4RAHA

Crystal structure of dimeric s33c beta-2 microglobulin mutant at 1.4 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPCDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title A covalent homodimer probing early oligomers along amyloid aggregation.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rahA00
5GHWH 1EFXA 3OAYK 5F72S 1CU4L 4X4ME 4UILL 4ODWA 4X7SH 3RGHA 5I2IA 2DLGA 1B4JH 3TWCH 3MRBA 3B2UD 3BZ4A 4ZUTA 3LMJH 5JW5A 1ZLSL 5I30L 1KYOJ 2A38A 1S7UA 1RUKL 2EE6A 1FIGH 3V6ZB 1A9BB 2QSVA 2GKIA 3C8KA 4PG9B 3CFIC 3JWOH 4M6MH 4NZUH 3R0MA 4B7IA 1MPAL 1NAMH 4O02L 1B4RA 1SEBA 3FO0H 4KI5E 1PY9A 5D1QD 5L8LB 4MB4A 4HIJB 4QRTB 2BDNH 3FT3B 4BFIA 5A2JH 3MGTA 3JWDH 1RJYA 2R1YB 1B0GA 5F7NC 3HZYB 5HD8D 3I9GH 4OQTA 5EWIL 3V6OE 2BCKB 4G8GA 4R97C 4HJGB 3U4AA 1QEWA 3K2MC 4I4WB 2G9HB 2V7HA 1ITBB 1A47A 3LQAH 4HWNA 2DWEA 4PJBA 1KGCD 4M00A 2LAAA 2VO5A 2XT1B 2FIKA 2Q8AH 2APXA 4WUKH 1PJ9A 5C8JA 3MGOA 1ORQA 3WO4C 3T77B 4NZTH 3T8XA 2PO6A 1I3VA 2NY6D 5D1XB 3X11A 4JZJA 4TVSa 3H2WA 2ZP0T 2F53D 4FFYH 3VWJB 3DYMA 4BZ1H 4HPOL 4LL9A 3C2SA 4X6CB 4KU1A 1CLYL 4HS3B 3MCKB 3RTQC 1NBYB 5GSVA 3C5ZA 1KCVL 4PRAB 5E6ID 3OGCA 3O6LH 1RK1A 1NCAL 4HBCH 4NQVA 4WWID 5E6ZA 1NCCH 1BQUA 5GS0H 3BUYA 1FVEB 4AMKH 4M5YH 4R90H 2HT4C 4KMLB 4LSVL 1CDIA 4PRHB 2E6QA 2PUQT 2KPNA 4EN3D 1MIEH 3ET9F 3UROR 5T3XE 3C5JB 5C2UB 3HZVB 1NFKA 2CLZB 2DQUH 2NY3B 3RY4A 5F8QC 4F9PA 1CGXA 1OLLA 1C5BH 3FN0L 4NFCA 5F7HA 3KYMA 5C92A 1RUAL 1MCBA 1UKSA 4UIMA 5IB2A 4P9HH 4ZTPL 1ZWIB 2YBRA 1KT2B 2YKLL 3A67H 4IIQA 4NN6C 2VXQH 1UA6L 5F1IA 1U8IB 4I2XB 5DDHB 5KSAB 2OCFD 5IVXF 5JOPD 3WIFA 1B90A 4KFZC 4P2OD 3SE9H 3PHQB 2EIEA 1G9ML 4G6JL 2EDRA 2A0LD 2GSIB 3HMWH 1FNGB 3MJ9L 1J11A 5GZND 4O4YL 4OM1H 4OF3A 2F54D 1CL7L 1WZ1H 3Q3GA 1G1CA 4ZAKA 2RFXB 4TUJB 4BUHA 3ZYIA 4WTZG 2W0FA 4YNYB 2P1YA 1F5WA 2ATPB 3MOBH 4JPKL 3VFNB 1IJ9A 5C70A 4J8RA 3RWCA 4LRNL 3H9SA 3FZUD 1IAIL 2J8OA 2AP2A 5KTEL 4P57A 5J9PA 3S34L 1IGIH 2R2EA 1KV3A 4PR5A 3GSRB 4DVRH 2P8LB 3W9DA 5IT2L 4IJ3C 2NW2A 3WNOA 1ZAGA 1P6AB 4ZUSA 1KYOK 1CFSB 1GPOL 4FTVD 4Y2DB 3LS5L 3F7RA 5BVPL 4MA8H 1G7HB 1C08A 3HPLB 3VRJA 5T5FH 2YUWA 2XZQL 2B7DT 3PIQB 4KRPD 4NO5A 4LFHD 4NPYA 4PJFB 4WI4A 3OKOB 3L7FA 3TBTA 3N1QC 4N9OB 2AXFA 3HNVH 1EERB 4L3ED 1E0OB 5HHOD 3VXOA 5IEKB 2EXYD 5KBNC 4CADB 4HWZB 2V5RA 5BXFA 1MI5B 3LS4H 3TO2B 4M7LT 2ATKA 2DIJA 3MR9A 2WBJB 5A3ID 3VXMD 4JKMA 2AK4D 2EDXA 1CXKA 1NMBL 4R7NB 4QRPE 4MYWB 3L6FA 1JF5A 2W9LA 5ADPH 5HGHB 3EDFA 4I3SL 2X7LB 3JV6A 3RL1B 1NCWL 3SJVE 4G7YL 3FAXA 5DJAA 5I1GL 1CLCA 1Q0XH 1QLRB 3FMGH 3WDHA 2R29H 5F9JA 5CSGA 4X80H 1BQHB 3OJDA 2ADJB 5CIPA 4LLVB 3C6LC 4NRXB 4XBGB 3O2DA 1UYWL 1QNZL 4YHYB 4EDXA 1DQML 5HYJE 1CBVL 4RZCA 5BV7B 5C0DB 2XTJB 5BJTB 1P84J 5GZOD 1VB9A 3RWDA 3SEPA 3QPXL 5JO5A 5IQ9B 1MY7A 1DANT 3ZE2F 2ITCB 4S11A 2ENYA 3IDGB 5E4EC 1S9XB 1MWAB 4POZD 1F42A 3MQIA 3GBMH 1J86A 1T3FA 3RJQB 3NFNA 4GMTL 3K74B 1K4DA 4KY1H 2V9RA 4ZYKA 4TNVK 1A6WH 1BOYA 3D85B 3UBXB 2GSGB 4LSUL 3DHJA 1FGVH 1F4HA 4U3XA 3SCMB 4YXLL 5HDQL 1IC4H 2QQKL 4KI1A 4Y1AB 3QEHA 3MRCB 4QHMA 4ZPTA 4EUPB 4MNQA 3T65A 1ZKAA 3AAZA 4WTXA 4GSDH 3QEQA 1HH9A 4JJHA 4PYHA 3RDTA 4OD1H 1BD2E 3QWRD 1OSPL 4HLZH 3KPRA 5DD0L 4OLYL 1S7QB 3OB0H 1T1YB 3WNLA 1QYGL 4Z5RB 5IHLB 3U79A 4EQ3A 3WUWA 3MV9B 4M9OA 3KPQA 5DEFB 3P11L 4FQLH 1YMMA 3DBXA 1ZE3C 5FIEA 5T1KB 4MXVF 5D7JB 5D1XD 1CDGA 3OX8A 4P4KB 2XQYK 1CIUA 3ZSTA 4AEHL 5J6GA 4M93C 1E4WL 3DARA 1FDLH 1X5LA 4J3XA 5HHNB 4JLRB 43CAA 2CDEA 1VFBA 2SEBB 2JK5B 1YJDL 1TCRA 4XVSL 2O93L 4OCMC 1BIIA 2WP3T 3IXAB 2VLRD 4KKBD 4MX7A 1RU9H 2NW3A 1CGSH 4F57H 4Y19D 2ZCKH 3GSNH 5D6CA 2ICWI 3BZDA 4PRHD 2ZUYA 1MCOH 3REWA 3JXAA 1G7JA 1F3JA 4PJGA 5KS9A 1BD2D 1E27A 4YHML 3FO2B 3QUYC 1FLRL 3QA3B 2E8YA 1NANH 2ICES 1TETH 2ZOKB 1HKFA 2Q8BL 4QHLB 5F89B 1IFHH 4EDWL 1MRFL 1RZKH 3PGCB 4H20H 3T1FB 4XZUB 2HTLD 1UCBL 4XVUC 2B2XH 5F1NA 4OFKA 1KN2H 3MV11 3TEUA 5FGBC 4Y8AA 3DIFA 1YZZA 1S78D 1MCHA 4OQTL 5LG1A 1AXSB 1IAIM 4ORGB 5B3NA 3B5HA 4X4YA 2BHUA 4WY7H 3T0EC 3HAEH 3R1GH 1EGJH 1YN6B 2VSCA 3TZVA 1P5UA 4KK5D 4NUGL 1P53A 5KSAD 1L7TH 2QHRH 1INDL 1UWEL 1I3GH 1NGZB 1JGEB 4KKLC 4RGMC 1D7FA 5EH1A 5GRYA 4BQ9A 1OGAB 4N0UB 3KNBB 3PWPA 2YPLE 4I0KA 3VGDA 5ITFA 2H8PA 1WK0A 5ALBL 3GRWA 2OJZH 1U3JA 5DD5H 5I1EH 3NIFF 1EEZA 5FYKD 1G9NC 5ABDE 1A7PL 2VLJE 3O6FC 2EDLA 3IU3A 5KSUA 1TITA 1TNNA 2YA0A 5FA3B 3SKUD 3JTSB 4M7KH 5CZXD 5ICZA 1VPOL 4F8QA 4JFQA 5CHNA 3BEVB 4LAQH 4FQXB 5D93C 1LO0H 4EXKA 2NMSA 1F6AB 5JPMA 3NZHH 3AS3A 1CDJA 3FB6A 1OAKL 4Y2DD 3QCUH 5J12B 1I1YA 3VA6A 1QKZH 5I1KL 3MJ7B 3VRLE 2W9DL 3UYRL 1VEMA 4TUOB 2HT2D 4HC1A 5EA0H 3TN0C 5IJVB 1WEJL 3BW9A 3FFDA 2VDQL 1LE9A 4P2RE 5TPWH 4JFDE 5ESVB 1HYSD 2AEPH 3SE3C 5E08H 2YMXL 3P9WB 3QG6A 1HXYB 2FO4B 1JPTH 1YQ2A 3MPCA 3ZTNL 4Z7WE 1T0NA 5FUZL 3HN3A 1T03L 1JPFB 3FRPG 1V5JA 3B3IB 3QIWD 1JGLL 5TDPA 2EC8A 5HI4C 2NY4C 2X9WA 2K3TA 2Z0BA 4P5MB 3QZWA 4ZO6A 3JUYA 3TV3H 5DMGD 4DTGL 3OAZK 4RMSA 3HMXA 4OGXH 5JORA 3GB7B 3FTGA 3DGGA 5JOFB 3IYLW 1UZ8B 1FL6B 4ZFOB 3RIFF 3B8SA 4JFEB 3CZJA 4AIOA 1BM3H 1QRND 3NABL 4LNVA 3LEVH 5E2TL 2N7BA 2DQEL 4U1KA 2CKNA 2PYFA 4RAUB 3CFJA 3HUJB 3C6SB 5IVNA 3QI9D 3ALWA 3SGDI 5FA4B 3R8BB 4AT6B 2VB5A 4NM8H 4C57C 2IH1A 2AI0H 3E8UL 3PGFH 4WWKC 3D85D 4CVXB 4DKEL 2VYRE 2NXYD 3SCMD 1IGYB 3EO0A 4Y1AD 1ZEAH 2PYEE 4L3CB 1EAJA 1YQVH 4JN2A 3FQNA 4WO4B 1P5VA 4BQBA 1J5OH 4PTTA 3WFHA 4XPAH 4EI5C 2BNQB 1A1OA 1TTFA 2GK0B 1HHGB 4XI5C 2R69L 3PL6B 5GGUA 4NBYB 1ZTXH 5EU7E 3TYGH 1KEGL 3QPQD 1FZJB 4HJJH 4LIQH 4Y16B 2DQJH 4OB5H 4E41E 1JUFA 1B3JA 3GHEL 3MV9D 5C3TA 3EYSH 2X4QB 1HNFA 5GRUH 2ZUUA 1JHTA 1ZHNA 2AV7A 1AGFB 4UDTA 5T1KD 2HT3C 1MJUL 3H9ZA 4HDIB 5D7JD 5IKCB 4QRRB 3KJ6L 4P4KD 4X6EB 2ESVE 4UV4H 3NFSL 4GRMB 2EDNA 1AC6A 1X6LA 3IDNB 5HGGS 3CFBB 5FO7B 4Q6IA 3ZYOA 2FJHA 2WSKA 1I7TB 3MGAA 3F7VB 2DQCH 4M3KB 1V05A 4NKDA 5HGBB 2IWGA 3ARZA 3SE8H 3QNYA 5L2KE 1IGJB 1Y6KR 3MLYH 4DVBB 4F8TA 1EUTA 1JWMB 2XWBB 1DDHB 1L0YA 1XZ0B 4HZLB 4LU5L 4FHBD 2HTKC 4LLYA 1RZGA 3FT4B 3Q2CA 2AJYL 1TZHB 2OLDA 1OPGH 3X3GL 4WW2B 2YSSB 4QHUA 4CBPA 3C8HA 1RFDH 4RGNB 4XNYL 5HI5D 4PJIA 2CKBB 3VDBA 4PB9L 3I2CL 3IDYC 4G9FA 5CJBA 3UPCA 3KLSA 1QA9B 1BIHA 4YHLL 3VFTA 5GGQH 5A2IH 2ZUWA 5T3ZD 1Z0NA 3KXFA 5I8EB 4Z7UA 5JHDB 1J87A 2WW8A 1JE6A 5I9QB 3U9UA 1RIVH 4ELMB 3KPLA 2ZG3A 2DKUA 5EZLB 3KVQA 4TQEL 5L7XH 4FZEH 5GISL 4RCAA 5DMJB 1E4KC 4D94A 3U48A 4D0BB 4UTBL 2WNGA 1U8QA 1EAPA 5FYKH 2ITDB 1KENL 1J8HA 8CGTA 5DJXB 1HZHH 3RPIA 4F7MA 4PREB 5HDLA 5FM5O 5F7EH 1OGAD 3ZDZE 1M1SA 5I8CA 3LSOA 3RUGB 1F3RB 5I16A 4YX2L 3CIQA 2RB8A 1NDMA 1QQDB 1F11B 2X4OA 5MEPB 4AYFA 1R3IL 4R96B 2LTQC 4PJXE 3U30B 1LNUA 2DI7A 4HT1H 5E6YA 3WUWG 4PRDB 3ARGA 3P9MB 4QNPF 5GS2D 2BC4B 3O11A 5B39A 4PJHA 4GKSB 4UNTA 4FQXD 3BEWB 4ZS7L 3P30H 1EEUA 4DCQA 1AKJA 4NDMA 4LHUB 2Y36H 2CIIB 3IVKA 1BECA 4UMGA 5IB4A 3OAUL 1IKFH 2EYTA 2BK8A 1JZ4A 1YY9C 3RVVD 4A6YH 3RIFK 3WHE0 1KXQE 5D2NB 4N8CL 4DZ8B 1U2CA 5FYLD 3IGAA 3FRUA 1OP5K 3TH3T 3RWIA 1WBZB 3LDBB 1CGWA 1MJ7H 2ARJA 1HINL 2P24A 3BO8B 1OP3H 1TZGL 5HGAA 3UAJC 5D7IA 4CDHA 4LQ1A 2ZSVA 5A43C 1FVDB 4M1DL 2YZ8A 3DYOA 1KNOB 1AQKH 1XF2B 4F33A 4HF5L 5FM8A 1UXWB 4XAKE 3T4AA 2VXTL 3MODL 3LKRB 3O3AA 4JQIL 3SGEH 3BGMA 1UM5H 4MQXC 1ROWA 3F58L 3CD4A 3PV6A 1FZOA 3CK0L 5F1SA 3UTZA 5FYJL 4I18B 5DMIH 3UDWC 3S96B 3QDJE 1UZ6F 5BV7H 4DUXA 5FB8A 5C3LD 4M5ZH 5D2LA 5L2JB 5KG9A 4Q9RH 4U31A 4YH6A 3GRWL 2BOBA 4G42A 1MWAH 4Y4HB 4ODXB 3AREB 1VGKB 3S9DB 4Q74A 2W60A 3V9FA 4HG4J 4JFED 5I19L 4WU5A 2J88L 3L1OH 1HOCA 5E2UH 1VFOA 2RQ8A 3BP6A 1UB6A 3D18B 3S5LA 1OTTC 5ADOL 4NO0D 2CJUL 2E3VA 4QGTA 4EUPH 4PJEF 1OW0A 4HUUA 5D6DA 1L0XA 5D5MA 1PZUB 2FEDC 2A83A 4QOKB 2VNCA 2OXHA 3I50H 5EFIA 5TH2A 3KYAA 1JPST 4OZHB 3OF6D 1JGDA 2NTFB 3TBYB 4OZIF 1N5YH 1F90H 2RCSL 3LEYH 4WO4D 4Z76A 5M7QA 3FN9A 3SDYL 3UO1L 2PXYA 1UM4L 2JCCE 3U4BH 5IMMA 3GNMH 5DRNB 3PL6D 3HZKB 1BJ8A 3VXPA 3WSQH 3QIBA 5IHUL 3P73B 1T6WA 1OTSD 3PV7A 2CLVB 5JW4Q 1G0XA 3GHBH 4BFBD 1ED3A 3CVHB 2C26A 2ZNWA 2G60L 1A6AA 2YXMA 3LH2H 1NUGA 1CXEA 4ZXBC 3L3DA 2MQCA 4IRSC 4QRRD 3U0WH 5B8CA 3UC0H 4QWWC 1N3NA 5J6HA 3U1SL 5F7YC 1MQKH 3ULVC 4XCCL 4UAOB 4NHCL 4OZFG 4D0CA 2Y7QB 1BQLH 3WL9A 3RQ3A 3BUTA 4HQQH 2P5WB 1H15B 1JK8A 4M1GL 4YR6A 3HS0A 4V2CB 3U7YH 5HSFA 1N6QL 1H3PL 2BNRA 1V7ML 4FFWC 1MCCA 4HUXA 3L3KB 3CMOH 4NQSB 5K9OB 4U3HA 3EDKA 4UU9B 1FC1A 1FORL 1AD0A 3QHZH 4NZJA 5DQ9B 4U6HA 5T3ZH 5CD5D 3W9EB 1I1RA 3GBNH 3LHPL 5IWLC 4Y5XC 4PJ8C 4RGND 2AK1H 3INUH 3ULVF 1LEIB 1H8SA 3TBWB 4PJ9B 3M17B 2N7AA 4CU7A 3MRQB 5I0ZA 5LKNA 3MRHB 1CS6A 2YRPA 2HFGH 4JG0L 5EU5A 4WHYG 1CFQA 5CLTA 2D2OA 3AS2A 3WXWH 3ARXA 5CSZB 2V9QA 3ELAT 3KLAA 1A22B 5B4MD 4K3HA 4WW1B 5DS8A 3AS1A 4NFDA 3HR5A 3HE7C 1JF1B 5FECA 1C16B 5IM7A 1UM6L 4HBQA 4R8WH 3IETA 1GGIL 3L5XL 3QEGH 3VCLA 2O5XH 1RZJL 3FQUB 1QVOB 3H7LA 1OSZA 2FJGB 1P1ZA 2DM7A 5GS2H 3AB0B 2FJFA 1P4IL 1I8MA 4OF5A 2V2TA 1S3KL 4L4TB 1JRHI 4JO1L 4FQJH 4MNGE 2BY0A 2W0KA 4MAYB 2UZXB 3G6AB 1I3RB 2PTVA 3BPOC 5FCUL 4CU6A 3VFMB 3HB3C 1A3RH 3FQWA 3IDIA 2X1PA 4Y4FB 2DQDL 4LLUB 5LBSH 1M7DB 2EKSB 4RNRB 3L3GA 1S7VB 4WI9A 4K23L 1FFPA 3D39D 3EYOB 3HZMB 3TJHD 5K33A 1QLEH 5FYLH 4YQXL 4GBXA 1EO7A 1A7NH 3SN6N 1CDHA 4JY6B 4U3CA 3T0VA 4LHUD 5IFJB 4OBSA 3CH1A 3WFCL 1EEYB 4HXBH 3QEUA 4X4MA 1VGEH 1MH5A 1Z9SA 4KZDL 1XCQA 3MCLH 1CLOH 5HY9B 2A6IA 5EBWB 5EU4B 4KKCD 5IROA 2DB8A 3M07A 1BOGB 2NYYD 4RX4D 2X4PA 4Y5YC 1NMAL 3VFVA 5IMOB 1FVCA 1C12A 3UJIL 2CD0A 3FB8B 5ILTH 4O2FB 1AP2B 1EMTH 1MAML 2CO7B 4NRYA 5FM5M 1FAIL 4G6KH 4XC1H 1JNLH 2MQ0A 3Q6GH 4G7VH 1AIFB 1QFWI 3V6OA 4HIXH 4JHZA 2YZ1A 4JFXA 1G9MC 4N0FA 3G04A 3K4ZA 5GHWL 1DLFH 1WUNT 3MUGA 1FNEA 3V52H 1XFPA 3TWCL 3T2OA 1D5MB 1TLKA 4X9IA 3T1WA 2VR5A 5ESAB 1DLHB 2QBWA 4NNXA 1X4XA 3SPVB 3EO1A 4WV1B 3BPCB 1MNUH 1FIGL 4Y4HD 2DMBA 3VI4E 3IFPA 3ARED 4YHNB 3JWOL 5D8JH 4M6ML 3GMLA 4NZUL 3UPAA 2Q6WA 1NAML 4JANA 3H3PH 4PRPB 1J10A 1ZANH 4JFPB 2BDNL 3GMOB 5K93A 1MVFA 4YHZH 3JWDL 3JVGA 4BKLB 1NGWA 3I9GL 4P2OA 1MCFA 2V5SA 5FK9B 2IANB 2VUYA 5CBEA 2JTDA 3IU4H 1U95B 5T1LA 3TBVB 5FKPA 3CSBA 3G6DH 3UTQB 3QUMB 1G7LA 4QHNB 5C0EA 1A3LH 1KCLA 1RY7B 3HLAA 3I6LD 1N59A 4KUCF 5B39G 4WUKL 1T83A 1ZA6A 3BN9C 4PTUA 2D9CA 5MENB 3DX6B 4NZTL 3TP4A 1K3IA 3GJFB 2VC2H 3QJFA 3T09A 3VRIB 2CDFA 1U8OB 4UB0H 1HWHB 4CRPA 4FFYL 4PY7A 5E8DL 4BZ1L 4J4PD 4OCRH 2DYPA 5DZOA 3VFPA 4JFHE 4GW5A 2B4CC 4EIGB 4GRLB 3PP3K 3WS3B 4F7CB 3O6LL 3S36X 4NZRH 4FRWA 5FGRA 4DN3H 3GFUA 1H5BB 5I71B 1LP9F 2R1WB 3VG9C 2VLKB 1L6ZA 1FCCA 5GS0L 2O5YL 4M5YL 4R90L 2IFFH 5DR5H 3PDDA 2PTTB 1PVHA 1BJ1J 1MIEL 5HI3D 2UVFA 1KCRH 4GG6F 4NFBA 2CKBH 1RK0B 1QR1B 4WCYH 4G9DB 5EBMA 1C5BL 2Q7NA 3I6KA 4HAFA 2UWEA 3TVMB 3CU1A 3P4MA 4LGRB 4QTHB 5A2FA 2Y5TB 1R24A 2H9GA 4GRWF 4XXDB 1UXSA 1I1AA 1OQOA 1SMOA 4EVNA 2VE6B 1N8ZB 1I9IL 3BP4B 4P9HL 4KWUA 2G5BA 1J1XH 2VN4A 2GTZB 2BJMH 4PJ9D 5D7LE 5IGXH 5EUOB 3A67L 2DN7A 3CPLB 3GI9H 5EIVA 4ZNEE 2VXQL 1XGUA 1UQSB 4PV9A 5KSBE 3E6HB 3S5LG 1YEGH 1ONQA 1E4XI 3BYYA 3SE9L 1J1PL 4OGYL 5IMKA 4DUWA 3N1MC 2YC1B 3PDGA 5D1ZA 2DIAA 3HMWL 3CZFA 2ICWJ 1W0VB 2Z93A 3DX8A 3PWLB 3DETC 5K9JH 4OM1L 3ZE0E 5CP3A 1P9MA 1WZ1L 2IAMC 5FF6B 2RR3A 3L7EA 1L0QA 5IW1B 3L3IB 1U41A 3MOBL 3O3EA 1WCQA 4OQ1A 4X7CC 2FL5A 4O58H 2BHZA 3MACH 1LQSR 4O2EB 4KJQD 4L4TD 2WQ8A 4L8BA 5I1LB 3HRZB 4KQ3L 5IOPA 1IGIL 3SKMB 1KPVA 4YPJA 4HV8B 3OKNB 4QRPA 5F6HI 1BFTA 3VE0A 3BIKB 5L0QB 3RZWA 1QHPA 1BWWA 5J1AA 4PBVC 1S7TA 4UIKH 4Y4FD 1ZHLA 1NC2D 1QFOA 4K55A 4FN0A 1AD9B 1XGQB 4MA8L 1RJZB 5FO8A 5I66A 1J0KA 4JM4H 5T5FL 3QFJE 3EJYC 4FXKB 5H94B 3EFDH 3WN5B 5EZIH 5DHXB 3MRPB 3U7AA 5HYJA 5CEXB 1NMCC 1P7QD 3QNXB 3PQYB 1S9WA 3HNVL 5FHAL 3PABB 3HFMH 2DDQH 3VGEA 3WKMH 4OZGB 2IPKB 2L4OA 3NCBB 3N1GC 4AK1A 2WV3A 4JRXD 3LS4L 1NCDH 4APQA 2JB6A 3QO0A 2XY2A 3T2NH 3LEXA 5CFHA 4ODHH 4OTXH 4M8QA 4JFYA 5DYOB 4FG6D 3H42L 2VLRA 5I1DB 4ISVA 5IK3A 1Q0XL 3O9WA 4OFIA 3FMGL 4Y19A 2J6EH 3EYUH 2R29L 4WFHE 1NPUA 4K8RD 4OJFH 5ETUB 3FOLA 4MCYA 1BD2A 3W11D 1JN6A 4IDJL 1PEZA 3GSOA 4XH2B 2K7QA 5C08B 1MEXH 4NQEB 3U4EA 4U1HB 1WZLA 4KROC 4J3VA 4P4RA 4QXWA 2JJVA 3OR6B 3QUZA 4CVZA 4YHIA 3I6GB 1KPUA 1X5YA 3WNNA 4AIXA 2UVEA 2VXSH 3BGAA 2WIMA 3WEXB 3GBML 1VACA 1FFNA 2X4SA 4Z77A 1QO3A 4KY1L 3UJJH 3BD3A 3AMKA 3REVA 5DRWB 1ZLVK 3WV0A 4GAYA 4PRPD 1KXTB 3QG7H 4HFUH 2VTFA 1FGVL 1DANU 4UQ3A 3MBEC 4Q58C 1F3DJ 1IC4L 4NQCE 3UP1A 1U8IA 5GIRA 2B20A 1N5AB 2J7LA 4M8VA 3T2PA 1P7KB 4LDEB 1U3HC 5J1SC 3KS0J 4GSDL 2Q76B 1KPRA 4NKMB 4OD1L 3P3YA 1JNHA 4X98A 1ADQH 1F4AA 3QJHB 5BRZB 1IBGH 3OXRA 3KPTA 1BFOB 1MAJA 2IJ0C 4KK9D 3L95A 4C83B 3G6JB 4UQ2B 1OGTB 1WQVT 4JRWA 2A77H 4EQ2A 3CVHH 4FQLL 4LGPB 5ANMB 5EOTB 3VFNA 5MEND 2PTUA 5AZ2H 3QIUC 3SOBH 3LRSB 1BREA 1A2YB 3P0VH 5E1HB 5FV1L 3IFLH 3PWJB 3ULUC 4HLZG 4LVEA 3KYKH 4K3JH 5FDYA 5T1MB 3RWFA 4HKZB 3NIGE 4HKJB 1FDLL 1INEL 1XEDA 3L5JA 1CFSA 4X99B 1R3KB 4FZ8H 2PETA 1ES0A 2G75A 3OR7B 4JFFB 4GRLD 4HEME 5E99H 3O8XA 4LSPL 2YUXA 5HGDA 1CICC 4LHQB 4JKPL 4LCUA 2VLKD 4GLRH 1RU9L 4M4PA 5DJCB 1IL1A 1CGSL 4F57L 4KKAC 2ZCKL 1D9KB 2EZ0C 2FATL 4X6DF 1MCOL 4LLQB 4A6YA 4I77H 4QXUL 3EW3B 3ULUF 2YPLA 1KLGB 4F7TA 1TETL 4D9LH 1CGTA 4PJDB 1IFHL 4PJAE 3ULSA 1FYTD 3I84A 1AHWC 3SDDD 3F5WB 4H20L 1WBYB 4JM2B 3TVMD 2FHFA 4X6CE 2VLJA 2B2XL 3SKJH 3QIWA 1KN2L 3RRQA 4IM8A 1QSFB 3MRLA 2AJZB 4NSKB 5TE4H 4ZUVA 7FABH 4JFOB 2BVPA 3R1GL 4LCWB 2BZDA 5CJQL 3ZT7A 4IMKC 5BZWA 3TO4C 2ZUVA 4ZSOB 1KB5B 5IW6B 1L7TL 1S7WB 2QHRL 2DM4A 3S88L 3T3MF 4LRIC 3EUUA 5C0DA 2GITA 4YPGB 1I3GL 8FABA 1WIPA 2JKXA 1DQDH 1MHCA 3LPGA 1BJMA 2OTWA 1MF2H 3BWAB 2OR7A 3QH3B 5B22A 1QRNA 4F3FB 1LEGA 4P2QD 2I24N 3B8YA 4ELKB 4TRPH 3HAEG 2QSTA 2ZSWA 2OJZL 4P2RA 3WIIH 3DO3A 4JFDA 4KJPC 5I1EL 1IVLA 2IC2A 3QI9A 5C0JA 2FH6A 1PAMA 3ZHKA 3MYJA 5JW3H 1Q9WA 4M7KL 2Y1VA 4S1QH 4X9HA 5TE6H 4LAQL 2HVKA 3IRZA 1LO0L 4LPUA 1W8OA 3D5OF 2CUMA 3SKNA 3VFWA 5DJZB 3HC3H 3NZHL 2AEWA 2IMMA 1JWUB 1UVQA 4PGBA 3OGOE 2IPTH 1KBGH 2NZ9D 3QCUL 4QYOA 3MUJA 5AEAA 1T6VN 1S7QA 1JTPA 3VFSA 2NY0C 2XA8L 5E2WH 3MLVH 5DO2D 2R2HA 5I8KH 1INQA 3D0VA 4YLQT 5EA0L 3KDMB 1RMFH 2EH7H 1WC7B 3ZDXE 2FYYA 4L8CB 3LKQA 3Q1SH 5TPWL 3DROA 4LFHG 1VHPA 2AEPL 3PQYD 5E08L 3EYQC 4N0CD 3ARBC 2BSTA 1RZFL 4P23B 4ZNCD 1JPTL 1YY8A 5M95B 3VXNA 3V79C 1AR1C 2QSCH 4KJYA 3W39A 1A02N 5F71A 1VKXB 4N1EA 2VKXA 2WWKO 4K8RH 3O4OB 5DJYA 4MAUH 5GGTH 2ADIA 4KDVA 1I7UA 5FGCB 4OF0A 5IG7B 4PGCB 4CJ0A 1TVBB 2VH5L 2WWMC 2FECI 3TV3L 4PRNA 2GEEA 1IMHC 2PYEA 3MRKA 2EIBA 1WTGT 3CFDB 3SKOB 2VQ1A 5LGJB 4OGXL 4YDVA 1NLDH 3SY0B 1PKQE 5GS1B 1PZ5A 4P5TC 5CEZD 3UTPD 2D7QA 2BNUA 2I26N 4OLXH 3VGBA 5EUKA 3MLUH 4KTDH 5C08D 5KAQF 3ABZA 1D3CA 1M05B 2BRQA 1UB5B 4GAJH 3BVNB 3FQRB 3ESUF 3LEVL 1MI5E 1Q9OB 4WI6A 3VRLF 5FDWA 4CAGA 3ECBB 2W9EL 2ESVA 1W72A 4NM8L 5E8OA 5C0CB 2GIYA 4C56E 5ID1A 2AI0L 3PGFL 1O5DT 1A4KB 4QT5B 1WJ3A 2XXMB 4N1CA 3SO3C 3O0RL 4FQPA 1MLCB 1ZEAL 3BH9A 4JE4B 1YQVL 4FS0A 3OXSB 5SX4H 1ZHBA 1J5OL 3MNZA 3H9HA 3HI5L 5L2KA 4XPAL 3X3FH 4Z7NE 1FZMB 2XTJE 4Z7WF 4QEGA 1EBPA 4KZEH 2VR4A 2NY7H 1CCZA 4JCLA 1VA9A 1D5BA 3EFFB 3P4OA 4JRYB 5BRZD 2NPLX 1ZTXL 3TYGL 4K2UH 4HJJL 4LIQL 5C0GB 1NUDA 3LKNB 5ISZE 4OB5L 4XNXH 2JJTC 2AJ3A 3EYSL 1U58B 4KMTH 5GRUL 2Y72A 1FJ1B 4PGDA 5CGYC 4NOFA 4U6XB 5TDNB 3ZKSD 4NYLB 4A2LA 1T4KB 1WFTA 4KRLB 4MZ2A 4P59H 2RHEA 4BQ8A 1A4JB 3AFLA 4PFEA 5LXGH 3FQXA 4K94L 2DQCL 3DUSA 4U1JA 4ZDHB 3SE8L 1RJLA 4NKIL 4QTIH 3TA3D 4HKBB 3MLYL 3T0AA 3JSSA 1T1ZB 3G9VA 4XVJH 3O3UN 5H35B 4MS8C 5JXEA 3BZEA 1TXKA 4XBPA 4KK8C 1ZGLA 1BZ7B 5EPMA 1D9KD 1OPGL 3MV8B 3NAAH 3K3QA 2ERJB 1RFDL 4Z78A 1EZVX 5DC0A 5DRXA 2IALB 3SQOL 2J8UE 2B5IB 3MXVH 4RMRA 2X4RB 3M1BB 3G5YB 4PJ7E 3UJTL 2BX5A 1KFAH 1JV5A 4WGWB 5GGQL 5DUBA 3TFKC 2IBBA 3PHOB 4OF7A 2F15A 1QSFD 3LPWA 1AGCA 4JZNA 5BS0D 1RIVL 4NGHH 3QQ3B 5L7XL 4L8SC 4FZEL 4PGEA 3TNNB 5C0NC 3JUZA 2NLJB 3VA2C 5EOCH 1EFXB 2VZOA 3LKSA 4ODWB 5I2IB 3LN5A 4HH8A 1CT8A 4IS6A 4MZ3A 5F7MC 3V5HA 3MRBB 4S1DD 3U7WH 3VGGA 2H45A 3BZ4B 5F7EL 4RAVA 4ZUTB 5JW5B 4HCRH 4NO0A 2IG2L 3GSUA 1S7UB 1IRAY 3UXFA 2FLBT 1S9YA 3C6SA 3QR2A 5KVDL 1R5WA 5GJTH 5EO0A 3BFOA 4HT1L 4LOUD 5E70A 4KJWD 1SEBB 3NCMA 3GO1H 1U8PA 2CUHA 5MI0C 3BIBX 3IXTA 4BFIB 3MGTB 3OF6A 1RJYB 3P30L 1B0GB 1A1NA 2Y36L 4G8GB 1F58H 3QDJA 1QEWB 1IKFL 2V7HB 3DV4A 3FONA 4DGYH 4A6YL 3KJ4C 1S5HA 4N0UE 4CW1A 3GM8A 4HUVA 1SJXA 5E0QA 2DWEB 4PJBB 3UZVB 4TNWF 3OKLA 2YD7A 1MJ7L 2FIKB 3ZKND 5IV2A 5C8JB 3MGOB 1ORQB 2WAHA 4WFGD 2PO6B 3T8XB 2Z31C 2I9TA 1C7SA 4RISH 3X11B 4JZJB 1IAKA 3ESVF 1NFIA 1AQKL 4YEEA 3L3JA 4G6AC 4P23D 1BQSA 4NC1E 4BFEA 3N06B 1UM5L 2BERA 1MHHA 4HHAA 4K71C 3QDME 5GSVB 3C5ZB 4OT1H 4RDQG 4HMDA 1ETZA 3OGCB 4E5XA 3QFDA 5CEZH 5F6IC 1I9JH 5DMIL 4NQVB 3BUYB 3PE9A 4YHOH 3D3VE 4M5ZL 3RY6C 4PJXF 2I07A 1WZKA 4KH2A 1DE4A 5KOVC 4Q9RL 4J3SA 2ED7A 1MWAL 2JCCA 1A7QH 4TULH 5LGHH 2KDGA 4WFFD 5DQJA 1RVFH 4ODVH 5JMRA 1DFBH 2FGZA 3QCVH 3QUKA 1ACYL 5HTSA 2O61A 3RGVC 2OQJA 3L1OL 4Q7DA 5E2UL 4K7PY 5HHMD 3TM6A 5D96C 3KYMB 4DAGH 4JJ5B 4XX1G 3HE6A 2Q7YA 4KDTA 1G7QA 4ALAH 4UIMB 5HVGB 5IB2B 3AXLA 2ADGA 2YBRB 3BJLA 4LVHC 5C0CD 4PP1C 1UH4A 5D71H 4IIQB 3BIAX 4LVNC 3GK8H 5F1IB 4M7LL 5TQ2H 1N5YL 1F90L 3LEYL 3WIFB 3EOYG 1X5HA 1YEKH 5IMLA 3GDBA 5KANI 3LKPA 3V8OA 1QBBA 3BISA 4GAGH 4EUPG 2MKWA 3U4BL 3GNML 4DKFH 3OKEA 5LVEA 2QSQA 5IJKC 2CXGA 1P7HL 1A9EA 1HNGA 4JRYD 3WSQL 4LCCC 3RKDC 4ETQA 3Q3GB 4ZAKB 2Z91A 5T5NG 1F11A 3GHBL 2W0FB 1ND0A 2EO9A 2Z4QA 1TQBC 4JVUA 3E2HB 2E7MA 3LH2L 1T89C 4J8RB 3RWCB 5JXAH 3H9SB 2P47B 1VCAA 32C2A 3D39A 2Z92A 3UC0L 4P57B 4GS7C 5E4EB 4LVOB 3RVTD 2R2EB 3MRDA 3NA9H 1MQKL 1XR9A 4PR5B 4TVPE 3W9DB 4H5SA 2NW2B 5C71A 4ZUSB 1BQLL 3L3HA 5C0FB 2GFBA 2X4UA 4KV5F 2BNQE 1C08B 1WFNA 4BQCA 5E1AA 3VRJB 4XP1H 1AJ7H 1WT5C 2QQQA 2LU4A 1M4KA 1FIEA 3U7YL 2WZPD 4NO5B 3BQUA 4OKDA 3K1DA 3CMOL 4P9MH 4NPYB 1BPVA 2GJJA 2WIIA 5EO9A 3L7FB 3TBTB 3QHZL 3MV8D 1H8OA 2AXFB 5BW7C 2OZ4H 4ZS6C 4TTDD 3GBNL 2X41A 1HH6A 3DUHA 3QXAA 3VXOB 1XF2A 3QUXC 2AK1L 3INUL 1YNKL 5BXFB 1CLYH 1L9MA 2ATKB 3MR9B 2HFGL 4OLZH 4ODBD 2V5YA 2VLLA 4OLVH 4PIRF 1CXLA 3AGVA 1KB5H 3L6FB 4OFDA 1XGRA 3WXWL 3JV6B 2KUTA 5DJAB 1M7IA 5HYSA 3G9AB 5IBLD 3RWJA 3VXRE 1BP3B 3LQAC 4YC2B 2VN7A 5CBAA 1JZ6A 5F9JB 4TVPD 4POYA 3OJDB 5DVNA 5CIPB 5CSBA 4J2XA 4DEPC 1TPXB 1EFXD 4EDXB 4RZCB 2BVYA 4R8WL 5GRWA 4K07A 3QEGL 1U36A 3SDAC 3T0BA 1FSKC 3RWDB 1WBXA 1BLNB 4LPYA 2FX8L 5JO5B 1R3HA 5F1OB 3QULA 3ALPA 3RHWF 3N1FC 2FH8A 4FQJL 4P46C 4U4BA 3VD9A 4NO2A 4R26H 1YPZF 3C09C 1T3FB 3NFNB 1GL4B 1K4DB 5AD0A 5JHDE 2XXCB 4ZYKB 2UY6A 2YKLH 4LQFH 5LBSL 1KLFA 5CZVH 5GS0C 3NGBB 3EYFA 3BJ91 3D69A 3HHRB 3QEHB 3GMNA 1QLEL 5FYLL 4QHMB 4ZPTB 1A7NL 3OWEA 4MNQB 3T65B 4JDZA 3AAZB 4ZPVA 4G8GD 1NL0H 3QEQB 1HH9B 1PG7X 1LVEA 4HXBL 3U6RA 3RDTB 25C8H 3U82B 3KPRB 1DN2A 1VSCA 4S2SA 3MCLL 2D9QB 2E7HA 1ADQA 1AR2A 2F8OA 3RUGE 4L1DA 4J4PA 3WUWB 5DHYA 3KPQB 2FEEL 3TT3L 1YMMB 2N56A 3DBXB 5I1IH 2PO6D 1XF3A 3C5SA 3OX8B 3RA7H 4Z8FH 1CDBA 5EDXA 4ERSL 5ILTL 1EMTL 5J6GB 3WS6C 4G6KL 4Y5VC 1G7PA 5JR1H 2Y7QA 3SGKA 2R23A 1I1CA 3ZE2E 3VGHA 4HIXL 2CDEB 1VFBB 43CAB 3C5ZD 3CXDH 2QLVB 1QSEE 4L4JA 2ZCLH 1TCRB 1B88A 1DLFL 1CR9L 1EJOL 4ZFOL 1BIIB 2ADFH 3C60A 1JFQH 4MX7B 2NW3B 3V52L 3E6FA 3BT2H 2WM0A 5D6CB 3SDCC 2NXZC 1H8NA 4Y4KC 4M7JH 3REWB 1DTUA 1G7JB 1F3JB 4PJGB 5KS9B 1S9KC 1MNUL 1E27B 2FGWH 4M9PA 1WWAX 3E3QC 3D9AH 5D8JL 4EZMA 2COQA 2FZ3A 1PSKH 3H3PL 3TBWA 1ZANL 3M17A 3G5VA 3MRQA 1JWSA 2N1KA 4I9WE 3CGTA 3MZTA 4XHJC 5F1NB 1NFDA 5HVHC 4YBLB 5FCSH 3DIFB 1UG9A 3B9KA 4MNHA 4X4YB 4XXCA 1J12A 2UUDH 3IU4L 3SGJA 3ALXA 6FABH 4C58B 1N64H 1NCBH 1RI8A 4MXVE 4LSQL 1A3LL 2F74A 3TZVB 3U2SA 3AS0A 4ODUA 1I85A 1QNZH 1CBVH 1N6UA 2DOCA 2YWZA 3KR3H 1BAFH 1BFSA 2C4XA 4ZFFA 4KKNA 3RWEA 2VC2L 3PWPB 1E4JA 4UB0L 4I0PC 4HXAH 5FUOH 2GJ6E 5ITFB 1MFAH 2H8PB 5AZEH 3IDXH 4OCRL 1EEZB 2ZWLT 2UZIH 1T22A 3IU3B 4XNZB 5KSUB 4U05A 1NC2A 5DGQA 4DN3L 4NZRL 3MUHL 4XNMA 4QOKE 4UI2A 5ICZB 4JFQB 5CHNB 4ZNEA 3B2UC 3EOBA 4YK4B 3QBTB 2IFFL 5DR5L 5JPMB 5KSBA 2AJXH 1IGMH 3FB6B 1OSPH 1P7QA 4NKOA 1I1YB 4BSVA 1KCRL 1Y18A 5KW9H 3QXWA 5D1QC 2CKBL 1BHGA 1FNSL 3FFCB 4JRXA 4WCYL 3AM8C 5C9JA 4LKCA 4YBQC 5E03A 3RHWK 3BW9B 5CJXA 3FFDB 3S37X 1LE9B 4JPIA 1MCSA 3BOVA 1PEWA 3LKOA 3QG6B 1IKNA 1J1XL 4FQQA 3I3EA 1KJVA 2BJML 2F58H 1T0NB 3GI9L 3IS1X 1U8JA 1WAAE 4ZD3H 1U8KA 4TVPH 2EXWD 4ZO7A 1NBQA 5GGTA 3B4NA 1YC8A 3HI1A 5TDPB 1L4IA 2EDOA 4FFVD 2E9BA 2VDKH 1C5DA 1YEGL 4WUUD 5ACMA 2NY6C 2OI9C 3T0EE 3WJJC 1E4XL 3QFJA 3QZWB 5D7SH 3DMMA 1LO4H 1T20A 1ZT4A 1ZGLM 1I4FA 4FXGA 5JORB 5K9JL 3FTGB 4X9BA 1LK3H 3DGGB 4ZG1A 3SDXF 5C0RH 4PJCF 5HXMA 4MD5A 3RX5A 1FLRH 5E6IC 3QYCA 4PRPA 5GRVL 2F9BT 5GXBB 5CINH 1MUJA 3MACL 4NHUA 3SO5A 3V6FA 3U0TA 4U1KB 2PYFB 1ZS8A 3HRPA 3CFJB 5J8OA 2M1KA 1MHEA 4MXWL 2ZPKH 3CAFA 4OQTH 5F1KC 1XIWA 1D6VH 4EN3C 3VFRA 1YYLL 4UIKL 4OCWH 2IH1B 1G7MA 4MJ6A 1I3UA 2XNAA 4H25A 1ZVYA 1NCTA 4L4VE 2YD1A 5DURD 3EO0B 4W70A 2QR0A 3EFDL 3FQNB 4JN2B 43C9A 5EZIL 4D9RE 2ICEA 4PTTB 3WFHB 4GQPH 1A1OB 3QEQD 4R0LC 1RZ7H 4LHUG 3VWKA 2OK0H 2AKRA 3HFML 2DDQL 3WKML 4R4BA 4YGVA 4NO3A 1BZ9A 3EOAA 1RZKC 2JJSA 2GCYA 1JUFB 1NCDL 4LSTH 1KEMH 1JHTB 4LPXA 5DJ2A 1ZHNB 1YMMD 2AV7B 5IB5A 4UDTB 4IEFB 5DFTA 1OM3H 4KUZL 1T0MA 5D7KD 4ODHL 4OTXL 5F88A 2BXZA 3QDGB 2A0LC 2ILLA 4CJ1A 4PJ5E 3GSQA 4PY8I 2EH8H 1NBZA 4NQCA 4JB9H 4FXLA 5GZNC 4KGJA 4Q6IB 3TPUA 4FQ1H 3EYUL 2VLME 2FJHB 2V17H 3TIDA 3O6FD 3OG6B 1X5AA 1N7MH 1D5ZA 3QO1A 4NKDB 4OJFL 4YXKH 1K9TA 2XFXB 2YD2A 2R9HD 3QNYB 3OQ3B 3H0TA 1DVFA 4N0YH 1ZLWH 4NUJA 1MEXL 4YZFF 3RZCC 3FZUC 1FYTA 1RZGB 4LLYB 3SDDA 2V5MA 1WFUA 4GQ9H 5HYSG 4JQVC 5E9DE 1KF9B 2OL3A 3DURB 1NCUA 4QHUB 2VXSL 4KRMB 1WF5A 4PJIB 3KPNA 3OB8A 2W59A 2ORBH 4G9FB 3QG7L 4MDIA 3ZTNH 4HFUL 3HCVA 1XF5A 4WDIA 3VFTB 2AEQH 4KRPC 4FMKA 4KAQH 5IBUB 4OF6A 3KXFB 4MGXA 4Z7UB 4UTAH 3U9UB 3BN3B 1KLUA 2YN3A 4L9LA 3KPLB 2VZUA 4PJ5D 4HIIA 5MEQA 2FRGP 5TF0A 3HC4H 4WEMB 1TNMA 2EXYC 1ADQL 1T5XA 4JY4A 4D3CH 4P2QA 2X44D 1IBGL 1KUMA 3TZVD 1T7WA 1MJJA 1U8QB 5A3IC 5DK3A 3WE6A 1EAPB 1WIUA 1J8HB 2NY4D 2A77L 4V1DE 3CVHL 3RPIB 4F7MB 3WDJA 3F65A 1YEDA 4R2GC 3SOBL 3WLWC 3PWPD 4PJAA 3LSOB 3P0VL 5I8CB 5E2TH 1B0RA 1SBSH 3IFLL 1HQRA 5I16B 4HEPG 4U1IA 2BVTA 1NDMB 3KYKL 1JHKH 2X4OB 1OVZA 1LNUB 5AWNH 2CIKA 2H6PA 5EC1A 1OQXA 2IANE 3ARGB 4FZ8L 1FRGH 2NNAA 4G5ZH 5E99L 3NIDF 1DCLA 3O11B 5B39B 4PJHB 2DMKA 1N4XH 4BSWA 1MCPH 4DCQB 4TUKH 1AKJB 5DVKA 4NDMB 1MQ8A 1KIQA 2EYTB 1MCQA 1HSBA 3LVEA 2AV1A 2EYSA 4D9LL 5F7KC 4IHOA 3IGAB 3FRUB 5F7LB 3FFCD 4IOFD 4Z7VF 3RWIB 2ARJB 1JPSL 4QCIA 5F9WB 2P24B 3HPJA 1MCDA 1TFHA 4MSWA 5HGAB 5D7IB 5BVJB 1ACZA 2ZSVB 2Y4SA 5TE4L 4F33B 7FABL 2E5EA 1J0JA 3T4AB 1M6OA 3O3AB 4HH9A 4DW2H 3BGMB 5I15H 3PV6B 3BPNB 1FZOB 5CIPH 1SJHA 3UTZB 3O2DH 1EHNA 3O3DA 5HHVL 5FB8B 5D1XC 1DQDL 1MF2L 4XPBH 3VWJC 2DL2A 5K9QI 4QNPE 5D2LB 4M7ZB 5KG9B 4TRPL 3X3GH 3WDIA 3IKCA 2BOBB 4IDLA 4MQSB 1DBKL 4G42B 3WIIL 5INDA 5ACZA 1L6XA 5DWUL 5JPNA 4IRZH 2W60B 5EULV 2FR4A 3NTCH 1FLTX 2NX5E 4WU5B 3I2CH 1HOCB 5JW3L 2VDOH 1A64A 3BP6B 3TH2T 3VMOA 4KKBC 1UB6B 3S5LB 3KGRA 2J8HA 1GC1C 4S1QL 2OR9H 2JF1A 4HUUB 1SVCP 2GT9A 3HC3L 5D5MB 4EI6A 1QUNA 2A83B 4JREB 1EO5A 2IPTL 1KBGL 2D03H 3G08A 2DS4A 4KDWA 2NY3C 4MA7H 4P5KA 3RIAF 4X6CF 5EFIB 5TH2B 5E2WL 3MLVL 1HDMA 1JGDB 2HKHH 5I8KL 4Z76B 2HTLC 1PKQA 1KENH 1RMFL 2EH7L 3QHFH 2PXYB 1KB9J 1S78C 4URTB 5IMMB 4AZ8A 1N0XL 3FB7A 4MHHI 4E0RA 2OX5A 2W1NA 3VXPB 1UZ6E 1A6PA 4XT1C 1I8IA 4XP4H 2FHCA 2QSCL 4KK5C 2EDTA 1DL7H 1ED3B 5KSAC 3CX5J 4K8RL 3X14A 1A6AB 5E56A 5GGTL 3L3DB 4C56A 3TA3A 3QDGD 2EEAA 5B8CB 4K3GA 4HKXA 3RL2A 1LE5A 4OCSH 1N3NB 3IDUA 3P2TA 4IRJA 3W2DH 4D0CB 1A3QA 3KYOA 3C08H 3WL9B 5DSCA 3OAUH 2VMFA 1NLDL 4Y88A 1I8LA 4PJEE 1JK8B 4JPWH 1UACL 2ZUXA 4OLXL 2DAVA 2P4AB 1LDPH 3HNTH 3MLUL 1WISA 4KTDL 3HS0B 4R4FL 4YR6B 4ZOBA 5CZXC 1BMGA 4OZGE 2BNRB 4HUXB 4GAJL 5ISZA 1SBBA 3NCEB 2NY1B 5ELIA 4NQUA 1AD0B 1MOEA 1FP5A 1DUZA 4U6HB 3WIHA 4DFHA 1UJ3A 4Y2DC 1QFHA 5BS0A 1KJ2A 2HYMA 2HT2C 3FJTA 5HVFB 2APBA 1NEZA 5EU5B 5C6TH 3MRGA 3BGFB 1CFQB 3TBSA 1MRCH 2EDHA 3CFEA 1EZVY 3HC0A 3MV7E 3FO1A 3OPZH 3X3FL 1HYSC 4MD0A 1MCEA 3WMSA 4L8DA 3KLAB 3B9EA 4NQEE 2Y6SD 4KZEL 5F93C 4F3FA 3AY4C 3HR5B 3GRWH 5J0BA 5FECB 2WBJC 5IM7B 5KVGH 3V7MA 4M43H 4XNXL 2P45B 3IETB 2KBGA 1JF6A 2IPUK 3VCLB 3G5ZA 4WRLA 5JNYA 5DK0A 2J88H 1OSZB 1IM9A 1P1ZB 4M1CC 4O9HH 4RFNB 2J8UA 2FJFB 1I8MB 2V2TB 5DMGC 1LO5A 5LAXA 4PJ7A 4PJFF 2BVUA 2NZIA 2XZAH 1J1OH 4P59L 5I73B 3DHMA 2HMID 3NVQA 1EXUA 5LXGL 3VXUD 3FQWB 3IDIB 4LPCA 4YHYC 4MWFA 3ARGD 5BV7C 3ARFA 1VFAA 1UADC 2AVGA 2HH0H 2XTJC 4I8DA 4QTIL 4I1NB 3L3GB 1OTTD 1CFTA 1FFPB 3OKMA 3MFFA 4XVJL 4D2NA 2QQLH 2C9AA 3ULVE 3GSXA 4GBXB 4HC1H 3SDYH 2VKWA 1X6NA 3CH1B 3B2VH 3QEUB 1A0QH 1MH5B 1XCQB 2ED8A 2A6IB 4NQDE 1YUHA 3MMEA 3SCMC 2X4PB 3MXVL 5CJ5A 5IESH 5CP7A 1AE6L 4HWEH 3VFVB 1JZ7A 1KFAL 2G60H 4F7EA 2QJDA 2VWEC 4XWGH 3ZKMD 5EIQA 4RGOL 1FVCB 4JKLA 1C12B 1KB9K 1QSZA 3MO1A 2IH3B 4NGHL 3BDBA 1NGXA 3S4SA 2Z35A 4NRYB 4CN1A 1DJSA 3RIAK 4U7MA 4XCCH 5B3JE 3QPQC 3HMXH 3F7QA 2E27H 2PR4H 5F7FA 4D0DA 2EC9T 2VZ1A 4JFXB 4ZXBD 5EOCL 1NCNA 4N0FB 3G04B 3BPLB 4OZ4A 2YPVL 2CUIA 2ZOLA 4GW1A 2JE8A 3MUGB 1FNEB 3CX5K 5D7JC 1Q8MA 1K2DA 2AJVH 3RJDA 5C07E 4P4KC 5FOBA 1H3PH 3MNVA 1UB5A 5DRZA 4NNXB 3G5XA 4OI9A 2YRLA 3EO1B 4QRUA 2CR6A 1DEEA 1F6FB 3IFPB 3GSVA 5GJTL 3ARDA 3GMLB 2Q6WB 2O5ZH 2ZNXA 4NQDD 4JANB 2R0ZL 3GO1L 4FFWD 3FQTA 5DMKA 4XP9L 3WYRA 4HMEA 3T0DA 1SEQH 4Q6YA 4GXUM 3QDMA 3BXNA 3LD8B 1HHIA 2JB5H 1NGWB 2V7NA 3PXHA 4P2OB 2P5EE 2P42B 4ZSOE 5CBEB 1ZA3A 1F58L 2DKSA 4WI2A 5T1LB 1DBJH 4C59B 5FKPB 3O6MH 4HFWA 4KVNH 4OCNC 5HI5C 5IHZA 1J0ZA 3D3VA 3PWUA 4ZO8A 1G7LB 4OFYA 5C0EB 1IC5H 1VFUA 3UPRA 1K3ZA 3CXHJ 3HLAB 1AI1L 1UM6H 1N59B 2CR3A 2QTEA 4B0MM 1LDSA 4N8PA 1ZA6B 1T2QH 4PTUB 1RZJH 2PXYD 1X9QA 3QJFB 4RISL 3OL2A 2CDFB 4PY7B 1ULVA 3WLBA 1AGDA 4FOMA 2DYPB 4YDLB 3VFPB 4GW5B 3RBSA 4QGYA 4XWOC 1NKOA 5CEZL 4FABL 4CMMA 3EYVA 3B9AA 3UTTD 3PWVA 2YK1L 3W5MA 3K7UA 5DJ8A 4MXQC 4DK3A 3IAPA 4OV6F 4OUOA 1A7QL 4TULL 5LGHL 3BHBA 4LHJB 4U6VL 1DFBL 1W8NA 4R3SA 1WWCA 1AO7E 1BFVH 4G43B 5EBMB 2BNRD 3I6KB 4NC1C 4FQXC 3QHTC 2UWEB 3P4MB 1PG7W 3Q48A 1RD6A 2NY1D 1R24B 4DAGL 2H9GB 4N5ED 1UXSB 1I1AB 5CCKH 2VQTA 4EVNB 2FX7H 5LJYH 4HK3J 1KXVC 3BWUC 5J12C 3RX8A 2I25N 4Z9KB 1LEKA 4C4KO 2G5BB 3QB7C 5D71L 2IADA 1NDGA 2E7CA 3QWOA 3GK8L 1XGUB 3DRQA 5MHSD 1KTRL 1OP3K 3RTQA 5MEOA 4DOHE 1I7RA 2OXGA 4PV9B 2I5YH 5TQ2L 1YN7A 3RVXD 1YEKL 1ONQB 2VDPL 3UZQA 5IMKB 4MB5A 4GAGL 3IJHA 5IF0A 5D1ZB 1LK2A 4DKFL 3CZFB 5DJ6A 5AG9A 3ES6A 2Z93B 3DX8B 1LP9E 4LCYA 5DUML 2BXYA 4QF1A 1F4YH 3L7EB 2GTWA 5IVXA 2XI9A 2XWJA 3O3EB 4LLWA 1YNTB 3UTSA 2FL5B 3DOSA 4LAJH 5JXAL 4GG6E 3GKZA 5KANG 4L8BB 5IOPB 3NA9L 1KPVB 4QRPB 3VE0B 1S8DA 5J1AB 1S7TB 4X7EC 1ZHLB 4GRWE 3RY5A 5FO8B 4Q2ZB 2D7NA 4N90E 5I66B 1NH6A 3QXTA 3VXRA 4XP1L 1AJ7L 3UZEA 4GBXD 3CVIH 3EIFA 4AY0A 4D8PA 3IJSA 4P9ML 5HYJB 2VABA 4V2BA 2NY2B 5C0AE 5L9DH 2C7UA 2A6DA 1S9WB 2OZ4L 1TMCB 5L8JB 4LPVA 3DSFL 2WLYA 3K8KA 5E8DH 1WGOA 2B1HL 3K80A 4APQB 2JB6B 3QO0B 4OLZL 1KCSH 4WO4C 4K3EH 4OLVL 3CXHK 3VXQA 3LEXB 2ZKHH 1KB5L 4TNVF 1JI1A 2Y25A 3V6BR 4KI5D 4M8QB 4JFYB 3B43A 4XP5H 2VLRB 2AW2A 4RBPH 4ISVB 3PL6C 5DQDH 5IK3B 2O5YH 4KPHL 3O9WB 1MSPA 2HVJA 3ULVH 4Y19B 1HE7A 3HUJF 5I6XB 1FH5H 1IEHA 4Y16C 2F5BH 1UWGH 3FOLB 4MCYB 1BD2B 1LO2H 1EBAA 1AGBA 1JN6B 3GSOB 3MOQA 1NEZG 4N90D 5DEGA 2Z9TA 1T21A 3U4EB 1UCTA 2VDMH 4P4RB 1FN4A 3ETBF 4Q0XH 3QUZB 4CVZB 4S0SD 1ZGLP 4JJ5A 4YHIB 1KPUB 1Q1JH 4R26L 2E6JA 4OI7A 1I9IH 4UT9H 1NUFA 2I60H 1VACB 1FFNB 2X4SB 4Z77B 1QO3B 3REVB 4GAYB 1JPGA 4LQFL 3B5GA 4N8VA 2X09A 1PQZA 5CZVL 4UQ3B 2X1OA 2NY5C 3CSYA 5GIRB 1QSEA 5CD5C 1I75A 2XQBH 4CN4A 4WW2C 1J1PH 1NL0L 4OGYH 3TLRA 1KPRB 4K7FA 4JY5H 25C8L 5T1LD 1KTDA 3U36A 4RGNC 1JNHB 4HLJA 4MJIE 4X98B 3OXRB 4WTWA 4ODTH 4P99A 3JV0A 3C6LA 1DN0A 3L95B 4G8IA 4H1LH 5T3XD 3N50A 3MLPA 2XKSA 5I1IL 5I9QC 2AJUH 2AEIT 2PNDA 4Z8FL 3RA7L 5DXWA 3CNKA 2XN9E 4WFEE 1DBMH 3ZYZA 1FL5A 4KQ3H 5B4MC 4OCYL 1LMKA 2DYPD 4WW2F 3VG0H 3RWFB 1JNNH 1X4YA 5JR1L 4JN1L 4UV7H 3PGDA 3O3BA 5C0FA 1ES0B 2G75B 3CXDL 5ICYA 2ZCLL 3O8XB 3W0WE 1A1MA 5ITBH 5HGDB 2ADFL 3EZJB 4LCUB 2G5RA 4LSSL 1JFQL 2P43B 1IL1B 2QHLA 4J3WA 2MCPL 2DQHH 4LSRH 1T66D 3BT2L 3S4SG 5KJRH 4M7JL 4ELMF 3OG4B 4OGAD 4MJ5A 3U30C 3BD4A 5FHAH 2FGWL 4A6YB 2YPLB 3D9AL 1TTUA 2NY0B 3D48R 2Q3AA 2Q87A 4F7TB 2LU3A 3EJYD 2B0SH 3KYNA 2GJ6A 5B38A 1PSKL 3RX7A 3ULSB 2Q1EA 3TJHC 1TCMA 1GZPA 3ZMRA 4PV8A 2VLJB 1TENA 3C9NA 3QIWB 1I1AD 3T08A 5TE7L 5DEZA 4RA0C 4FQHA 3MRLB 4PY8J 4WUUA 4F7PA 5AAWA 3H42H 5JQ6H 3RUGF 3OKDA 3JV4A 4ZUVB 2WLZA 6FABL 1N64L 1NCBL 2BVPB 2WBKA 2JIXA 4KKCC 5D2NC 2NYYC 5BZWB 2KZ1B 1I8KA 3LDBC 2EDFA 4DWHA 4JO3H 3CUPA 5I74B 1IAOA 1GZQA 3IAGC 4IDJH 2GITB 8FABB 1MFCL 3B83A 1MHCB 9CGTA 3KR3L 1BAFL 2OTWB 5D1ZD 1QTYT 1BLNA 5CKGA 1QRNB 1JYWA 1CL7I 1LEGB 4HXAL 4NCC1 5FUOL 2HKFH 1MFAL 5AZEL 3WD5L 2ZSWB 4P2RB 3MRMA 4JFDB 1HEZA 1FAKT 3CJJA 3IDXL 4O2CA 3QI9B 2JJUA 1Q9KA 5C0JB 3QUYA 1VFMA 4P48A 2P46B 2UZIL 4P49A 4HX1A 5FXCH 3MCG1 1IAII 4I18C 3MYJB 4X6DE 5DFWH 1Q9WB 2NXYB 3CFCL 4F9LC 4DUVA 2CPCA 3C2AH 3IDJA 3ULUE 1BBJA 2HVKB 2ZG1A 4ZUWA 2AXJA 5FGBA 4QRPD 3CDGA 3SKNB 3VFWB 2ENSA 4XPGH 2AJXL 4Y4HC 1UVQB 1N2RA 1IGML 3AREC 4PGBB 3SJVD 2JELH 4TOYH 5HBBA 4QYOB 3T0EA 4ENEC 4UOW1 3VFSB 5KW9L 1ZLVH 1HN1A 1T1XA 2R2HB 1INQB 4H0HB 5ACLA 2P49B 3D0VB 4G6FD 1EA9C 3GI8H 4W6WB 1U3HD 4ONOA 4GJTB 1BWMA 5HYJD 2FYYB 3LKQB 4H26A 1KTLA 3DROB 5GGVH 2NY2D 4HULB 3T3ME 1Y0LA 4M02A 3H9SE 2Z8VC 5E8PA 2BSTB 4YDIH 1WCBA 1XT5A 1YY8B 2F58L 3VXNB 3ZSSA 4BZYA 4KJYB 3W39B 4APQD 4ZD3L 1NJ9A 1OWRM 5F44A 4TVPL 3O6FA 1INEH 2H2SD 2BRRH 5DJYB 2ADIB 4XRCA 1I7UB 4LSPH 2VDKL 5HYFA 4JKPH 4L4VA 3A6CH 3MRRB 4PRNB 5D7SL 2PYEB 3O9WD 5E2VH 1G6RH 2D3VA 3MRKB 3SE4C 3HNSH 2VQ1B 1LO4L 2FNBA 3B5TA 4YDVB 2E7LC 2FATH 3WKNA 1IQDA 1LK3L 1PZ5B 1UC6A 5C0RL 2VUOA 4QXUH 1H3TA 2YUVA 4DQOH 2BNUB 4K9EC 5EUKB 4OZHF 4XBEL 4OFPA 5CINL 3TN0A 5I18H 1H0DA 4KKAD 3VI3F 1U0QA 1YECH 3MLRH 3QUZD 2VSDA 1U93A 4UAOC 4WEUD 2ZPKL 5DK2A 5FDWB 5SWZE 3SE3A 2QQNH 2HJFA 1D6VL 2A9MH 3OTTA 5ID1B 2ESVB 1W72B 4PJ5A 4OCWL 5E8OB 3MV01 1YNLL 2DLFH 1IGTA 2A74A 2GY5A 15C8H 5CJQH 3BH9B 1ZT7A 4O00A 3S88H 1IC1A 3KLHD 3H7BA 1ZHBB 5T3XH 2LE9A 3MNZB 3H9HB 5JDJA 5L2KB 4LNRB 4RAHA 3UX9B 5CKAA 1RZ7L 3ZKXB 5IVZA 1WAAF 4AENA 2OK0L 1D5BB 3P4OB 5E5RB 5EU3A 2EDBA 4PJ9C 1OD7A 2X4NA 3NCYS 2P8PA 2HJLA 3JV5A 5E9DA 1C5CL 2X1XR 2AJ3B 5J1TC 4LSTL 2OTPA 5DHVA 1KEML 3OSKA 5CLWA 5BCAA 4HPYH 4PGDB 1P4LA 5ERWA 4OUUA 1EJ6A 1OM3L 5C7XH 5E5UB 1CE1L 2IGFH 5EZOH 3GUTA 2EH8L 2YRZA 4JB9L 1CD0A 3KPSE 3C8DA 1OARH 4FQ1L 1CDUA 4CU8A 4MNQE 2V17L 4MLSA 3FQXB 4NKQB 1N7ML 3D2UD 3QAZB 3DUSB 3QRGH 4YXKL 4U1JB 4WI7A 5SWSE 5FUCE 4WWKA 1RJLB 3O8XD 3KPRE 2XA8H 3TCLA 4N0YL 3AB0C 2OSLA 1OAQH 3WFBH 3FFCA 2DD8L 3BZEB 4KJQC 1FBIH 4NN5B 4XBPB 5E00A 1ZGLB 4MAYC 2IQ9H 4EI5A 5EPMB 4GQ9L 3EGSA 1D5XA 1JL8A 2VDNH 3MFGB 4Z78B 4Y4FC 2YPLD 2NY0D 1SM3H 5DRXB 1RZFH 2YS4A 2ORBL 1DZBA 3M8OL 5DJDA 1ZVSA 1JV5B 2AEQL 2VLJD 5DUBB 4KAQL 2GY7B 2OP4H 4J12A 3MRJA 1F3DH 3BE1L 4YEFA 4UTAL 3ARBD 4XGZA 1AGCB 4JZNB 2VH5H 4YIQA 1OB1A 2HG5A 5I8OH 1H3VA 3HC4L 4PGEB 1GHFH 4D3CL 1CTOA 2R8SH 5DD6A 5HYQA 1Z2KA 5CP3H 3D87B 4W81A 1TVHA 3FN3A 3BSZL 3BI9X 2O26U 3CX2A 3LKSB 4QXTA 3VD4A 1A6VH 2CSPA 4AQOA 4LMQE 4CUCA 3LN5B 1EX0A 2WWMD 1CT8B 4IS6B 3V5HB 4RAVB 1FL3A 1SBSL 5EU6E 1QRKA 4NO0B 3GSUB 1JNJA 4P2RD 4JFDD 1JHKL 1S9YB 2VQUA 4P5TD 5A2KH 5HPMA 4K8RC 1R5WB 5EO0B 5AWNL 4JHAH 3SGDH 3ARPA 2W9EH 1OAXH 1U6AH 5C0IA 1FRGL 3OJVC 1U8PB 4G5ZL 3O0RH 3IXTB 2VZSA 1N4XL 4BJLA 2HAZA 1MCPL 3I75A 1GRWA 4TUKL 1CDYA 5DVOA 1A1NB 1U8LA 3HI5H 5FYJE 3QDJB 4WV1C 4YAQA 5F8RC 2GUOA 5C0BE 3UTSE 4KXZI 5J56B 3DV4B 3FONB 4X5WA 2R4RH 1FNLA 1S5HB 4CW1B 4HUVB 1E4KA 5DZNA 1RZ8A 2A73A 1UKQA 3OKLB 1GCFA 3X12A 5IV2B 1PD6A 5IHBA 5D9SB 2I9TB 4G6ML 4R9HA 2NX5A 1IAKB 3R4DA 3QDGA 5IBTH 1NFIB 2HRPH 4X0KA 2CMRH 3L3JB 3ULUH 4GMSL 5EU6D 2Y07L 5A16A 2MWCA 3VW3H 1A7RL 2ZUQB 4DW2L 2C4FT 1MHHB 2IEPA 4HHAB 4KK9C 2A1WH 5I15L 3EJZC 4K94H 5B38G 1ETZB 2XFXA 4E5XB 4W6YB 3QFDB 3O2DL 3TC9A 4NKIH 1PLGH 1IQWH 4XCEA 4XMPH 1IEAA 4WI8A 4ZOCA 4XPBL 2DWDA 2PYED 3V7AG 4TTGA 2I07B 1DE4B 1KTKE 1SJEA 2CLRA 4ZODA 3THMH 2DICA 3DURA 3MRIA 2JCCB 3LV3A 5DQJB 4IRZL 4GRLC 3SQOH 3QUKB 3NTCL 2O61B 4MS8D 1H5BC 5I71C 5EORH 2OQJB 4PPTA 2VDOL 2V6HA 4E41D 4KK8D 3UJTH 1IM3A 2PF6A 2OR9L 2ZG2A 3HE6B 2Q7YB 1CN4A 1G7QB 2HLFD 4DKAA 1OT2A 3AXLB 2ADGB 4TSAH 3RWHA 1AQDA 5IQ7H 2ESVD 4ZTOH 4WHTA 2D03L 2BOCA 4MA7L 5DA4A 1BVKA 1IAMA 4L29A 3BRGC 1ZMYA 2HKHL 3TVMC 4E42A 4NWUH 5IMLB 5DJ0A 3UDWA 5L2KD 3LKPB 1I1FA 3QHFL 1N26A 4PJEA 1S9VB 5F9OL 3NPZB 2EIDA 2V2XA 3OKEB 5D72L 5SX5H 2D4DA 2FIRT 3SBWC 4OD2A 1FNAA 3O45A 1A9EB 5AG8A 4ETQB 2IG2H 4OV5A 2DJUA 1T5WA 2Z91B 4XP6H 3P9LA 1V3LA 4XP4L 5KVDH 5J11B 3KWWA 4OZIA 1DL7L 5I1JH 4L1HA 1ND0B 4P2YA 3VXUA 2Z4QB 2PCPA 5C09E 32C2B 3STLB 1ZK9A 3D39B 2Z92B 4HS8H 3WFEH 4OCSL 3MRDB 1XR9B 4RMTA 4H5SB 1TZIB 3W2DL 3MV7A 3L3HB 3C08L 2GFBB 2X4UB 4KK6D 1A6ZA 1RUPH 3EKCA 4EBQH 5E1AB 4XAWH 5EUOF 4JPWL 4YFLI 5I75B 1LDPL 3HNTL 1GGBH 5JXED 3BQUB 1KCKA 1RZIB 3U9PH 3MREA 2WIIB 4ONFH 5EO9B 4YDJA 5BVJA 4LDOB 5L0QC 1CVRA 5F96H 1HH6B 3QXAB 3VFGH 2NZ9C 2MMXA 3V4UH 1W0YT 3WJLC 2DJ4A 5DO2C 3NN8A 3BYTA 2VLLB 3WN5C 2LV4A 4DZBA 1MIML 5C6TL 2AJSH 4UUJA 4ZXBA 1MRCL 4MA1B 3KPPA 4IRSA 1XGRB 3RVWD 3OPZL 1OY3B 5HYSB 1M7IB 4N0CC 1F4XH 5CJ8A 2DQGH 4WJ5A 5EOCJ 3RWJB 3PXJA 5CBAB 3VFOA 1KIRA 3ORJA 5KVGL 3CMGA 4M43L 1Q72H 3NCYP 2IMNA 4NQDA 1ACYH 1WBXB 4KV5E 4LARH 4O9HL 5HYIA 1R3HB 3F7YA 2XZZA 4G9FE 3ILPA 3PHSA 5IUSA 3QULB 1FO0H 4NO2B 1GOHA 2XZAL 1J1OL 5IWLA 4Y5XA 3KXFE 4PJ8A 5AD0B 2XY1A 4OZGF 1U91A 3CDCA 2HH0L 4CMHB 1HQ4A 4XAKD 2J4WH 3EYFB 4HWUA 3TIEA 2Z8RA 3D69B 1AXIB 4M7LH 1FNHA 3GMNB 4NC0B 2QQLL 4HC1L 4JDZB 2ZJSH 4ZPVB 1K8DA 3T0XA 1A21A 4LMQI 3QDJD 1J8HE 3B2VL 3U6RB 5CJOH 1A0QL 4PP1D 4S2SB 3N85L 4OIIH 5C07A 5CS7A 1R3JA 2Y06H 1JVKA 3HE7A 5DUPH 1VADA 5DHYB 1PY4A 4QY8A 4H1LA 5IESL 4HK3N 4HWEL 2QADB 1SYVA 4XWGL 5KVFH 3GJFK 1XF3B 3C5SB 3V5DA 1TVDA 2FX9L 3OZ9H 4DK6A 3UTTA 4PJHE 3WHXA 2BVOA 3DVNA 4K7PX 1G7PB 3HMXL 1T04A 2P5EA 2R23B 2E27L 2I27N 2PR4L 3DXAE 3BKMH 4HGWB 1YPZE 1YA5A 4QLRA 3DI2B 3C60B 3BP7A 2AJVL 3GMQA 5LGKA 2C3WA 3E6FB 1RSFA 3CLFH 4OIBA 2EC9U 3QZWG 1G0YR 3EDJA 2PW2A 1UWXH 1M71B 1FE8H 5J89A 1TTGA 1QFUH 2FHBA 2NR6D 1J0HA 2RGSA 3QXDA 1YNKH 1MCNA 2O5ZL 1W72H 2FZ3B 2LVCA 4Y5YA 1E6JL 4J1UA 3G5VB 1JWSB 4XB7A 5CUSH 3G6JF 3ARWA 1NFDB 5EB9A 1SEQL 3HE6D 4JKKA 2JB5L 5TF1H 1OTUD 1VERA 1D9KC 5H2BA 3B9KB 4MNHB 5IW3A 1AGEA 4Z0XA 4JO4H 2C3VA 3FO9A 1OT1A 1GGTA 1DBJL 4MA3A 3O6ML 4KVNL 2UYLA 4WTZA 3ARVA 5JA9A 4PLKD 3LCYA 2F74B 1IC5L 2X70A 4HS6A 5D2LE 3U2SB 3R06A 4JM2C 4ODUB 2E9IA 1GOGA 4NCC2 1REIA 4IMLA 2WINA 1Z6JT 4PRIE 5AAMA 1BF2A 2MFNA 1T2QL 2APFA 3MNWA 1X5FA 3MJ9A 3GMMA 1QLFA 4M6NL 5DTFA 4ZFFB 1JYVA 1S7SA 3RWEB 5B3JF 2AQ3A 2FX8H 5EN2A 1AO7A 2AXGA 4R4NC 1RURH 4NP4H 2CDGA 1JRHH 1KC5H 1CG9A 4ZFGH 3IB4A 5JZ7D 3S3SA 3GIVA 1T22B 4NM4H 4YUEH 4CN6A 1NC2B 4Y89A 1IGFL 1PGRB 4PJDF 3GEWB 4XNMB 4YHKH 3NZ8A 4S1DC 5F9AC 4CDGC 4JM2F 3O4LE 3EOBB 3NMEA 4MVBD 4XNQA 2UV3A 4U1MA 5KSBB 3K2UH 4RWHA 1F6LL 1P7QB 2BVQA 4NKOB 5C6PB 4BSVB 3Q5OA 1Y18B 4KJWC 4PUBH 3VGFA 5JIKA 3I02A 5GGRA 4JRXB 5KN5A 5FGSA 1BFVL 1XCTA 5C9JB 4LKCB 2A6JA 3BQUD 3TT3H 3IDMA 4JPIB 1MCJA 5CCKL 3HG1E 3E3QE 2FX7L 5JIHA 3LKOB 4ERSH 3VXSE 4GG6A 2A9NH 2IH3A 2V9TA 1CFVL 4M4RA 3T4YA 4FQQB 4ONHA 1FQ9C 1KJVB 1IC7H 3J8F7 3MLWH 1U8JB 2X5PA 1U8KB 1S7XA 1RJCA 4LLDA 2J12B 3QQ9D 1QFWH 1AY1H 3HI1B 2VR9A 2I5YL 3P4NA 5BZDA 5IFAH 1CR9H 1EJOH 1C5DB 2XPGA 4RMQA 5IBUG 1ZOXA 3QFJB 5L88H 1G6RA 2WK2A 3DMMB 2DQFA 1KELH 1T20B 1ZT4B 4P23C 1I4FB 4FXGB 2ICWA 1I9RH 3D1MC 1JMXA 1F4YL 2FSEA 5C0AA 4MD5B 3O4OC 4W4OC 5EBLA 3NFPA 3B6SA 1O7VA 1BGXH 1E28A 4W68A 1MUJB 2W91A 3ROOA 5GGSA 4NHUB 4IBLT 1U8MA 3V6FB 3U0TB 2NXZD 1ZS8B 2B39A 1MHEB 4XTRD 4DGIL 1XIWB 2HN7A 1A14H 2RBLA 4PG2C 5GS1C 3VFRB 4F58H 1G7MB 4MJ6B 1MFNA 2XNAB 3EDDA 4H25B 3CFKA 4LSQH 1HIMH 4PLJC 4Z95H 4G80A 2AQ1A 4OCXH 4XHJD 2D7TH 2QR0B 2AS5M 43C9B 2ID5A 2ICEB 3CVIL 2EE2A 3FHQA 1ITCA 4WNQA 4NRZA 3VWKB 5L9DL 2AKRB 5I1AA 4LGSB 5DI8A 4R4BB 4YGVB 4NO3B 1BZ9B 4HK0A 3EOAB 1ZT1A 2OR8A 4R7DA 3AMLA 2IAMA 2GCYB 5F7UA 1KCSL 5DJ2B 4X5XA 4Z0BL 1OAZH 5IB5B 4K3EL 2QADD 2Q86A 4NQXA 1CIDA 1EVUA 2ZKHL 3VGAB 3DVIA 1T0MB 4NT6A 1J9CT 5F88B 1L7IH 3SDXE 4PJCE 3GSQB 3IRPX 1V8HA 5IIEB 4XP5L 1NBZB 4NQCB 5DQDL 1CVSC 3ULVL 3TPUB 5CEYB 5JA8B 1KGCE 2VOTA 1FH5L 2IBZY 3Q6FA 3TIDB 2EIZB 1D5ZB 3QO1B 4W4NA 2F5BL 1UWGL 3QP3A 4X7DC 3VFUA 2VL5A 4XMKL 4YXHH 1LO2L 3H0TB 4L3AA 4BH7A 1X7QA 4MJIA 1DVFB 4Y0GA 3KPOB 3C60D 4NUJB 5L6YH 3GBLA 2F53E 1FNSH 5TQ0H 3PG2A 2VDML 4G43A 1FYTB 1P69B 4JHBA 1QBAA 3SDDB 3TT1H 1P6FA 1OAUH 1R5VA 4R6UA 4Q0XL 3RVTC 4QRSA 2OL3B 1Q1JL 1IZKA 3OHXA 4M6OL 4UT9L 2I60L 2WWKT 3KPNB 2XN9A 2VXVH 4UDUA 4MDIB 2KL6A 2V2WA 3HCVB 3RU8H 1XF5B 4WDIB 4YBQD 4JFHD 2HFFA 2BSED 4UZGA 2FCBA 2WUCH 4JQXC 3BMVA 4LPWA 1OD9A 3B9KD 4Z18A 3W0WA 2XQBL 3BKJH 1KLUB 4L9LB 4TTDC 1E4XH 2ERJC 4JY5L 5LWYL 4HIIB 5MEQB 4DN4L 4J3OC 4OM0H 5I17A 2I9LA 1T5XB 4JY4B 4P2QB 2B5IC 4BK5A 2CRMA 4ODTL 1R5IA 2VITA 1MJJB 1NBVH 4GKNA 4X8XA 3WE6B 1A5FL 4LKXA 2FDBP 3S98A 5LQBH 4P3WA 1NC4A 4F80A 1T1WA 5CD3A 1A7OH 1YNTA 2DLEA 1YEDB 5EBGA 2AJUL 4XCYA 4PJAB 1A6TA 1VENA 1B0RB 2VIRA 1HQRB 1YMHA 3GKWH 5IBLC 1DBML 4U1IB 5DVLA 5F7DA 4MXWH 4YZFE 3VH8A 2R2BA 3BDYH 3DX7A 3VG0L 5JOPE 5GJSH 1JNNL 3MRFA 2CIKB 2XTLA 4NIKB 2HJKA 1YJDC 3VDCA 1YYLH 2H6PB 4UV7L 5EC1B 3SJVA 3TYFA 1JGUH 3KHOA 1RUMH 2NNAB 4H1LG 4XVTH 4Q2ZA 5D7LD 5ITBL 3LQZA 3MBEA 5E8NA 1B2WH 4BSWB 1TDQA 4YDKH 2F54E 2LABA 2DQHL 1U3HA 4LSRL 1IGCH 4KGLA 5KJRL 3ZT5A 4PYGA 4RMVA 3O41A 1KIQB 1HSBB 5CWSA 3TJEH 3FRPA 1S7RA 2AV1B 2EYSB 4NNPH 4NJAH 2B0SL 1LO3H 4HIHA 4IHOB 2H32A 4AEEA 3NACH 2EICA 4E9LA 1CFNA 4OF8A 4QCIB 3HPJB 4XHQA 1TJGH 4MSWB 4NCDA 4H88L 5HHXH 2E6PA 4KUZH 2D4FA 4FTVE 3QIUA 4X6DA 1J0IA 5JQ6L 3WFDH 1M6OB 4NQTA 4HH9B 3RBGA 1QG3A 2BFVL 1W0WA 1SJHB 4JO3L 3DTXA 4F15B 5KSVA 1NUNB 5J13B 4GKOA 1MFEH 2QL1A 3O3DB 2PO6C 5IVOA 1CICA 2FB4H 4L3EE 5HHOE 3QFJD 4JZJC 4LASL 4UOJA 3U46A 1FFOA 4ONGH 1U9KA 3RNKA 3DMMD 3L9RA 4OLWH 2CK2A 3NIDE 1T7ZA 2HKFL 2UWEE 1CD1A 3VXME 3IKCB 2AK4E 5ACZB 5INDB 3FB5A 2E7BA 5JPNB 2ED9A 1G1YA 3C5ZC 3FCTA 4FMFA 5E5MA 2DBJA 2FR4B 3RZCD 5JUEH 4PJBF 3D0LA 5DC9B 1AHWA 3C2AL 3PNWA 5TGBA 3QXUA 4X9FA 5FYJU 4Z7VE 5HHPA 1XIWD 2GT9B 1Z5LA 4EI6B 4GOSA 3L3OA 4XPGL 1C1EH 1XF4A 3N1PC 4TOYL 2JELL 3G08B 4P5KB 4RQQA 4F9PC 2YOCA 3ZKQD 1XGPA 4IMKA 1HDMB 2J3SA 4WFHD 3TO4A 2FBJH 1PKQB 3LB6C 3GI8L 4LRIA 2FWOA 5ID0A 2UUDK 5GGVL 1O0VA 3V0VA 3EO9L 2CRIA 3VWKD 5FOJA 3FB7B 1GGCH 4E0RB 2GK2A 4IIQC 4YDIL 1I8IB 4X8JA 5JIIA 2YA2A 5SWZA 4U1GB 2B4CL 3JZ7A 3X14B 3D2UA 2BRRL 4C56B 1K8IA 3MXWH 4JO2H 4R2GD 3TA3B 3WLWD 4UNUA 4HKXB 3RL2B 1RHHA 1LE5B 4NQCD 3A6CL 5E2VL 1G6RL 4IRJB 1U2HA 1XR8A 3HNSL 4ZAKC 3KYOB 4UT6H 5DSCB 3BAEH 4Q9BA 2YEZA 4GG8A 1HCVA 4DQOL 3E2HC 1DVFD 3VU2A 1U3ZA 4UINH 5EZJA 3IJYA 1JPSH 4LIQE 5ISZB 5I18L 4UT7H 4YHPA 4LVOC 1YECL 3MLRL 1DUYA 3OKKA 4ORZC 1DUZB 2MTPA 4I13B 1CE6B 2C1PA 1MCWM 1KG0A 1UJ3B 7CGTA 2CO6B 2QQNL 3ARBA 5BS0B 2GJZA 5IR1A 2A9ML 1KJ2B 3SQBA 2N4IA 5BO1H 2VLRE 2DLFL 2H41A 3EDEA 3KPSA 4RMWA 3VXTA 15C8L 1NEZB 4Y19E 3MRGB 1OP9A 3TBSB 4PRHE 2QV2A 3CFEB 3MLZH 5SWSA 5T3XL 5HHVH 3HC0B 3LZFH 3FO1B 5DMYA 4W6XB 1XMWA 4MD0B 1VEOA 4L8DB 1CLZH 4KVCL 3DRTA 3S6CA 4WEBH 2G2RA 3FT2A 1QFPA 4I48A 4NN7B 5TDOA 5BQ7A 1DBKH 1LD9A 3MLTA 3DV6A 2EXWC 4P5TA 3WXVH 5DWUH 1E6OL 2XIDA 1ZVHA 4M3JA 1K4CA 3O2WL 3G5ZB 1EK3A 1Q0YL 4HPYL 5JNYB 4FFVC 5DK0B 4GXUN 1IM9B 3F7PC 3VWJD 5C7XL 2J8UB 5HJ3A 2B1AL 1I7ZA 2DTSA 2HLAA 1LO5B 2IGFL 4Z7WA 5EZOL 5LAXB 4A2MA 1FO0A 4PJ7B 1YEFH 4N9GA 4YC2C 4I2XE 3QQ4A 1OARL 2QEJA 3Q5YA 1EXUB 1PW3A 2YD9A 1TPXC 3QRGL 4MWFB 1G6VK 1VFAB 3ARFB 1K6QH 5ICXA 1CFTB 4M48H 3OKMB 2FO1A 3MFFB 1KCUL 3DVGA 2R0WH 3GSXB 1OAQL 3WFBL 1FBIL 35C8H 1PYWA 4WHCA 5DT1L 5T1DL 1DEDA 4QHKI 5FYKE 1CQYA 2IQ9L 4OIAA 2KQNA 4MCZA 1NANI 1N0XH 2NY3D 2X2YA 2VDNL 2K7PA 3WUZA 3ISWA 4LCIH 4TSCH 1YUHB 3BH8A 1SM3L 2X6MA 3MMEB 5EU6A 4F2MA 3NGBC 2M8XA 1F13A 2AQ2A 3F12A 2JJTA 5CP7B 2C3XA 5F3HA 4F7EB 2OP4L 4TPRH 5HDBF 5FUCC 3DPBA 3H3KA 4X7TA 2EE9A 3RDTC 4YFLF 1NGQH 1HHJA 3MROA 3MO1B 4RA3A 3S4SB 1NGXB 2Z35B 3MRRA 5B21A 4OLUH 1PX4A 5I8OL 5SWQB 4NBXB 3NPSB 1GHFL 2VAAA 2R8SL 4AM0A 3STZA 2EYRA 4D0DB 3L5HA 2DTMH 2R39A 4PJFE 1IEBA 5C0BA 1F2QA 4OZ4B 4HIEA 2YPKA 4S1RH 4GUPA 2XG4A 2ZOLB 4GW1B 1UACH 1A6VL 5DA0B 5BMFH 4X6BA 4R4FH 1K2DB 2YD8A 2C1OA 1YEHH 2GYSA 5FOBB 1U3YA 3MNVB 2XRAH 5HHMB 4E41A 1FV1A 5DRZB 3G5XB 5CMAA 4QRUB 2YN5A 1WSST 1DEEB 1UT9A 3S35H 1HXMA 3GSVB 3ARDB 4JZOA 4P2CG 2R9HC 4JHAL 1ZLWK 2DBLH 1OAXL 1U6AL 5CILH 4U0RB 2R2CA 2L7JA 1P84K 3FQTB 3MA7A 2DLTA 5DMKB 2DMCA 1QR4A 5IB3A 3AVEA 1DQJA 1HCFX 5J3HD 1MFDH 3QDMB 1XF1A 3BXNB 4U1SA 1HHIB 2V7NB 1ZLUH 1ZA3B 3DGCR 4LNRA 4NZDA 2OJEA 3VH8G 2MCG1 4HFWB 4X4XA