4RAIA

Crystal structure of cng mimicking nak-etpp mutant in complex with na+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
b'FQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4raiA00
3OR7C 1K4CC 3R65A 4MVRA 4P9OA 2ITCC 3OGCC 3E8BA 3EFFK 4WFEA 2WLIA 4P2ZA 2DYSC 3K04A 4H37A 2WLJA 4TWKA 3RW0A 5KUKA 3LDDA 5EBWC 4RUFA 4G27B 2ITDC 4PDRA 3T4DA 3AG2C 5CBFA 2X6BA 1R3LC 5EBLC 3ZJZA 4WFHA 2EILC 4R50A 3VOUA 2OCCC 4QE9A 2WLLB 3F7YC 1R3JC 3K0DA 4MW8A 4PA4A 5EK0A 3OUSA 5IY5C 3RVZA 2A79B 2IH1C 4MTFA 4ZBMA 3ASOC 1V54C 3E8GA 1M56C 4R8CA 2ATKC 2DYRC 4X89A 5EC1C 5B1AC 3SPIA 4F4LA 3E8FA 1OCOC 2WLHA 2WLLA 4KFMA 5B1BC 2EINC 2DWDC 4P9PA 3T1CA 5CBGA 3AG1C 4LBEC 3T4ZA 3OUFA 4MVQA 2HJFC 5KUMA 1S5HC 2Q67A 3IGAC 4GX2A 3SYCA 3UKMA 4CBCA 4QE7A 5B3SC 3T2MA 5EC2C 2ZD9A 1K4DC 1OCRC 3SPJA 4MTGA 4PA7A 2EIMC 2EIJC 3F7VC 2KB1A 3AG3C 1JVMA 1J95A 3E8HA 1ZWIC 2BOBC 4GX1A 3SYAA 4RUEA 4I9WA 2YEVA 2W0FC 3ZRSA 2X6CA 4MVZA 3LDCA 2HG5C 1M57C 4MW3A 3K06A 3SYQA 1QLEC 2X6AA 3ABLC 3SYOA 2WLKA 4H33A 4EKWA 3TCUA 2QKSA 3SJQC 2HVKC 1ORQC 2QTOA 3ASNC 3FB5C 4HYOA 3OR6C 1R3IC 2K1EA 4GX5A 3LDEA 4MVOA 3KG2A 3RBZA 4WFGA 1OCCC 5CBHA 1KKDA 4HZ3A 3FB7C 1OCZC 2H8PC 3K0GA 4PA9A 3LNMB 1G4YB 4LP8A 3TETA 1XL4A 3FB8C 1V55C 3GB7C 4J9ZB 4JTCB 4X88A 4OXSA 4G28B 4MSWC 3E86A 3SPHA 2HVJC 1BL8A 4UUJC 2DWEC 3PJSK 4XDJA 1LNQA 2Y69C 4PDMA 3K03A 2AHZA 3SPGA 4BW5A 2A0LA 1R3KC 4MVSA 3LUTB 5J9PC 2Q69A 2IH3C 2P7TC 3F5WC 4GX0A 2A9HA 4LCUC 2BOCC 3ABMC 2JK5C 4J9YB 4MVUA 3BEHA 5BZBA 5EBMC 1P7BA 4QNHB 3SPCA 2AHYA 3E89A 2WLMA 2ZXWC 4MS2A 3HPLC 3SYPA 4XDKA 3E83A 2Q68A 4JTAB 4WFFA 4RO2A 4XDLA 3STLC 4PA6A 4R6ZA 3WG7C 4MVMA 3FB6C 4PDLA 4X8AA 1XL6A 3AG4C 5E1AC 3JYCA 3STZC 3RVYA 4JTDB 2HFEC 2R9RB 3UM7A 4RAIA 4PDVA 3K08A 2WLIB 4MTOA 4R7CA 2EIKC 4PA3A 3X2QC 4P30A 4DXWA 2WLNA 2NLJC 2Q6AA 3ABKC 3IFXA
chains in the Genus database with same CATH superfamily
2HR3A 3N2GB 1SA0A 4JI2B 2ODMA 1ZLZA 4LF4O 1VQ8V 3T1YB 1NH2B 4FLYA 3ZMSA 2X6BA 4PELA 5EBLC 1XBLA 4U3JA 3THOA 4PA4A 1CXZB 2KG7A 2ZT9B 4MT8A 1VQ7V 5J2TA 1B6QA 2HEPA 1GRJA 1NTKH 4LFCB 4FMTA 1GH6A 1HR0B 1NZ6A 4F6RA 4YJ3B 4FZ0A 3OUFA 3CCJV 1FYJA 1Z5VA 4W4LA 1TVKB 2ZINA 5LYJA 5B66Z 1SQBH 1N34O 3FYIB 2VQEO 4HAMA 4GX1A 2UUAB 1ENVA 1FS0G 5LMUB 3OD4A 2X6CA 1XMOO 4Q6GA 5FL7G 2DW4A 3K06A 3DXRB 3U10A 2YDEA 4J7KA 1EN5A 2C2AA 3RBZA 1WAZA 1M90W 3FB7C 3K0GA 4CH6A 3LNMB 4LP8A 1URFA 1XMQB 4Z1MG 4DRXA 4JTCB 1AI5A 3APQA 4TV9A 3LSSA 3E22B 2IJKA 4I4TB 1R3KC 1XEQA 3LUTB 3TGUH 3JARA 3BEHA 3M99B 4HNAB 1EN4A 3DTUB 2PF4E 5LMNB 4PDLA 1K34A 2Z5UA 4O4LA 3CRCA 1VQ5V 1FXHA 4UB6Z 3UO3A 4DXWA 1QVFU 2Q6AA 3K5MA 3R65A 4QGPA 3G71V 3VQYA 3EFFK 4JZGA 1MSWD 4U3JB 3P30A 2DYSC 2JEXA 2O57A 2IM9A 5J2TB 4RUFA 1JR9A 4EFBA 2Y4UA 4LR3A 2ETNA 5H9CA 4X64B 2JJ2G 1TUEB 3P3NA 2A79B 4MTFA 3CCEV 4R8CA 4X89A 2UXBB 4F4LA 1SQVH 3N2KA 3RYHA 3OW2U 4NXNB 4ICGA 4IHJA 1ZSPA 1QVGU 1T5EA 4AHCA 4I0XA 3L70H 1BE3H 1AP6A 1VP7A 4O4IA 2Q7HA 3K5NA 2LJ2A 2UXDO 4QPJA 5E79Z 1FXKB 4MW3A 5CB4B 1NH2D 2D3OW 5JJNB 4YIOA 3HKDA 4TV9B 3NR7A 3FFQA 5C93A 3WB1A 4TV8A 1FXVA 1R1BA 1Q6HA 3JARB 2Q7EA 3WG7B 3PJSK 3IC9A 1WA8A 5LHHA 4I5SA 4BW5A 4CS3A 2JS3A 1F4NA 5L3GA 3A8TA 3I56V 1IXBA 2QSAA 2WA4A 1AR1B 4O4LB 1I0HA 4TT3G 1Y76A 1JJ2U 4QPKA 3K5LA 2W0XA 3JALA 2P5OA 3J80N 1FFXB 3MHHC 3EHBB 1OCOB 1M1KW 2YICA 4JAAA 2WLJA 3FAVB 5A9GA 2UUCB 2LFRA 3ZJZA 4WFHA 4TSFG 2OCHA 4QE9A 2QR4A 1OCRB 3N2KB 1IXMA 3CEIA 3K9SA 1Q6UA 4IHJB 1HNXB 4E2LA 2Q8VA 3D36A 4KHPB 1MSDA 4DV5O 4I0XB 3HB3B 1Y66A 2WLHA 2ARHA 2PYJA 4OGQB 5CBGA 1Q86W 2L35A 3A2FA 3CD6V 1FJGO 4O4IB 1KUQA 1VQ4V 3UT5B 1YJWV 2PZSA 4LNUA 1RPRA 2YI9A 4AILC 2AZ2A 4FK5C 5TISZ 5KHKA 4JI0O 2BOBC 5DECA 3DC5A 3HKDB 4K35A 2PYLA 3ZRSA 4B3MB 3H1KH 1SC5B 1F51A 1QLEC 2WWWA 4IGGA 4TV8B 2YXYA 4DV1O 2Q9LA 4DK1A 1QU7A 4DO2A 1WA8B 2RQ6A 3ZMUA 1SKVA 1GO3F 1IURA 4J42A 3S3WA 4X66O 3OMIB 4UUJC 1FXKC 1HNWO 3JSNA 1DK1A 2CK3G 5J9PC 2A9HA 3WFVA 4MVUA 3HKBA 1N33O 3B77A 4QNHB 2WLMA 3CYOA 3IC7A 3SYPA 3JALB 2A3QA 3WG7C 4GLXA 4OX9O 3B8NA 5EZYB 2JDIG 1VIBA 1IDSA 2IW5A 2K9PA 4O4HA 2BTOA 5H6QA 1NBMG 4JI3O 4G2KA 3CCRV 3RW0A 5EBWC 4FLWA 2UU9O 2ITDC 3WB2A 1G6UA 1H8HG 2GTSA 4I50A 2FL4A 1R6TA 4MTXA 4NB5A 4JYAB 3OMNB 4NYKA 4LNUB 2X0LA 1OCOC 2LFSA 3GWKC 4UCVA 4L87A 5DM6V 1M57B 1SETA 2PI5A 4LF5O 2UXXA 1P4RA 4X1YA 4UCSA 4CBCA 1OCRC 4K0KO 4FM2A 2EIJC 2KKWA 1J95A 2Q0AA 3E8HA 1OHHG 2EIMB 3J81N 3RFRA 3GVMA 2ZNJA 5LXTB 1N4CA 1RPOA 1F7YA 4H33A 1IZ3A 1ORQC 4LF7O 4O4JA 3F5TA 4BIUA 4UVBA 4UV8A 4DV2O 1KB9F 1XL4A 1N32B 2BE3A 1H2MA 3LSQA 4YY3B 4X1IA 3HKBB 1JJOA 3CRQA 5BMVB 1AJPA 4CZZA 3BY6A 3CP1A 3CC2V 5IYCO 1G8MA 3W7TA 3QTCA 1YF2A 2BSKB 3E89A 1WP7A 4W4KA 4DR6O 4ZHQA 3E83A 4WF9V 1KKCA 4O4HB 3FD9A 2XASA 2IJJA 2EILB 4MTOA 3ZRVA 2PGGA 2DOSA 3RYFA 4LFAB 1OV9A 2YIBA 1H38A 2L6LA 3L75H 1QCEA 3L74H 4MVRA 3E8BA 4I50B 5JVDA 5D5PA 1DF4A 2Q0OC 1NR7A 2P06A 1HW7A 4I9QA 1R3LC 3VOUA 4B3RB 4PD4F 5H6RA 3RWRD 3CCSV 3OUSA 3AG3B 4JI6B 1J5EB 5K1XA 4DV6O 4UV9A 4X1YB 2ATKC 2ZE5A 1SERA 1ZL8A 2F93B 1SZTA 1UFIA 2F66C 1JOYA 4YJ2B 2QA4V 2UXNA 3D36C 5D5QA 3CMEV 2YIAA 1K5SA 3D3QA 3CE2A 1DTOA 1SESA 1VEWA 2CGNA 5JQGA 5LHGA 4B08A 1W2BU 1PM9A 4O4JB 5LHIA 2ZCEA 4LF4B 3QO8A 1BMFG 1M57C 1AVMA 4DUYO 4EKWA 1SZXA 1R3IC 4UFZA 3ZHRA 1XHZA 4X1IB 4UXNA 5CA1A 4EB6A 5HFMA 2V4DA 2R72A 3OFNG 1KU9A 5A2QN 4ZHQB 4MVSA 5EIBD 3Q4HA 1N34B 1YJNV 2PUSA 2VQEB 4UCRA 4FLUA 1P49A 2JRIA 3OE7G 3O65A 1GMGA 3RYFB 2R9AA 2MW2B 1IBLO 3AG2B 4X65B 4JTDB 5JVDB 4AQYO 2GBOA 4PA3A 4LWSA 4NXMB 3QO5A 1VQ9V 1S0VA 1Z2GA 5LOVA 1XQ8A 5JCOA 4G27B 4RQEA 1K3EA 4B3SO 5B3SB 2EILC 1OZ0A 1SQQH 1ZL8B 3L9DA 2P67A 3F7YC 3K0DA 4KL1A 3RVZA 2EZOA 4F6EA 4RQFA 1S3JA 4FLVA 2JEUA 2D2CB 5JQGB 1GK9A 3T4ZA 2RMKB 3AK2A 3UKMA 5IWAO 3OAAG 3SPJA 3AG3C 1H2KA 3BFRA 1H2NA 3ZCCA 1JQ0A 3RYIB 4YHHO 5CA1B 4LC1A 3SYOA 3K5OA 1GTOA 1NS1A 4EB6B 1R73A 3OR6C 2K1EA 1W0JG 5CBHA 3ABMB 4DR5B 2CH7B 5LGUA 5IJ0B 2YEVB 5FNVA 4FM1A 4MSWC 1IBKO 3Q4HB 1MOFA 2FKXA 4JV5O 1HDJA 3AG4B 2EJ7A 4ZIBA 2Q69A 3F5WC 3VBBA 2HHHB 5B1OA 1CP9A 1Q43A 4ASUG 2UXDB 1TAEA 4FVMA 2N74A 5LP6A 3TK1A 4PA6A 4DV4O 1SQFA 4LWSB 5IYBO 4GZRB 1THZA 3CCLV 4K8ZA 1K73W 5LL6Y 1HNZO 3G67A 3G6EV 5IY5B 1NT2B 3X2QC 1EBOA 3OTOO 1M56B 1P84F 4TOIA 1QLNA 1R6KA 4C7UA 3UQ8A 5H5NA 1I08A 5GONA 2JVDA 2YS8A 4X1KA 3AG2C 4R50A 1VF6A 3W7XA 3JAWB 1Q81W 1GN4A 3CXCU 3ZBHA 4JF3A 4JI8O 1SA0B 4JI7O 1D2DA 2XAHA 1LUWA 1M93A 1JA8A 2WLLA 3OMAB 4DV7O 2YIBD 1N8RW 2DMXA 2HJFC 5B3SC 2KG7B 4DUZO 2F95B 5EC2C 2CAZC 4FM0A 1YITV 2RDCA 4MTGA 2KB1A 4JI2O 3H1LH 1ZWIC 4F6RB 3CPWU 4CH3A 1VQPV 2GDSA 2F4VB 2HG5C 1U97A 2Y69B 3WB0A 5LYJB 5FNVB 2HVKC 4FJCC 1BSMA 1QLEB 3KG2A 4XBFA 2YI8A 1ROPA 2KQXA 3NXSA 4PA9A 1K92A 4DV5B 3DGEA 1SQXH 1R6NA 3EXAA 1S77D 4XDJA 2LW7A 4LF9O 1FJGB 2QWPB 2OIEA 3K03A 4NKGB 2FB5A 4ZI7A 1D5AA 1MG1A 2QM4A 2E75B 5LP6B 1NJIW 2YIDA 1NKDA 4FFBA 2IH3C 4LCUC 2M6YA 4JI0B 4DRXB 3ABMC 2CDYA 3ABKB 2X7RB 1K7DA 2AHYA 1IBMB 1VF7A 3HPLC 1NVPD 4IIJA 4TQDA 2E76B 1SF9A 1TUBA 1GM9A 1XNQO 3AG4C 4DV1B 3STZC 3CWBH 1NI8A 1XMQO 2QGNA 1H8EG 1XDCA 5GONB 3ASOB 2ILMA 1XHXA 4UCUA 2QE7G 2XHBA 2W6IG 1JCHA 2CTPA 4WBNA 1Y74A 1QR8A 1HNWB 2P6JA 3OM3B 4J7ZA 4HBNA 2WLLB 3KCYA 5KHIA 5IY5C 1N33B 3JCZA 5JCOC 4ZBMA 1M56C 5CA0A 4OX9B 1AROP 3IAYA 3ASNB 1S5HC 3L73H 4JAVA 1JMKC 2QJ1A 3D8CA 2GHYA 4NTXA 2UUBO 1S5LZ 3QF7A 1E1RG 4GYCB 4LF6O 3MAQA 3RYHB 2EIJB 5KHJA 2DJVA 1BGYH 3ZHVA 3ZHSA 4B7KA 2X6AA 1O9HA 4X64O 4FPPA 3A0RA 3LDEA 2LO1A 1BS3A 1VMGA 4ZI7B 4KXRA 3ABTA 4OXSA 4FFBB 3ZRXA 3OGIB 2Y69C 4JPRA 3EVKA 2XAFA 4K0KB 1GN3A 4GT1A 2DN9A 5LGNA 1TUBB 3ML0A 5EYPA 2JK5C 2XAGA 2QTSA 5DN6G 4EEQA 5FLXN 2ZIOA 4H44B 4YIPA 3ZN1A 2OYQA 2DE0X 3JYCA 1MZEA 4LF7B 2ZM6O 4BR6A 1S76D 2ZE8A 1PV0A 5LP6C 3K08A 2N04A 4FLTA 2HP8A 4FLZA 4WBNB 4DV2B 1XI1A 1Y74B 3G6BA 1Y76B 3ABKC 2PI4A 4GKJO 4GKKO 1Q8IA 1RFYA 3SDLA 3T1HO 5GTHZ 3A0BZ 3K04A 4H37A 4TWKA 3K59A 1M5IA 3ZN0A 4CH4A 4TUYA 1YTFD 5CA0B 3K79A 2Q4PA 3S3XA 2N05A 3G80A 1ZUQA 4B3TO 1N36B 3ASOC 4DR6B 1EFRG 1YJ9V 1Q5OA 2Y4TA 2BTQA 1YCIA 1VF6C 1W59A 3T1CA 2NNUA 4BIOA 4PHZA 1AR5A 4MVQA 5KUMA 3IGAC 3T2MA 3OEHG 1OCCB 1FD9A 3LNNA 3ZMTA 1OCZB 1GN6A 5IJ9A 4Q20A 4JZ2A 2B1GA 2W0FC 1NU1H 4DYLA 3LDCA 3L71H 3SYQA 1GM8A 3ASNC 3B40A 2OIGA 4H13B 4ABMA 4KHPO 2MK3A 1XREA 3MHSC 4NR1A 1B06A 2UXCO 1YVWA 1XOUA 4DR2O 2LGWA 5EYPB 5KA6A 2OT5A 1AI4A 4QJFB 2IU0A 1FAFA 5BR8O 2VQFO 1XUQA 4GX0A 3CC4V 1UJWB 3CRRA 4U7OA 4DUYB 3FB6C 3U0ZA 1XL6A 4U3FH 4BW9A 5E1AC 2VWKA 1G1XB 1W0KG 1YEWA 4RWUA 3ICXA 2EBOA 3CJHA 2LQTA 1Q90D 3IFXA 2FMLA 1FFTB 5KLVH 4FFKA 5JH7A 2YUAA 4UB8Z 4LH7A 2ZR3A 3HR0A 1PL0A 3BRCA 4JGSA 2BTQB 4DR3O 2WPDG 1EN6A 2QM8A 1RM1B 1XNRB 4FIPC 4BWAA 5LA6A 3FKSG 3U11A 1WP8A 4P9PA 4DV3O 1IBLB 2Q7GA 4GX2A 3SYCA 1MNGA 4CH5A 4UVAA 4PA7A 5JJJB 3M7MX 1CPYA 1AJQA 1HWYA 1WN7A 1JVMA 4DR1O 2EULA 1PPJH 4A5UB 2YXHA 2XT9A 3K3WA 1ZX3A 3QNEA 4B3SB 1A32A 1I7FA 2WAMA 2XAQA 1RP3B 1WPBA 4MVOA 3SJAC 3HKCA 1OCCC 1Q3EA 1OCZC 1DLBA 1AI6A 2KSDA 1V9PA 3ZHQA 4U7NA 2HKOA 3B4SA 4UCTA 3VQVA 3E86A 2H94A 1RSOA 2AHZA 3B8MA 3SPGA 2JGDA 1VQNV 3CB2A 5IWAB 2A0LA 1IVSA 4JI5O 4JI4O 2P7TC 4WCEV 1KQSU 1K9MW 4D6TH 5EIBC 3ZX6A 1F4MA 1MA1A 1TA8A 3N2GA 3PN1A 2EJRA 3RGBA 4NTWA 2B5UA 1KECA 2HFEC 3RYCA 3UM7A 1D5NA 1X59A 1K33A 1N32O 2M7WA 2NLJC 4JAUA 4P9OA 1IBKB 2PY5A 5LGTA 1S5JA 5B1AB 3X2QB 4WFBV 4JV5B 4PI2A 1QQCA 4WFEA 1Z5WA 3DSQA 5KUKA 2E5LO 3LDDA 1XMOB 4D7SA 1I5YA 2P90A 4DR7O 1L0LH 1TVKA 1YZBA 1SQPH 4LH6A 3WU2Z 4DV4B 3CHXA 2QM7A 2Q67A 3ZHTA 3ETDA 2GUZA 1PNKA 1GKFA 1E1QG 1RM1C 4DR4O 1WB7A 1O9GA 3B2EE 3TJTA 2JJ1G 4JYYA 1YI2V 3J7AU 4K3AA 1L0NH 4DW1A 3CS5A 1H2GA 3JD2A 4JI8B 4JI7B 2FYUH 3ETGA 1S72V 1G4YB 2H3OA 2JGDB 3VQXA 3GB7C 2LW1A 2B1IA 5CN0A 3SPHA 2HVJC 4D7TA 4DV0O 2DWEC 4PDMA 1NVPB 3K57A 4DUZB 3CCUV 2DQ3A 5GTIZ 4NVPA 4LFBO 2BOCC 3BA9A 1BHAA 2CUGA 1PNLA 3RYCB 1WLEA 2PTMA 3JD1A 4JTAB 1KP2A 4XDLA 2CTQA 2ZIMA 4X8AA 3RVYA 1I94O 4JI1O 3ZHUA 2WLNA 3C3SA 2ZE6A 3OR7C 1K4CC 1US6A 1DGSA 2XAJA 2EINB 4LF9B 1FPOA 2E3CA 4PDRA 2LGQA 3SGIA 3K58A 2ZKOA 1BHBA 1Q7YW 3K9AA 4X62O 2XUMA 3H1HH 2VRZA 3R66A 5KHHA 5B1AC 5LOVB 2GUZB 3CCVV 1VQLV 1YDXA 4X65O 1XNQB 2JGUA 1PKXA 2GTAA 1ZAUA 1FXKA 2OWOA 4QE7A 5CB4A 5CMUA 5L3CA 5B5EZ 4NXMO 4B7EA 4FZ1A 1KBHA 1VQOV 5J2UA 2QEXV 1JX9A 5IDJA 5L3FA 4LF8O 3CXHF 1Y6XA 1PD3A 3TCUA 2QKSA 4E4EA 3QO7A 4HYOA 4J7JA 2R9IA 4WFGA 4JYBA 3BABA 3TETA 2ZXWB 5ITZA 3JASA 4G28B 4BAYA 3I5DA 1VQKV 1QHTA 1LNQA 4X20A 3AK1A 3MD0A 3T1YO 3CCMV 4I7ZB 1BCCH 1M4UA 3BHPA 4O2BA 3UCSC 2UUBB 1PNMA 5K1PA 4LF6B 2Y0PA 3W7SA 4MS2A 1QBZA 1LUVA 3MDSA 4LFCO 1FFXA 1SS3A 1HR0O 4MVMA 4X9QA 3OT7A 3FAVA 2OCCB 4DR5O 3FYEB 1N0JA 2ZR2A 1YSCA 1YTFB 2XOKG 4UVCA 1V54B 2AW9A 5KX5A 2F23A 2UUAO 1H2SB 5LMUO 3AG1B 2F43G 2JS5A 3T4DA 3ZRWA 1PL4A 1EZVH 2R70A 3BAAA 2HHHO 4MW8A 3UT5A 2XNDG 3AEIA 1WPXA 5BY1A 3E8FA 2EINC 4X1KB 3L72H 3VQWA 4X66B 2ZM6B 5J2UB 2YSUB 3RN4A 3QG5A 1K4DC 3F7VC 3OTFA 4GKJB 4GKKB 5H2FZ 3T1HB 3C90A 3SYAA 4AI8A 1KC8W 5LMNO 3H1JH 5GW7A 1MABG 2V1DA 1L8DA 1F23A 2GV9A 5ITZB 3JASB 5IE9A 3HKEA 3UO2A 4X20B 4B3TB 3FB8C 4L8JA 1BQZA 3APOA 1BQ0A 4ZKIA 4O2BB 5HFLA 1BL8A 2QWRB 1NTZH 3BCCH 4JI3B 1IX9A 5CA3A 5KMGA 3JCUZ 5F2VO 2UU9B 3KCXA 4Z2WA 5EZYA 1Y4MA 5L3BA 2FTKA 2VS0A 2F4VO 2ZXWC 2W6JG 4KUMA 4XDKA 2UXBO 1AP5A 4NXNO 3W7WA 4IYIA 4TQFA 5KX5B 3W7UA 2QWOB 2Y48A 4LF5B 4PDVA 2EZPA 3ZS8C 1AR4A 4IIJB 3ZRWB 4Z1VA 2UXCB 4JYCA 2G38A 2ITCC 4DR2B 2DYRB 5DEDA 3OGCC 4DK0A 5B1BB 5KAIZ 3JD0A 4PJ0Z 4J10A 2OTLV 5BR8B 4J11A 2VQFB 5FPRA 1YHQV 1E79G 2OCCC 3BA8A 3H1IH 5FPOA 4PI0A 1UPGA 1TGOA 4H0LB 1IBMO 4IYHA 1GM7A 4NTYA 1FKAO 3E35A 1V54C 1U96A 3CX5F 1WNSA 4EFEA 2RN9A 4KFMA 3ABUA 3P32A 3AG1C 3ETEA 1I5XA 3ABLB 3JD3A 2NN4A 5LXTA 3GWOA 2BCCH 2ZDIA 5B1NA 5L3EA 2RJZA 3CSXA 1KP3A 5LBQA 3TXQA 1VQMV 1V55B 4RUEA 4I9WA 3HKEB 1EM1A 4I55A 1NTMH 3LSUA 3JAMN 2QWQB 4DR3B 5BMVA 5IYZA 4HZ3A 2H8PC 2CE4A 5KMGB 2OTJV 2P22C 4DV3B 2BSKA 2CTWA 4BIZA 4CS4A 2F1MA 2QDOA 3DC6A 1L1FA 2UUCO 3TXSA 4DR1B 1HNXO 3RT3C 4DV6B 2IJHA 4OPHA 2Q68A 4WFFA 4ZOLA 1KMIZ 5IT9N 3QVNA 2V7QG 2R9RB 1NQTA 2WA3A 1QNMA 3JATA 4RAIA 1KYOF 2AXTZ 2WSSG 2EX3A 2WLIA 4P2ZA 4B3MO 3I55V 4IL6Z 1B04A 2HJDA 3ZMVA 5CBFA 2P4KA 4JI5B 4YJ2A 4JI4B 2NR5A 3IJ4A 2Z0AA 3SJCC 1AB3A 1R3JC 5EK0A 2CGOA 4N21A 3CMAV 3N27A 3E2EA 3E8GA 3SR2C 2DYRC 5EC1C 3SPIA 1WJZA 1M9NA 5B1BC 1H2LA 4TUYB 2QKAA 4GCZA 4JASA 3D3IA 2ZE7A 2ZD9A 4GUNA 1JFFA 4I55B 5JJEB 1LR1A 2ZQMA 3JD4A 2RCVA 1CEZA 5IYZB 2E5LB 4MVZA 1OJHA 3ZIAG 3O9OA 1COWG 3ABLC 3CRAA 2WLKA 4KP4A 1Q82W 5C8YA 3SJQC 2P4VA 3JAKA 1AJNA 3FX7A 4OPAA 5IJ9B 4DR7B 1N36O 2B9ZA 1KKDA 4AQYB 1V55C 1AILA 1EZJA 3CC7V 3SJBC 2CTRA 4ZOLB 3P3PA 1BZKA 1NR1A 1VF5B 2EIKB 2GSMB 3JSLA 4DR4B 1X4TA 4J9YB 2IU3A 3C3TA 1K8AW 5EBMC 5BXZA 4JYAO 4FLXA 4J41A 3BPZA 3H9VA 4RO2A 4R6ZA 4O2AA 2ZNIA 3JATB 5L3DA 1MZFA 2WLIB 2ADPA 4QIWF 3AK3A 4R7CA 4P30A 3AG7A 1SQGA 1QR9A 4N23A 1Y67A 5AG2A 3OEEG 4DV0B 1DF5A 2E74B 4YHHB 5IYDO 1ZTEA 3CJHB 4LFBB 3B09A 2ADQB 2IH1C 3H01A 5JH7B 1JFFB 4PV1B 2DWDC 5KA5A 3ZEDA 4LBEC 2A7WA 4YY3O 1YIJV 1I94B 3RYIA 2YXLA 4JI1B 2HLDG 1K5QA 2AZ0A 3M8AA 2EIMC 5LA6B 1WB8A 5JWPA 1VQ6V 1GAXA 4YJ3A 5C8YB 1HP8A 3CRMA 3JAKB 2ZDIC 2CH7A 5IJ0A 2YEVA 5KAFZ 2Z3YA 3KKYA 1KD1W 2QKCA 2LP7A 3FB5C 2QTOA 4GX5A 4K8XA 1XNRO 4J80A 1MMMA 4X62B 2IBZH 3DXRA 1HNZB 2VWJA 4LFAO 2AGAA 4J9ZB 4YXWG 2XTAA 1GN2A 2IJIA 3ETQA 1K97A 4X88A 4CS2A 4IT5A 3OTOB 3ZMZA 1AI7A 1BT8A 4CC5A 3HKCB 1JPXA 4CC6A 2YC0A 1Q6IA 2Q5ZA 1XILA 4WFAV 1P7GA 3A0HZ 4B3RO 4O2AB 2A06H 5BZBA 3E22A 4JI6O 1P7BA 1J5EO 3SPCA 2DQ0A 4LF8B 4I4TA 4UCOA 1RSOB 2DYSB 3STLC 3CCQV 1VARA 3BVOA 4HNAA 4DV7B 3G4SV 2JIZG 2Q73A 2QWNB 1N0NA 5KHGA 2Y0IA 3KZIZ 2EIKC 1SRYA 2RNBA 1PP9H 1B3QA 3JAWA 1YXBA 4DW0A
chains in the Genus database with same CATH topology
1QCEA 4MVRA 2HR3A 3E8BA 1DF4A 3K04A 4H37A 1NR7A 3AG1B 4TWKA 1VQ8V 2F43G 1NH2B 3ZMSA 3ZN0A 3T4DA 3ZRWA 2X6BA 4PELA 1R3LC 5EBLC 1YTFD 3VOUA 3K79A 5H6RA 3CCSV 4MW8A 4PA4A 4MT8A 3OUSA 3AG3B 2XNDG 1VQ7V 1B6QA 3AEIA 3ASOC 4UV9A 1WPXA 1EFRG 1YJ9V 2ATKC 4FMTA 1SERA 3E8FA 2EINC 3T1CA 1SZTA 1JOYA 2NNUA 2QA4V 2UXNA 3OUFA 3CCJV 4MVQA 5KUMA 3CMEV 3IGAC 2YSUB 1K5SA 3T2MA 3OEHG 1DTOA 1K4DC 1SESA 1OCCB 3ZMTA 1OCZB 3F7VC 4Q20A 3FYIB 5LHGA 2B1GA 4HAMA 4GX1A 1ENVA 1W2BU 3SYAA 5LHIA 1FS0G 3QO8A 2W0FC 1BMFG 2X6CA 1KC8W 3LDCA 5FL7G 2DW4A 1M57C 3K06A 3SYQA 5GW7A 1MABG 2V1DA 4EKWA 1GM8A 1F23A 3ASNC 2C2AA 1R3IC 3RBZA 1M90W 2MK3A 3FB7C 4UXNA 3MHSC 3K0GA 3LNMB 4LP8A 3FB8C 4Z1MG 4JTCB 5HFMA 1AI5A 4ZKIA 5HFLA 1BL8A 3LSSA 5KA6A 2OT5A 1AI4A 3OFNG 4QJFB 2IU0A 2IJKA 5CA3A 1R3KC 4MVSA 3LUTB 4GX0A 3CC4V 1YJNV 3BEHA 1UJWB 1Y4MA 3M99B 5L3BA 2FTKA 4U7OA 2ZXWC 2W6JG 3OE7G 3DTUB 4KUMA 4XDKA 1GMGA 3FB6C 4PDLA 3W7WA 1XL6A 5E1AC 3AG2B 1K34A 2Z5UA 4JTDB 3W7UA 1W0KG 2Y48A 1VQ5V 1FXHA 4PDVA 2EBOA 4PA3A 2EZPA 4DXWA 1QVFU 2Q6AA 3ZRWB 3IFXA 4JYCA 3R65A 2ITCC 2DYRB 3G71V 1FFTB 3OGCC 3QO5A 1VQ9V 1S0VA 3EFFK 1MSWD 5B1BB 3P30A 2DYSC 2JEXA 3JD0A 4RUFA 2ZR3A 2OTLV 4G27B 1PL0A 1K3EA 4JGSA 4RQEA 5B3SB 1YHQV 2EILC 1OZ0A 1E79G 2OCCC 5H9CA 2P67A 3F7YC 2WPDG 2JJ2G 3K0DA 1TUEB 2QM8A 3RVZA 1GM7A 2A79B 1RM1B 4MTFA 2EZOA 3E35A 4FIPC 4RQFA 3CCEV 1V54C 1S3JA 4R8CA 3FKSG 4X89A 4F4LA 4KFMA 3OW2U 4P9PA 2JEUA 3ABUA 3P32A 3AG1C 3ETEA 1I5XA 1GK9A 3ABLB 3JD3A 3T4ZA 3GWOA 1QVGU 4GX2A 3UKMA 3SYCA 2ZDIA 3OAAG 5B1NA 5L3EA 4UVAA 3SPJA 1KP3A 5LBQA 4PA7A 1VQMV 1CPYA 1AJQA 1HWYA 3AG3C 1JVMA 1V55B 4RUEA 4I9WA 3K3WA 3ZCCA 4QPJA 1JQ0A 3QNEA 1FXKB 4MW3A 4LC1A 3SYOA 1NH2D 2D3OW 2WAMA 1GTOA 2XAQA 1R73A 3OR6C 2K1EA 4MVOA 1W0JG 5CBHA 5C93A 1OCCC 4HZ3A 1OCZC 1DLBA 2H8PC 3ABMB 1AI6A 5LGUA 2YEVB 4U7NA 2HKOA 1FXVA 2OTJV 4MSWC 3E86A 1MOFA 2H94A 3WG7B 4BIZA 3PJSK 5LHHA 4I5SA 3AG4B 2AHZA 3B8MA 3SPGA 4BW5A 1VQNV 1F4NA 5L3GA 2A0LA 1L1FA 3I56V 2Q69A 3F5WC 2P7TC 3VBBA 5B1OA 4WCEV 1KQSU 1K9MW 1AR1B 1CP9A 4ASUG 1F4MA 4TT3G 2IJHA 2Q68A 4WFFA 3TK1A 4PA6A 1JJ2U 2EJRA 5IYBO 4QPKA 2V7QG 1THZA 2B5UA 1KECA 2HFEC 2R9RB 3UM7A 3CCLV 1K33A 1K73W 3G6EV 5IY5B 3X2QC 2M7WA 2NLJC 1NQTA 1EBOA 4RAIA 4JAUA 4P9OA 1M56B 3MHHC 5LGTA 3EHBB 5B1AB 2WSSG 3X2QB 4WFBV 4WFEA 1OCOB 2WLIA 1M1KW 4P2ZA 2WLJA 5KUKA 3I55V 1QLNA 1R6KA 3LDDA 3ZMVA 5CBFA 3AG2C 2LFRA 3ZJZA 4WFHA 4TSFG 4R50A 4QE9A 1I5YA 1OCRB 1IXMA 2P90A 3W7XA 3CXCU 1Q81W 1R3JC 5EK0A 4JF3A 4N21A 3CMAV 4E2LA 2XAHA 3D36A 3E2EA 3E8GA 2DYRC 5EC1C 3SPIA 3HB3B 1M9NA 1Y66A 5B1BC 2WLHA 2WLLA 3OMAB 5CBGA 1Q86W 4GCZA 3CD6V 4JASA 3D3IA 1N8RW 2HJFC 2QM7A 2Q67A 5B3SC 1VQ4V 3ETDA 1YJWV 5EC2C 1RPRA 1PNKA 2ZD9A 1YITV 4MTGA 4FK5C 1GKFA 1E1QG 2KB1A 1RM1C 2ZQMA 1ZWIC 2BOBC 3JD4A 3CPWU 1CEZA 1VQPV 3ZRSA 4MVZA 2HG5C 3ZIAG 1F51A 2Y69B 1COWG 1QLEC 3ABLC 2JJ1G 2WWWA 2WLKA 4KP4A 1Q82W 1YI2V 3SJQC 2HVKC 1AJNA 4FJCC 1H2GA 1QLEB 3KG2A 4XBFA 3JD2A 4DO2A 1KKDA 1ROPA 3ZMUA 3ETGA 3NXSA 4PA9A 1S72V 1G4YB 1K92A 1GO3F 1V55C 3DGEA 3GB7C 2B1IA 1R6NA 3OMIB 5CN0A 3SPHA 2HVJC 1S77D 4UUJC 4XDJA 2DWEC 1FXKC 1EZJA 4PDMA 3K03A 1NVPB 3CC7V 3CCUV 2DQ3A 1MG1A 2CK3G 1NJIW 1NKDA 5J9PC 1NR1A 2IH3C 2EIKB 4LCUC 2A9HA 2GSMB 3WFVA 2BOCC 3ABMC 4J9YB 4MVUA 2IU3A 1K8AW 3ABKB 3B77A 5EBMC 4QNHB 2X7RB 1BHAA 1K7DA 2AHYA 1PNLA 2WLMA 1WLEA 3HPLC 3CYOA 3IC7A 3SYPA 3JD1A 1NVPD 4JTAB 1KP2A 4RO2A 4XDLA 4R6ZA 3WG7C 3B8NA 1GM9A 4X8AA 5L3DA 3AG4C 3STZC 3RVYA 2JDIG 2WLIB 4QIWF 4R7CA 2IW5A 4P30A 1H8EG 2WLNA 1QR9A 4N23A 3ASOB 3OR7C 1K4CC 2QE7G 5H6QA 3OEEG 1NBMG 2W6IG 4G2KA 2XAJA 1JCHA 2EINB 3CCRV 1DF5A 3RW0A 5EBWC 1QR8A 2P6JA 2ITDC 4PDRA 5IYDO 3OM3B 1H8HG 2WLLB 5IY5C 3JCZA 1BHBA 2IH1C 1Q7YW 3K9AA 4ZBMA 4MTXA 3H01A 1M56C 3OMNB 2X0LA 5B1AC 1OCOC 2LFSA 3CCVV 1VQLV 2DWDC 4L87A 1AROP 5DM6V 5KA5A 1M57B 4LBEC 1SETA 1YIJV 2PI5A 2UXXA 1P4RA 1PKXA 3ASNB 1S5HC 1FXKA 2HLDG 4CBCA 4QE7A 5CMUA 5L3CA 4JAVA 1K5QA 1OCRC 2EIMC 1VQ6V 2EIJC 2GHYA 1J95A 3E8HA 1E1RG 1VQOV 1OHHG 2ZDIC 2EIMB 2EIJB 2QEXV 1JX9A 5IDJA 5L3FA 2YEVA 2Z3YA 1RPOA 1KD1W 2X6AA 4H33A 1PD3A 3TCUA 2QKSA 4FPPA 3QO7A 2LP7A 1ORQC 2QTOA 3FB5C 3A0RA 4HYOA 4GX5A 3LDEA 4BIUA 2R9IA 4WFGA 4JYBA 4UVBA 4UV8A 3TETA 1XL4A 2ZXWB 4J9ZB 4YXWG 3ABTA 2IJIA 4OXSA 1K97A 4G28B 4X88A 4BAYA 3ZRXA 3LSQA 1VQKV 1LNQA 3ZMZA 1AI7A 2Y69C 1AJPA 4JPRA 3MD0A 4CZZA 2PI4A 3CCMV 2XAFA 3BY6A 1JPXA 3CP1A 4GT1A 3CC2V 5LGNA 4WFAV 5IYCO 3ML0A 1G8MA 2JK5C 1PNMA 3W7TA 5BZBA 2XAGA 1P7BA 3SPCA 3W7SA 3E89A 2DQ0A 4MS2A 4UVCA 1QBZA 5DN6G 3E83A 2DYSB 3STLC 4WF9V 3CCQV 4MVMA 3ZN1A 3JYCA 2XASA 3G4SV 1S76D 2IJJA 2EILB 2JIZG 2OCCB 3K08A 4MTOA 3FYEB 3ZRVA 2EIKC 1SRYA 2ZR2A 1YSCA 1YTFB 2XOKG 1H38A 3ABKC 1V54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR7 C;  1K4C C;  3R65 A;  4MVR A;  4P9O A;  2ITC C;  3OGC C;  3E8B A;  3EFF K;  4WFE A;  2WLI A;  4P2Z A;  2DYS C;  3K04 A;  4H37 A;  2WLJ A;  4TWK A;  3RW0 A;  5KUK A;  3LDD A;  5EBW C;  4RUF A;  4G27 B;  2ITD C;  4PDR A;  3T4D A;  3AG2 C;  5CBF A;  2X6B A;  1R3L C;  5EBL C;  3ZJZ A;  4WFH A;  2EIL C;  4R50 A;  3VOU A;  2OCC C;  4QE9 A;  2WLL B;  3F7Y C;  1R3J C;  3K0D A;  4MW8 A;  4PA4 A;  5EK0 A;  3OUS A;  5IY5 C;  3RVZ A;  2A79 B;  2IH1 C;  4MTF A;  4ZBM A;  3ASO C;  1V54 C;  3E8G A;  1M56 C;  4R8C A;  2ATK C;  2DYR C;  4X89 A;  5EC1 C;  5B1A C;  3SPI A;  4F4L A;  3E8F A;  1OCO C;  2WLH A;  2WLL A;  4KFM A;  5B1B C;  2EIN C;  2DWD C;  4P9P A;  3T1C A;  5CBG A;  3AG1 C;  4LBE C;  3T4Z A;  3OUF A;  4MVQ A;  2HJF C;  5KUM A;  1S5H C;  2Q67 A;  3IGA C;  4GX2 A;  3SYC A;  3UKM A;  4CBC A;  4QE7 A;  5B3S C;  3T2M A;  5EC2 C;  2ZD9 A;  1K4D C;  1OCR C;  3SPJ A;  4MTG A;  4PA7 A;  2EIM C;  2EIJ C;  3F7V C;  2KB1 A;  3AG3 C;  1JVM A;  1J95 A;  3E8H A;  1ZWI C;  2BOB C;  4GX1 A;  3SYA A;  4RUE A;  4I9W A;  2YEV A;  2W0F C;  3ZRS A;  2X6C A;  4MVZ A;  3LDC A;  2HG5 C;  1M57 C;  4MW3 A;  3K06 A;  3SYQ A;  1QLE C;  2X6A A;  3ABL C;  3SYO A;  2WLK A;  4H33 A;  4EKW A;  3TCU A;  2QKS A;  3SJQ C;  2HVK C;  1ORQ C;  2QTO A;  3ASN C;  3FB5 C;  4HYO A;  3OR6 C;  1R3I C;  2K1E A;  4GX5 A;  3LDE A;  4MVO A;  3KG2 A;  3RBZ A;  4WFG A;  1OCC C;  5CBH A;  1KKD A;  4HZ3 A;  3FB7 C;  1OCZ C;  2H8P C;  3K0G A;  4PA9 A;  3LNM B;  1G4Y B;  4LP8 A;  3TET A;  1XL4 A;  3FB8 C;  1V55 C;  3GB7 C;  4J9Z B;  4JTC B;  4X88 A;  4OXS A;  4G28 B;  4MSW C;  3E86 A;  3SPH A;  2HVJ C;  1BL8 A;  4UUJ C;  2DWE C;  3PJS K;  4XDJ A;  1LNQ A;  2Y69 C;  4PDM A;  3K03 A;  2AHZ A;  3SPG A;  4BW5 A;  2A0L A;  1R3K C;  4MVS A;  3LUT B;  5J9P C;  2Q69 A;  2IH3 C;  2P7T C;  3F5W C;  4GX0 A;  2A9H A;  4LCU C;  2BOC C;  3ABM C;  2JK5 C;  4J9Y B;  4MVU A;  3BEH A;  5BZB A;  5EBM C;  1P7B A;  4QNH B;  3SPC A;  2AHY A;  3E89 A;  2WLM A;  2ZXW C;  4MS2 A;  3HPL C;  3SYP A;  4XDK A;  3E83 A;  2Q68 A;  4JTA B;  4WFF A;  4RO2 A;  4XDL A;  3STL C;  4PA6 A;  4R6Z A;  3WG7 C;  4MVM A;  3FB6 C;  4PDL A;  4X8A A;  1XL6 A;  3AG4 C;  5E1A C;  3JYC A;  3STZ C;  3RVY A;  4JTD B;  2HFE C;  2R9R B;  3UM7 A;  4RAI A;  4PDV A;  3K08 A;  2WLI B;  4MTO A;  4R7C A;  2EIK C;  4PA3 A;  3X2Q C;  4P30 A;  4DXW A;  2WLN A;  2NLJ C;  2Q6A A;  3ABK C;  3IFX A; 
#chains in the Genus database with same CATH topology
 2HR3 A;  3N2G B;  1SA0 A;  4JI2 B;  2ODM A;  1ZLZ A;  4LF4 O;  1VQ8 V;  3T1Y B;  1NH2 B;  4FLY A;  3ZMS A;  2X6B A;  4PEL A;  5EBL C;  1XBL A;  4U3J A;  3THO A;  4PA4 A;  1CXZ B;  2KG7 A;  2ZT9 B;  4MT8 A;  1VQ7 V;  5J2T A;  1B6Q A;  2HEP A;  1GRJ A;  1NTK H;  4LFC B;  4FMT A;  1GH6 A;  1HR0 B;  1NZ6 A;  4F6R A;  4YJ3 B;  4FZ0 A;  3OUF A;  3CCJ V;  1FYJ A;  1Z5V A;  4W4L A;  1TVK B;  2ZIN A;  5LYJ A;  5B66 Z;  1SQB H;  1N34 O;  3FYI B;  2VQE O;  4HAM A;  4GX1 A;  2UUA B;  1ENV A;  1FS0 G;  5LMU B;  3OD4 A;  2X6C A;  1XMO O;  4Q6G A;  5FL7 G;  2DW4 A;  3K06 A;  3DXR B;  3U10 A;  2YDE A;  4J7K A;  1EN5 A;  2C2A A;  3RBZ A;  1WAZ A;  1M90 W;  3FB7 C;  3K0G A;  4CH6 A;  3LNM B;  4LP8 A;  1URF A;  1XMQ B;  4Z1M G;  4DRX A;  4JTC B;  1AI5 A;  3APQ A;  4TV9 A;  3LSS A;  3E22 B;  2IJK A;  4I4T B;  1R3K C;  1XEQ A;  3LUT B;  3TGU H;  3JAR A;  3BEH A;  3M99 B;  4HNA B;  1EN4 A;  3DTU B;  2PF4 E;  5LMN B;  4PDL A;  1K34 A;  2Z5U A;  4O4L A;  3CRC A;  1VQ5 V;  1FXH A;  4UB6 Z;  3UO3 A;  4DXW A;  1QVF U;  2Q6A A;  3K5M A;  3R65 A;  4QGP A;  3G71 V;  3VQY A;  3EFF K;  4JZG A;  1MSW D;  4U3J B;  3P30 A;  2DYS C;  2JEX A;  2O57 A;  2IM9 A;  5J2T B;  4RUF A;  1JR9 A;  4EFB A;  2Y4U A;  4LR3 A;  2ETN A;  5H9C A;  4X64 B;  2JJ2 G;  1TUE B;  3P3N A;  2A79 B;  4MTF A;  3CCE V;  4R8C A;  4X89 A;  2UXB B;  4F4L A;  1SQV H;  3N2K A;  3RYH A;  3OW2 U;  4NXN B;  4ICG A;  4IHJ A;  1ZSP A;  1QVG U;  1T5E A;  4AHC A;  4I0X A;  3L70 H;  1BE3 H;  1AP6 A;  1VP7 A;  4O4I A;  2Q7H A;  3K5N A;  2LJ2 A;  2UXD O;  4QPJ A;  5E79 Z;  1FXK B;  4MW3 A;  5CB4 B;  1NH2 D;  2D3O W;  5JJN B;  4YIO A;  3HKD A;  4TV9 B;  3NR7 A;  3FFQ A;  5C93 A;  3WB1 A;  4TV8 A;  1FXV A;  1R1B A;  1Q6H A;  3JAR B;  2Q7E A;  3WG7 B;  3PJS K;  3IC9 A;  1WA8 A;  5LHH A;  4I5S A;  4BW5 A;  4CS3 A;  2JS3 A;  1F4N A;  5L3G A;  3A8T A;  3I56 V;  1IXB A;  2QSA A;  2WA4 A;  1AR1 B;  4O4L B;  1I0H A;  4TT3 G;  1Y76 A;  1JJ2 U;  4QPK A;  3K5L A;  2W0X A;  3JAL A;  2P5O A;  3J80 N;  1FFX B;  3MHH C;  3EHB B;  1OCO B;  1M1K W;  2YIC A;  4JAA A;  2WLJ A;  3FAV B;  5A9G A;  2UUC B;  2LFR A;  3ZJZ A;  4WFH A;  4TSF G;  2OCH A;  4QE9 A;  2QR4 A;  1OCR B;  3N2K B;  1IXM A;  3CEI A;  3K9S A;  1Q6U A;  4IHJ B;  1HNX B;  4E2L A;  2Q8V A;  3D36 A;  4KHP B;  1MSD A;  4DV5 O;  4I0X B;  3HB3 B;  1Y66 A;  2WLH A;  2ARH A;  2PYJ A;  4OGQ B;  5CBG A;  1Q86 W;  2L35 A;  3A2F A;  3CD6 V;  1FJG O;  4O4I B;  1KUQ A;  1VQ4 V;  3UT5 B;  1YJW V;  2PZS A;  4LNU A;  1RPR A;  2YI9 A;  4AIL C;  2AZ2 A;  4FK5 C;  5TIS Z;  5KHK A;  4JI0 O;  2BOB C;  5DEC A;  3DC5 A;  3HKD B;  4K35 A;  2PYL A;  3ZRS A;  4B3M B;  3H1K H;  1SC5 B;  1F51 A;  1QLE C;  2WWW A;  4IGG A;  4TV8 B;  2YXY A;  4DV1 O;  2Q9L A;  4DK1 A;  1QU7 A;  4DO2 A;  1WA8 B;  2RQ6 A;  3ZMU A;  1SKV A;  1GO3 F;  1IUR A;  4J42 A;  3S3W A;  4X66 O;  3OMI B;  4UUJ C;  1FXK C;  1HNW O;  3JSN A;  1DK1 A;  2CK3 G;  5J9P C;  2A9H A;  3WFV A;  4MVU A;  3HKB A;  1N33 O;  3B77 A;  4QNH B;  2WLM A;  3CYO A;  3IC7 A;  3SYP A;  3JAL B;  2A3Q A;  3WG7 C;  4GLX A;  4OX9 O;  3B8N A;  5EZY B;  2JDI G;  1VIB A;  1IDS A;  2IW5 A;  2K9P A;  4O4H A;  2BTO A;  5H6Q A;  1NBM G;  4JI3 O;  4G2K A;  3CCR V;  3RW0 A;  5EBW C;  4FLW A;  2UU9 O;  2ITD C;  3WB2 A;  1G6U A;  1H8H G;  2GTS A;  4I50 A;  2FL4 A;  1R6T A;  4MTX A;  4NB5 A;  4JYA B;  3OMN B;  4NYK A;  4LNU B;  2X0L A;  1OCO C;  2LFS A;  3GWK C;  4UCV A;  4L87 A;  5DM6 V;  1M57 B;  1SET A;  2PI5 A;  4LF5 O;  2UXX A;  1P4R A;  4X1Y A;  4UCS A;  4CBC A;  1OCR C;  4K0K O;  4FM2 A;  2EIJ C;  2KKW A;  1J95 A;  2Q0A A;  3E8H A;  1OHH G;  2EIM B;  3J81 N;  3RFR A;  3GVM A;  2ZNJ A;  5LXT B;  1N4C A;  1RPO A;  1F7Y A;  4H33 A;  1IZ3 A;  1ORQ C;  4LF7 O;  4O4J A;  3F5T A;  4BIU A;  4UVB A;  4UV8 A;  4DV2 O;  1KB9 F;  1XL4 A;  1N32 B;  2BE3 A;  1H2M A;  3LSQ A;  4YY3 B;  4X1I A;  3HKB B;  1JJO A;  3CRQ A;  5BMV B;  1AJP A;  4CZZ A;  3BY6 A;  3CP1 A;  3CC2 V;  5IYC O;  1G8M A;  3W7T A;  3QTC A;  1YF2 A;  2BSK B;  3E89 A;  1WP7 A;  4W4K A;  4DR6 O;  4ZHQ A;  3E83 A;  4WF9 V;  1KKC A;  4O4H B;  3FD9 A;  2XAS A;  2IJJ A;  2EIL B;  4MTO A;  3ZRV A;  2PGG A;  2DOS A;  3RYF A;  4LFA B;  1OV9 A;  2YIB A;  1H38 A;  2L6L A;  3L75 H;  1QCE A;  3L74 H;  4MVR A;  3E8B A;  4I50 B;  5JVD A;  5D5P A;  1DF4 A;  2Q0O C;  1NR7 A;  2P06 A;  1HW7 A;  4I9Q A;  1R3L C;  3VOU A;  4B3R B;  4PD4 F;  5H6R A;  3RWR D;  3CCS V;  3OUS A;  3AG3 B;  4JI6 B;  1J5E B;  5K1X A;  4DV6 O;  4UV9 A;  4X1Y B;  2ATK C;  2ZE5 A;  1SER A;  1ZL8 A;  2F93 B;  1SZT A;  1UFI A;  2F66 C;  1JOY A;  4YJ2 B;  2QA4 V;  2UXN A;  3D36 C;  5D5Q A;  3CME V;  2YIA A;  1K5S A;  3D3Q A;  3CE2 A;  1DTO A;  1SES A;  1VEW A;  2CGN A;  5JQG A;  5LHG A;  4B08 A;  1W2B U;  1PM9 A;  4O4J B;  5LHI A;  2ZCE A;  4LF4 B;  3QO8 A;  1BMF G;  1M57 C;  1AVM A;  4DUY O;  4EKW A;  1SZX A;  1R3I C;  4UFZ A;  3ZHR A;  1XHZ A;  4X1I B;  4UXN A;  5CA1 A;  4EB6 A;  5HFM A;  2V4D A;  2R72 A;  3OFN G;  1KU9 A;  5A2Q N;  4ZHQ B;  4MVS A;  5EIB D;  3Q4H A;  1N34 B;  1YJN V;  2PUS A;  2VQE B;  4UCR A;  4FLU A;  1P49 A;  2JRI A;  3OE7 G;  3O65 A;  1GMG A;  3RYF B;  2R9A A;  2MW2 B;  1IBL O;  3AG2 B;  4X65 B;  4JTD B;  5JVD B;  4AQY O;  2GBO A;  4PA3 A;  4LWS A;  4NXM B;  3QO5 A;  1VQ9 V;  1S0V A;  1Z2G A;  5LOV A;  1XQ8 A;  5JCO A;  4G27 B;  4RQE A;  1K3E A;  4B3S O;  5B3S B;  2EIL C;  1OZ0 A;  1SQQ H;  1ZL8 B;  3L9D A;  2P67 A;  3F7Y C;  3K0D A;  4KL1 A;  3RVZ A;  2EZO A;  4F6E A;  4RQF A;  1S3J A;  4FLV A;  2JEU A;  2D2C B;  5JQG B;  1GK9 A;  3T4Z A;  2RMK B;  3AK2 A;  3UKM A;  5IWA O;  3OAA G;  3SPJ A;  3AG3 C;  1H2K A;  3BFR A;  1H2N A;  3ZCC A;  1JQ0 A;  3RYI B;  4YHH O;  5CA1 B;  4LC1 A;  3SYO A;  3K5O A;  1GTO A;  1NS1 A;  4EB6 B;  1R73 A;  3OR6 C;  2K1E A;  1W0J G;  5CBH A;  3ABM B;  4DR5 B;  2CH7 B;  5LGU A;  5IJ0 B;  2YEV B;  5FNV A;  4FM1 A;  4MSW C;  1IBK O;  3Q4H B;  1MOF A;  2FKX A;  4JV5 O;  1HDJ A;  3AG4 B;  2EJ7 A;  4ZIB A;  2Q69 A;  3F5W C;  3VBB A;  2HHH B;  5B1O A;  1CP9 A;  1Q43 A;  4ASU G;  2UXD B;  1TAE A;  4FVM A;  2N74 A;  5LP6 A;  3TK1 A;  4PA6 A;  4DV4 O;  1SQF A;  4LWS B;  5IYB O;  4GZR B;  1THZ A;  3CCL V;  4K8Z A;  1K73 W;  5LL6 Y;  1HNZ O;  3G67 A;  3G6E V;  5IY5 B;  1NT2 B;  3X2Q C;  1EBO A;  3OTO O;  1M56 B;  1P84 F;  4TOI A;  1QLN A;  1R6K A;  4C7U A;  3UQ8 A;  5H5N A;  1I08 A;  5GON A;  2JVD A;  2YS8 A;  4X1K A;  3AG2 C;  4R50 A;  1VF6 A;  3W7X A;  3JAW B;  1Q81 W;  1GN4 A;  3CXC U;  3ZBH A;  4JF3 A;  4JI8 O;  1SA0 B;  4JI7 O;  1D2D A;  2XAH A;  1LUW A;  1M93 A;  1JA8 A;  2WLL A;  3OMA B;  4DV7 O;  2YIB D;  1N8R W;  2DMX A;  2HJF C;  5B3S C;  2KG7 B;  4DUZ O;  2F95 B;  5EC2 C;  2CAZ C;  4FM0 A;  1YIT V;  2RDC A;  4MTG A;  2KB1 A;  4JI2 O;  3H1L H;  1ZWI C;  4F6R B;  3CPW U;  4CH3 A;  1VQP V;  2GDS A;  2F4V B;  2HG5 C;  1U97 A;  2Y69 B;  3WB0 A;  5LYJ B;  5FNV B;  2HVK C;  4FJC C;  1BSM A;  1QLE B;  3KG2 A;  4XBF A;  2YI8 A;  1ROP A;  2KQX A;  3NXS A;  4PA9 A;  1K92 A;  4DV5 B;  3DGE A;  1SQX H;  1R6N A;  3EXA A;  1S77 D;  4XDJ A;  2LW7 A;  4LF9 O;  1FJG B;  2QWP B;  2OIE A;  3K03 A;  4NKG B;  2FB5 A;  4ZI7 A;  1D5A A;  1MG1 A;  2QM4 A;  2E75 B;  5LP6 B;  1NJI W;  2YID A;  1NKD A;  4FFB A;  2IH3 C;  4LCU C;  2M6Y A;  4JI0 B;  4DRX B;  3ABM C;  2CDY A;  3ABK B;  2X7R B;  1K7D A;  2AHY A;  1IBM B;  1VF7 A;  3HPL C;  1NVP D;  4IIJ A;  4TQD A;  2E76 B;  1SF9 A;  1TUB A;  1GM9 A;  1XNQ O;  3AG4 C;  4DV1 B;  3STZ C;  3CWB H;  1NI8 A;  1XMQ O;  2QGN A;  1H8E G;  1XDC A;  5GON B;  3ASO B;  2ILM A;  1XHX A;  4UCU A;  2QE7 G;  2XHB A;  2W6I G;  1JCH A;  2CTP A;  4WBN A;  1Y74 A;  1QR8 A;  1HNW B;  2P6J A;  3OM3 B;  4J7Z A;  4HBN A;  2WLL B;  3KCY A;  5KHI A;  5IY5 C;  1N33 B;  3JCZ A;  5JCO C;  4ZBM A;  1M56 C;  5CA0 A;  4OX9 B;  1ARO P;  3IAY A;  3ASN B;  1S5H C;  3L73 H;  4JAV A;  1JMK C;  2QJ1 A;  3D8C A;  2GHY A;  4NTX A;  2UUB O;  1S5L Z;  3QF7 A;  1E1R G;  4GYC B;  4LF6 O;  3MAQ A;  3RYH B;  2EIJ B;  5KHJ A;  2DJV A;  1BGY H;  3ZHV A;  3ZHS A;  4B7K A;  2X6A A;  1O9H A;  4X64 O;  4FPP A;  3A0R A;  3LDE A;  2LO1 A;  1BS3 A;  1VMG A;  4ZI7 B;  4KXR A;  3ABT A;  4OXS A;  4FFB B;  3ZRX A;  3OGI B;  2Y69 C;  4JPR A;  3EVK A;  2XAF A;  4K0K B;  1GN3 A;  4GT1 A;  2DN9 A;  5LGN A;  1TUB B;  3ML0 A;  5EYP A;  2JK5 C;  2XAG A;  2QTS A;  5DN6 G;  4EEQ A;  5FLX N;  2ZIO A;  4H44 B;  4YIP A;  3ZN1 A;  2OYQ A;  2DE0 X;  3JYC A;  1MZE A;  4LF7 B;  2ZM6 O;  4BR6 A;  1S76 D;  2ZE8 A;  1PV0 A;  5LP6 C;  3K08 A;  2N04 A;  4FLT A;  2HP8 A;  4FLZ A;  4WBN B;  4DV2 B;  1XI1 A;  1Y74 B;  3G6B A;  1Y76 B;  3ABK C;  2PI4 A;  4GKJ O;  4GKK O;  1Q8I A;  1RFY A;  3SDL A;  3T1H O;  5GTH Z;  3A0B Z;  3K04 A;  4H37 A;  4TWK A;  3K59 A;  1M5I A;  3ZN0 A;  4CH4 A;  4TUY A;  1YTF D;  5CA0 B;  3K79 A;  2Q4P A;  3S3X A;  2N05 A;  3G80 A;  1ZUQ A;  4B3T O;  1N36 B;  3ASO C;  4DR6 B;  1EFR G;  1YJ9 V;  1Q5O A;  2Y4T A;  2BTQ A;  1YCI A;  1VF6 C;  1W59 A;  3T1C A;  2NNU A;  4BIO A;  4PHZ A;  1AR5 A;  4MVQ A;  5KUM A;  3IGA C;  3T2M A;  3OEH G;  1OCC B;  1FD9 A;  3LNN A;  3ZMT A;  1OCZ B;  1GN6 A;  5IJ9 A;  4Q20 A;  4JZ2 A;  2B1G A;  2W0F C;  1NU1 H;  4DYL A;  3LDC A;  3L71 H;  3SYQ A;  1GM8 A;  3ASN C;  3B40 A;  2OIG A;  4H13 B;  4ABM A;  4KHP O;  2MK3 A;  1XRE A;  3MHS C;  4NR1 A;  1B06 A;  2UXC O;  1YVW A;  1XOU A;  4DR2 O;  2LGW A;  5EYP B;  5KA6 A;  2OT5 A;  1AI4 A;  4QJF B;  2IU0 A;  1FAF A;  5BR8 O;  2VQF O;  1XUQ A;  4GX0 A;  3CC4 V;  1UJW B;  3CRR A;  4U7O A;  4DUY B;  3FB6 C;  3U0Z A;  1XL6 A;  4U3F H;  4BW9 A;  5E1A C;  2VWK A;  1G1X B;  1W0K G;  1YEW A;  4RWU A;  3ICX A;  2EBO A;  3CJH A;  2LQT A;  1Q90 D;  3IFX A;  2FML A;  1FFT B;  5KLV H;  4FFK A;  5JH7 A;  2YUA A;  4UB8 Z;  4LH7 A;  2ZR3 A;  3HR0 A;  1PL0 A;  3BRC A;  4JGS A;  2BTQ B;  4DR3 O;  2WPD G;  1EN6 A;  2QM8 A;  1RM1 B;  1XNR B;  4FIP C;  4BWA A;  5LA6 A;  3FKS G;  3U11 A;  1WP8 A;  4P9P A;  4DV3 O;  1IBL B;  2Q7G A;  4GX2 A;  3SYC A;  1MNG A;  4CH5 A;  4UVA A;  4PA7 A;  5JJJ B;  3M7M X;  1CPY A;  1AJQ A;  1HWY A;  1WN7 A;  1JVM A;  4DR1 O;  2EUL A;  1PPJ H;  4A5U B;  2YXH A;  2XT9 A;  3K3W A;  1ZX3 A;  3QNE A;  4B3S B;  1A32 A;  1I7F A;  2WAM A;  2XAQ A;  1RP3 B;  1WPB A;  4MVO A;  3SJA C;  3HKC A;  1OCC C;  1Q3E A;  1OCZ C;  1DLB A;  1AI6 A;  2KSD A;  1V9P A;  3ZHQ A;  4U7N A;  2HKO A;  3B4S A;  4UCT A;  3VQV A;  3E86 A;  2H94 A;  1RSO A;  2AHZ A;  3B8M A;  3SPG A;  2JGD A;  1VQN V;  3CB2 A;  5IWA B;  2A0L A;  1IVS A;  4JI5 O;  4JI4 O;  2P7T C;  4WCE V;  1KQS U;  1K9M W;  4D6T H;  5EIB C;  3ZX6 A;  1F4M A;  1MA1 A;  1TA8 A;  3N2G A;  3PN1 A;  2EJR A;  3RGB A;  4NTW A;  2B5U A;  1KEC A;  2HFE C;  3RYC A;  3UM7 A;  1D5N A;  1X59 A;  1K33 A;  1N32 O;  2M7W A;  2NLJ C;  4JAU A;  4P9O A;  1IBK B;  2PY5 A;  5LGT A;  1S5J A;  5B1A B;  3X2Q B;  4WFB V;  4JV5 B;  4PI2 A;  1QQC A;  4WFE A;  1Z5W A;  3DSQ A;  5KUK A;  2E5L O;  3LDD A;  1XMO B;  4D7S A;  1I5Y A;  2P90 A;  4DR7 O;  1L0L H;  1TVK A;  1YZB A;  1SQP H;  4LH6 A;  3WU2 Z;  4DV4 B;  3CHX A;  2QM7 A;  2Q67 A;  3ZHT A;  3ETD A;  2GUZ A;  1PNK A;  1GKF A;  1E1Q G;  1RM1 C;  4DR4 O;  1WB7 A;  1O9G A;  3B2E E;  3TJT A;  2JJ1 G;  4JYY A;  1YI2 V;  3J7A U;  4K3A A;  1L0N H;  4DW1 A;  3CS5 A;  1H2G A;  3JD2 A;  4JI8 B;  4JI7 B;  2FYU H;  3ETG A;  1S72 V;  1G4Y B;  2H3O A;  2JGD B;  3VQX A;  3GB7 C;  2LW1 A;  2B1I A;  5CN0 A;  3SPH A;  2HVJ C;  4D7T A;  4DV0 O;  2DWE C;  4PDM A;  1NVP B;  3K57 A;  4DUZ B;  3CCU V;  2DQ3 A;  5GTI Z;  4NVP A;  4LFB O;  2BOC C;  3BA9 A;  1BHA A;  2CUG A;  1PNL A;  3RYC B;  1WLE A;  2PTM A;  3JD1 A;  4JTA B;  1KP2 A;  4XDL A;  2CTQ A;  2ZIM A;  4X8A A;  3RVY A;  1I94 O;  4JI1 O;  3ZHU A;  2WLN A;  3C3S A;  2ZE6 A;  3OR7 C;  1K4C C;  1US6 A;  1DGS A;  2XAJ A;  2EIN B;  4LF9 B;  1FPO A;  2E3C A;  4PDR A;  2LGQ A;  3SGI A;  3K58 A;  2ZKO A;  1BHB A;  1Q7Y W;  3K9A A;  4X62 O;  2XUM A;  3H1H H;  2VRZ A;  3R66 A;  5KHH A;  5B1A C;  5LOV B;  2GUZ B;  3CCV V;  1VQL V;  1YDX A;  4X65 O;  1XNQ B;  2JGU A;  1PKX A;  2GTA A;  1ZAU A;  1FXK A;  2OWO A;  4QE7 A;  5CB4 A;  5CMU A;  5L3C A;  5B5E Z;  4NXM O;  4B7E A;  4FZ1 A;  1KBH A;  1VQO V;  5J2U A;  2QEX V;  1JX9 A;  5IDJ A;  5L3F A;  4LF8 O;  3CXH F;  1Y6X A;  1PD3 A;  3TCU A;  2QKS A;  4E4E A;  3QO7 A;  4HYO A;  4J7J A;  2R9I A;  4WFG A;  4JYB A;  3BAB A;  3TET A;  2ZXW B;  5ITZ A;  3JAS A;  4G28 B;  4BAY A;  3I5D A;  1VQK V;  1QHT A;  1LNQ A;  4X20 A;  3AK1 A;  3MD0 A;  3T1Y O;  3CCM V;  4I7Z B;  1BCC H;  1M4U A;  3BHP A;  4O2B A;  3UCS C;  2UUB B;  1PNM A;  5K1P A;  4LF6 B;  2Y0P A;  3W7S A;  4MS2 A;  1QBZ A;  1LUV A;  3MDS A;  4LFC O;  1FFX A;  1SS3 A;  1HR0 O;  4MVM A;  4X9Q A;  3OT7 A;  3FAV A;  2OCC B;  4DR5 O;  3FYE B;  1N0J A;  2ZR2 A;  1YSC A;  1YTF B;  2XOK G;  4UVC A;  1V54 B;  2AW9 A;  5KX5 A;  2F23 A;  2UUA O;  1H2S B;  5LMU O;  3AG1 B;  2F43 G;  2JS5 A;  3T4D A;  3ZRW A;  1PL4 A;  1EZV H;  2R70 A;  3BAA A;  2HHH O;  4MW8 A;  3UT5 A;  2XND G;  3AEI A;  1WPX A;  5BY1 A;  3E8F A;  2EIN C;  4X1K B;  3L72 H;  3VQW A;  4X66 B;  2ZM6 B;  5J2U B;  2YSU B;  3RN4 A;  3QG5 A;  1K4D C;  3F7V C;  3OTF A;  4GKJ B;  4GKK B;  5H2F Z;  3T1H B;  3C90 A;  3SYA A;  4AI8 A;  1KC8 W;  5LMN O;  3H1J H;  5GW7 A;  1MAB G;  2V1D A;  1L8D A;  1F23 A;  2GV9 A;  5ITZ B;  3JAS B;  5IE9 A;  3HKE A;  3UO2 A;  4X20 B;  4B3T B;  3FB8 C;  4L8J A;  1BQZ A;  3APO A;  1BQ0 A;  4ZKI A;  4O2B B;  5HFL A;  1BL8 A;  2QWR B;  1NTZ H;  3BCC H;  4JI3 B;  1IX9 A;  5CA3 A;  5KMG A;  3JCU Z;  5F2V O;  2UU9 B;  3KCX A;  4Z2W A;  5EZY A;  1Y4M A;  5L3B A;  2FTK A;  2VS0 A;  2F4V O;  2ZXW C;  2W6J G;  4KUM A;  4XDK A;  2UXB O;  1AP5 A;  4NXN O;  3W7W A;  4IYI A;  4TQF A;  5KX5 B;  3W7U A;  2QWO B;  2Y48 A;  4LF5 B;  4PDV A;  2EZP A;  3ZS8 C;  1AR4 A;  4IIJ B;  3ZRW B;  4Z1V A;  2UXC B;  4JYC A;  2G38 A;  2ITC C;  4DR2 B;  2DYR B;  5DED A;  3OGC C;  4DK0 A;  5B1B B;  5KAI Z;  3JD0 A;  4PJ0 Z;  4J10 A;  2OTL V;  5BR8 B;  4J11 A;  2VQF B;  5FPR A;  1YHQ V;  1E79 G;  2OCC C;  3BA8 A;  3H1I H;  5FPO A;  4PI0 A;  1UPG A;  1TGO A;  4H0L B;  1IBM O;  4IYH A;  1GM7 A;  4NTY A;  1FKA O;  3E35 A;  1V54 C;  1U96 A;  3CX5 F;  1WNS A;  4EFE A;  2RN9 A;  4KFM A;  3ABU A;  3P32 A;  3AG1 C;  3ETE A;  1I5X A;  3ABL B;  3JD3 A;  2NN4 A;  5LXT A;  3GWO A;  2BCC H;  2ZDI A;  5B1N A;  5L3E A;  2RJZ A;  3CSX A;  1KP3 A;  5LBQ A;  3TXQ A;  1VQM V;  1V55 B;  4RUE A;  4I9W A;  3HKE B;  1EM1 A;  4I55 A;  1NTM H;  3LSU A;  3JAM N;  2QWQ B;  4DR3 B;  5BMV A;  5IYZ A;  4HZ3 A;  2H8P C;  2CE4 A;  5KMG B;  2OTJ V;  2P22 C;  4DV3 B;  2BSK A;  2CTW A;  4BIZ A;  4CS4 A;  2F1M A;  2QDO A;  3DC6 A;  1L1F A;  2UUC O;  3TXS A;  4DR1 B;  1HNX O;  3RT3 C;  4DV6 B;  2IJH A;  4OPH A;  2Q68 A;  4WFF A;  4ZOL A;  1KMI Z;  5IT9 N;  3QVN A;  2V7Q G;  2R9R B;  1NQT A;  2WA3 A;  1QNM A;  3JAT A;  4RAI A;  1KYO F;  2AXT Z;  2WSS G;  2EX3 A;  2WLI A;  4P2Z A;  4B3M O;  3I55 V;  4IL6 Z;  1B04 A;  2HJD A;  3ZMV A;  5CBF A;  2P4K A;  4JI5 B;  4YJ2 A;  4JI4 B;  2NR5 A;  3IJ4 A;  2Z0A A;  3SJC C;  1AB3 A;  1R3J C;  5EK0 A;  2CGO A;  4N21 A;  3CMA V;  3N27 A;  3E2E A;  3E8G A;  3SR2 C;  2DYR C;  5EC1 C;  3SPI A;  1WJZ A;  1M9N A;  5B1B C;  1H2L A;  4TUY B;  2QKA A;  4GCZ A;  4JAS A;  3D3I A;  2ZE7 A;  2ZD9 A;  4GUN A;  1JFF A;  4I55 B;  5JJE B;  1LR1 A;  2ZQM A;  3JD4 A;  2RCV A;  1CEZ A;  5IYZ B;  2E5L B;  4MVZ A;  1OJH A;  3ZIA G;  3O9O A;  1COW G;  3ABL C;  3CRA A;  2WLK A;  4KP4 A;  1Q82 W;  5C8Y A;  3SJQ C;  2P4V A;  3JAK A;  1AJN A;  3FX7 A;  4OPA A;  5IJ9 B;  4DR7 B;  1N36 O;  2B9Z A;  1KKD A;  4AQY B;  1V55 C;  1AIL A;  1EZJ A;  3CC7 V;  3SJB C;  2CTR A;  4ZOL B;  3P3P A;  1BZK A;  1NR1 A;  1VF5 B;  2EIK B;  2GSM B;  3JSL A;  4DR4 B;  1X4T A;  4J9Y B;  2IU3 A;  3C3T A;  1K8A W;  5EBM C;  5BXZ A;  4JYA O;  4FLX A;  4J41 A;  3BPZ A;  3H9V A;  4RO2 A;  4R6Z A;  4O2A A;  2ZNI A;  3JAT B;  5L3D A;  1MZF A;  2WLI B;  2ADP A;  4QIW F;  3AK3 A;  4R7C A;  4P30 A;  3AG7 A;  1SQG A;  1QR9 A;  4N23 A;  1Y67 A;  5AG2 A;  3OEE G;  4DV0 B;  1DF5 A;  2E74 B;  4YHH B;  5IYD O;  1ZTE A;  3CJH B;  4LFB B;  3B09 A;  2ADQ B;  2IH1 C;  3H01 A;  5JH7 B;  1JFF B;  4PV1 B;  2DWD C;  5KA5 A;  3ZED A;  4LBE C;  2A7W A;  4YY3 O;  1YIJ V;  1I94 B;  3RYI A;  2YXL A;  4JI1 B;  2HLD G;  1K5Q A;  2AZ0 A;  3M8A A;  2EIM C;  5LA6 B;  1WB8 A;  5JWP A;  1VQ6 V;  1GAX A;  4YJ3 A;  5C8Y B;  1HP8 A;  3CRM A;  3JAK B;  2ZDI C;  2CH7 A;  5IJ0 A;  2YEV A;  5KAF Z;  2Z3Y A;  3KKY A;  1KD1 W;  2QKC A;  2LP7 A;  3FB5 C;  2QTO A;  4GX5 A;  4K8X A;  1XNR O;  4J80 A;  1MMM A;  4X62 B;  2IBZ H;  3DXR A;  1HNZ B;  2VWJ A;  4LFA O;  2AGA A;  4J9Z B;  4YXW G;  2XTA A;  1GN2 A;  2IJI A;  3ETQ A;  1K97 A;  4X88 A;  4CS2 A;  4IT5 A;  3OTO B;  3ZMZ A;  1AI7 A;  1BT8 A;  4CC5 A;  3HKC B;  1JPX A;  4CC6 A;  2YC0 A;  1Q6I A;  2Q5Z A;  1XIL A;  4WFA V;  1P7G A;  3A0H Z;  4B3R O;  4O2A B;  2A06 H;  5BZB A;  3E22 A;  4JI6 O;  1P7B A;  1J5E O;  3SPC A;  2DQ0 A;  4LF8 B;  4I4T A;  4UCO A;  1RSO B;  2DYS B;  3STL C;  3CCQ V;  1VAR A;  3BVO A;  4HNA A;  4DV7 B;  3G4S V;  2JIZ G;  2Q73 A;  2QWN B;  1N0N A;  5KHG A;  2Y0I A;  3KZI Z;  2EIK C;  1SRY A;  2RNB A;  1PP9 H;  1B3Q A;  3JAW A;  1YXB A;  4DW0 A; 
#chains in the Genus database with same CATH homology
 1QCE A;  4MVR A;  2HR3 A;  3E8B A;  1DF4 A;  3K04 A;  4H37 A;  1NR7 A;  3AG1 B;  4TWK A;  1VQ8 V;  2F43 G;  1NH2 B;  3ZMS A;  3ZN0 A;  3T4D A;  3ZRW A;  2X6B A;  4PEL A;  1R3L C;  5EBL C;  1YTF D;  3VOU A;  3K79 A;  5H6R A;  3CCS V;  4MW8 A;  4PA4 A;  4MT8 A;  3OUS A;  3AG3 B;  2XND G;  1VQ7 V;  1B6Q A;  3AEI A;  3ASO C;  4UV9 A;  1WPX A;  1EFR G;  1YJ9 V;  2ATK C;  4FMT A;  1SER A;  3E8F A;  2EIN C;  3T1C A;  1SZT A;  1JOY A;  2NNU A;  2QA4 V;  2UXN A;  3OUF A;  3CCJ V;  4MVQ A;  5KUM A;  3CME V;  3IGA C;  2YSU B;  1K5S A;  3T2M A;  3OEH G;  1DTO A;  1K4D C;  1SES A;  1OCC B;  3ZMT A;  1OCZ B;  3F7V C;  4Q20 A;  3FYI B;  5LHG A;  2B1G A;  4HAM A;  4GX1 A;  1ENV A;  1W2B U;  3SYA A;  5LHI A;  1FS0 G;  3QO8 A;  2W0F C;  1BMF G;  2X6C A;  1KC8 W;  3LDC A;  5FL7 G;  2DW4 A;  1M57 C;  3K06 A;  3SYQ A;  5GW7 A;  1MAB G;  2V1D A;  4EKW A;  1GM8 A;  1F23 A;  3ASN C;  2C2A A;  1R3I C;  3RBZ A;  1M90 W;  2MK3 A;  3FB7 C;  4UXN A;  3MHS C;  3K0G A;  3LNM B;  4LP8 A;  3FB8 C;  4Z1M G;  4JTC B;  5HFM A;  1AI5 A;  4ZKI A;  5HFL A;  1BL8 A;  3LSS A;  5KA6 A;  2OT5 A;  1AI4 A;  3OFN G;  4QJF B;  2IU0 A;  2IJK A;  5CA3 A;  1R3K C;  4MVS A;  3LUT B;  4GX0 A;  3CC4 V;  1YJN V;  3BEH A;  1UJW B;  1Y4M A;  3M99 B;  5L3B A;  2FTK A;  4U7O A;  2ZXW C;  2W6J G;  3OE7 G;  3DTU B;  4KUM A;  4XDK A;  1GMG A;  3FB6 C;  4PDL A;  3W7W A;  1XL6 A;  5E1A C;  3AG2 B;  1K34 A;  2Z5U A;  4JTD B;  3W7U A;  1W0K G;  2Y48 A;  1VQ5 V;  1FXH A;  4PDV A;  2EBO A;  4PA3 A;  2EZP A;  4DXW A;  1QVF U;  2Q6A A;  3ZRW B;  3IFX A;  4JYC A;  3R65 A;  2ITC C;  2DYR B;  3G71 V;  1FFT B;  3OGC C;  3QO5 A;  1VQ9 V;  1S0V A;  3EFF K;  1MSW D;  5B1B B;  3P30 A;  2DYS C;  2JEX A;  3JD0 A;  4RUF A;  2ZR3 A;  2OTL V;  4G27 B;  1PL0 A;  1K3E A;  4JGS A;  4RQE A;  5B3S B;  1YHQ V;  2EIL C;  1OZ0 A;  1E79 G;  2OCC C;  5H9C A;  2P67 A;  3F7Y C;  2WPD G;  2JJ2 G;  3K0D A;  1TUE B;  2QM8 A;  3RVZ A;  1GM7 A;  2A79 B;  1RM1 B;  4MTF A;  2EZO A;  3E35 A;  4FIP C;  4RQF A;  3CCE V;  1V54 C;  1S3J A;  4R8C A;  3FKS G;  4X89 A;  4F4L A;  4KFM A;  3OW2 U;  4P9P A;  2JEU A;  3ABU A;  3P32 A;  3AG1 C;  3ETE A;  1I5X A;  1GK9 A;  3ABL B;  3JD3 A;  3T4Z A;  3GWO A;  1QVG U;  4GX2 A;  3UKM A;  3SYC A;  2ZDI A;  3OAA G;  5B1N A;  5L3E A;  4UVA A;  3SPJ A;  1KP3 A;  5LBQ A;  4PA7 A;  1VQM V;  1CPY A;  1AJQ A;  1HWY A;  3AG3 C;  1JVM A;  1V55 B;  4RUE A;  4I9W A;  3K3W A;  3ZCC A;  4QPJ A;  1JQ0 A;  3QNE A;  1FXK B;  4MW3 A;  4LC1 A;  3SYO A;  1NH2 D;  2D3O W;  2WAM A;  1GTO A;  2XAQ A;  1R73 A;  3OR6 C;  2K1E A;  4MVO A;  1W0J G;  5CBH A;  5C93 A;  1OCC C;  4HZ3 A;  1OCZ C;  1DLB A;  2H8P C;  3ABM B;  1AI6 A;  5LGU A;  2YEV B;  4U7N A;  2HKO A;  1FXV A;  2OTJ V;  4MSW C;  3E86 A;  1MOF A;  2H94 A;  3WG7 B;  4BIZ A;  3PJS K;  5LHH A;  4I5S A;  3AG4 B;  2AHZ A;  3B8M A;  3SPG A;  4BW5 A;  1VQN V;  1F4N A;  5L3G A;  2A0L A;  1L1F A;  3I56 V;  2Q69 A;  3F5W C;  2P7T C;  3VBB A;  5B1O A;  4WCE V;  1KQS U;  1K9M W;  1AR1 B;  1CP9 A;  4ASU G;  1F4M A;  4TT3 G;  2IJH A;  2Q68 A;  4WFF A;  3TK1 A;  4PA6 A;  1JJ2 U;  2EJR A;  5IYB O;  4QPK A;  2V7Q G;  1THZ A;  2B5U A;  1KEC A;  2HFE C;  2R9R B;  3UM7 A;  3CCL V;  1K33 A;  1K73 W;  3G6E V;  5IY5 B;  3X2Q C;  2M7W A;  2NLJ C;  1NQT A;  1EBO A;  4RAI A;  4JAU A;  4P9O A;  1M56 B;  3MHH C;  5LGT A;  3EHB B;  5B1A B;  2WSS G;  3X2Q B;  4WFB V;  4WFE A;  1OCO B;  2WLI A;  1M1K W;  4P2Z A;  2WLJ A;  5KUK A;  3I55 V;  1QLN A;  1R6K A;  3LDD A;  3ZMV A;  5CBF A;  3AG2 C;  2LFR A;  3ZJZ A;  4WFH A;  4TSF G;  4R50 A;  4QE9 A;  1I5Y A;  1OCR B;  1IXM A;  2P90 A;  3W7X A;  3CXC U;  1Q81 W;  1R3J C;  5EK0 A;  4JF3 A;  4N21 A;  3CMA V;  4E2L A;  2XAH A;  3D36 A;  3E2E A;  3E8G A;  2DYR C;  5EC1 C;  3SPI A;  3HB3 B;  1M9N A;  1Y66 A;  5B1B C;  2WLH A;  2WLL A;  3OMA B;  5CBG A;  1Q86 W;  4GCZ A;  3CD6 V;  4JAS A;  3D3I A;  1N8R W;  2HJF C;  2QM7 A;  2Q67 A;  5B3S C;  1VQ4 V;  3ETD A;  1YJW V;  5EC2 C;  1RPR A;  1PNK A;  2ZD9 A;  1YIT V;  4MTG A;  4FK5 C;  1GKF A;  1E1Q G;  2KB1 A;  1RM1 C;  2ZQM A;  1ZWI C;  2BOB C;  3JD4 A;  3CPW U;  1CEZ A;  1VQP V;  3ZRS A;  4MVZ A;  2HG5 C;  3ZIA G;  1F51 A;  2Y69 B;  1COW G;  1QLE C;  3ABL C;  2JJ1 G;  2WWW A;  2WLK A;  4KP4 A;  1Q82 W;  1YI2 V;  3SJQ C;  2HVK C;  1AJN A;  4FJC C;  1H2G A;  1QLE B;  3KG2 A;  4XBF A;  3JD2 A;  4DO2 A;  1KKD A;  1ROP A;  3ZMU A;  3ETG A;  3NXS A;  4PA9 A;  1S72 V;  1G4Y B;  1K92 A;  1GO3 F;  1V55 C;  3DGE A;  3GB7 C;  2B1I A;  1R6N A;  3OMI B;  5CN0 A;  3SPH A;  2HVJ C;  1S77 D;  4UUJ C;  4XDJ A;  2DWE C;  1FXK C;  1EZJ A;  4PDM A;  3K03 A;  1NVP B;  3CC7 V;  3CCU V;  2DQ3 A;  1MG1 A;  2CK3 G;  1NJI W;  1NKD A;  5J9P C;  1NR1 A;  2IH3 C;  2EIK B;  4LCU C;  2A9H A;  2GSM B;  3WFV A;  2BOC C;  3ABM C;  4J9Y B;  4MVU A;  2IU3 A;  1K8A W;  3ABK B;  3B77 A;  5EBM C;  4QNH B;  2X7R B;  1BHA A;  1K7D A;  2AHY A;  1PNL A;  2WLM A;  1WLE A;  3HPL C;  3CYO A;  3IC7 A;  3SYP A;  3JD1 A;  1NVP D;  4JTA B;  1KP2 A;  4RO2 A;  4XDL A;  4R6Z A;  3WG7 C;  3B8N A;  1GM9 A;  4X8A A;  5L3D A;  3AG4 C;  3STZ C;  3RVY A;  2JDI G;  2WLI B;  4QIW F;  4R7C A;  2IW5 A;  4P30 A;  1H8E G;  2WLN A;  1QR9 A;  4N23 A;  3ASO B;  3OR7 C;  1K4C C;  2QE7 G;  5H6Q A;  3OEE G;  1NBM G;  2W6I G;  4G2K A;  2XAJ A;  1JCH A;  2EIN B;  3CCR V;  1DF5 A;  3RW0 A;  5EBW C;  1QR8 A;  2P6J A;  2ITD C;  4PDR A;  5IYD O;  3OM3 B;  1H8H G;  2WLL B;  5IY5 C;  3JCZ A;  1BHB A;  2IH1 C;  1Q7Y W;  3K9A A;  4ZBM A;  4MTX A;  3H01 A;  1M56 C;  3OMN B;  2X0L A;  5B1A C;  1OCO C;  2LFS A;  3CCV V;  1VQL V;  2DWD C;  4L87 A;  1ARO P;  5DM6 V;  5KA5 A;  1M57 B;  4LBE C;  1SET A;  1YIJ V;  2PI5 A;  2UXX A;  1P4R A;  1PKX A;  3ASN B;  1S5H C;  1FXK A;  2HLD G;  4CBC A;  4QE7 A;  5CMU A;  5L3C A;  4JAV A;  1K5Q A;  1OCR C;  2EIM C;  1VQ6 V;  2EIJ C;  2GHY A;  1J95 A;  3E8H A;  1E1R G;  1VQO V;  1OHH G;  2ZDI C;  2EIM B;  2EIJ B;  2QEX V;  1JX9 A;  5IDJ A;  5L3F A;  2YEV A;  2Z3Y A;  1RPO A;  1KD1 W;  2X6A A;  4H33 A;  1PD3 A;  3TCU A;  2QKS A;  4FPP A;  3QO7 A;  2LP7 A;  1ORQ C;  2QTO A;  3FB5 C;  3A0R A;  4HYO A;  4GX5 A;  3LDE A;  4BIU A;  2R9I A;  4WFG A;  4JYB A;  4UVB A;  4UV8 A;  3TET A;  1XL4 A;  2ZXW B;  4J9Z B;  4YXW G;  3ABT A;  2IJI A;  4OXS A;  1K97 A;  4G28 B;  4X88 A;  4BAY A;  3ZRX A;  3LSQ A;  1VQK V;  1LNQ A;  3ZMZ A;  1AI7 A;  2Y69 C;  1AJP A;  4JPR A;  3MD0 A;  4CZZ A;  2PI4 A;  3CCM V;  2XAF A;  3BY6 A;  1JPX A;  3CP1 A;  4GT1 A;  3CC2 V;  5LGN A;  4WFA V;  5IYC O;  3ML0 A;  1G8M A;  2JK5 C;  1PNM A;  3W7T A;  5BZB A;  2XAG A;  1P7B A;  3SPC A;  3W7S A;  3E89 A;  2DQ0 A;  4MS2 A;  4UVC A;  1QBZ A;  5DN6 G;  3E83 A;  2DYS B;  3STL C;  4WF9 V;  3CCQ V;  4MVM A;  3ZN1 A;  3JYC A;  2XAS A;  3G4S V;  1S76 D;  2IJJ A;  2EIL B;  2JIZ G;  2OCC B;  3K08 A;  4MTO A;  3FYE B;  3ZRV A;  2EIK C;  1SRY A;  2ZR2 A;  1YSC A;  1YTF B;  2XOK G;  1H38 A;  3ABK C;  1V54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...