4RAHA

Crystal structure of dimeric s33c beta-2 microglobulin mutant at 1.4 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPCDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title A covalent homodimer probing early oligomers along amyloid aggregation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rahA00
4OZIF 1CICC 1EGJH 5ECJE 4MXQC 1KB9J 4QEGA 2M8XA 2H8PA 5D7SH 1N3NB 3LN9A 3SGEI 2OZ4A 4R7NA 4EBQH 2OP4L 1A7BA 1XIWC 1HHGA 4Y5YB 4ZQKB 4LSUL 2R2EB 4M48L 3W11D 1AO7D 2A83A 3L7EA 4QHKJ 2R1XA 4O02H 1A7RH 3MRPB 3ZE1E 4YXLH 3MNVB 1TMCB 3H7BB 4KPHH 4M93B 4NO5A 2A0LC 3FFDB 3OKMA 3REWA 3LEVL 2NXYC 4FQLL 1AR1D 1WWBX 5CAYB 1FL3B 1YYLH 1Z9LA 1M71A 1OY3B 1UWXK 4CAGA 3L3GB 1JRHH 3CIQA 4QY8A 5GS2D 1INEH 2H26A 3RVWC 3WIHA 3S36H 1E4KA 1L9MA 1AQDB 3UROR 1EEUA 1IBGH 3JBG7 4JPWH 3BWAB 3IVKB 2CJUL 3M1BA 3LDBB 5ABDE 4KZDL 3BIKB 5E56A 1GJIA 5LJYH 1ZLUK 5BMFH 3FQXB 2E7LA 1MPAL 2FBJL 4OT1H 1S7VA 3U0PB 3TO4D 1H3PH 4HS3B 5H2BA 4TULL 2VE6A 3VA2C 2CKBH 5EOCH 3PXJA 1ZHKB 4PP2A 1QRNA 3C8KA 4XP1L 1LGVA 2IANA 3QDGE 4J6RH 5KVGL 4F3FA 2ESVB 5JOFA 2XA3A 4WRLA 4EIGB 4L4TA 1NC2B 3V0WH 1UM4L 4KK8C 4X6DB 3FQRA 2BNQA 1JTPA 4L4VA 3L7FB 3CFDB 2NR6D 4LIQH 3OPZH 3D3VA 3HPJA 2F58L 3OAZH 1WK0A 2IBZY 5A1AA 1BAFH 4TNVK 4NNXB 1RIVH 3MLXL 2O93L 1CGYA 1LE9B 3WDHA 1KIPA 2DLTA 5EU7E 2HFGL 2AJYH 2WSKA 4GBXB 1RFDL 3QULB 5D7JC 5DD5L 5EO1A 5F7DA 3MLSH 4K94C 4D9RE 5DLMH 2XQBH 5MP6H 1MI5B 5DEGA 2IQAA 4H8WL 3RUGA 5IMKB 1A6VH 4ODUB 4S1DD 4NRYA 4GAYB 5KZCB 1KOAA 4UILH 3QUZC 2CSPA 5F21B 4PJ9D 3QXVA 4P4KD 4HZLA 4ERSL 2E6JA 4LSRH 2YWYA 3DROA 3PDDA 1NCCL 2X42A 4MHHG 2YPLD 3VFPB 3BESR 2BRRL 4CN6A 2VQUA 3KPNB 5D6CA 1BFTA 3B2VL 1FSKB 4NQTA 4MNQB 5L7XH 4JFDB 4P9HC 1D5IL 1G7QB 2XNAB 1EEZB 5D7KD 3PABA 1EO8L 1CFSB 1RVFL 4BUGA 8CGTA 5JIIA 1JCKA 1FVEA 2XTJC 4JFFE 3VXNB 2BC4A 4Z7QF 4GAFB 2M26A 1J1OH 1BEYH 4POZC 3PQYA 4R7NB 5F7WC 4MCYB 4XVSH 1EVTC 4DAGH 4GW4A 4XVJH 5ITFB 3HE7A 5KW9L 1ED3B 3K8KA 3DARA 4HUMB 2BSRA 3JWDL 3PWLA 5F3BA 2A83B 3L7EB 4GH7B 5A16B 3BKCH 4YC2C 3VWJD 2R1XB 3MUGA 2FSEA 5GRWA 4KZEH 1UXSA 4GMTL 4JFXA 3EYUL 3OKMB 1FJ1B 4Z0XA 2OMNA 3BMWA 4B0MM 1M71B 5F70A 4HBCL 4QY8B 4OF3A 3CVHL 3OKLA 1SY6A 5I1KL 1CGSH 1ZGLA 1IGCL 1A3LL 4UU9A 1PSKL 4XB8A 3RI5F 3ULUF 5HHOD 4TOYL 3IFNH 4PJAF 2KPNA 1B3JA 1MRFH 1S7VB 3QRFM 3U83A 3M45A 2EIEA 2XN9A 3CSPA 2NCMA 4PB0L 5C07E 1C1EL 3VH8A 1NANH 2O5YL 4PP2B 5EORL 2B8OT 3LIZH 1E4XL 2BVTA 5B22A 4OCMC 3O2WH 3MOQA 1P2CB 2DM4A 5I8CA 4MA7L 5A3ID 4TSBH 3V5DA 1MFAH 1YEKH 3AB0B 4M02A 1GOHA 2BNQB 3RRQA 3T4YA 3WFEL 4ZXBB 4GFTB 4L4VB 1FFOB 3QIWC 3RWHA 3D3VB 3MA9L 3HPJB 4XHJD 3HC0A 1KIQA 3B9VA 3KPSA 1U9KA 4LQFH 2Q8BH 3MLVL 3BP4A 3AVEA 3NN8A 4M6NH 4U1KA 1K8IA 4RAUA 1FVCA 2MJWA 5C1MB 4M9PA 5FGCB 4LLAA 1KIPB 4EXPX 1EBPA 1ZA3A 3ZSTA 4PV9A 3MFGB 5T1DH 5F7DB 3FFCE 3NBNA 4F7EA 4U33A 3MACH 5LBSL 5EZLA 1NDGA 3TO4A 1PG7W 3O0RH 5DQ9A 1IZKA 1CGXA 5A40E 3TP4A 5J7CC 5CEZD 5DD0L 3BJ91 2Z9TA 4WU7A 1AXTH 1DLFH 1NGQH 2AKRB 1E0OB 3BN9D 4PJ5E 4JG0H 3S4SA 1R24A 4RIRA 2C4XA 4J3VA 3U9PL 3IKCA 4S11A 3GHEH 1TCMA 2NTFA 1XCTB 3QA3A 1U8HA 2F5BH 3GI8L 5D71H 3FQWA 3LZFL 3F7VB 3A67H 4JZJA 3LN5A 1CDIA 3U1SH 3MREA 5GGTH 3AGVA 1AQKH 4LLQA 3EOBB 4PJHF 1A6ZB 1TJHH 4I9WE 1QBBA 3FZUC 4XCNB 1NCAH 1KJVA 3FT4A 1S7XA 2R0LH 3ILPB 4K07A 4YHLH 2IBZX 3ZKMD 4CVUA 3BD4A 3GIZH 1KF9B 5KS9F 5C0JB 1L0XA 4DKFL 4GW4B 3RX7A 1F6FB 3HE7B 3OGCA 5IVZA 2YPKB 5DRZA 4IRSD 1CN4A 2WUCH 4LSVH 3BQUB 5IT2L 3PWLB 5F3BB 2UZXB 2WV3A 4PJ9A 4P4KA 3MUGB 1XGTB 1D5BB 1UXSB 3BKMH 4JFXB 5TE7L 5EIIA 1OTSD 4K55A 4Z95L 2YPLA 3MSPA 4OFVA 5HVFB 5ACMA 2Z92B 5GIRB 3K81A 1YY9D 2OP4H 3BDYL 3QIUA 5F9JB 3OKLB 4N1CA 4YGAB 5ERWA 1ZGLB 3BZDA 2FWOA 3F65A 4QXUH 1MIML 2WP3O 4F7MB 3CAFA 4M48H 5EU6E 3HC4H 1CLOL 1YMMD 2XN9B 5ADOH 3FB6B 1S5IL 4HDIA 3EOAA 2XWJA 2NY6C 1BECA 4JR9L 5I1CL 3ZDZE 2NX5E 2VQTA 3MBED 2VUYA 5KSAD 1OLLA 3TNMB 5D5MB 2RFXA 4FTVE 5I8CB 3VWJA 3I2CL 5FOJA 4KZDH 1I8LC 4BZ2L 4DN4L 5GS0L 1P4LB 3O2DA 1IILE 2GSGA 3HUJF 4PJXE 4GS7B 4JCLA 2DJSA 4KKBC 5C2BH 2J8UB 3RWHB 4OFDA 5DMIL 5FA4B 3U79A 4PJCA 1KIQB 3L3HB 3KPSB 4PY8I 2VJXA 3S9DB 4FQXC 3VJ6B 4NZUL 4U1KB 4H26A 1K8IB 3TIDB 5HHOA 5EZIH 1HHJA 1LP9F 4PV9B 2QBWA 4M7ZC 3SDXB 2IPUG 3ARFA 4X6CF 5EZLB 4UTAH 1UC6A 3HMXH 5D7LE 2VDRL 2R29L 5I16A 1F00I 4NN5B 4XMPL 1YQVL 3IDUA 2FEDD 4H25A 3D0LA 4RIRB 2AQ2A 2H9GB 4YXHH 4KMLB 4OF5A 1MJ7H 3BI9X 3DVGA 1DN0B 2DBJA 1B0RA 2ORBH 2WP3T 3FO2B 1XGRA 2AJVL 3G5XB 4ZNEA 4WDIB 4U1GB 4DWHA 4JZJB 3C09C 3LN5B 3AU1B 12E8H 4H8WH 4MLSA 3MREB 1KCUH 3BH8A 2ARJQ 3RWCA 1B9ZA 3ULUH 4KJWC 3FT4B 1KJVB 4GLRH 1Y0LB 4PLKD 1S7XB 3T2NH 1NCCH 3S3PA 1N4XH 1CYGA 2EDJA 5JDJA 4U1MA 3SBWC 4A6YA 2FR4B 2DM3A 2YN5A 3MNZB 4NCC2 5DMKA 3RDTC 4UOW1 5DRZB 1KEMH 1YC7A 3HG1E 2EIBA 4W4OA 1OSPL 2QADD 5GZOD 3HLAB 1MJ8H 2W9LA 4MNGA 5DSCB 4HCRA 4JY4B 4KVNL 3RGVD 1HKLH 5DFTA 1MREH 3QIUB 2PXYC 1IGYA 2VXTH 5ESAA 4K8RH 5F1KC 5J3HD 3MRLB 3RWEA 5ERWB 1GZQA 2FWOB 3JWNC 5KW9H 3D39A 4N0CC 4KC3B 4R4BA 5DURD 2OXHA 4F2MA 3C8HA 5D93C 1QO3B 4KUZH 1MFCL 4X8JA 2Y07L 3I02A 3IDXH 3MRNB 4GMTH 5C0EA 3EYUH 1FNLA 3PJSA 4Y19D 5E24E 2DQCL 4HDIB 2XWJB 1MQKH 1CL7L 5GGVY 3VXMD 4AL8L 2IAMA 3OAZK 5L88L 4IRSA 1FLRH 1ZS8B 4KRLB 4WUUE 2VLRB 3CX5J 2Q7YB 2RFXB 4JDZA 4M5ZH 4YBLB 2CLVA 1YPZE 3HNVH 1UVQA 3H8NA 1Z9OA 1PSKH 4K7FA 1J0KA 2FH6A 5E8NB 4ZFOL 4TOYH 4WUKL 2BY2A 5IB4A 4NO2B 2CKBB 2ICWA 4PJCB 4XNYL 5T1LB 5FOBA 2R2BB 1UGNA 3KPOB 1JNHA 2VC2L 4DCQA 4PJDA 4Y0GA 4H26B 1H9VA 4U2ZA 4ZUSA 1FFNB 1KTDB 3ARFB 3RVUD 3C6LB 1YMMA 1EDQA 4WO4B 4EDWH 4IRJC 5MI0B 1N59A 3VWKD 5J12C 3BGFB 3RY6A 4F7TB 5KSAA 3V4VL 4H25B 1NBQA 3V7AG 3VCLB 3VI4F 4ORGA 3WFBL 4E41D 4TUKL 5DZLA 5I1JH 4U7MA 2Z35A 3BISA 2PO6D 1GOFA 3KPRE 5IMOB 3HMWL 4IRZL 2Q20A 4OCRH 2E6QA 3V4PL 1XGRB 3PDGA 4EVNA 2QSVA 2VDMH 4QNPE 1Q38A 4JDTL 1AE6H 4OTXL 1SJHA 4L8SB 4QHMB 1I9RL 2A6KA 3BH8B 1LO5A 1CF8L 2WMPA 5FYJE 4GUPB 4OKDA 3WNMA 3NFNB 3QQ9C 1N64L 3BP6A 1NCWH 5KVEL 4KTEL 5C0CD 3Q0HA 4NM8H 1R3JA 4LSDA 5IK3A 1OM3L 5DR5H 3PWPB 5DJAA 4X5LA 1WIUA 3RKDD 2D7TL 5HGAB 1HQ4A 2HJLA 1GIGL 2EEDA 4NJ9H 4YUEL 3FTGB 4IDJL 3PP4L 1GCFA 4PP1C 3SKJL 1KLFA 5DD6B 5GZND 5I66B 5MEPA 1QSFE 5TQ0L 4Q2ZA 1WCQA 5DVNA 1QPPA 4MNGB 1OARL 4S2SB 4K3JH 1XF3A 4JFOA 1FH5H 4L3AA 3VXOA 3MCKB 1VENA 4C56B 2CRMA 1D9KD 5ESAB 2Q87A 5HVWA 3UO1L 2ATKA 1IAIH 2V2XA 5I71B 4OFPA 3D39B 2VN7A 4R4BB 4YQXH 1KENL 1BFOB 3QFJA 1B2WH 4BQCA 1J8HD 2G75A 3T65B 5C0EB 3PJSB 1I7RB 4WWKC 4ZTOL 1JZ2A 1ZA6A 3ULVF 4UB0H 2GCYA 1HINL 2JJVA 4JQXC 4Y88A 5HGBB 1PEZA 2IAMB 3CSYA 1PX3A 2EE2A 5J57B 2CLVB 4WI6A 1KFAH 3GNML 4I0PC 2E6PA 4NWTL 1UVQB 4GKZA 3H9HB 7CGTA 1OD7A 4JGJA 5SWZE 4V1DE 3IKKA 1R0AL 4IMLA 1TFHA 5HVHC 5IB4B 1I8KA 4D0DA 3RGVA 5FKPA 1S9VA 2R0KH 4MJ5A 1E6OH 4FQIL 3RWDA 4K23L 4XMLL 4F33A 1JNHB 4JR9H 5I1CH 4DCQB 4PJDB 3SGKA 2G60H 5AUMA 4TSAH 4ZUSB 4OLEA 1VHPA 5FDYA 2YUZA 4L1DA 4I2XE 3I2CH 1YNKL 4OUUB 4DN4H 1U36A 2VR4A 4XPHL 4YHZH 1JPSH 3RTQD 1BBDH 2ITDA 3VXMA 3HZVA 4FQ2L 2DQUL 4XPBH 3K8MA 2H6PA 3P4OA 1MLBB 4ORGB 5ACZA 4Y5YC 1ZOXA 4H0HB 3NIGF 3FO9A 3WYRA 4C4KO 3FO1A 2MFNA 1ZGLP 4MQ7A 4OCYH 1LK3L 4HKJB 2R0WL 3QWOA 4TPRL 3U2SB 1EHLH 1MHEB 3WKMH 1YDPB 4EKXA 1FDLL 1LQSR 3EDDA 5JIKA 3UTSD 4C83A 1A1OA 3O3DA 2DWEA 4MA8L 5T3XL 1LO5B 3QHZH 3E6HA 1Q0YL 1QEWA 1RZIB 4N0RA 1F90L 2EYTA 3BP6B 2EXWD 1MCBA 1R3JB 5KVFL 4NPYA 3LDBC 4L3EE 4GQPH 1UYWH 3VXTA 4OZ4B 3VFNA 1Y18A 3QXAA 5FUCC 3VWKA 1T2JA 1VACB 3DECA 3QEGH 4WGWB 1X7QB 5ELIA 4PIRF 1F3DJ 1I1CA 4ODTH 4PJ7F 5F88B 5C6TH 4Y5VB 1QKZL 4PJBF 4B50A 3QUML 4E41A 4M1DL 2DD8H 5C0RL 1I1YB 1F4AA 2PO6A 4V2BA 2P8PA 1QLRA 1JBJA 2Q3ZA 2FATH 1IGIL 5DJDB 4JFOB 1DQTA 3FONB 3UJIH 3DIFA 4MB3A 5E2WH 5IIEA 4PRPE 1QVOB 3F7YA 5GGQL 1MCNA 1UJ3A 4YHIA 2UWEA 4HG4K 3U0WH 1OVZA 2SEBB 3OXRA 3QH3B 4M5YH 1HEZA 3OB0H 3U9UB 5B4MC 2YRZA 3QFJB 5ESQB 4WHCA 5C0CA 1JN6A 1OOAA 2G75B 3VE0A 3SDCB 4JKPL 1ZA6B 4XXDA 1D6EB 4GBXC 1A6AA 3NCJL 3TVMB 4CNIA 3LRSA 4C4KT 2X4NA 1WEJH 3HNSH 3CSYB 4OLZH 3UJJH 3LKOA 5E2UL 3GMOB 5HY9A 5JW4N 3GJEA 3ZE2F 4APQD 4UV7L 3U4BH 4GKZB 4KQ4L 3MCG1 2CPCA 5D8JH 4BYHA 1JI1A 5DVKA 3QRGL 4Z18A 4IMLB 3INUL 2DLEA 3W5NA 2YKLH 5FKPB 1CXHA 3M07A 3RWDB 4JO3H 1D9KA 4XNXL 4PTUB 2DN7A 3TV3L 1FYHB 1VADB 2BVOA 1A4JA 5HD8D 5ITBH 1MHCB 5L88H 3ARQA 1NMAH 1QFWL 4FQHB 4C57C 3KYKH 4A2LA 2XPGA 4E5XB 4OI7A 5FO7A 3B5TA 2B5IB 4G7VH 3IAGC 1NEZB 1E4WL 1J8HA 1DUZB 3O45B 5AD0B 4XMKH 2HA1A 4M3KB 1DDHB 2XV6B 4LEXL 4TUJA 5TGBA 3RU8H 1PBYA 3BE1H 4P2OD 2ITDB 3VXMB 4QOKE 1U3ZA 3VXUD 1RJYB 1NUDA 2FHCA 4OM1L 4XNYH 4DGVL 2H6PB 3P4OB 2B1HH 1ZEAH 5ACZB 1NAKL 1ZLWH 3P77B 2VC2H 4G6FB 1RK1B 2VH5L 3RI5K 3VXSB 1KN4L 3CMOL 3DGCR 1KPUA 1MRCL 1JK8A 1X5LA 3O6MH 1ZVSB 1QSEA 2R2HA 1XH3B 2VDNH 1F58L 5I17B 2JB6A 3NACH 3O3DB 2DWEB 4XVTL 1Z6JT 2Q76A 4Z77A 1QZ1A 4Z78A 4JFZH 1QEWB 3T0DA 2AJUL 4ODHH 3V4VH 4UDUB 2EYTB 5KANI 3WFBH 2LFGA 2X4RB 2XWBB 1DBML 2ZUVA 4LLUA 1JJUA 1VERA 4I18A 2GTWA 4CMHB 3VXTB 1MCOL 4FP8H 5FDWA 3QXAB 5HDBE 3V4PH 2E9IA 1A14H 1X5IA 3RTQA 3RNKA 1HH9A 2JE8A 4JFPA 3ULVH 2DM7A 5ISZE 4P2QE 1NLBH 3O8XD 2EDXA 2CQVA 1DBJH 1BREA 1BLNA 3EOTH 4I3SL 4PJAB 4OLYH 2P8PB 1FV1A 1QLRB 1BQLL 1IEAB 2V7HB 2NXZB 1BD2E 3WNNA 2HJFA 2X09A 3K0WA 2CLRA 3DIFB 2QL1A 5IIEB 3AB0C 3CDYA 1OM3H 3BDXA 3O4LA 1ZTXH 1NJ9B 1UJ3B 3UTSA 2IFFL 2C1OA 4ZXBC 4YHYC 2D7TH 4RNRA 1PGRB 4NFDA 5F9WB 4OV5A 1RIHH 4IDJH 1AH1A 1QBLL 3R1GL 4ZS6C 3FMGL 4M7LL 3SKJH 4OJFL 2HG5B 1JN6B 2M1KA 2PYED 4KROD 3ZTNL 5CD3A 3VE0B 1TVDA 3OZ9L 4XXDB 3QYCA 1A6AB 3DV6B 4G8FB 4WI7A 3LRSB 5D70H 3X13A 2X4NB 5FGSA 1YECL 3LKOB 3GJEB 1OT2A 5HDQL 1NLDL 3JWOH 1XR9A 1NC4A 2Z31B 5EUOA 3HI6L 1RIUH 2DKMA 2Y7QA 2OMBA 1UXWA 3U4EB 3KWWA 4ZPTA 4ODXB 2OYPA 4WNQB 4M6AA 5E0QA 1CLCA 3OF6D 1BBJB 5DJYA 3UZEA 4BUHA 1CXKA 2X4SA 3U82B 3WLWC 1F3JA 3VFRA 3MV7E 3QEQA 2OR9H 3ZE1F 1A4JB 4XP4H 3WXVL 5IHLB 2ATPB 2A6JA 1LO4H 1T4KB 1T1XA 2Z93A 5I73B 2YPVH 2IALA 1LEKA 1J8HB 4DW2H 5IVXA 2Y36L 3V52L 2CK2A 2Y4SA 4JRXE 2IH3B 1SJXA 5FK9B 3RWJA 5TGBB 4TUJB 4DUXA 2OJEB 3ARPA 3IXAA 5DC9B 2BMKB 4G8IA 2D7MA 5BO1L 1H8OA 4XPAH 2AEPL 4X8XA 4APQA 3PWNA 2AAVA 3EYOA 4PJHB 4ZUTA 1E4XI 1CDCA 5D1QB 2ADGA 1Z2KA 4QTHB 3SDAD 4EIZC 3VFSA 3BQUC 1RZJC 1VEMA 1J1PL 1KPUB 1JK8B 4JJ5B 5KS9B 3I75A 1QSEB 2R2HB 1DEEA 5CKAA 3IU3B 3MXWH 4G6JH 5SX5K 2JB6B 1A6UH 3T1WA 4P9ML 1UEMA 4UDTA 5CMAA 5BRZE 3DYPA 1JYVA 1I3GH 3EJJX 2ADJA 3T0WA 3LRHA 3NMEA 1VGKA 2YA0A 5MEOA 5F3HA 4LLUB 5FYKU 5SWSB 1EHXA 4UOJA 4MAUL 5DHXB 1FYTB 4KUCD 1UQSA 3X11A 5FDWB 3P0VL 4P2OA 3RTQB 2BVPB 5CLTA 5ANMA 3RNKB 3VXUA 3GSXA 3TNNA 1DP0A 5FHAH 2HT4D 3NFSH 4MA8H 3KLDA 1U93B 1S7SA 1TZIB 1CBVL 1F90H 1IFHL 5HHXH 3DRTB 2CLRB 5FYLH 3TA3D 4LVOB 2D0HA 5A2LH 2ESVE 3O4LB 4O51A 2YD5A 3FRUA 1P7KB 5EBWA 2CRYA 1WZ1H 1KB9K 2BZDA 2RJMA 4P3DA 5D2LA 5BVJA 4X6DE 1OAYH 3FRPA 4BFEA 4GS7C 2X7LA 5B38A 5ALBH 3ILQC 2W0KA 3CC5A 5C0RH 1KJMA 5DJ2B 5CD3B 5TE4L 3HUJB 2WINB 3AM8C 1S7RA 1D5XB 1DEDA 2FX7L 3N1MC 2ZCHL 3X13B 1BWWA 1JHKL 4OBRA 4Y4HA 3O8XA 2LTQC 3LD8B 1GGIH 4LQ1A 1NC4B 1YEIH 5F1OB 4G8GB 1MI5E 2VLJB 1FGVL 3DGGA 3MGOA 1UXWB 3MRQB 3KWWB 4KKCC 4LKCB 1CT8B 3FT3A 2HFEB 1SVCP 1RV6X 4P5MA 2QSCH 5E2VH 3VXRD 5CEXA 4PS4H 3QI9D 2ZUWA 1F3JB 1UEYA 3G6JF 3QEQB 5L8JB 4OSUL 4GQ9L 2VDKL 2MCG1 2NR6C 1T03L 4U1GC 1QFPA 1FNEB 4JZJC 3D0VB 2HYMA 4KDWA 4MNQE 4NZTH 3JTTB 4JFDE 1LEKB 2PYEA 3B43A 2HLFD 4TQEL 4YHKH 4YHNA 3MBXH 1ZANL 3RWJB 5F6IB 1WCBB 4OB5H 3INUH 2GHWB 3IXAB 1TXKA 4P2RB 3EUUA 3G5VB 4I4WA 5H35A 3DX9A 1EUUA 3L3JB 2D31A 1BMGA 1F4YH 4APQB 3PWNB 4JANA 1NEZG 4ZUTB 1UFUA 5JPMA 2GITA 3QEHB 1AXSB 3C5SA 4ODVL 1G7LB 4X98A 5JXAL 1I9JL 4BFIA 1I85C 2YD2A 5FGRA 5DUML 3OF6A 4HFWA 4DQOL 4PREA 1NGWA 4PJ8A 5E00A 4QRSA 4UDTB 5CMAB 3RFZC 1MHHA 1IZJA 2LU3A 1ITCA 5I1LA 3QIUC 4PYGA 4DGVH 3AREB 3UZVB 3VD7A 4DZ8A 4X0KA 2PN5A 3QDHA 4MD5A 1U8JB 2DI9A 2OM5A 4TVSa 5F3HB 4JPVL 1JMZA 3M17A 3SN6N 4WHYH 3CLEH 4KK6D 5ANMB 4JFYB 3VXUB 5IB2B 4X7TB 3TNNB 1F58H 4FFZL 4TYUA 3NCYP 4WW2F 3SE9L 4DK6A 2JJSA 4GRWB 3CDGA 4LCIL 4RGNB 3SDAA 5EO0B 5IQ7H 1PAMA 1K9TA 4YBLC 1KIUA 15C8H 1QRNE 4WU5A 1KEGL 1DBMH 1SVZA 3WFHB 2IANE 2Z8SA 3WFCL 5CBAA 1AP2A 3QDAA 3FRUB 5KTEH 1R3KB 4L4TE 5EBWB 4DVRH 4JFEA 2VIRB 5BVJB 2BNQE 4R26H 2X7LB 1A7NL 4RZCA 5B38B 3HFML 5SX4H 4L4VE 4OGZA 1DQML 1XGPB 2BFVH 4N0YL 3LEYH 3D3VE 2VLLB 1KB5L 1KJMB 5DRWB 3TLRA 1N5YL 1IJ9A 3UPCA 1UB6B 1S7RB 4R4ND 2ZNXA 5IB1A 2WUBL 3ARFC 1MFNA 4X6BA 3WIIL 1KCVH 3C6LC 1N2RA 4RQQA 3V7MA 4Y4HB 5I18H 1NFIA 1IM3B 4WO4C 3GSRA 1V5JA 4U1JB 5MI0C 2OTUB 4G42B 4KK5D 3HC3H 5HI3D 3BGFC 3OAYH 1MWAH 3RUGE 1RMFH 3EIFA 1N6QH 1QBLH 1IM9B 1G9MC 4ZUUA 5LGHL 1WWCA 5FYKL 3UDWA 4NWUL 1VFAB 5DHYB 3G5ZA 3TA3A 4GKNA 2FB4L 4YDKH 4NUGH 1TZHB 4PUBL 5FCUL 4IOIA 3U6RA 3QO1B 3EJZD 4JO1L 4LAQH 4U6TA 3HKFA 1REIA 1SJEB 1ZLWK 3JV5A 4L8SC 2GSIB 1NBVH 4K94L 2BX5A 1A0QH 3V6OA 2PYEB 5D7IA 3QUXD 5HHVH 3CGTA 4P23D 5E2TL 3GMRA 2JK5B 5IWLA 3CX2A 5HTSA 1CL7I 3UTOA 2BRQA 4LLVB 1QR4A 1HIMH 3PQYE 4LF3A 3N0PB 4XGZB 5JPMB 2GITB 4XCFH 2BNRB 2UZYB 1TJIH 3EJYC 4ONFL 4BFIB 3C5JB 2JLLA 5CINH 4HFWB 3TJEH 3VXRA 3WE6A 4JPIB 4P9HL 4PJ8B 3O11B 4GRMA 5E00B 4QXGL 4D0BB 4HGMA 2XIDA 4LPYA 2BJML 4PJ7A 3I9GL 2Y06H 5GRYA 3N9GL 4XH2A 4NQXB 3ZO0A 4K7PH 1PYWB 4KV5E 5ILTL 2Q6WA 4DZ8B 4LFHD 4MD5B 3LKRA 5I71C 4AM0A 4UNVA 5C2UB 3QDMD 4NFBA 1EUTA 2ZKHL 3M17B 4LSPL 5IR1A 1S8DA 1UACL 4Z5RB 5EUKA 1NCDH 2VWEC 1ETZA 1I4FA 3E1F1 3MUJA 2XN9E 3CDGB 2IAMC 5LQBL 5A2JH 4R2GB 4GW5A 3GKWL 3LN4B 4AK1A 1J1XL 2W9EH 4DGIL 4LPVA 1FNAA 4M61A 5D9SB 2K7QA 4IBLT 5CBAB 5CCKL 1XGQA 5D6DA 4BQ9A 3P0VH 4ELMA 4JFEB 4K9EH 4Q6YA 3EO1A 2NYYD 4RZCB 3AXLB 5EC1B 1HYSD 1WIPA 2BERA 4GRLA 3QZWA 2HRPH 4O5LL 2E9WA 4LP5A 3KPSE 1NCBL 4O2FA 5JXEC 4FA8A 4P5KA 1Q0XL 4HIXL 5DMGD 4YR6A 4F7PA 4OLXL 3KJ6H 5AZ2L 2FCBA 1T22B 3OR7B 2EYSA 3BP7B 1N6VA 3WN5A 4CDHA 1J5OH 1MELA 4RQQB 2IWGA 3MXVL 2VDQL 3VMPA 5FO8A 3H0TB 3ARYA 4QRPB 3RY6C 3Q5YA 2V2TA 4JHAH 4ZUUB 2DQTL 5IMMB 1HSBA 3G5ZB 3MNWA 5K93A 4WY7H 4XPGH 1T04A 3DURA 3SE4A 4IOFD 5JR1L 4FN0A 2ZCHH 5HYSB 1P7QA 4LNVA 4CVWA 4F15B 1G7PA 5ADPL 4PJEA 3ZDXE 2FIKB 3MGTA 3MLTA 4EOWL 5IBTH 3WFZA 2XXMB 5D96B 4OI8A 2GT9B 1CE1L 4LNRA 3G6AB 2QV2A 3UTZA 4I1NB 1ZLSH 1H5BA 1FNFA 3MV9D 2Y6SC 2QHLA 4LVNB 3GMRB 4YH6A 2YD1A 3TBYB 4FNLL 2EO9A 3W0WA 4PGCB 5F6HI 4NNYA 5DQJA 4LASH 4GQ9H 1B0GA 5BW7A 1NAMA 1PDKA 2FEDC 2DQJH 4ELKB 3AAZA 4Y5VC 2XYCA 1F45A 2IJ0C 4HD9A 5CP7A 2A77L 3W9DA 5F7EH 4BKLA 4OGAD 3B9KD 4GRMB 3C2SA 3SDYH 1YPZF 2X41A 4D8PA 1AD0B 4DOHB 4PJ7B 1ZLVH 2YPLE 3IU4L 4XH2B 3D87B 2DTML 3QJFA 3BH9B 2P48B 1RURH 4L8CA 3LKRB 1NH6A 5TDOA 4K3GA 1MQ8A 3QUXA 1WTGT 3BJLA 5D7KE 4WIQA 2VABB 2BSSB 1YEFH 2Y25A 1S8DB 1CXFA 4OQTH 1Y6KR 3SDCC 1NKOA 3STZB 4KHTL 1KTLB 3TVMC 1NGYB 3QCUL 5F1NA 2P5WA 1OAZL 4MLIA 4NO0D 4GW5B 2DQIL 3DWTA 4NQUA 1RJLB 3O9WD 3ROOB 2AQ3A 3QSKB 1G6RL 5JW5A 1XGQB 2R56L 2X4TA 5EZJA 3ES6A 4OZFA 5JZ7D 3MYJA 2VSCA 1AGEA 1X4ZA 4GRLB 4M7KL 4F80A 3QZWB 5HPOA 3T2PA 1L0YA 2A9MH 2EIDA 4PJCE 4E42A 3GRWL 4DZBA 2VLKD 4O2FB 4QNPF 4BK4A 1BOGA 3QDMA 3I3DA 4YR6B 4F7PB 4JM2D 3B6SB 1G7IA 5DJ0A 2EYSB 2B5IC 4JO4H 1HOCB 3OGOE 5HHOE 2D03L 3WN5B 5D1ZD 1S7TB 4NQEA 5C0DA 2V17L 4PGZA 4BJLA 3LEXA 2V2TB 4QRRD 3EYSL 4HJJH 5LWYL 2DLFL 3DXAD 1A6TA 2A74A 1F97A 2ICES 2N7AA 4IEFB 3JVGA 1OAXL 1T04B 1CDUA 1INDL 1KJ3L 3U7YL 3FN0H 4S1QL 5IVOA 1A7OL 2NY4D 2CIIA 1P7QB 3I85A 4LLYB 4YK4B 1G7PB 1QBML 4FZ8L 5CZVH 5DUPL 1IC4H 3MGTB 3MLTB 4ZNEE 1EMTL 3WS3B 1Q9LA 4LNRB 4X5XA 3OXSA 2I60L 4U3XA 4LLDB 1H5BB 2R8SH 3CX5K 1QD0A 1NGXA 4TVPH 4NWUH 3W0WB 5IHUH 2FB4H 3NH7L 4F58L 4H8WC 4MMXC 4UINH 5DQJB 5FCUH 4JO1H 1B0GB 2YD8A 4HT1L 4CVXB 4YEFA 5JPNA 5CEZE 4RRPG 3ULUC 5CP7B 4YHPB 5INCA 4RAVA 3L5XH 3CLFL 4ZOCA 4F7CA 1KGCE 2J8HA 3P73A 3PP3H 2OL3L 4P57A 3VDAA 2NXZC 1PG7H 1FORL 5C0FA 1LO2L 5IFAH 4MNGE 2W60A 2NNAA 1IQWL 1UJ3C 4YAQA 3UC0H 1QFWI 5TDOB 1XFPA 1RUAH 1XZ0B 2EECA 5F9WC 4Z7VA 3MRKB 4NUJA 3WL9A 1FO0A 3MV9A 4HHAA 4QHLA 3D39E 3FO0L 3IJYA 4NNPL 1CR9H 1QLEH 4P9HH 4AEHL 1C5DA 3DBXA 4NCC1 2Q8AH 2CIKA 3MOAH 4K8RC 5SWQA 3T0BA 1P6AB 1HDMA 2C26A 2VWEE 5F1NB 2P5WB 1A6WH 4HUNB 2HKFH 4NKOA 3MZGB 3DI2B 1U91A 3KS0J 2Z31C 4MXVE 1PLGL 4XP9L 1KV3A 1H0DB 3L9RA 1MVUB 1QA9A 3ES6B 4OZFB 4NJAH 1GHFH 1Z3GL 2J88L 3M8OL 1AJ7L 3VGAC 1MFBL 5E8EB 4ZOEA 3RZCD 1KBGH 2CK0H 3CMGA 4DZBB 2OJZH 4KRNA 5LQBH 3QG6A 2EYRA 3DVNB 3KLHD 4PJDE 4Z7NE 2CDFA 5I73C 1NGZA 1UKTA 4R8WL 1EBAA 1G7MA 3G6JA 3GGWA 1L4IA 5TE6L 3FKUS 4ZS7L 4NQEB 5I1DB 4Z8FH 5C0DB 3DUHA 1YMME 5KJRL 3TCLB 3VFGL 1HXMA 4YO0A 2D7OA 3B3IA 3B2UD 3DMMC 4MAYB 4NO0A 1R3HA 4GAGL 2OK0L 3O6KL 2HTLC 1WAAF 2E9JA 4CJ0A 4NFCA 1RZGB 1FZOA 4M6OL 1WFNA 5FM5O 5DGQA 5D1QC 5E03A 5JLZA 3O9WA 1CGVA 1FIEA 2WW8A 3T1FA 3BHBA 5BOZG 1NUNB 5F9OL 2EEAA 1TZGL 1MWAB 1BGXL 1EZVX 3VRJB 3RL1A 3S88L 3ARDD 4MMZC 5E6YA 5FGBC 1TVHB 4M1CD 3TT1L 2F53D 5BS0D 3ARGD 3GI9H 1F4XH 2XFXA 4WEMB 2YSSB 4DKEH 5F7NC 2HLAA 5HYSG 1DQQA 1S7QB 1QG3A 2FO1A 5IESH 1DBBL 5D1ZA 3L1OH 1K4CB 2BY0A 5BZWA 3ARBD 5EBGA 3U0TA 1Q9WA 3T0ED 3RTQC 4GMSL 5CKGA 1I3UA 4QRRA 5F72S 4L29A 4BSWA 2XY1A 3KVQA 3THML 5CZXC 5I1AB 3P73B 3QP3A 2OCFD 2KDGA 1IARB 3S34L 3P40A 2ZCKL 5C0FB 4WW2A 1FBIL 1F4WL 3DSFL 4PTTA 1U95A 4HUWA 1VGEH 1YMHB 4LVOC 3SKMA 2RHEA 4YAQB 1T83C 5TDPB 4YZFF 3BSZH 3SOBH 2VNCA 3BT2L 5KVDL 4HH8A 2F74B 3QDJD 5ID0A 5FCSH 5CZKA 3WL9B 2FX8H 3MV9B 4HHAB 3TC9A 3CH1B 4XZUA 1C08B 4P3WA 4X99A 5FYJH 3QFJE 1C5DB 1IKFH 3X3FL 3ME0A 2CIKB 4S0TD 1ORSB 1CFBA 5CD5D 1I1AD 4G9FD 3QUYA 3KDMA 3IU4H 3MJ9L 2DTMH 5E95B 4U1HA 5GQBA 2C3WA 1CD1A 4GG8A 5T33H 3NIDE 9CGTA 1EERB 4KI5D 4NRZA 1OGAA 1JIBA 3DYMA 5TF1L 5E9DD 1W72L 4XI5D 4HF5H 3UZQA 4MD4A 3MRCB 5EU4A 4YFLI 5CILH 2WBJD 5T3ZL 3P11L 2V9TA 4KTYA 4EI6A 1G0YR 3C87A 3MRIA 3CXDL 1MCRA 3IAPA 3BRFA 1OAZH 3QG6B 1HSAA 5HYEA 2UUDK 5C9KA 1G7MB 3QQ3A 3G6JB 4N5EC 2GI7A 5I8OL 3MLWL 1MHPL 3IS0X 2VDLH 4TNWF 1A1NB 5F6IC 3ETBF 4EN3B 5JQ6H 3VXPB 5CUSH 3RWFA 5KBNC 2WQRA 1HXMB 4YO0B 4OIIH 3TH3T 5GISH 4DN3H 3B3IB 4NSKB 5EFIB 4XVUD 5HDBF 3VXME 3F6IA 4OI9A 4YDJB 1D6VL 4JM4L 1GPOL 4P49A 1K5NA 5CSBA 3MLYL 5FO9A 2LU4A 5TH2A 5JLZB 2CXGA 2HVJB 1PX4A 5EN2A 4AQOA 5E08L 2IG2H 5I76B 2F5AH 4EDXA 3BHBB 4Z7QE 4R3SB 4NOFA 3C9NA 2D03H 5GS0D 1FFPA 4LLWB 4W68A 3WMSA 1ITBB 2V17H 3E0GA 5ICXA 4UV4L 5C07B 3RZCA 1VB9A 4WI2A 3CVHA 5I19H 2XFXB 4O00A 1JZ3A 2RAMA 3EYSH 3AREC 1DL7L 3FAWA 3KPQB 3JV0A 2HLAB 4ODWB 1DQQB 2VDOL 2AJXL 3E8UH 1G6VK 1OW0A 4Q9QL 3X3GH 3U0TB 3MRBA 3W2DH 5HHPA 5AZEH 1EXUB 3DRQB 1KCLA 1CD9B 4HUVA 2WM0A 4FZ8H 1OAQH 4HKZA 3S37L 4L29B 2EZ0C 5F7YC 2R23A 4MNHB 4BSWB 5GJSL 4OLVL 1HH6A 1XGYH 2IH1B 4MDJA 1MAJA 2PYFA 3D18B 4ONHA 1ULVA 4RGNC 5E94A 3T4AA 3TN0D 4E41E 3K2UH 2ADFL 5EWIL 5C86A 4PJAE 3F7QA 1DQJA 4ZFZB 5HHMD 4WW2B 4HUXA 4DKAA 3RBGA 3JTSA 2ZPKH 3SKMB 2AEQH 2V9QA 4UNUA 2MCPL 1BZ7A 3S35L 4F58H 3OWEA 2BSTB 3ARDA 5DFVC 1INQA 1C12A 2F53A 4XTRD 5BS0A 1MFEH 4NQDD 3RX8A 1YEGH 1IAKB 4M7LT 1AHWA 4PG2A 1JNNL 2UWEE 1P5UA 1TTGA 2QSTA 5ACLA 2O26U 4K3EL 1P69B 1DLHB 4FABH 5GRJH 1PW3A 4HBQA 4LMQE 3ARBA 5C0CE 5IMLA 2AK1L 2MSPA 1FORH 3T0EA 3HAEH 3KDMB 1U92B 3QUYB 3BKJH 1ZKAA 5FKAA 4N0UA 4Y4HC 4U1HB 3GJFH 1IQWH 3VG0L 1N8ZA 1BQHA 3HB3C 4OZGA 2BDNH 3HI5H 4KQ3H 1TLKA 3I6GA 1OGAB 4I77L 4LSTL 5JA9A 1A9BA 4NNPH 1XCQA 1NMCB 4F9PA 4IHOA 4F57L 2DQEL 2BY3A 4WHYG 4EI5D 5J13C 5T5FL 2VXQL 1OAUL 1Q72L 4NZDA 1J12A 1BIIA 3QDJA 4KJYA 1R5VA 2O5ZL 4XPTH 5EA0L 1X5GA 4YDIL 4JVWA 3QQ3B 4ZTPH 1RU9H 1QLFB 4X7EC 4KMQA 6FABL 4CU8A 1JPTL 5JIHA 5I1EL 4HXAL 4IIQA 2FEEL 1FGNL 1J8HE 3KNBA 1I1AA 3RWFB 4G9FA 3SJVD 1BP3B 3QBTB 5JMRA 5I30H 5IROC 4L9LA 2XZQL 1AJ7H 2R4SL 4W6YB 1MFBH 3MTRA 3DV4A 1GGCL 4OM0L 5KSVA 5TJWK 2GJJA 3CUPA 2JKXA 4P59L 5EN2B 5E9DA 4XNUL 4YWGL 4R97B 4L9DA 5EU6B 4EDXB 3CZFB 4U49A 3Q48A 3ZDYE 3MLPA 1UCBH 1QSZA 4PJ8C 1FFPB 5EULV 2VXSH 1QSEE 5JIPA 1QRKA 1OGTA 4HKXA 5LGKA 3D5OF 2NX5B 3O2VL 3PNWB 4WHTB 2EC8A 4HKBA 2XKNA 1DQLL 1SBSL 4G43A 1GSMA 2FYYB 1T5WA 5ICZB 1OAKL 4KFZC 1RZ7L 5E8PA 1YEDB 5JNYA 5C7XH 5HHPB 2EIZA 4N1HB 4HWEL 1N5AB 3FQNA 1TTUA 1FNSH 2AV7B 3VGHA 1IGFL 1ONQB 3KPPB 5IBUG 5F8RC 2XA8L 3S88H 4UQ3A 2XG5A 2R23B 3FAXA 1KG0A 2JJSC 4MDJB 4R4FH 4ONHB 3EFDL 1U8MA 5E94B 3T4AB 4AY0A 2Q86B 4R2GC 4UBDC 5K9KB 1ACYH 4RFEA 1T1ZB 1DQJB 2CXKA 5DO2D 5F1SA 1A9EA 2ADIB 4HUXB 3UYPA 3JTSB 3QCTL 3ULVC 1YYMH 1V7MH 3EFFA 3L5IA 4YHML 1WBZB 1YC8A 2X40A 5D7LB 1INQB 3O4LE 1C12B 2F53B 3WNPA 2VISA 3FB8B 3UTSE 1AHWB 3TO2A 5EOCJ 2NY1D 3BUYA 4ALAL 5IF0A 3KHQA 3LS4L 5GGUA 1E28A 3CFCH 3VXQB 4B53A 1CE6A 3R06A 3IB4A 3O6FD 5IHBA 3GSVB 2VXVL 3CFEA 3ARBB 5IMLB 1EJOH 5DQDH 3LOWA 4H88H 1TVBB 4RWYL 1S3KH 5FKAB 3RIFK 4S1RL 1JFQL 4N90D 5IG7A 3TF7C 4PGDA 5E6ID 1E6JL 4N8PA 3I6GB 5EUOE 5EU5B 3VG9B 4JFHD 1U41A 3HZYA 4N9GA 3N1PC 4XWOC 3EYQC 1JPGA 2EKSA 5INDA 4JN2A 5JDSB 1KACB 4PB9H 1IC1A 1S9WA 4DVBA 1JPFB 1QFUL 3JWOC 4OFIA 3RL2A 1ND0B 2YK1H 4KJYB 1R5VB 4NQDA 5J9PA 4F15C 3QEQE 5C0BD 2J12B 5DJ6B 4EJ1C 1YNLH 1A21A 5D96C 3C2AH 2CLZA 1VEPA 5JW3L 4Z76B 4LVNC 1W72H 3KNBB 5IVXE 2HH0L 5IWLC 2AK4A 4QWWD 1LD9B 32C2B 4L9LB 2HT2D 4ZD3H 5GSRA 3L3OB 2APTA 3C5ZD 5B8CA 4HIEA 4WFGD 2XZCH 2ZSWA 4G9DA 4OLWH 2KQNA 4Q74A 4YPJA 5ID1A 2QQKL 4S1SL 2XZAH 1NSNH 1HHKB 1FL6A 4Q0XL 2DBLH 4NKIL 1Q8MA 4MWFB 1TETL 4FS0A 5I75B 4EI5A 1MF2L 1OGTB 4HKXB 3K2MC 1MJJA 5ALCH 2MHAA 1QSVA 2A38A 2V5RA 5TDNA 2ARJB 5AG8A 4HKBB 3GMLB 4HPYH 4WUUB 2XKNB 4JPKL 5HI5C 2BVUA 5EZOH 1T5WB 3C8DA 1YPZB 1U6AL 5IM7B 3GSOB 4NN6B 1NGPH 2XQYK 3D25A 5E8PB 1RUKL 4AMKH 1F6AA 3Q6FA 2X44D 2EIZB 2NY2B 2P49B 1ES0A 1RZJL 1JE6A 3QG7H 5K9QI 3KLSA 3LH2H 5ANME 3QAZB 4UQ3B 4CW1A 3VXUE 3WXWL 3SKOA 4KAQL 3TJHC 35C8H 2D0GA 4XP5L 5AG9A 2W9DL 1G1YA 2PW1A 3TCXA 1OLZA 1OD9A 4KXZH 4GRWE 1NL0L 5BZDA 5C0AD 3RUGF 4UT9H 1KXVC 3EFFB 3T77B 2H3NA 5D6DC 3KHOA 1QPXA 4OD2A 4EZMA 3BPNB 5I8KH 5D2LE 3BUYB 3UAJD 1IRAY 3HR5B 3S37H 3DUUA 4GRLC 3PWUA 5T3XD 5GGUB 3LQZA 1CE6B 2VAAA 3SGDH 4G6AC 1UM5H 3ZT5A 3QWRD 1NDMA 4TTDD 3CFEB 2C3VA 2JIXD 1M05A 3KPRB 3ZKNC 4BSJA 2R4RL 1PKOA 4W4NA 2WNGA 1W0VB 4MXWL 1KCSH 4HWBL 4Y2DB 3S35H 3UPRA 3LS5H 2J6EH 4PGDB 1V3MA 5E99L 3IDMA 5I2IA 3RBSA 4RX4D 4H20H 2HT3D 1JNNH 3H7LA 4H1LA 1FNHA 1M7DA 3DVIA 1LNUB 4JB9H 5CJQH 5T1KD 3HZYB 4N9GB 5DD1L 5HHMB 4LDEB 2JJWA 4GG6A 1JPGB 1I9EA 2GFBA 2NY0D 4JN2B 5INDB 1S9WB 3HCVA 3W9EA 5J6GA 3HZKA 4KY1H 1WAAA 4YK4C 3EGSA 1S78D 2F8XC 2R1YA 3O6FA 2HTKC 2QHRL 1H5BC 3D48R 1QSFB 3FQTB 1Z5LA 2PYEE 5TFSL 1TJGL 3I6KA 1FG2A 5IW6B 2AK4B 4G7YH 2IMMA 5EG6C 3UBXA 5GSRB 1RUQH 2WZPD 2YD4A 3LQMA 1QACA 4KKLC 4HIEB 4LBEA 5B8CB 4G9DB 1A64A 5IOPB 3NCCB 4WWID 5E6IA 1CQKA 4MZ2A 2ZJSL 2EDOA 2W65B 3OAUL 5ID1B 5CSZA 4O4YL 4GW1A 1FL6B 1IAOB 1A1MB 3ZL4L 4Y4KD 5EOQH 3KS0H 3MLRH 4WV1B 1TPXB 1J0YA 3ZT7A 3QJHA 1X5AA 2R69H 4EI5B 1BVLA 1FZMB 3UMTA 1MJJB 2BOCA 4OGXL 4LSQH 4M7JH 5TDNB 1A3RH 1WBYA 2BVEA 3MUY1 3BPOC 4Y5XA 2X70A 4AEFA 1VKXA 2E7MA 3D25B 4OF0A 4NGHH 4YWGH 4FQQB 4V1DB 2DQGL 4X6EA 3REVA 4NQCD 2AJZB 1YEEH 1ES0B 4TVPL 5CHNB 4RBPK 1EGJL 3UEZA 5IFJA 5D7SL 3VD9A 4DFHA 1FC1A 1FRGH 3HNTH 4JZNA 4UOW0 5CJXA 2JJUA 4EBQL 5CGYD 5D2NA 5CIPA 4PJGA 2ZUTA 3SCMD 2IADA 4MQXD 2OZ4H 5BZDB 3W82A 4GOSA 4KRPD 2NY7H 2A6DA 3QCVH 2H3NB 4P0DA 4H5SA 5D72H 4NDMB 1BZ9A 1MSPA 4O02L 1A7RL 4HWEH 4OD2B 3RVVD 3GJFK 4U6XB 2IBGA 4KPHL 5IJKC 4JFEE 5GGRY 4OZHA 4LHUB 4AH2A 3GHBH 3DUUB 3PWUB 2EXYC 1YYLL 5F7KC 4YHOL 1H8NA 2FJGB 2XOTA 1F42A 1JRHL 1JHTA 1INEL 1NDMB 3ZDXF 2C3VB 2FJHA 3S36L 2PW2B 4P5TA 1IBGL 3UTTD 2CGRH 4JPWL 3H42H 1MAKA 4E9LA 3WIHH 5BMFL 2DRUA 2KKQA 4FHBD 3G5YA 3MC0A 3D85D 4OT1L 5I2IB 4UT6H 1H3PL 5C0IB 4MAYC 4ALAH 4H1LB 3S6CA 2CKBL 2PUQT 3HTLX 5EOCL 2VITA 1HHHB 1MVFA 2VZOA 3HAEB 5GRXG 5C0AA 4GG6B 1PQZB 3Q2CA 4J6RL 3PGFL 3W9EB 5J6GB 4ENED 1T66C 4MX7B 1KNOB 5DJ8B 3HZKB 5GGSA 1EEYB 5DA0B 3SY0A 3EGSB 3P9MA 1KPRB 4FFWD 4HXBH 3MV11 1HYSC 1X4XA 5DS8A 3GMQA 2VZUA 3RNQB 1YN7B 3OPZL 5B39A 4C59B 1JYNA 2AJSH 1DTUA 3QWRA 1BAFL 2VZSA 4M62H 1Z5LB 4GAJH 3V6OE 5D7IE 4FXKB 3TPUB 1FG2B 1RIVL 4NO3A 2AW2A 5F9DC 3MODH 2XI9A 3UBXB 1G9ML 3C08H 4PRPB 2AJYL 4UAOB 3MLSL 4RX4A 5DLML 2NY3C 3IGAB 2XQBL 4DK3A 5MP6L 4GXUM 1VEOA 5CSZB 3PXHA 3QUMA 3ZT6A 1A6VL 4R90H 3CFKB 1T2QH 4UILL 1M7IB 4NKDA 1P1ZB 3EW3B 3WBDA 5DD3H 3VXRE 3GBLA 3NCYS 3ZKXB 2PTVA 1X5KA 5TPWH 1LE5A 4LSRL 2R15A 4U0RB 4KJQC 1AI1H 1CVSC 2P5EA 4PJ7E 2C3GA 2QKIB 4Y5XB 5FB8B 2X70B 5L7XL 3L95A 5K9OB 3NGBB 3A6CH 4HC1A 1XEDA 4RMQA 3MLUH 1RHHB 2V9RA 2D7NA 4ZO8A 1J1OL 1BEYL 4JZNB 3PF2A 5D2NB 3WO4B 1CVRA 2F54A 4XVSL 5CIPB 5JUEH 2VLME 2Q7NA 4DAGL 4XVJL 2IADB 3CH8A 3HE6D 3H9ZA 4O9HH 4Y4KA 1U6AH 2DQDH 2AS5M 5HYJD 3FHQA 4OCLC 1CGWA 4P46A 4JAMA 3QISA 4O2CA 4H5SB 1OL0A 2P8MA 3BKCL 4IDLA 4TNWK 5EO9A 5DK3A 4KZEL 4BELD 4YPGA 3V9FA 4QOKB 4DTGH 4ELME 1OSZA 1AGCB 3FOMA 4OZHB 4YIQA 4AH2B 1SEQH 3VGEA 4JFFD 4MQTB 5I1HH 1WICA 5BV7H 2H2PC 3GO1H 1VFMA 1IVLA 1CGSL 2FJHB 4JREC 3N1QC 3PL6B 4P5TB 2D4DA 3OL2A 2WWMC 4K9EC 4P3CH 1T7ZA 4NQCA 1AY1H 4TSCH 1PKQA 1CFVH 3TZVD 1SY6H 5CBEA 3IFNL 3TFKD 3WSQH 2XQYG 3TBWA 1S9YA 4MZ3A 1A7QL 1DVFA 1MCEA 4EN3C 5EH1A 4MDIA 2IGFH 1MRFL 1C5CH 1EFXA 4PLJD 3QIBA 1K4DA 1N6UA 3KYOA 3SCMA 3CCHB 3MJ7B 1QFOA 5C0AB 1MH5A 2APBA 3LIZL 3O2WL 3OV6A 1AIFA 5BQ7A 4TSBL 1C5BH 5DMYA 3P9LB 1MFAL 3PHOA 5KSUA 1CU4H 5DEFB 1YEKL 3SY0B 2DKUA 4KK9D 1HI6B 2D0FA 4XC3H 3MRMA 5ISZB 5DS8B 3G6DH 3IFOA 1VFUA 4AIZB 4PJEE 2P24B 2OSLA 3K3QA 3KPLB 5L0QC 4LQFL 2Q8BL 3WJJA 2XACC 3EHBC 2YA1A 5DJZB 5HGGS 3UTTA 4BQ6A 1TCRB 4M6NL 1T0MA 4HJ0C 1NFDA 5GS2H 4LARH 3GSNH 4FZEH 3RZWA 3W0WE 1AD9B 5T1DL 3TPKA 4PR5A 3D85A 3L6FB 3MACL 2YRPA 5EBMB 2NLJB 5I1IL 2GUOA 5KVMC 3E2HB 4J4PD 5E7BA 1TITA 3QXUA 3ALPA 4NKDB 5DHVA 1G84A 4U1IA 1AXTL 1NGQL 4JG0L 1BQUA 3O6LL 4FXGA 4Z7WA 2VTFA 4MVBD 4U6YB 4KU1A 4MXVF 3GHEL 3BGMB 4WW2C 2P5EB 4D9QD 2F5BL 2EE3A 3L95B 1ZAGA 5IEHA 3A67L 1DUYA 5BJTA 5GGTL 1AQKL 1EHNA 4JQIH 3EDKA 2EDWA 5C09D 3T3PE 4KKAD 1TJHL 4U6VH 4JEGB 3IT8D 3NABH 1NCAL 4J7RA 3QUYC 5HYQB 2R0LL 5MEQA 1U3HB 2FGWH 4YHLL 4KDTA 2FZ3B 2F54B 4CDGC 4MS8D 5HI4C 1OWWA 1D3CA 1YA5A 2YUWA 3DI3B 2P5WE 3MA7A 3U46A 1L7TH 4P46B 2WUCL 4LSVL 4HS8H 1BJ1H 3KR3L 1NCNA 3NZHL 4O2CB 4RMWA 4JRXB 3D2UB 4MSWA 5EO9B 2ZOLB 4FOMA 3S5LA 1NMCC 4R6UA 4YPGB 2DLIA 3BKML 4CL7A 1OSZB 4YIQB 3QEUB 1CIDA 4X4XB 1OF2A 2UYLA 3VRIB 4NQSB 1CICD 2YHGA 4PRBB 4NN7B 1FZKA 4MXQD 2PCPA 3L5JA 2B0SH 3VFTB 2LVCA 4WTZA 4IJ3B 1WC7A 3TGXA 1MIEH 4X4YA 2ARWA 4JKMA 1XIWD 2XKSA 3QDME 4QXUL 4UMGA 1PKQB 5CS7A 4LHUG 2B39A 5DJXA 3GUTB 3LB6C 3L3KA 4WGVB 3QNXA 1DVFB 3OR6A 4PV8A 4ISVA 3ZMRA 2I9TB 5HXMA 3HC4L 1MLCA 1WZMA 1EFXB 2W59A 4NQEE 5BRZB 5EPMA 5ADOL 2VB5A 4P99A 3QIBB 2D2OA 3KYOB 1SMAA 1JYWA 2R1WB 3VA6A 4J3OC 4YHOH 3HE6A 2A0LD 1T5XA 1L9NA 1MH5B 2NXYD 5HYJA 1T6VN 5KOMC 4O58H 3V0VA 1AIFB 2IPUK 5H94B 4MCZB 1H3TA 4R97C 43C9A 3PHOB 1MCFA 3RVWD 5GXBB 5E5MA 3IFLH 3MRMB 5DVOA 3MMEA 3HAEG 1QUNA 4WTXA 5C2BL 1I9IH 1IKNC 5DA4A 1JUFB 2D3VA 4CRPA 3O2DH 3GB7A 4PPTA 1CFNA 4Q6IB 2OLDA 3UTTB 4ZUWA 4BH7A 4QRTA 3TZVA 3VFWB 5EZIL 3RY4A 1UM6H 1T7XA 3PGFH 5AAWA 4PD4J 4XRCB 3HHRB 3WJLC 4UTAL 2KUTA 4PRHA 2X5PA 3HMXL 4KK8D 2XICA 2OTWA 3P4NA 5F7FA 3UBXG 4U1IB 2YOCA 3QQ4B 4ORZC 3W39A 5FYKD 4FXGB 3NIDF 4N8VG 4YXHL 4HGWA 1MJ7L 5I1GH 3R8BB 3WO3B 1G9MH 4YE4H 1KUMA 1EAPA 3SE3A 4X5WA 4JE4B 2ORBL 4PY7A 1UCTA 3IDIA 1SYSB 5I8EA 5IEHB 2J5LB 5DTFB 12E8L 5D7JD 5HGDB 1KCUL 1TIUA 2P8LA 4Z7VE 1IAIM 3FL7A 3MV9E 5A43C 3OKOA 3ULUL 1HCVA 3ARBC 4K3DH 4XXCA 4WFED 3QUZD 3T2NL 1BJMA 2XXCB 1JF6A 5E4EB 2CO6B 1RJZB 2O5XH 4OF7A 1N4XL 1V7NH 5CJ5A 4ZUVA 4NC1E 1JNLL 3KGRA 1J7VR 4J4PA 4PGBA 2K9UA 3PHSA 1KEML 2OI9B 4A6YH 4QTIH 1UWEH 4ZDHB 1YUHA 4MSWB 3DUSB 1JV5B 3BEVA 3VG9C 5CEZH 1MJ8L 3S5LB 4XWGH 5KG9A 1CFTA 3MRFA 3KLAB 4JGUA 2H8PB 2UYLB 4R0LA 2XTJD 2DI8A 3L3IA 1HKLL 1MREL 4HK3J 2PCPB 4BH8A 2VXTL 4FQJH 4K8RL 1HHGB 2HFFA 4HCRH 4POZD 3ECBA 5HYFA 4M3JA 5CLWA 4QCIA 4S0SD 3MGAA 1GYAA 4F37F 5C09A 1Z9SA 3HG1D 3QNXB 1CDGA 2ZWLT 3OR6B 4PV8B 3G6JE 2F19H 4KUZL 3S8WA 3IDXL 5F1IA 5EPMB 3QHFH 4NO5B 4L9LC 5E2JA 5L2JA 3REWB 5IKCA 1MQKL 2PNDA 2DTSA 5ICYA 4W6WB 4AJ0A 5T1MA 1FAIL 3UYRH 4RGOL 1FLRL 3BO8A 5HYJB 2H26B 4M5ZL 2A9NH 3V0VB 3HNVL 4XBPA 3T0VA 5CJOH 1AKJD 3M1BB 1JZ4A 1X4YA 2GY5A 5E5MB 5I75C 4J3XA 1A7QH 1GC1H 3ALWA 3D69A 1ADQH 4YGVA 1V05A 1CICA 3AS2A 3P30H 5H2BB 3VU2A 2VE6B 2YUXA 4OV6F 4UUJA 1OCWH 2HJKA 3OJDA 1QRNB 3C8KB 1XIWA 1T1YA 3RAJL 4ZFFA 1EVUA 1WJ3A 2UWEF 2IANB 2VKWA 4HIJA 4NN6C 2Z0BA 3RHWF 4F3FB 5C6WH 2GEEA 1AO7A 3H3PH 5ENWA 5JOFB 1I1RA 3Q6GH 1EPFA 4L4TB 1MUJA 5IFHL 1LEIA 2NY2C 3KYNA 3FQRB 4PRHB 1EX0A 4EDWL 2OTWB 1ZHBA 3P4NB 3LMJH 4QRRE 1BZQK 3RA7H 5DF0A 4JRYD 3QIWD 3GSNA 4HK0A 5GGRA 5IHZA 3GMPA 5I1JL 3GSQA 4HGWB 4O2EA 4XAKD 3IJSA 1HN1A 2APVA 1X5ZA 4OCRL 5MEND 1EA9C 4PY7B 5L2KD 1FHGA 3CDCA 5EO1B 5DRNA 4NYLA 3IF1A 4MJID 5I8EB 2VDML 4YXKH 5DEGB 3BPNC 2IQAB 5I1IH 1BIHA 3RUGB 1AE6L 1R3IH 1KB5A 4NRYB 2P8LB 5HHQA 3BZEA 1XF4A 3O6LH 1NCWL 4HZLB 4LCWD 5IEKA 2JTDA 4NM8L 1HK6A 3DROB 5DR5L 4Y2DC 4J8RA 4PGBB 5D6CB 3GSWA 4R96A 2DKSA 4NJ9L 1I3RA 1OTUC 5E5UB 1YUHB 3PABB 4Y1AD 3CFIC 1MY7A 1OGAE 1CFTB 1FVEB 3MRFB 1A5FL 1B4JH 1SHMA 4LSSH 4K3JL 1FH5L 1FG9C 2BC4B 3OJ2C 1RZ8A 4R0LB 3N1FC 3PQYB 3E6FA 3ZDYF 1BHGA 1S7UA 4XTRC 2GTZA 3FZUD 2HFFB 3HPLA 3ECBB 2HKHH 4PJIF 4GXVH 1IAIL 4BSVA 2ZUSA 4Q9RH 5SV3A 4YQXL 4JHWH 1NCTA 2YWZA 2BSRB 3KR3H 1MCWM 2D4FA 5HDOA 4G5ZL 3NZHH 1XT5A 2EH8H 2E7HA 2FSEB 1B2WL 5BV7B 1ZV5A 5K59F 4M4PA 5IKCB 1II4E 4Z0XB 4ZSOA 1D5ZA 4UB0L 5T1MB 1IC5H 3AS1A 5DXWA 1W8OA 3BO8B 5CSGA 1RY7B 4XNMA 1KFAL 1NMBH 5C0NC 2F9BT 4UU9B 1MCCA 5M95B 1KTKE 3KXFD 1BPVA 1EJ6A 3SHSA 5L9DH 3S3SA 4WV1C 1TPXC 1I8IA 1JZ8A 2YEZA 2IEPA 3N06B 1O5DT 2DIBA 2R0KL 1R3LA 4HZAA 1MY5A 1E6OL 2ED9A 1F11A 3LHPH 3VH8B 5F44A 1XF5A 5K9JH 4ZFFB 2NY6D 1KJ2A 2G60L 3PIQA 5KN5A 5FFLA 4M4RA 4TSAL 3HG1A 1AO7B 2BXYA 3V5DB 4OGYL 3KYNB 5IBLC 3T4YB 3MV8D 2ZNWA 4YHZL 5C6PB 1JPSL 4PGEA 1BBDL 1ZHBB 1RK0A 1RZFL 1T80A 3HC0B 5B3JF 4XPBL 3O3UN 4KKBD 5F93C 1UB5A 3GSNB 5GS3A 4HK0B 3BP4B 5GGRB 3BVNA 2E5EA 1AKJA 3NN8B 4RAUB 5DC4B 1RZKC 1FVCB 2CH8A 4FQXD 4LKXA 5EUOF 4J3SA 3WD5H 1ZA3B 4RAHA 4OCYL 2E27H 4NYLB 5GGVL 4F7EB 1EHLL 3BWUC 3WKML 1NDGB 3TO4B 5DQ9B 4K3HA 1LDSA 5MHSD 2G9HA 2F53E 5BS0E 1J0ZA 5BVPL 3WDJA 3QHZL 1P9MC 4WU7B 3BZEB 1XF4B 2OQJA 3S4SB 3DX6A 1R24B 2W0LA 5J1SC 3IKCB 2QQNH 3LKNA 4TN9A 1NCUA 3OJVC 1F8TH 1UYWL 2ZUUA 2NTFB 2UZIH 3JV6A 2MTPA 3QA3B 4J8RB 3T0EE 5IVXF 3U30B 1U8HB 3QEGL 2EDYA 4L8DA 4N0UE 4N8CH 4NIKB 2NW3A 4D0CA 3FQWB 2X9XA 1HXYA 4JRYA 4ODTL 4OZGE 1JGLH 4IMKC 5C6TL 3QIWA 5JQHC 2DD8L 4QKXB 4LLQB 2BVQA 1TNMA 3CK0H 3K80A 2YD9A 2ZG2A 3QO0A 4HQQH 2FATL 3C6SA 3BZFA 5MENA 1RZ8B 5L2KA 3UJIL 2NW2A 1WT5C 3E6FB 4MJIA 4UTBL 1S7UB 5E2WL 2GTZB 4KJWD 2NZ9C 1JNLH 2VL5A 3S5LG 1ZT4A 3U0WL 3QDJE 5C3LD 3OGCB 5IVZB 5IW1A 3TWCH 3O81A 2AV1A 4M5YL 3C60C 5J89A 1HILA 3RDTD 4PJ9B 4P4KB 5CJ8A 4LCWA 4U3HA 2Z8RA 5EIIB 4G8EA 2YPLB 2DL9A 8FABA 4G9FE 4WVRA 1FIGH 2R39A 2EDRA 1JTOA 3JUZA 1JGUH 1D7FA 4HK3N 3WEXA 2BOBA 2K7PA 1LEGA 4UAOC 1WEJL 3HNSL 4OLZL 4FQ1H 3UJJL 1UH3A 4XNMB 3AROA 3U4BL 2PXYD 4KI5E 3BW9A 3J8F7 4Y1AA 5A2IH 2RR3A 4PRNA 2H45A 5D8JL 4CKVX 5E9DE 1I8IB 3PWJA 4NM4H 4GRWF 3ZKXC 2KQMA 2HMIC 2M2DA 4N0CD 1G9NH 2YKLL 2XTJB 5DYOA 2LQRA 4U0RC 3SDDD 4JO3L 2YBRA 3EOAB 1JRHI 3VW3H 3O3AA 1BVKA 1FAIH 2KL6A 5ITBL 4Y5XC 4RGOH 1XGUA 3QPXH 4UIMA 1NMAL 4POYA 1KJ2B 5D2LF 5HJ3A 1J18A 2AXFA 3K4DA 3KYKL 3NGBC 3ESUF 1MNUH 1O0VA 1KXTB 2X4PA 2Y5TA 4G7VL 3VWJB 3KJ4C 3P9WB 1ADQA 4XMKL 2VXUL 2X1WL 1CLYH 1MCWW 3RU8L 4PGEB 3EO0A 3BE1L 2GSGB 3H9SD 1RK0B 4PRDA 3BX7C 4QYOA 5D2NC 3WO4C 2B1HL 1UB5B 1ZEAL 4OIAA 1JL8A 4EUPA 1WFTA 3KXFA 1AKJB 1IEBA 4NHUA 3RAJH 3F58H 1G6RA 5HHOB 2PR4H 3G9VA 4HAGA 4LKXB 1HHJB 3IJHA 3ARUA 4XBGA 4MYWB 1UZ8A 1H15A 1P53A 5IFHH 5E4IA 3O6ML 2MQ0A 3GMMA 2VDNL 5D1XC 3A0OA 4L8BA 2AJ3A 3NACL 5I16B 3RKPA 4IRJD 3MBEA 5JHDD 4JFZL 1B4RA 4ODHL 5HGHA 3DX6B 3D0LB 3U7WH 25C8L 5FEBA 5F9AC 3PL6C 4LPTA 2NPLX 4P5TC 3SQOH 2AABH 4ONOA 3DVGB 3JV6B 3MV8A 4FP8L 2APWA 1B0RB 4KI1A 1K6QH 1A14L 1I8LA 1ZSDA 1Q9KA 5JOEA 1I3VA 3ULVL 3MCLH 1ZWIA 1HXYB 1NLBL 3MFFA 5HBBA 1J8KA 1DBJL 1F4HA 2VKXA 3EOTL 2BVQB 2YN3A 4LOUD 3OG4B 3SGEH 2B7DT 4LEOA 3RWCB 4OLYL 4HEPG 1BQSA 3GM0A 5HHME 3QQ9D 5L2KB 1BFVH 2NW2B 4MJIB 5IQ9A 3WFDH 1ZTXL 4YBQC 4U1MB 4A6YB 4JVPA 4NQDE 2R0ZH 5F7LB 2BNUA 3S37X 5IW1B 4Q97A 5DMKB 3V4UH 1RIHL 4P2QD 1UZ6E 5FM5M 4TTDC 5FUOH 4CVZA 4RISH 4LCWB 1FE8H 4PRID 1W0WA 3V6FA 1H3XA 4JKWA 4PP1D 4AIXA 3ZLQC 1A5FH 1DBAL 4JRWA 1JGEA 3AS3A 5L6YL 1BD2D 5JW4M 2AK4E 3S35X 5B21A 3ABZA 1LEGB 4JCMA 4LP4A 5D70L 2EDTA 1UWGH 1IGYB 1MCPH 1QOKA 2XWTA 4FFVC 3RWEB 1DE4A 3E2HC 3JWOL 1GZQB 4Y1AB 4L3CA 1RIUL 2OL3A 4F2MB 3IDGA 1QFWM 4G5ZH 4XNZB 3ZYIA 3GMNA 4X8JB 3I02B 7FABH 3SGJC 4WCYH 2WIIA 1R5WA 5T3ZD 3AY4A 3FT2A 2X89D 2OR9L 1BVKB 3QXDA 4XP4L 5C71A 3RY5A 3J7HA 4IRSB 4UIMB 1XGUB 4WWKD 3SBWA 5DK2A 1K3ZA 1LO4L 5AYQA 5C08D 2AXFB 1FPTH 4JDZB 5GHWH 1T2XA 2X4PB 2Y5TB 2ZUXA 2YPVL 1JGDA 4K7FB 4DW2L 4I0PD 4PGJA 1YJDH 3VH8G 1EEQA 2P7TA 3EO0B 3QFDA 4HH9A 4KUCF 2ICWB 4PRDB 1U3HC 2WAHA 4OLUH 4D9LH 3WKNA 4XPAL 5FOBB 1NANI 1ZLUH 3MV7D 4QHUA 2PXYA 4QHNA 4JY5H 4NHUB 4ONGH 4P46C 3VFOA 2EE9A 4OGYH 2P42B 4Z9KB 5FF6A 3GMMB 1YMMB 5GJTH 3SDDA 1DSFH 3MXWL 4Y19A 4G6JL 3EZ8A 4L8BB 1A6UL 1N59B 1WFOA 2AJ3B 4RA0C 3V95A 1UH2A 4I48A 3UTQA 3ZHLA 1I3GL 3MBEB 4IS6A 5FM4A 1RZFH 4NN7C 5KSAB 3TIEA 1I7UA 4IJ3C 3KAAA 5I15H 2PF6A 2Z35B 1KT2A 4F8QA 1CDJA 1TQBB 3MV8B 5D7IF 4HWUA 1DVFC 1HKFA 1ZSDB 3K1DA 3OSKA 3H9SA 4XCCH 5GGVH 4EVNB 4RCAA 2FJFA 4GKSA 3S4SG 3MFFB 4M93C 5FHAL 2GJ6D 3QIBC 3NFSL 1SJHB 5BVPH 2G2RA 2A6KB 5J0BA 3NZ8A 5CGMA 5HHXL 2YC1A 4GG6E 1A4KA 4I3GA 2VR5A 4GRWH 1T7VA 5FYLL 1CLZH 5IK3B 1WIOA 3R4DA 4I8DA 5IQ9B 1KSRA 4JZOA 5DJAB 1WZ1L 1WV7T 1HQ4B 2DQHH 1OAYL 1WAAE 2HJLB 4KHXH 1X44A 2WQ8A 3RWIA 3UP1A 5JHDA 3O41A 4ZFGH 5ALBL 3N85L 4OAWA 3EO9H 1MCIA 3CPLA 4CVZB 5IB3A 1W0WB 4Q6IC 3VFVA 4G6MH 5MEPB 2IBBA 4Q2ZB 4HGKC 1JGEB 1XF3B 2L0DA 3VXOB 3V79C 4Z0BH 1PVHA 1ACZA 4UTBH 5AYUH 5DDHA 2RCSL 4WFHD 4N90E 1RUMH 2ESVD 4AENA 1NC2D 2ATKB 5FECA 2V2XB 1GGIL 1YEIL 2YD7A 4L3CB 3RIAF 3CVIH 4JG1H 1WSST 1FP5A 1QR1A 1AXIB 3DJ9A 2QSCL 5E2VL 4ACPA 1AGFA 4PS4L 3RJQB 1L6ZA 3QUKA 3VRLE 1JWSA 1CZ8H 4ZNCD 2QQQA 2GCYB 1YQ2A 1CXIA 4ELMF 2IPKA 4D94A 3UJTH 5C9JA 2I5YH 4GBXD 2J5LC 1MCSA 2QADB 2L4OA 4NZTL 4PRIA 3X14A 1H3VA 1MI5D 2WIMA 4M6MH 4P4RA 1CQYA 4YHKL 3MBXL 2MMXA 2DMBA 5KZCD 1P7HL 2V7NA 2P7TB 3RVTC 4OB5L 3VDCA 4HH9B 1I8KB 4D0DB 3RGVB 1JYXA 1S9VB 4YZFE 4XP6H 3B83A 4MJ5B 1GGBH 5E4EC 4KDTC 2OR7A 4KMTH 4NC0B 4F33B 4LGSB 4WFGE 2B2XH 1F4YL 3DLQR 4CBPA 2R9HC 4NBZB 5D2NE 2IPTH 1FSKC 3WLBA 2OI9C 4PJGE 5AUMB 5DURB 3LPWA 3I50H 4F37K 1W2KT 4ODSH 1P4IH 4I5BA 3IDYB 3BAEH 3SDDB 2VXUH 4WEBH 4Y19B 1S5HA 1IAMA 4FFYH 3LCYA 1X5FA 2X89A 1ZHNA 4IS6B 4OZHE 3HZVB 4MA1B 5IJVA 4WWKA 1QTYT 5C08A 4JQXA 5HHNA 3TIEB 2BSED 1U58A 4PJEF 2HN7A 2VZ1A 2YMXH 1UKQA 3FO9B 4I0PA 5A2KH 3FO1B 1HZHH 4Z7UA 1GXEA 4MQ7B 1BFSA 3CLEL 2CKNA 3H9SB 3QWOB 5KSBA 4PJIA 1L7IH 2PTTA 4YDVA 2JELL 1P4BH 4C83B 1A1OB 1LMKA 3DETC 1J0JA 3GBNH 3OJMB 4RGMB 4PG9A 2HWZH 3E6HB 1JWMA 3FN9A 4AEIH 5IQ7L 1X9QA 1WF5A 3HN3A 4M43H 25C8H 2WBWB 5C0AE 15C8L 3RHWK 1E4KC 4NPYB 2E3VA 3OKEA 5KTEL 2DDQH 1MAMH 3VFNB 1Y18B 3VWKB 4DVRL 2XZZA 4H0IA 3RWIB 3WV0A 2E7LC 1T21A 4R26L 4MQSB 2J3SA 3IDJA 5T3XE 1J87A 2BFVL 3MYZA 5IB3B 1R5IA 4E41B 3LEYL 3MLZH 2CRZA 4KJPC 4QXWA 3VFVB 3TM6A 1T3FA 2PO6B 2D7PA 4Y5YA 4GLRI 3ZZ1A 4OF8A 1CG9A 2H2SC 1VPOH 2A73A 4ZQKA 1GGYA 2R2EA 4JN1L 1KCVL 4PLJC 3T3PF 5I18L 3F7YB 2GJ6A 3FQUA 4YHIB 4WHDA 3MRPA 2UWEB 5HPMA 3MNVA 3HC3L 4QF1A 1IGJA 4U3CA 3H7BA 3FFDA 4MB5A 1QHOA 1MWAL 3OXRB 1RMFL 1N6QL 4ZXBD 1HEZB 1W8NA 3L3GA 3D3VD 5C0CB 2X4QA 3PUCA 1AGFB 2VAJA 3QUKB 4ZS6D 1DBAH 2QEJA 3SE3C 4KK9C 5L6YH 3LKQA 4YDKL 4NUGL 3IVKA 2ICCA 4RFOL 3VFMA 4CNIB 4LAQL 2P5EE 3FQXA 5HY9B 1R6VA 1MFDH 1NBVL 4YX2H 3U0PA 1A0QL 4P4RB 2Y5EA 5HHVL 4HS3A 1C8PA 1ZHKA 2DIJA 1KCRL 1IGMH 2KBGA 1D9KB 2ESVA 4YFEA 4RDQF 1HIML 5SV4A 1NC2A 2BVOB 1PZUB 2R2CA 2H1PL 3Q5TA 3WLWD 4X6DA 2F54E 4XCFL 2ENYA 3B9DA 1TJIL 4JGMA 1EK3A 2XPGB 1DANT 2IQ9H 5CINL 5FO7B 3CFDA 3TJEL 2VDPH 3X12A 3SE8H 3GSUA 3PWVA 1RULH 4NNXA 1C7SA 1TQCB 4R0LC 1LE9A 2Y06L 3WS6A 1C16A 2W1NA 4K7PL 5C08B 4GBXA 3S97C 3QULA 3HE7C 2HN7B 1DCLA 2ZCLH 3E3QC 4Y4FD 2FX9H 5IMKA 4ODUA 3H2WA 4Z7UB 1P6FA 4NQCE 3UCRA 1PKQE 4LRIA 3BQUD 5BV7C 4PJIB 5KAQF 3ULSA 5H37H 1NCDL 1QP1A 1U8KA 1ZK9A 4PG9B 4XB7A 4Z77B 2Q76B 3VFPA 3CU1A 2J2ZA 4Z78B 2J1KA 4FG6D 2AGJH 3KPNA 2EDKA 2BP3A 4LL9A 2W9EL 4LRNH 1KC5H 5DT1H 3NTCH 3QPQC 1G7QA 2XNAA 3OKEB 1EEZA 2GTWB 4I18B 1JZ7A 4CGTA 3JV4A 1CFSA 4K9EL 4CU7A 1HH9B 3QXWA 4JFPB 5JORA 5DEZA 4YJZL 3IDJB 3VXNA 2Z91A 1R5IB 1BLNB 2HRPL 2XN9D 1T3FB 4MCYA 3MOBH 1FV1B 5CP3A 1CG9B 3UTTE 5ITFA 3KJ6L 3W11C 2HJFB 4Z7VF 1NFDE 2A73B 1ED3A 1J5OL 3P0GB 4B7LA 1PEWA 5A16A 2GJ6B 3BXNA 3FQUB 3UTSB 2C1OB 1AR1C 5HPMB 3IXTA 4QF1B 4RNRB 1IGJB 3HRZA 3LPGA 1FJ1A 4FXLA 4OV5B 1OTTD 1BM3L 3N85H 2AI0H 2C7UA 4JHAL 2LVEA 2X4QB 3S36X 3SQBA 3ILQD 3KPSD 4WY7L 4XPGL 4Z7WE 5FV2A 3LKQB 3IDNA 3WDIA 2ZP0T 1T89A 3VFMB 2RCSH 3ROLA 1IAII 3ARZA 3TO4C 1XR9B 5IBTL 4X4MA 4OD1H 5EUOB 5GPRA 4NN5C 1ZLSL 2Y7QB 4JO2H 4ZPTB 4DGYL 1J0HA 1A7PH 1WZKA 3LY6A 4CADA 4KKCD 2AXHA 4X9GA 5DJYB 2X4SB 4OF6A 1P2CA 3VFRB 4FQCH 2UY6A 4LASL 3U30C 2E9BA 2FD6H 1C7TA 4LVEA 2A6JB 4M1GH 4Q58C 2DQJL 4ZXBA 2DJ4A 1FFOA 1T1XB 2Z93B 1Q94A 3JXAA 4G6KH 2IALB 1NAMH 3D9AH 1B6UA 5F7EL 3X12B 1IMHC 4BZ1H 5IVXB 3GSUB 4K2UL 3SDYL 3PWVB 4U1LA 1YEJH 1SEBA 4G3YH 4QHKI 1GAFH 4JDVA 4PD4K 4G8IB 1C16B 2VRAA 1YZZA 3DO3A 2EDNA 1RURL 3EYOB 3TYGH 1CGTA 4S1DC 2ADGB 3WHXA 3VFSB 2ZG1A 3BYTA 3SKUD 4PJ9C 3MUZ1 4P4KC 3RPKA 1YEFL 2AKRA 3I75B 4TVPD 4JM2F 1DEEB 4OQTL 3ULSB 5AWNH 2CDGA 3SO3B 3BYYA 1U8KB 4C55A 4HX1A 2YRLA 4NHCH 1JMXA 2B1AH 4N1EA 4KRMB 2EC9T 1QNZH 2ADJB 1XCTA 1S7WA 2CUMA 1EIBA 2X2YA 5E7FA 3RX5A 3FN3A 1VGKB 3QIUD 1PY4A 5HYJE 5MEOB 3F7VA 3BKYH 1DBKL 5E6ZA 1UQSB 3S98A 4ETQA 3X11B 4JKLA 3JV4B 4JHBA 4DUWA 4P2OB 3EOBA 1A6ZA 3LQAH 4YLQT 5JORB 3GSXB 3QHTC 4OFYD 2JELH 4XCNA 1AFVL 2Z91B 3ILPA 3TT3H 1T7YA 5D4QA 2A9ML 2K1MA 4OZFH 1LO3H 3OB0K 4Y4FA 5C0JA 1S7SB 5JTWA 2H32A 2NQCA 4TUOA 2YPKA 1SM3H 3VWJC 4JO4L 2VLRD 3BQUA 5E8DH 4KTDH 4O51B 5C3TA 3BXNB 1XGTA 1D5BA 1MRDH 3IXTB 4P3DB 5D2LB 5GSVA 3HRZB 4PRHE 4ODBD 3UYOD 4OD3H 5I6XB 2C7UB 4HJJL 2Z92A 3CC5B 5GIRA 3PV6A 5F9JA 4CU6A 5T1LD 1N7MH 4HFUH 3WNLA 5LCVH 5FYJU 1OB1A 1PY9A 3FN0L 3IDNB 4F7MA 2C9AA 4JN1H 4ZAKD 3ROLB 2G5BA 3OKKA 4ETYA 5CZVL 4M8QA 4YBHA 3O8XB 1IC4L 3ARFD 3GBMH 2CR6A 3C6LD 1GZPA 4GSDH 3A6BH 4WO4D 1NUGA 3DGGB 3FB6A 3MGOB 3DO7A 2OBGA 5LXGL 2R8SL 3FT3B 1XAUA 1KYOJ 4ZO6A 4P5MB 4CADB 5A3IC 5CEXB 3TNMA 3NAAH 5D5MA 1MCLA 4HWBA 4L5FH 5IHUL 5JMOC 4UINL 4RFOH 2MPAL 1P4LA 4XHJC 1UA6H 4YHYB 4HWNA 1CFQA 1Q94B 2J8UA 5FA4A 4KROB 3L5XL 3L3HA 2RIKA 4YHNB 3STLA 4U1LB 3VJ6A 1SEBB 1PG7L 3ARTA 3TBVA 4JDVB 5IFAL 1KCRH 3TIDA 3AM8A 4N5UA 5H35B 4I4WB 3DX9B 3BPCA 2D31B 4D9QE 3SDXA 2N4IA 3UC0L 4JANB 2H1PH 1RUAL 3C5SB 3U36A 3PWPD 4X98B 3WHXB 3BN9C 2FH8A 4W4OC 4DEPB 3E3QE 1WQVT 1FLTX 4X7SH 3EJYD 4ZOBA 3ARRA 1CR9L 5F7UA 4PREB 1QLEL 5C09E 1KGCD 1NGWB 3QI9A 4L1HA 1FO0H 2CDGB 4QRSB 2Q8AL 1WZLA 2H9GA 3MOAL 4HX1B 1MHHB 2DWDA 5I1LB 1A6WL 1DN0A 4TTGA 2DB8A 2E7CA 1S7WB 2HKFL 3FO2A 4X0KB 3G5XA 4C56D 4WDIA 3LV3A 2E8ZA 1OP9A 3AU1A 5DUBA 1UADC 4ETQB 4XPFL 4LU5L 4XNZC 5DZNA 1RD6A 3D39D 4X4ZA 2CMRH 2X9WA 1NUFA 2H41A 1IC7H 2P44B 4NJAL 3ZKMC 1ORQA 1GHFL 1LDPH 1KPVA 1GOGA 1Q1JL 1Y0LA 4UIKH 1KBGL 2CK0L 3DYOA 5AEAA 2OJZL 4IRSC 4Y4FB 5L8LB 2FR4A 3SDAB 2H32B 3B8YA 2QJDA 3MNZA 1JHLL 2FDBP 2IAMD 4TUOB 3TESA 1JVKA 4WU5B 1GC1C 1QQDA 1JPST 3B4NA 1I85A 1AO7E 1AP2B 1G7JA 1EGJA 1OTSC 3HLAA 4Z8FL 4D3CH 5GSVB 2FLRT 3VI3E 4HUUA 1YY9C 5DSCA 1IQDA 3JUYA 3G9AB 4JY4A 5F6HJ 2I07A 3PV6B 4J3TA 3MRLA 4OZGF 5E70A 1OB1B 5IB1B 2X6MA 5JXED 4LSUH 4X6BB 2BHUA 1N2RB 2G5BB 3OKKB 1NFIB 1QO3A 5JHLL 4M8QB 3GSRB 4OFYA 3BRGC 5E5RB 3ZHDA 1GZPB 3MRNA 3MBEC 2JCCF 2V5SA 3P3YA 3LEVH 3GI9L 3DO7B 3SPVA 4FQLH 1F4XL 5KSAC 1BM3H 4DKEL 2HRLA 1ZS8A 5IESL 2VLRA 2Q7YA 3TA3B 3L1OL 5JA8B 5IVNA 5EU3A 4Y8AA 4GKNB 1TQBC 3OTTA 2CJUH 4IOIB 3U6RB 1WWWX 5E8NA 1FN4A 2QTEA 2PTUA 1BX2A 1CFQB 3SO5A 1MPAH 2FBJH 2CKBA 4NO2A 3HA0A 1JZ6A 4L4JA 1EFQA 4OFKA 5D7IB 5T1LA 2R2BA 4TULH 3STLB 5FYKE 3KPOA 4DGYH 1FAKT 4KI5F 3TBVB 4XP1H 1A3QA 2O61A 2Y6SD 4ZAKA 5KVGH 1VGEL 3BPCB 3MR9A 4BFBD 1FFNA 4LF3B 1KTDA 1UM4H 3C6LA 3BSZL 1NKRA 4WO4A 3SOBL 1X6NA 3U36B 3RIAK 2LTQB 2FX8L 5EB9A 3VXRB 3WE6B 4F7TA 2F58H 3QI9B 5FYJL 3VCLA 4WFEE 4K2UH 1IKFL 5ETUA 4I13B 3MLXH 3NOIA 2DWDB 4PRAA 5IMOA 4ZSOE 3V5HA 1DQDL 2HFGH 1OWRM 1RFDH 2Q6WB 5DD5H 4Q9CA 5T33L 3LV3B 4AM0B 3CSBA 5DUBB 3MRHA 4P23A 4L8SA 4QHMA 2X4OA 4GUPA 3NFNA 4HF5L 5IR1B 4PLKC 2NY5C 1ORQB 3QFJD 5CILL 3AY4C 4ERSH 5EUKB 5J06A 1KPVB 1ETZB 2XTJE 1I4FB 1OP3H 3SDCD 1ERNA 2GQHA 2BRRH 3PWPA 4HMDA 4BQBA 4CN1A 1EZVY 3NPSB 5HGAA 3TVMD 2QADC 3B2VH 5GZOC 2EICA 4M61B 3FTGA 1QQDB 2MOVA 1DBKH 3Q1SL 1D5IH 1G7JB