 1YJ5A 2HLHA 1O4WA 3HL4A 5KSPA 1TB4A 4XGIA 5FOTA 3WGOA 2IXEA 4BO6A 3ZCQA 1ZESA 3I9V6 3FCOA 3Q5DA 3UFBA 5DOZA 3K6SB 1S1MA 3LUPA 1GARA 2NTVA 1J8MF 1QOQB 2W6OA