4RAIA

Crystal structure of cng mimicking nak-etpp mutant in complex with na+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
FQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4raiA00
3OR6C 2ITDC 3STZC 1S5HC 3BEHA 4LP8A 4MS2A 4MW8A 4GX2A 2HJFC 1K4CC 2OCCC 5EBWC 3K0DA 3AG4C 2A0LA 2HG5C 2HFEC 4MVUA 4MTOA 2X6CA 2DYRC 3ASOC 2H8PC 5CBFA 5IY5C 1BL8A 3LNMB 4R50A 2YEVA 4BW5A 1QLEC 3UM7A 3F5WC 4WFFA 4R7CA 3FB7C 4PDMA 3SPJA 5E1AC 3E8BA 2WLIB 2WLLB 2WLLA 2WLIA 2A9HA 2KB1A 1G4YB 3LUTB 4MTFA 4R6ZA 4P9PA 2ATKC 3T2MA 1K4DC 4TWKA 2K1EA 4GX1A 5KUKA 1ZWIC 1R3JC 4PDLA 2Q68A 4G27B 4I9WA 3E83A 4JTDB 4EKWA 2QTOA 3OUSA 4X8AA 3OR7C 3T1CA 3K04A 4X88A 3SYOA 2EIJC 2QKSA 2HVJC 3OGCC 2W0FC 4J9YB 3ABLC 4HZ3A 2EIKC 5EBLC 2Q67A 1XL4A 2WLKA 2ZXWC 2BOBC 3ABMC 2AHZA 2ZD9A 3LDEA 3RBZA 4JTAB 4QE9A 4DXWA 3HPLC 4WFGA 3T4ZA 3SYCA 3IGAC 3SYPA 3FB6C 3E89A 1M56C 5CBGA 4QE7A 4XDJA 2WLMA 2EINC 1JVMA 3F7VC 3RW0A 5B3SC 3K03A 1OCZC 4XDKA 3T4DA 4HYOA 1J95A 5EBMC 3SPGA 3FB8C 3STLC 4RAIA 1R3LC 3E8GA 4P9OA 4R8CA 3LDCA 4XDLA 4CBCA 3SPIA 3RVZA 3TETA 2X6BA 2IH1C 3SJQC 2HVKC 3KG2A 4LBEC 4X89A 3F7YC 3E8HA 2EIMC 2JK5C 4P2ZA 2Q69A 2R9RB 1V54C 4PDRA 4RUEA 3AG1C 4MSWC 5EK0A 5CBHA 5EC2C 3ABKC 4MVSA 4PA6A 4OXSA 4PA4A 4RUFA 4PA3A 3GB7C 2DWEC 3SYQA 3EFFK 4MVRA 2AHYA 3OUFA 3AG3C 5B1BC 1V55C 2P7TC 4UUJC 2A79B 4F4LA 4ZBMA 3SPCA 3VOUA 2DYSC 1M57C 1R3KC 3IFXA 3LDDA 1ORQC 1OCRC 4MVZA 3AG2C 3TCUA 1P7BA 4H33A 1OCCC 4G28B 4PA9A 1XL6A 4MVMA 4PDVA 4WFEA 5KUMA 4GX0A 1OCOC 3PJSK 2DWDC 3E8FA 3K08A 3R65A 3SYAA 4JTCB 3JYCA 2X6AA 4MW3A 4MTGA 4PA7A 2EILC 4RO2A 2ITCC 4MVOA 2Y69C 4LCUC 3ASNC 3K06A 4H37A 2NLJC 3RVYA 3UKMA 5J9PC 2WLNA 2WLJA 4QNHB 3ZJZA 1R3IC 4P30A 4WFHA 3ZRSA 1LNQA 1KKDA 5BZBA 3K0GA 3SPHA 4KFMA 3E86A 5EC1C 2IH3C 3FB5C 3WG7C 3X2QC 4J9ZB 2WLHA 4MVQA 2Q6AA 5B1AC 2BOCC 4GX5A
chains in the Genus database with same CATH superfamily
1R1BA 3UO3A 5JQGA 1SS3A 5LMUO 4ZOLA 4H44B 4ICGA 2A0LA 3DC5A 4MTOA 3W7TA 3K5LA 2H8PC 1N34O 4LNUA 1QLEC 3B8MA 4CH6A 1FPOA 3QTCA 3QO5A 3JAWA 1VQ4V 3BFRA 1BT8A 1AP5A 1K4DC 4GLXA 2K1EA 4LFAB 4ABMA 3KCXA 2YIDA 3H1LH 2QTOA 1AP6A 5LMNB 4FZ0A 1HR0O 4Z1MG 3B40A 5H2FZ 4QGPA 5LA6A 3LSSA 2ODMA 4JYAO 1VP7A 2UU9B 2Q7GA 4K0KO 2PI4A 1L0LH 4WFGA 3FB6C 1M56C 4K35A 1Z5WA 2ILMA 3R66A 2RJZA 3CPWU 4WFBV 3ABKB 3SPGA 1F7YA 4R8CA 5JJNB 5IWAO 4DR3B 4PDRA 3C3TA 1YJNV 1GRJA 4OPAA 1EFRG 4JI6B 3SYQA 3A2FA 1NU1H 1HDJA 5LHIA 4NR1A 3CC7V 1E1QG 3JATA 2P5OA 4RWUA 2CTQA 4JF3A 1VQPV 1K97A 2VRZA 3JCUZ 3I56V 3QF7A 2FB5A 4LFCB 1JFFA 3HKBB 2GDSA 3ZMVA 2NLJC 4EFBA 2OCHA 2RN9A 3ZHVA 1WN7A 5BZBA 2HHHB 1QLEB 1WB8A 1XDCA 4O4IB 3WG7C 2Z5UA 4DV2O 1I94O 2QWNB 4IHJA 1JA8A 1QR8A 4I55B 1S72V 2CGNA 2OCCC 1MOFA 4JI2O 3AG4C 2Q7HA 4CS4A 3W7XA 3BA8A 2VS0A 2OYQA 2CUGA 2PI5A 2K9PA 1VF6C 3P30A 3LNNA 4H13B 2QEXV 3SPJA 1N0JA 4LC1A 2CAZC 2QKCA 2PGGA 1EZVH 5IJ9B 1XQ8A 1M90W 3ZBHA 2GBOA 1RSOA 3IC7A 1M56B 2OIGA 1RM1C 2L6LA 3SYOA 3K5NA 2DE0X 4I7ZB 1IBMO 1XL4A 4X62O 2WLKA 5H5NA 4O2AB 3ZX6A 1FXKB 3HB3B 2P22C 3BHPA 3CRMA 3EHBB 4JASA 4UCTA 4UVCA 1KKCA 3T4DA 3CE2A 4IYIA 5A2QN 3ABUA 3E8GA 3LDCA 5GTHZ 2X6BA 3RYHB 2AGAA 3WB2A 3F7YC 2ARHA 4RUEA 2XNDG 2Q8VA 4YXWG 2CTWA 4OXSA 2DWEC 1Y76A 2X0LA 3ZN0A 5BXZA 3D36C 2R70A 2IM9A 1MNGA 2LGQA 3ETEA 5JJJB 3CEIA 3U0ZA 3CCUV 3VOUA 4X65O 1PV0A 2D2CB 2VQEB 2QM4A 3GVMA 1OCRC 2LFRA 1OCCC 3WG7B 5KA6A 4X1YA 3TK1A 2XUMA 4MTGA 5KMGB 1AR1B 2E76B 2QWRB 4DUZB 2Y69C 3AG4B 3BABA 5J2TA 4BIUA 1N34B 4P30A 4WFHA 4PHZA 1HNWO 1YITV 3H01A 2WLHA 4LH6A 3OFNG 3STZC 3E2EA 5L3CA 1US6A 2HFEC 1LUVA 3ASOC 1N32B 1RM1B 5EYPA 5E1AC 3N2GB 4JI1O 1DGSA 2H3OA 4BW9A 1SERA 4UCOA 1FFXA 4YIPA 2Q5ZA 1R6TA 1VQMV 3O65A 3QG5A 1TVKB 4NTXA 4JV5O 3D3QA 2UXCO 3FFQA 1WNSA 4U3JA 2B5UA 1YTFD 3G6BA 2CGOA 3ZRWB 2CH7B 2ZM6O 1BHBA 2RCVA 1BZKA 4QE9A 3IAYA 2E3CA 2WPDG 3SYCA 1XMOO 2GSMB 2CTRA 1VMGA 4C7UA 2LJ2A 4LF5B 1JQ0A 2XAHA 3FB8C 3RVZA 1YCIA 1M1KW 3DXRA 4QIWF 3MHSC 2ADQB 4MTXA 1EN6A 5IYZB 1NS1A 1L1FA 1K34A 1JPXA 2PUSA 1OCRB 4YY3B 1OCCB 4FLYA 5LGTA 1D5NA 3MHHC 2MW2B 2Y69B 4ZBMA 1GAXA 2PF4E 3CCSV 1VQKV 4ZOLB 3MDSA 5BMVA 3SR2C 2RMKB 1I94B 4WFEA 1AI5A 4O2BB 3P3PA 4YHHO 3AK1A 5K1PA 1I5YA 4JI4B 1OCOC 2G38A 5H6RA 1PL4A 2X6AA 3H1KH 3K06A 4LF4O 3E35A 1PPJH 4J10A 1PP9H 3FB5C 4FFBA 4J9ZB 1Q6HA 1URFA 1TAEA 2UXDB 1EN4A 3OR6C 3U11A 4CH3A 3J81N 1A32A 4GX2A 2HJFC 4DR2B 5LA6B 1K33A 2E75B 3K0DA 1L8DA 2UUBO 3UO2A 1Q3EA 2EZPA 1S5JA 4CC5A 3QO8A 1OHHG 4LWSA 1VQ7V 5KUKA 1R3JC 4IYHA 1I0HA 4I9WA 2CK3G 3FX7A 4FLTA 1YSCA 3OGCC 3G4SV 4DV3B 1V55B 4J7KA 3ZHSA 4HZ3A 3TGUH 5JCOA 2UXBO 2JDIG 2ZXWC 2ZD9A 2JJ2G 1IXBA 2CDYA 3T4ZA 3SJBC 4N23A 4DV4O 1HW7A 4XDKA 4NVPA 1F4MA 4HYOA 3JATB 1R3LC 1FS0G 4RQFA 2JVDA 3S3WA 5GONA 3ETQA 1GN6A 3E8HA 4WFAV 3AK3A 1V54C 4EEQA 2LQTA 5CN0A 3CHXA 4MVSA 4LFAO 4RUFA 3A0BZ 1B3QA 1ZUQA 2JEUA 3B2EE 1AILA 3JASB 4I4TA 3IC9A 1IBKB 1H2LA 1SQXH 1GN4A 1HNWB 5LGNA 2UU9O 2YICA 1AROP 2NR5A 4FLXA 1R73A 3CCLV 1GMGA 4BAYA 4MVOA 3RVYA 1OV9A 4JPRA 2OTJV 1NKDA 4KXRA 1Y4MA 4GKJO 4X20A 4NB5A 4JI3O 1T5EA 4LF6B 2JRIA 1K92A 3TXSA 4UV9A 4DR3O 4ZHQA 2NN4A 2X6CA 3N2KA 5HFLA 2FL4A 1WA8A 1VQNV 1P84F 3UM7A 4LF7B 4F6RA 1SZXA 4R7CA 4PDMA 3OGIB 3P32A 3B4SA 4FJCC 2WLIA 5FNVB 3CC4V 2ZXWB 5EIBD 1VQOV 2AXTZ 2XAQA 4EKWA 4N21A 4PI0A 4BIOA 1S3JA 1NH2D 4LFCO 2Q0AA 4ZI7B 1Y74A 1WJZA 3ZMTA 1O9HA 1WPBA 2AZ0A 1Y76B 1ZLZA 4QE7A 2WLMA 2ZINA 3K03A 1V54B 5JH7B 3C90A 4UCRA 3KKYA 5EBMC 3JD3A 3QO7A 1K9MW 5BR8O 1M5IA 5FPRA 1H8EG 1Q8IA 4X1YB 2Q69A 4I0XA 4ZIBA 4TV9A 4OGQB 2KSDA 5EC2C 5J2TB 4YHHB 1VF5B 2MK3A 2YUAA 4HNAB 5CA1B 4AQYB 1JCHA 4LF4B 2A79B 3PN1A 3CRRA 5KHGA 2GUZA 2IJKA 3QNEA 1VQ9V 1K7DA 1QQCA 3CXHF 2E5LB 3RYFB 4JTCB 1CPYA 1QVFU 4X1IB 4JI5B 2UUBB 1WB7A 1K5QA 2GHYA 3ZRSA 3OMAB 4GUNA 2XT9A 2ZE5A 1IX9A 1XILA 1Z5VA 3E86A 1QR9A 1H2KA 2IU0A 2ETNA 1NI8A 5LHGA 2ITDC 2C2AA 2Q9LA 1O9GA 4U3JB 1G8MA 2ZR3A 3JAMN 1DF5A 2HG5C 2L35A 2RDCA 1BHAA 4R50A 4B7KA 1KU9A 5L3DA 4O4JA 2WLLB 1IBLO 1QCEA 4E2LA 2UXBB 3A0RA 1J5EB 4LFBB 1Q81W 3O9OA 3EXAA 1ZWIC 1GK9A 3FAVA 4G27B 4DK1A 4J41A 1N8RW 1NR7A 4I50B 4DV4B 1BCCH 1WAZA 1FXHA 1AB3A 2P4VA 4FM1A 4DUZO 4QPJA 2B1IA 3ZMZA 4DO2A 2V1DA 5JVDB 3RT3C 1COWG 4X1KB 1SQGA 4L8JA 2EBOA 1XNQB 3AK2A 2Q7EA 1H2MA 5BMVB 2HP8A 1N32O 1XEQA 4A5UB 5ITZA 3ETGA 2IJHA 1S76D 2QE7G 3HKEA 4PA3A 3OE7G 3T1HB 4FFBB 5KHIA 3AG3C 3RYCA 4GKJB 2DMXA 3AG2C 2IBZH 4O4LB 4JI3B 1HP8A 1FXKC 5KX5A 2YXYA 2YIBA 4TSFG 2HJDA 4LF5O 1XMQB 2JGDB 2YC0A 3I5DA 4O4HB 3UQ8A 4NXNB 1IXMA 3K59A 3K0GA 1AR4A 5EC1C 2UUCB 1YIJV 2FKXA 2RNBA 3T1YB 1W0JG 5IJ0B 1L0NH 2QTSA 2Z0AA 1M93A 4YY3O 3CYOA 2P67A 4MVUA 4IIJA 4PI2A 5IY5C 2DOSA 4GKKB 1R6KA 1ZL8B 2LFSA 3E8BA 4NYKA 2QWOB 3H9VA 3CMAV 1BGYH 1VQ5V 2GTAA 5DM6V 2QDOA 4DR6O 2BTQA 1AI6A 2F66C 3K04A 4JI4O 1TUEB 1IDSA 5GONB 5FPOA 2V7QG 2PTMA 1S77D 2F95B 2OT5A 4FFKA 1YVWA 4J7JA 5EZYA 3LDEA 2R9IA 3JAKA 4TUYA 5BR8B 2YI9A 4Z2WA 2R72A 4DXWA 1F23A 5C8YA 3K9SA 4I4TB 2UXDO 3ZRVA 1OCZC 3GWKC 2XAJA 3M8AA 4F6EA 4CC6A 4DR2O 1P7GA 4RAIA 4JAAA 5F2VO 1KUQA 3A8TA 3JD1A 1SF9A 4X9QA 3AG3B 4J11A 2QKAA 4UCUA 4YJ2A 3AG1C 5LBQA 3AG2B 1N0NA 1JR9A 4X20B 3SGIA 1QU7A 4DV3O 1N36B 1M57C 4JI8O 3BAAA 3I55V 1SQVH 4WBNA 2ZDIC 4D7SA 3N2KB 1WA8B 3SYAA 3RGBA 1E1RG 3JYCA 3CRQA 2W6IG 1SQPH 5BY1A 1XREA 4U7OA 2BE3A 2YDEA 5IY5B 1KKDA 3CSXA 4DV6B 3HKCA 1X59A 4K8ZA 2F4VB 2Q6AA 1IBLB 4DR1O 2D3OW 1H2GA 3CCVV 4LP8A 1FKAO 1E79G 3CD6V 1NVPD 1JJ2U 1XI1A 1K73W 3OTOO 4B3SO 2F23A 5LXTA 4OX9B 4MTFA 1IBKO 4JZGA 1GN2A 1VQLV 3KZIZ 4RQEA 1H8HG 1D2DA 3RFRA 1OCZB 1NQTA 1PL0A 4AILC 1NTZH 5CA0A 2BSKB 4KUMA 5GW7A 5L3GA 3L70H 2YIBD 4U7NA 2QWQB 4DRXA 2QWPB 2KG7A 3OEEG 4LF6O 4YIOA 3AG1B 5IT9N 1QBZA 3STLC 3CC2V 4JI0B 1PM9A 2QM7A 4JYBA 2KKWA 5LOVA 4LF7O 3M99B 2B1GA 3B8NA 1W2BU 1BMFG 2JK5C 5LYJB 1KBHA 1M57B 3UT5B 4UV8A 4DR7O 2E74B 4PA4A 3APOA 3HKDA 3EFFK 3CWBH 2EJRA 2AHYA 3OUFA 1Q7YW 1V55C 4I9QA 3CMEV 3M7MX 3IFXA 3JARA 1ORQC 1CP9A 3ABTA 1TUBB 4PA9A 4MVMA 1SA0B 4TQDA 2QSAA 3Q4HB 1P4RA 3AG7A 3W7SA 3K5MA 1LNQA 1MABG 4DV0B 4LF8B 1S5HC 1VIBA 5JQGB 2Q73A 3CB2A 1I08A 2O57A 3JALA 4DR6B 3ZS8C 4LNUB 1KYOF 2R9AA 4AQYO 2YIAA 2KB1A 3CP1A 3JAWB 4P9PA 1PD3A 1U97A 3BRCA 3N27A 2P6JA 1W0KG 2E5LO 2PYLA 2RQ6A 4JI5O 2BOBC 4BWAA 3HKEB 4U3FH 4QJFB 1SQFA 3U10A 3OM3B 1LUWA 2DQ0A 4JYCA 4IL6Z 3FYIB 1J95A 3TJTA 2IJIA 4NKGB 5K1XA 4X66B 4DUYB 3SJQC 3ZMSA 3KG2A 4LF9B 4JI8B 1J5EO 1Q82W 4LFBO 3OD4A 4L87A 2GV9A 1AI7A 3K57A 3BPZA 4BIZA 2WA4A 5L3EA 1GM7A 5L3BA 1DF4A 2P7TC 2F1MA 1DLBA 4Q20A 4W4KA 5TISZ 2UUAB 1KP2A 1YTFB 3JD2A 1VF7A 3ZHQA 5KUMA 4DR1B 1QHTA 1KB9F 1JFFB 3F5TA 4PA7A 2WSSG 4DV1B 3L71H 3WB1A 3HKBA 3WB0A 4FM0A 5J9PC 4DK0A 2Y0IA 4PV1B 2EIKB 1XNQO 1R3IC 3OTOB 3ZRXA 3G67A 4B3SB 4KHPB 3SPHA 4TT3G 2ZNIA 4IHJB 2F43G 3BEHA 4I55A 1G1XB 5D5PA 1SQBH 1QLNA 4DR5B 3JAKB 4GT1A 3T1HO 2YEVA 1HNZO 4FMTA 1B6QA 4PJ0Z 5CB4A 4J80A 3NR7A 1LR1A 3T2MA 5IJ9A 4IGGA 3OTFA 1Q86W 1JX9A 3OUSA 1RSOB 2LW1A 3DTUB 1VARA 3NXSA 4AHCA 4FLZA 4DW0A 1XMQO 1XNRO 2QGNA 4NXNO 4JTAB 1CXZB 3JCZA 3DSQA 2UUCO 1XHXA 3T1YO 2WWWA 4DR7B 5DECA 4B3RB 2OTLV 3J7AU 5KHJA 3RYHA 2IH1C 4TOIA 4GKKO 3ZHTA 1MMMA 1IURA 2ZIMA 4KL1A 4AI8A 1WLEA 5KAIZ 4MVRA 3HKCB 1ROPA 3ZHUA 2PY5A 1SC5B 2BCCH 1ENVA 2QR4A 1SETA 4G28B 3K58A 4PELA 2EX3A 2XASA 1YZBA 5KMGA 5H9CA 3ASNC 3CRAA 1GM8A 1BE3H 1VF6A 3RWRD 4B3TB 3VQYA 4MS2A 1SESA 5H6QA 1AR5A 5CBFA 1Q43A 5CA0B 3H1IH 1BQ0A 5EYPB 3GWOA 3N2GA 2KG7B 3RYIA 1ZTEA 2WAMA 2YXLA 1N36O 1FFXB 2W6JG 3OW2U 5CMUA 2FMLA 3EVKA 5CA3A 1TVKA 4OPHA 5LOVB 4EFEA 5JWPA 1V9PA 2HVJC 4WCEV 3SJAC 4J9YB 3JSLA 3B09A 1FJGB 2JEXA 3ZRWA 3VQVA 2GTSA 4DV6O 2CE4A 4XBFA 1IZ3A 3ZHRA 2F4VO 4JAUA 3SYPA 1TGOA 3ZN1A 3RW0A 5B3SC 1Q90D 3K9AA 3E22A 3OEHG 3L72H 5JCOC 3A0HZ 3JARB 2LGWA 1HNXB 3DXRB 3D36A 5B1AB 1X4TA 4OX9O 5IYZA 4FZ1A 2W0XA 2NNUA 1NJIW 1AJQA 4MSWC 1ZAUA 4CS2A 4DV5O 3G6EV 3HR0A 2DQ3A 1CEZA 2HKOA 1Y66A 2JGUA 3LSUA 2WA3A 3ASNB 1NH2B 3CCMV 1N33B 3JALB 1P7BA 4H33A 3FD9A 4B7EA 4PDVA 1ZSPA 4O2BA 2XOKG 2VWJA 1M9NA 4LCUC 4H37A 1K5SA 3ZEDA 3L73H 2N74A 4JI0O 1HNZB 1MSDA 1QNMA 1AJNA 1H2NA 2P4KA 4NTYA 2KQXA 2M6YA 4MW8A 3CJHA 1U96A 4G2KA 2IW5A 4J42A 1P49A 2P06A 4JGSA 4DYLA 4EB6A 1XNRB 1G4YB 3DGEA 1THZA 4LWSB 3L75H 3DC6A 1FFTB 2Q68A 2V4DA 1EM1A 3CCJV 1G6UA 3T1CA 3CCQV 2ZIOA 1ZX3A 5B3SB 5B1BB 4ASUG 4DR4B 1WP8A 4FPPA 1AI4A 5D5QA 2AHZA 3RBZA 1JOYA 2FYUH 5IYDO 2ZE7A 3IGAC 4DV0O 4LF8O 4XDJA 1VQ8V 3G80A 2IU3A 3ZMUA 4FLUA 1QVGU 3APQA 4NTWA 1KP3A 1KQSU 3BVOA 4JI7B 1F51A 2UXXA 2XHBA 2VQFB 2Y48A 1NBMG 2R9RB 1DK1A 5CBHA 5EK0A 3BY6A 4YJ3A 1WPXA 1Q6UA 3JASA 2YXHA 2OWOA 3SPCA 2DYSC 1S5LZ 5J2UA 4B3MB 1XL6A 4DV7B 3TXQA 4K3AA 2YEVB 3PJSK 3R65A 2YS8A 3RN4A 2A7WA 2N05A 5CB4B 4X64B 1GN3A 1W59A 3ZJZA 1BS3A 2JJ1G 3X2QC 4X66O 3W7UA 4DUYO 4CS3A 3G71V 2PZSA 4LF9O 3BCCH 3QVNA 2ZNJA 3ML0A 1K4CC 2QM8A 4JZ2A 5IYBO 1HWYA 3WFVA 4ZHQB 3L9DA 4DW1A 3OMIB 4NXMB 3F5WC 4F6RB 3FKSG 4WFFA 3FB7C 2Q4PA 4FK5C 2WLIB 5FNVA 1TA8A 1Z2GA 4JAVA 5LP6A 2LO1A 2UUAO 3CCRV 4X8AA 3D3IA 3VQXA 4FLVA 4X88A 3ETDA 2QKSA 4DV1O 1GH6A 4ZI7A 1Y74B 1UFIA 4IT5A 4KHPO 3E89A 2EULA 5LGUA 3F7VC 3JSNA 4DV5B 5JH7A 4KP4A 4TV8A 5KLVH 4XDLA 4CBCA 4DR5O 3BA9A 1PKXA 2HLDG 4UB6Z 3SDLA 4LH7A 2DYSB 5LMUB 1YDXA 4I0XB 2OCCB 4TV9B 1RPOA 1RP3B 3GB7C 1KD1W 3OT7A 5C93A 4HNAA 5CA1A 2Y4UA 1IVSA 1I7FA 2YI8A 4UUJC 2XTAA 3UCSC 3LDDA 2GUZB 2Y4TA 3THOA 3K5OA 4MVZA 1N4CA 4LR3A 3X2QB 1RPRA 4JYYA 4GX0A 1HR0B 3D8CA 3RYFA 4MW3A 4RO2A 2EILC 4TQFA 4X1IA 1MZEA 3RYIB 4BR6A 2WLNA 4QNHB 4JYAB 4B3RO 4K0KB 2IJJA 1RFYA 3ZIAG 4CZZA 2ZE6A 3VBBA 4GCZA 1B06A 5E79Z 5EBWC 5FL7G 5AG2A 5GTIZ 2ADPA 2DYRC 5IYCO 2HR3A 1GTOA 4O4JB 3LUTB 2WLLA 5IWAB 2EZOA 4D6TH 1YXBA 1NZ6A 3E22B 2X7RB 3FAVB 4PDLA 1BSMA 3E83A 4JTDB 4ZKIA 2LP7A 2B9ZA 5KHHA 4I50A 1GO3F 4W4LA 3ABLC 2EIKC 5EBLC 2Q67A 2A06H 5JVDA 2VWKA 2BTOA 4X1KA 2CTPA 1XBLA 3K79A 1Q5OA 4B3TO 5B5EZ 2F93B 4GYCB 2ZCEA 2Q0OC 4P9OA 1Y6XA 3TETA 1NVPB 4DV2B 2HVKC 2XAGA 4X89A 1WP7A 2EIMC 4P2ZA 1BQZA 5ITZB 1PNKA 4JI2B 1PNMA 1KMIZ 2OIEA 3AEIA 4PA6A 1NR1A 2DJVA 5LL6Y 3ASOB 4J7ZA 5B1OA 1PNLA 2ZE8A 3ZCCA 3WU2Z 2EILB 1UPGA 1DTOA 2P90A 2JS5A 3RYCB 2JS3A 3CJHB 1FJGO 4UB8Z 1R6NA 5KX5B 1SKVA 4O4LA 2ZKOA 2A3QA 5KA5A 1EZJA 1AJPA 1K3EA 4EB6B 1IBMB 3MD0A 3JD4A 4UCVA 2JGDA 4X62B 1YHQV 1JMKC 4O4HA 1EBOA 2DYRB 5DN6G 4UFZA 1HNXO 4MVQA 3B77A 2DN9A 3C3SA 5IJ0A 2AW9A 3MAQA 4IIJB 5LHHA 5LP6C 4CH5A 1YF2A 1BL8A 4I5SA 4BW5A 1NT2B 3K3WA 2ZQMA 2JIZG 1ZL8A 4MT8A 1I5XA 1M4UA 2A9HA 2M7WA 3ABLB 4FVMA 4Z1VA 1N33O 4O4IA 2BTQB 3CX5F 4PD4F 3W7WA 2EIJC 1GM9A 4X65B 1F4NA 3IJ4A 5EZYB 1VQ6V 3ABMC 5IE9A 4TUYB 5KHKA 1KC8W 1B04A 4YJ3B 5C8YB 1OCOB 5LMNO 2EIMB 1SZTA 4UVBA 2EINC 1JVMA 4WF9V 2FTKA 1NTMH 3CRCA 1H38A 3S3XA 1UJWB 2Y0PA 3OAAG 5J2UB 1FXVA 3P3NA 4UXNA 1XHZA 4YJ2B 2ZR2A 1JJOA 3ICXA 4O2AA 1SQQH 1FXKA 1FYJA 4Q6GA 3CCEV 2LW7A 4JI1B 4F4LA 5A9GA 2YSUB 4DR4O 2UXNA 1MA1A 4WBNB 1YI2V 3TCUA 1OZ0A 2DW4A 4JI6O 5L3FA 3K08A 4B08A 4JV5B 1YJWV 1Y67A 2UXCB 3LSQA 2ITCC 3UKMA 4GZRB 2ZM6B 2WLJA 2XAFA 3JD0A 5LP6B 1NTKH 1OJHA 4CH4A 1XMOB 5B1AC 4JI7O 4GX5A 2VQFO 5EIBC 3KCYA 3LNMB 2HHHO 2EIJB 5LXTB 1MSWD 4FLWA 4R6ZA 1D5AA 5IDJA 5HFMA 1S0VA 2ATKC 4TWKA 3ABMB 4GX1A 4TV8B 5JJEB 4B3MO 4K8XA 4UVAA 3OR7C 4DV7O 1MG1A 1FAFA 2EINB 5DEDA 2W0FC 1XOUA 1FD9A 4X64O 1XUQA 1MZFA 2H94A 2EJ7A 2BSKA 3CS5A 3HPLC 3OMNB 4DRXB 2QA4V 5CBGA 1YJ9V 3CXCU 2PYJA 4H0LB 2Z3YA 1EN5A 4FM2A 1AVMA 1H2SB 3SPIA 1YEWA 3SJCC 5B66Z 2HEPA 4NXMO 4LBEC 4E4EA 5LYJA 2CH7A 3UT5A 2AZ2A 3ABKC 2ZDIA 3J80N 3HKDB 4D7TA 3FYEB 3L74H 4QPKA 3VQWA 1VEWA 5B1BC 1R3KC 1SRYA 1K8AW 1TUBA 5KAFZ 2ZT9B 1SA0A 4HAMA 2DWDC 3E8FA 5FLXN 1Q6IA 3Q4HA 5B1NA 4FIPC 2VQEO 2N04A 3H1HH 3H1JH 1GKFA 2QJ1A 4KFMA 2IH3C 4HBNA 4UCSA 2BOCC 1KECA
chains in the Genus database with same CATH topology
1K92A 1S5HC 4UV9A 3ML0A 1K4CC 2QM8A 5IYBO 1HWYA 3WFVA 2A0LA 4MTOA 2X6CA 5HFLA 3W7TA 2H8PC 1VQNV 1QLEC 3OMIB 3UM7A 3F5WC 3FKSG 4WFFA 3B8MA 3FB7C 4R7CA 4PDMA 3P32A 4FK5C 2WLIB 4FJCC 2WLIA 2KB1A 3CP1A 3QO5A 1VQ4V 4P9PA 3CC4V 1PD3A 1K4DC 2ZXWB 2K1EA 4JAVA 1VQOV 3CCRV 2XAQA 4EKWA 2P6JA 2QTOA 1W0KG 4X8AA 3D3IA 4N21A 1S3JA 4X88A 4Z1MG 3ETDA 1NH2D 2QKSA 3LSSA 2BOBC 3ZMTA 2PI4A 4WFGA 4QJFB 3FB6C 3E89A 1M56C 5LGUA 3OM3B 4QE7A 2WLMA 3F7VC 2DQ0A 3K03A 1V54B 4JYCA 3CPWU 4WFBV 4KP4A 3ABKB 1J95A 3FYIB 5EBMC 3SPGA 2IJIA 3JD3A 4R8CA 3QO7A 1K9MW 4XDLA 4CBCA 1PKXA 2HLDG 3SJQC 1H8EG 3ZMSA 3KG2A 2DYSB 2Q69A 4PDRA 1Q82W 1YJNV 2OCCB 5EC2C 4L87A 1RPOA 1EFRG 1AI7A 2MK3A 3GB7C 4BIZA 1KD1W 5C93A 3SYQA 5LHIA 5L3EA 1JCHA 1GM7A 5L3BA 1DF4A 2P7TC 4UUJC 2A79B 3CC7V 1DLBA 4Q20A 1E1QG 3LDDA 1KP2A 1YTFB 2IJKA 3JD2A 4MVZA 4JF3A 3QNEA 1VQPV 1K97A 1VQ9V 3X2QB 5KUMA 1K7DA 1RPRA 4GX0A 3I56V 4JTCB 4MW3A 4RO2A 4PA7A 1CPYA 2EILC 2WSSG 1QVFU 3ZMVA 2NLJC 5J9PC 2WLNA 4QNHB 2EIKB 1K5QA 1R3IC 2GHYA 3ZRSA 3OMAB 3ZRXA 5BZBA 3SPHA 3E86A 1QLEB 2IJJA 3WG7C 2Z5UA 1QR9A 4TT3G 2IU0A 3ZIAG 5LHGA 4CZZA 2F43G 2ITDC 1QR8A 3BEHA 2C2AA 4GCZA 3VBBA 1S72V 2OCCC 5EBWC 1MOFA 5FL7G 1G8MA 2ZR3A 3AG4C 1DF5A 2HG5C 3W7XA 1QLNA 2DYRC 1BHAA 5IYCO 4GT1A 2HR3A 4R50A 2YEVA 2PI5A 3P30A 4FMTA 5L3DA 1B6QA 2QEXV 1GTOA 3SPJA 4LC1A 2WLLB 3LUTB 2WLLA 1QCEA 4E2LA 3A0RA 2EZOA 1Q81W 3T2MA 2X7RB 1Q86W 1M90W 1JX9A 1GK9A 1ZWIC 4PDLA 4G27B 3E83A 4JTDB 4ZKIA 3OUSA 2LP7A 3IC7A 1N8RW 1NR7A 1M56B 1RM1C 3DTUB 3NXSA 1FXHA 3SYOA 1GO3F 3ABLC 4QPJA 2EIKC 5EBLC 2Q67A 2B1IA 1XL4A 3ZMZA 2WLKA 4DO2A 2V1DA 4JTAB 1COWG 3JCZA 1FXKB 3HB3B 3EHBB 4JASA 4UVCA 3K79A 2EBOA 3T4DA 2WWWA 3ABUA 3E8GA 4P9OA 2OTLV 3LDCA 1NVPB 3TETA 2X6BA 2IH1C 2HVKC 2XAGA 4X89A 3F7YC 2EIMC 4P2ZA 1PNKA 4RUEA 2XNDG 1PNMA 3ETGA 4YXWG 3AEIA 2IJHA 1NR1A 2QE7G 4OXSA 4PA6A 1S76D 4PA3A 3OE7G 1WLEA 3ASOB 2DWEC 2X0LA 5B1OA 3ZN0A 4MVRA 1PNLA 3ZCCA 1ROPA 2EILB 3AG3C 3ETEA 1DTOA 2P90A 3CCUV 3VOUA 1ENVA 1OCRC 2LFRA 1R6NA 3AG2C 1SETA 1OCCC 4G28B 3WG7B 5KA6A 1FXKC 5KA5A 3TK1A 1EZJA 1AJPA 4PELA 4TSFG 2XASA 4MTGA 1AR1B 5H9CA 2Y69C 1K3EA 3ASNC 3MD0A 3AG4B 3JD4A 4BIUA 1YHQV 4P30A 4WFHA 1EBOA 2DYRB 1IXMA 5DN6G 3K0GA 1GM8A 5EC1C 1YITV 3H01A 2WLHA 4MVQA 3B77A 1YIJV 3OFNG 3STZC 3E2EA 4MS2A 5L3CA 1SESA 1W0JG 5H6QA 3CYOA 2HFEC 2P67A 4MVUA 5LHHA 3ASOC 5CBFA 5IY5C 1BL8A 4I5SA 4BW5A 1RM1B 3GWOA 3K3WA 2ZQMA 1R6KA 2JIZG 2LFSA 5E1AC 3E8BA 1I5XA 4MT8A 2A9HA 2M7WA 3ABLB 2WAMA 3CMAV 1SERA 1VQ5V 5DM6V 1VQMV 2W6JG 1AI6A 3OW2U 5CMUA 3K04A 5CA3A 1TUEB 2V7QG 3W7WA 2EIJC 1GM9A 2HVJC 4WCEV 4J9YB 1S77D 2B5UA 2OT5A 1YTFD 1F4NA 2JEXA 3ZRWB 3ZRWA 1VQ6V 1BHBA 3ABMC 2R9IA 3LDEA 1KC8W 4QE9A 4DXWA 1F23A 4XBFA 2WPDG 3SYCA 4JAUA 2GSMB 1OCOB 3SYPA 2EIMB 3ZN1A 1SZTA 4UVBA 2EINC 1JVMA 3RW0A 5B3SC 4WF9V 3ZRVA 1OCZC 2XAJA 1JQ0A 2FTKA 3K9AA 3OEHG 1H38A 1UJWB 2XAHA 3FB8C 4RAIA 3OAAG 3RVZA 1FXVA 3JD1A 1M1KW 3D36A 4QIWF 3MHSC 3AG3B 4MTXA 5B1AB 4UXNA 1L1FA 1K34A 1JPXA 2NNUA 1NJIW 1AJQA 3AG1C 4MSWC 2ZR2A 5LBQA 1OCRB 3AG2B 1OCCB 3G6EV 2DQ3A 1CEZA 1FXKA 2HKOA 5LGTA 3MHHC 1Y66A 3CCEV 2Y69B 3ASNB 4F4LA 2YSUB 1NH2B 4ZBMA 3CCMV 2UXNA 3CCSV 1M57C 1VQKV 3I55V 1YI2V 3TCUA 1P7BA 4H33A 2ZDIC 4PDVA 1AI5A 4WFEA 1OZ0A 2DW4A 1I5YA 1OCOC 2XOKG 5L3FA 3K08A 5H6RA 3SYAA 1E1RG 1YJWV 3JYCA 2X6AA 3LSQA 1M9NA 2ITCC 2W6IG 4LCUC 3K06A 4H37A 3UKMA 2WLJA 2XAFA 3JD0A 1K5SA 3E35A 4U7OA 5IY5B 1KKDA 3FB5C 1AJNA 4J9ZB 2Q6AA 5B1AC 4GX5A 2D3OW 1H2GA 3CCVV 3OR6C 4LP8A 4MW8A 4GX2A 2HJFC 1K33A 4G2KA 3K0DA 1E79G 3CD6V 1NVPD 1JJ2U 1K73W 3LNMB 2EZPA 2IW5A 2EIJB 1MSWD 4JGSA 4MTFA 4R6ZA 5IDJA 1G4YB 5HFMA 3DGEA 1S0VA 1VQLV 1THZA 2ATKC 1OHHG 3QO8A 1VQ7V 4TWKA 3ABMB 4GX1A 5KUKA 1R3JC 1FFTB 2Q68A 4I9WA 2CK3G 4RQEA 1H8HG 4UVAA 3CCJV 3T1CA 3OR7C 3CCQV 1MG1A 1YSCA 2EINB 5B3SB 3OGCC 1OCZB 2W0FC 3G4SV 5B1BB 1V55B 1NQTA 4ASUG 1PL0A 4HZ3A 4FPPA 1AI4A 2JDIG 2ZXWC 2AHZA 2H94A 2JJ2G 2ZD9A 3RBZA 4KUMA 1JOYA 5GW7A 5L3GA 3HPLC 3OMNB 4U7NA 5IYDO 3T4ZA 2QA4V 3IGAC 5CBGA 3OEEG 4N23A 4XDJA 1YJ9V 1VQ8V 4XDKA 3AG1B 1F4MA 2IU3A 3CXCU 3ZMUA 4HYOA 1QBZA 2Z3YA 3STLC 1R3LC 1FS0G 1QVGU 3CC2V 2QM7A 4RQFA 3SPIA 4JYBA 1KP3A 1KQSU 3M99B 4LBEC 1F51A 2B1GA 2UXXA 3B8NA 1W2BU 3E8HA 4WFAV 1BMFG 2JK5C 2Y48A 1M57B 1NBMG 1V54C 2R9RB 5CBHA 5EK0A 3BY6A 4UV8A 5CN0A 3ABKC 4MVSA 2ZDIA 4PA4A 4RUFA 2JEUA 3EFFK 1WPXA 3FYEB 2EJRA 2AHYA 3OUFA 4QPKA 1Q7YW 5B1BC 1V55C 3CMEV 3SPCA 2DYSC 1R3KC 3IFXA 1SRYA 1ORQC 1CP9A 3ABTA 5LGNA 1K8AW 4PA9A 1XL6A 4MVMA 2YEVB 4HAMA 1AROP 3PJSK 2DWDC 3E8FA 3R65A 1R73A 3CCLV 1GMGA 4BAYA 4MVOA 3RVYA 5B1NA 1P4RA 3ZJZA 3W7SA 4FIPC 4JPRA 2JJ1G 2OTJV 1NKDA 1LNQA 1GKFA 1Y4MA 4KFMA 1MABG 2IH3C 3X2QC 3W7UA 3G71V 2BOCC 1KECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR6 C;  2ITD C;  3STZ C;  1S5H C;  3BEH A;  4LP8 A;  4MS2 A;  4MW8 A;  4GX2 A;  2HJF C;  1K4C C;  2OCC C;  5EBW C;  3K0D A;  3AG4 C;  2A0L A;  2HG5 C;  2HFE C;  4MVU A;  4MTO A;  2X6C A;  2DYR C;  3ASO C;  2H8P C;  5CBF A;  5IY5 C;  1BL8 A;  3LNM B;  4R50 A;  2YEV A;  4BW5 A;  1QLE C;  3UM7 A;  3F5W C;  4WFF A;  4R7C A;  3FB7 C;  4PDM A;  3SPJ A;  5E1A C;  3E8B A;  2WLI B;  2WLL B;  2WLL A;  2WLI A;  2A9H A;  2KB1 A;  1G4Y B;  3LUT B;  4MTF A;  4R6Z A;  4P9P A;  2ATK C;  3T2M A;  1K4D C;  4TWK A;  2K1E A;  4GX1 A;  5KUK A;  1ZWI C;  1R3J C;  4PDL A;  2Q68 A;  4G27 B;  4I9W A;  3E83 A;  4JTD B;  4EKW A;  2QTO A;  3OUS A;  4X8A A;  3OR7 C;  3T1C A;  3K04 A;  4X88 A;  3SYO A;  2EIJ C;  2QKS A;  2HVJ C;  3OGC C;  2W0F C;  4J9Y B;  3ABL C;  4HZ3 A;  2EIK C;  5EBL C;  2Q67 A;  1XL4 A;  2WLK A;  2ZXW C;  2BOB C;  3ABM C;  2AHZ A;  2ZD9 A;  3LDE A;  3RBZ A;  4JTA B;  4QE9 A;  4DXW A;  3HPL C;  4WFG A;  3T4Z A;  3SYC A;  3IGA C;  3SYP A;  3FB6 C;  3E89 A;  1M56 C;  5CBG A;  4QE7 A;  4XDJ A;  2WLM A;  2EIN C;  1JVM A;  3F7V C;  3RW0 A;  5B3S C;  3K03 A;  1OCZ C;  4XDK A;  3T4D A;  4HYO A;  1J95 A;  5EBM C;  3SPG A;  3FB8 C;  3STL C;  4RAI A;  1R3L C;  3E8G A;  4P9O A;  4R8C A;  3LDC A;  4XDL A;  4CBC A;  3SPI A;  3RVZ A;  3TET A;  2X6B A;  2IH1 C;  3SJQ C;  2HVK C;  3KG2 A;  4LBE C;  4X89 A;  3F7Y C;  3E8H A;  2EIM C;  2JK5 C;  4P2Z A;  2Q69 A;  2R9R B;  1V54 C;  4PDR A;  4RUE A;  3AG1 C;  4MSW C;  5EK0 A;  5CBH A;  5EC2 C;  3ABK C;  4MVS A;  4PA6 A;  4OXS A;  4PA4 A;  4RUF A;  4PA3 A;  3GB7 C;  2DWE C;  3SYQ A;  3EFF K;  4MVR A;  2AHY A;  3OUF A;  3AG3 C;  5B1B C;  1V55 C;  2P7T C;  4UUJ C;  2A79 B;  4F4L A;  4ZBM A;  3SPC A;  3VOU A;  2DYS C;  1M57 C;  1R3K C;  3IFX A;  3LDD A;  1ORQ C;  1OCR C;  4MVZ A;  3AG2 C;  3TCU A;  1P7B A;  4H33 A;  1OCC C;  4G28 B;  4PA9 A;  1XL6 A;  4MVM A;  4PDV A;  4WFE A;  5KUM A;  4GX0 A;  1OCO C;  3PJS K;  2DWD C;  3E8F A;  3K08 A;  3R65 A;  3SYA A;  4JTC B;  3JYC A;  2X6A A;  4MW3 A;  4MTG A;  4PA7 A;  2EIL C;  4RO2 A;  2ITC C;  4MVO A;  2Y69 C;  4LCU C;  3ASN C;  3K06 A;  4H37 A;  2NLJ C;  3RVY A;  3UKM A;  5J9P C;  2WLN A;  2WLJ A;  4QNH B;  3ZJZ A;  1R3I C;  4P30 A;  4WFH A;  3ZRS A;  1LNQ A;  1KKD A;  5BZB A;  3K0G A;  3SPH A;  4KFM A;  3E86 A;  5EC1 C;  2IH3 C;  3FB5 C;  3WG7 C;  3X2Q C;  4J9Z B;  2WLH A;  4MVQ A;  2Q6A A;  5B1A C;  2BOC C;  4GX5 A; 
#chains in the Genus database with same CATH topology
 1R1B A;  3UO3 A;  5JQG A;  1SS3 A;  5LMU O;  4ZOL A;  4H44 B;  4ICG A;  2A0L A;  3DC5 A;  4MTO A;  3W7T A;  3K5L A;  2H8P C;  1N34 O;  4LNU A;  1QLE C;  3B8M A;  4CH6 A;  1FPO A;  3QTC A;  3QO5 A;  3JAW A;  1VQ4 V;  3BFR A;  1BT8 A;  1AP5 A;  1K4D C;  4GLX A;  2K1E A;  4LFA B;  4ABM A;  3KCX A;  2YID A;  3H1L H;  2QTO A;  1AP6 A;  5LMN B;  4FZ0 A;  1HR0 O;  4Z1M G;  3B40 A;  5H2F Z;  4QGP A;  5LA6 A;  3LSS A;  2ODM A;  4JYA O;  1VP7 A;  2UU9 B;  2Q7G A;  4K0K O;  2PI4 A;  1L0L H;  4WFG A;  3FB6 C;  1M56 C;  4K35 A;  1Z5W A;  2ILM A;  3R66 A;  2RJZ A;  3CPW U;  4WFB V;  3ABK B;  3SPG A;  1F7Y A;  4R8C A;  5JJN B;  5IWA O;  4DR3 B;  4PDR A;  3C3T A;  1YJN V;  1GRJ A;  4OPA A;  1EFR G;  4JI6 B;  3SYQ A;  3A2F A;  1NU1 H;  1HDJ A;  5LHI A;  4NR1 A;  3CC7 V;  1E1Q G;  3JAT A;  2P5O A;  4RWU A;  2CTQ A;  4JF3 A;  1VQP V;  1K97 A;  2VRZ A;  3JCU Z;  3I56 V;  3QF7 A;  2FB5 A;  4LFC B;  1JFF A;  3HKB B;  2GDS A;  3ZMV A;  2NLJ C;  4EFB A;  2OCH A;  2RN9 A;  3ZHV A;  1WN7 A;  5BZB A;  2HHH B;  1QLE B;  1WB8 A;  1XDC A;  4O4I B;  3WG7 C;  2Z5U A;  4DV2 O;  1I94 O;  2QWN B;  4IHJ A;  1JA8 A;  1QR8 A;  4I55 B;  1S72 V;  2CGN A;  2OCC C;  1MOF A;  4JI2 O;  3AG4 C;  2Q7H A;  4CS4 A;  3W7X A;  3BA8 A;  2VS0 A;  2OYQ A;  2CUG A;  2PI5 A;  2K9P A;  1VF6 C;  3P30 A;  3LNN A;  4H13 B;  2QEX V;  3SPJ A;  1N0J A;  4LC1 A;  2CAZ C;  2QKC A;  2PGG A;  1EZV H;  5IJ9 B;  1XQ8 A;  1M90 W;  3ZBH A;  2GBO A;  1RSO A;  3IC7 A;  1M56 B;  2OIG A;  1RM1 C;  2L6L A;  3SYO A;  3K5N A;  2DE0 X;  4I7Z B;  1IBM O;  1XL4 A;  4X62 O;  2WLK A;  5H5N A;  4O2A B;  3ZX6 A;  1FXK B;  3HB3 B;  2P22 C;  3BHP A;  3CRM A;  3EHB B;  4JAS A;  4UCT A;  4UVC A;  1KKC A;  3T4D A;  3CE2 A;  4IYI A;  5A2Q N;  3ABU A;  3E8G A;  3LDC A;  5GTH Z;  2X6B A;  3RYH B;  2AGA A;  3WB2 A;  3F7Y C;  2ARH A;  4RUE A;  2XND G;  2Q8V A;  4YXW G;  2CTW A;  4OXS A;  2DWE C;  1Y76 A;  2X0L A;  3ZN0 A;  5BXZ A;  3D36 C;  2R70 A;  2IM9 A;  1MNG A;  2LGQ A;  3ETE A;  5JJJ B;  3CEI A;  3U0Z A;  3CCU V;  3VOU A;  4X65 O;  1PV0 A;  2D2C B;  2VQE B;  2QM4 A;  3GVM A;  1OCR C;  2LFR A;  1OCC C;  3WG7 B;  5KA6 A;  4X1Y A;  3TK1 A;  2XUM A;  4MTG A;  5KMG B;  1AR1 B;  2E76 B;  2QWR B;  4DUZ B;  2Y69 C;  3AG4 B;  3BAB A;  5J2T A;  4BIU A;  1N34 B;  4P30 A;  4WFH A;  4PHZ A;  1HNW O;  1YIT V;  3H01 A;  2WLH A;  4LH6 A;  3OFN G;  3STZ C;  3E2E A;  5L3C A;  1US6 A;  2HFE C;  1LUV A;  3ASO C;  1N32 B;  1RM1 B;  5EYP A;  5E1A C;  3N2G B;  4JI1 O;  1DGS A;  2H3O A;  4BW9 A;  1SER A;  4UCO A;  1FFX A;  4YIP A;  2Q5Z A;  1R6T A;  1VQM V;  3O65 A;  3QG5 A;  1TVK B;  4NTX A;  4JV5 O;  3D3Q A;  2UXC O;  3FFQ A;  1WNS A;  4U3J A;  2B5U A;  1YTF D;  3G6B A;  2CGO A;  3ZRW B;  2CH7 B;  2ZM6 O;  1BHB A;  2RCV A;  1BZK A;  4QE9 A;  3IAY A;  2E3C A;  2WPD G;  3SYC A;  1XMO O;  2GSM B;  2CTR A;  1VMG A;  4C7U A;  2LJ2 A;  4LF5 B;  1JQ0 A;  2XAH A;  3FB8 C;  3RVZ A;  1YCI A;  1M1K W;  3DXR A;  4QIW F;  3MHS C;  2ADQ B;  4MTX A;  1EN6 A;  5IYZ B;  1NS1 A;  1L1F A;  1K34 A;  1JPX A;  2PUS A;  1OCR B;  4YY3 B;  1OCC B;  4FLY A;  5LGT A;  1D5N A;  3MHH C;  2MW2 B;  2Y69 B;  4ZBM A;  1GAX A;  2PF4 E;  3CCS V;  1VQK V;  4ZOL B;  3MDS A;  5BMV A;  3SR2 C;  2RMK B;  1I94 B;  4WFE A;  1AI5 A;  4O2B B;  3P3P A;  4YHH O;  3AK1 A;  5K1P A;  1I5Y A;  4JI4 B;  1OCO C;  2G38 A;  5H6R A;  1PL4 A;  2X6A A;  3H1K H;  3K06 A;  4LF4 O;  3E35 A;  1PPJ H;  4J10 A;  1PP9 H;  3FB5 C;  4FFB A;  4J9Z B;  1Q6H A;  1URF A;  1TAE A;  2UXD B;  1EN4 A;  3OR6 C;  3U11 A;  4CH3 A;  3J81 N;  1A32 A;  4GX2 A;  2HJF C;  4DR2 B;  5LA6 B;  1K33 A;  2E75 B;  3K0D A;  1L8D A;  2UUB O;  3UO2 A;  1Q3E A;  2EZP A;  1S5J A;  4CC5 A;  3QO8 A;  1OHH G;  4LWS A;  1VQ7 V;  5KUK A;  1R3J C;  4IYH A;  1I0H A;  4I9W A;  2CK3 G;  3FX7 A;  4FLT A;  1YSC A;  3OGC C;  3G4S V;  4DV3 B;  1V55 B;  4J7K A;  3ZHS A;  4HZ3 A;  3TGU H;  5JCO A;  2UXB O;  2JDI G;  2ZXW C;  2ZD9 A;  2JJ2 G;  1IXB A;  2CDY A;  3T4Z A;  3SJB C;  4N23 A;  4DV4 O;  1HW7 A;  4XDK A;  4NVP A;  1F4M A;  4HYO A;  3JAT B;  1R3L C;  1FS0 G;  4RQF A;  2JVD A;  3S3W A;  5GON A;  3ETQ A;  1GN6 A;  3E8H A;  4WFA V;  3AK3 A;  1V54 C;  4EEQ A;  2LQT A;  5CN0 A;  3CHX A;  4MVS A;  4LFA O;  4RUF A;  3A0B Z;  1B3Q A;  1ZUQ A;  2JEU A;  3B2E E;  1AIL A;  3JAS B;  4I4T A;  3IC9 A;  1IBK B;  1H2L A;  1SQX H;  1GN4 A;  1HNW B;  5LGN A;  2UU9 O;  2YIC A;  1ARO P;  2NR5 A;  4FLX A;  1R73 A;  3CCL V;  1GMG A;  4BAY A;  4MVO A;  3RVY A;  1OV9 A;  4JPR A;  2OTJ V;  1NKD A;  4KXR A;  1Y4M A;  4GKJ O;  4X20 A;  4NB5 A;  4JI3 O;  1T5E A;  4LF6 B;  2JRI A;  1K92 A;  3TXS A;  4UV9 A;  4DR3 O;  4ZHQ A;  2NN4 A;  2X6C A;  3N2K A;  5HFL A;  2FL4 A;  1WA8 A;  1VQN V;  1P84 F;  3UM7 A;  4LF7 B;  4F6R A;  1SZX A;  4R7C A;  4PDM A;  3OGI B;  3P32 A;  3B4S A;  4FJC C;  2WLI A;  5FNV B;  3CC4 V;  2ZXW B;  5EIB D;  1VQO V;  2AXT Z;  2XAQ A;  4EKW A;  4N21 A;  4PI0 A;  4BIO A;  1S3J A;  1NH2 D;  4LFC O;  2Q0A A;  4ZI7 B;  1Y74 A;  1WJZ A;  3ZMT A;  1O9H A;  1WPB A;  2AZ0 A;  1Y76 B;  1ZLZ A;  4QE7 A;  2WLM A;  2ZIN A;  3K03 A;  1V54 B;  5JH7 B;  3C90 A;  4UCR A;  3KKY A;  5EBM C;  3JD3 A;  3QO7 A;  1K9M W;  5BR8 O;  1M5I A;  5FPR A;  1H8E G;  1Q8I A;  4X1Y B;  2Q69 A;  4I0X A;  4ZIB A;  4TV9 A;  4OGQ B;  2KSD A;  5EC2 C;  5J2T B;  4YHH B;  1VF5 B;  2MK3 A;  2YUA A;  4HNA B;  5CA1 B;  4AQY B;  1JCH A;  4LF4 B;  2A79 B;  3PN1 A;  3CRR A;  5KHG A;  2GUZ A;  2IJK A;  3QNE A;  1VQ9 V;  1K7D A;  1QQC A;  3CXH F;  2E5L B;  3RYF B;  4JTC B;  1CPY A;  1QVF U;  4X1I B;  4JI5 B;  2UUB B;  1WB7 A;  1K5Q A;  2GHY A;  3ZRS A;  3OMA B;  4GUN A;  2XT9 A;  2ZE5 A;  1IX9 A;  1XIL A;  1Z5V A;  3E86 A;  1QR9 A;  1H2K A;  2IU0 A;  2ETN A;  1NI8 A;  5LHG A;  2ITD C;  2C2A A;  2Q9L A;  1O9G A;  4U3J B;  1G8M A;  2ZR3 A;  3JAM N;  1DF5 A;  2HG5 C;  2L35 A;  2RDC A;  1BHA A;  4R50 A;  4B7K A;  1KU9 A;  5L3D A;  4O4J A;  2WLL B;  1IBL O;  1QCE A;  4E2L A;  2UXB B;  3A0R A;  1J5E B;  4LFB B;  1Q81 W;  3O9O A;  3EXA A;  1ZWI C;  1GK9 A;  3FAV A;  4G27 B;  4DK1 A;  4J41 A;  1N8R W;  1NR7 A;  4I50 B;  4DV4 B;  1BCC H;  1WAZ A;  1FXH A;  1AB3 A;  2P4V A;  4FM1 A;  4DUZ O;  4QPJ A;  2B1I A;  3ZMZ A;  4DO2 A;  2V1D A;  5JVD B;  3RT3 C;  1COW G;  4X1K B;  1SQG A;  4L8J A;  2EBO A;  1XNQ B;  3AK2 A;  2Q7E A;  1H2M A;  5BMV B;  2HP8 A;  1N32 O;  1XEQ A;  4A5U B;  5ITZ A;  3ETG A;  2IJH A;  1S76 D;  2QE7 G;  3HKE A;  4PA3 A;  3OE7 G;  3T1H B;  4FFB B;  5KHI A;  3AG3 C;  3RYC A;  4GKJ B;  2DMX A;  3AG2 C;  2IBZ H;  4O4L B;  4JI3 B;  1HP8 A;  1FXK C;  5KX5 A;  2YXY A;  2YIB A;  4TSF G;  2HJD A;  4LF5 O;  1XMQ B;  2JGD B;  2YC0 A;  3I5D A;  4O4H B;  3UQ8 A;  4NXN B;  1IXM A;  3K59 A;  3K0G A;  1AR4 A;  5EC1 C;  2UUC B;  1YIJ V;  2FKX A;  2RNB A;  3T1Y B;  1W0J G;  5IJ0 B;  1L0N H;  2QTS A;  2Z0A A;  1M93 A;  4YY3 O;  3CYO A;  2P67 A;  4MVU A;  4IIJ A;  4PI2 A;  5IY5 C;  2DOS A;  4GKK B;  1R6K A;  1ZL8 B;  2LFS A;  3E8B A;  4NYK A;  2QWO B;  3H9V A;  3CMA V;  1BGY H;  1VQ5 V;  2GTA A;  5DM6 V;  2QDO A;  4DR6 O;  2BTQ A;  1AI6 A;  2F66 C;  3K04 A;  4JI4 O;  1TUE B;  1IDS A;  5GON B;  5FPO A;  2V7Q G;  2PTM A;  1S77 D;  2F95 B;  2OT5 A;  4FFK A;  1YVW A;  4J7J A;  5EZY A;  3LDE A;  2R9I A;  3JAK A;  4TUY A;  5BR8 B;  2YI9 A;  4Z2W A;  2R72 A;  4DXW A;  1F23 A;  5C8Y A;  3K9S A;  4I4T B;  2UXD O;  3ZRV A;  1OCZ C;  3GWK C;  2XAJ A;  3M8A A;  4F6E A;  4CC6 A;  4DR2 O;  1P7G A;  4RAI A;  4JAA A;  5F2V O;  1KUQ A;  3A8T A;  3JD1 A;  1SF9 A;  4X9Q A;  3AG3 B;  4J11 A;  2QKA A;  4UCU A;  4YJ2 A;  3AG1 C;  5LBQ A;  3AG2 B;  1N0N A;  1JR9 A;  4X20 B;  3SGI A;  1QU7 A;  4DV3 O;  1N36 B;  1M57 C;  4JI8 O;  3BAA A;  3I55 V;  1SQV H;  4WBN A;  2ZDI C;  4D7S A;  3N2K B;  1WA8 B;  3SYA A;  3RGB A;  1E1R G;  3JYC A;  3CRQ A;  2W6I G;  1SQP H;  5BY1 A;  1XRE A;  4U7O A;  2BE3 A;  2YDE A;  5IY5 B;  1KKD A;  3CSX A;  4DV6 B;  3HKC A;  1X59 A;  4K8Z A;  2F4V B;  2Q6A A;  1IBL B;  4DR1 O;  2D3O W;  1H2G A;  3CCV V;  4LP8 A;  1FKA O;  1E79 G;  3CD6 V;  1NVP D;  1JJ2 U;  1XI1 A;  1K73 W;  3OTO O;  4B3S O;  2F23 A;  5LXT A;  4OX9 B;  4MTF A;  1IBK O;  4JZG A;  1GN2 A;  1VQL V;  3KZI Z;  4RQE A;  1H8H G;  1D2D A;  3RFR A;  1OCZ B;  1NQT A;  1PL0 A;  4AIL C;  1NTZ H;  5CA0 A;  2BSK B;  4KUM A;  5GW7 A;  5L3G A;  3L70 H;  2YIB D;  4U7N A;  2QWQ B;  4DRX A;  2QWP B;  2KG7 A;  3OEE G;  4LF6 O;  4YIO A;  3AG1 B;  5IT9 N;  1QBZ A;  3STL C;  3CC2 V;  4JI0 B;  1PM9 A;  2QM7 A;  4JYB A;  2KKW A;  5LOV A;  4LF7 O;  3M99 B;  2B1G A;  3B8N A;  1W2B U;  1BMF G;  2JK5 C;  5LYJ B;  1KBH A;  1M57 B;  3UT5 B;  4UV8 A;  4DR7 O;  2E74 B;  4PA4 A;  3APO A;  3HKD A;  3EFF K;  3CWB H;  2EJR A;  2AHY A;  3OUF A;  1Q7Y W;  1V55 C;  4I9Q A;  3CME V;  3M7M X;  3IFX A;  3JAR A;  1ORQ C;  1CP9 A;  3ABT A;  1TUB B;  4PA9 A;  4MVM A;  1SA0 B;  4TQD A;  2QSA A;  3Q4H B;  1P4R A;  3AG7 A;  3W7S A;  3K5M A;  1LNQ A;  1MAB G;  4DV0 B;  4LF8 B;  1S5H C;  1VIB A;  5JQG B;  2Q73 A;  3CB2 A;  1I08 A;  2O57 A;  3JAL A;  4DR6 B;  3ZS8 C;  4LNU B;  1KYO F;  2R9A A;  4AQY O;  2YIA A;  2KB1 A;  3CP1 A;  3JAW B;  4P9P A;  1PD3 A;  1U97 A;  3BRC A;  3N27 A;  2P6J A;  1W0K G;  2E5L O;  2PYL A;  2RQ6 A;  4JI5 O;  2BOB C;  4BWA A;  3HKE B;  4U3F H;  4QJF B;  1SQF A;  3U10 A;  3OM3 B;  1LUW A;  2DQ0 A;  4JYC A;  4IL6 Z;  3FYI B;  1J95 A;  3TJT A;  2IJI A;  4NKG B;  5K1X A;  4X66 B;  4DUY B;  3SJQ C;  3ZMS A;  3KG2 A;  4LF9 B;  4JI8 B;  1J5E O;  1Q82 W;  4LFB O;  3OD4 A;  4L87 A;  2GV9 A;  1AI7 A;  3K57 A;  3BPZ A;  4BIZ A;  2WA4 A;  5L3E A;  1GM7 A;  5L3B A;  1DF4 A;  2P7T C;  2F1M A;  1DLB A;  4Q20 A;  4W4K A;  5TIS Z;  2UUA B;  1KP2 A;  1YTF B;  3JD2 A;  1VF7 A;  3ZHQ A;  5KUM A;  4DR1 B;  1QHT A;  1KB9 F;  1JFF B;  3F5T A;  4PA7 A;  2WSS G;  4DV1 B;  3L71 H;  3WB1 A;  3HKB A;  3WB0 A;  4FM0 A;  5J9P C;  4DK0 A;  2Y0I A;  4PV1 B;  2EIK B;  1XNQ O;  1R3I C;  3OTO B;  3ZRX A;  3G67 A;  4B3S B;  4KHP B;  3SPH A;  4TT3 G;  2ZNI A;  4IHJ B;  2F43 G;  3BEH A;  4I55 A;  1G1X B;  5D5P A;  1SQB H;  1QLN A;  4DR5 B;  3JAK B;  4GT1 A;  3T1H O;  2YEV A;  1HNZ O;  4FMT A;  1B6Q A;  4PJ0 Z;  5CB4 A;  4J80 A;  3NR7 A;  1LR1 A;  3T2M A;  5IJ9 A;  4IGG A;  3OTF A;  1Q86 W;  1JX9 A;  3OUS A;  1RSO B;  2LW1 A;  3DTU B;  1VAR A;  3NXS A;  4AHC A;  4FLZ A;  4DW0 A;  1XMQ O;  1XNR O;  2QGN A;  4NXN O;  4JTA B;  1CXZ B;  3JCZ A;  3DSQ A;  2UUC O;  1XHX A;  3T1Y O;  2WWW A;  4DR7 B;  5DEC A;  4B3R B;  2OTL V;  3J7A U;  5KHJ A;  3RYH A;  2IH1 C;  4TOI A;  4GKK O;  3ZHT A;  1MMM A;  1IUR A;  2ZIM A;  4KL1 A;  4AI8 A;  1WLE A;  5KAI Z;  4MVR A;  3HKC B;  1ROP A;  3ZHU A;  2PY5 A;  1SC5 B;  2BCC H;  1ENV A;  2QR4 A;  1SET A;  4G28 B;  3K58 A;  4PEL A;  2EX3 A;  2XAS A;  1YZB A;  5KMG A;  5H9C A;  3ASN C;  3CRA A;  1GM8 A;  1BE3 H;  1VF6 A;  3RWR D;  4B3T B;  3VQY A;  4MS2 A;  1SES A;  5H6Q A;  1AR5 A;  5CBF A;  1Q43 A;  5CA0 B;  3H1I H;  1BQ0 A;  5EYP B;  3GWO A;  3N2G A;  2KG7 B;  3RYI A;  1ZTE A;  2WAM A;  2YXL A;  1N36 O;  1FFX B;  2W6J G;  3OW2 U;  5CMU A;  2FML A;  3EVK A;  5CA3 A;  1TVK A;  4OPH A;  5LOV B;  4EFE A;  5JWP A;  1V9P A;  2HVJ C;  4WCE V;  3SJA C;  4J9Y B;  3JSL A;  3B09 A;  1FJG B;  2JEX A;  3ZRW A;  3VQV A;  2GTS A;  4DV6 O;  2CE4 A;  4XBF A;  1IZ3 A;  3ZHR A;  2F4V O;  4JAU A;  3SYP A;  1TGO A;  3ZN1 A;  3RW0 A;  5B3S C;  1Q90 D;  3K9A A;  3E22 A;  3OEH G;  3L72 H;  5JCO C;  3A0H Z;  3JAR B;  2LGW A;  1HNX B;  3DXR B;  3D36 A;  5B1A B;  1X4T A;  4OX9 O;  5IYZ A;  4FZ1 A;  2W0X A;  2NNU A;  1NJI W;  1AJQ A;  4MSW C;  1ZAU A;  4CS2 A;  4DV5 O;  3G6E V;  3HR0 A;  2DQ3 A;  1CEZ A;  2HKO A;  1Y66 A;  2JGU A;  3LSU A;  2WA3 A;  3ASN B;  1NH2 B;  3CCM V;  1N33 B;  3JAL B;  1P7B A;  4H33 A;  3FD9 A;  4B7E A;  4PDV A;  1ZSP A;  4O2B A;  2XOK G;  2VWJ A;  1M9N A;  4LCU C;  4H37 A;  1K5S A;  3ZED A;  3L73 H;  2N74 A;  4JI0 O;  1HNZ B;  1MSD A;  1QNM A;  1AJN A;  1H2N A;  2P4K A;  4NTY A;  2KQX A;  2M6Y A;  4MW8 A;  3CJH A;  1U96 A;  4G2K A;  2IW5 A;  4J42 A;  1P49 A;  2P06 A;  4JGS A;  4DYL A;  4EB6 A;  1XNR B;  1G4Y B;  3DGE A;  1THZ A;  4LWS B;  3L75 H;  3DC6 A;  1FFT B;  2Q68 A;  2V4D A;  1EM1 A;  3CCJ V;  1G6U A;  3T1C A;  3CCQ V;  2ZIO A;  1ZX3 A;  5B3S B;  5B1B B;  4ASU G;  4DR4 B;  1WP8 A;  4FPP A;  1AI4 A;  5D5Q A;  2AHZ A;  3RBZ A;  1JOY A;  2FYU H;  5IYD O;  2ZE7 A;  3IGA C;  4DV0 O;  4LF8 O;  4XDJ A;  1VQ8 V;  3G80 A;  2IU3 A;  3ZMU A;  4FLU A;  1QVG U;  3APQ A;  4NTW A;  1KP3 A;  1KQS U;  3BVO A;  4JI7 B;  1F51 A;  2UXX A;  2XHB A;  2VQF B;  2Y48 A;  1NBM G;  2R9R B;  1DK1 A;  5CBH A;  5EK0 A;  3BY6 A;  4YJ3 A;  1WPX A;  1Q6U A;  3JAS A;  2YXH A;  2OWO A;  3SPC A;  2DYS C;  1S5L Z;  5J2U A;  4B3M B;  1XL6 A;  4DV7 B;  3TXQ A;  4K3A A;  2YEV B;  3PJS K;  3R65 A;  2YS8 A;  3RN4 A;  2A7W A;  2N05 A;  5CB4 B;  4X64 B;  1GN3 A;  1W59 A;  3ZJZ A;  1BS3 A;  2JJ1 G;  3X2Q C;  4X66 O;  3W7U A;  4DUY O;  4CS3 A;  3G71 V;  2PZS A;  4LF9 O;  3BCC H;  3QVN A;  2ZNJ A;  3ML0 A;  1K4C C;  2QM8 A;  4JZ2 A;  5IYB O;  1HWY A;  3WFV A;  4ZHQ B;  3L9D A;  4DW1 A;  3OMI B;  4NXM B;  3F5W C;  4F6R B;  3FKS G;  4WFF A;  3FB7 C;  2Q4P A;  4FK5 C;  2WLI B;  5FNV A;  1TA8 A;  1Z2G A;  4JAV A;  5LP6 A;  2LO1 A;  2UUA O;  3CCR V;  4X8A A;  3D3I A;  3VQX A;  4FLV A;  4X88 A;  3ETD A;  2QKS A;  4DV1 O;  1GH6 A;  4ZI7 A;  1Y74 B;  1UFI A;  4IT5 A;  4KHP O;  3E89 A;  2EUL A;  5LGU A;  3F7V C;  3JSN A;  4DV5 B;  5JH7 A;  4KP4 A;  4TV8 A;  5KLV H;  4XDL A;  4CBC A;  4DR5 O;  3BA9 A;  1PKX A;  2HLD G;  4UB6 Z;  3SDL A;  4LH7 A;  2DYS B;  5LMU B;  1YDX A;  4I0X B;  2OCC B;  4TV9 B;  1RPO A;  1RP3 B;  3GB7 C;  1KD1 W;  3OT7 A;  5C93 A;  4HNA A;  5CA1 A;  2Y4U A;  1IVS A;  1I7F A;  2YI8 A;  4UUJ C;  2XTA A;  3UCS C;  3LDD A;  2GUZ B;  2Y4T A;  3THO A;  3K5O A;  4MVZ A;  1N4C A;  4LR3 A;  3X2Q B;  1RPR A;  4JYY A;  4GX0 A;  1HR0 B;  3D8C A;  3RYF A;  4MW3 A;  4RO2 A;  2EIL C;  4TQF A;  4X1I A;  1MZE A;  3RYI B;  4BR6 A;  2WLN A;  4QNH B;  4JYA B;  4B3R O;  4K0K B;  2IJJ A;  1RFY A;  3ZIA G;  4CZZ A;  2ZE6 A;  3VBB A;  4GCZ A;  1B06 A;  5E79 Z;  5EBW C;  5FL7 G;  5AG2 A;  5GTI Z;  2ADP A;  2DYR C;  5IYC O;  2HR3 A;  1GTO A;  4O4J B;  3LUT B;  2WLL A;  5IWA B;  2EZO A;  4D6T H;  1YXB A;  1NZ6 A;  3E22 B;  2X7R B;  3FAV B;  4PDL A;  1BSM A;  3E83 A;  4JTD B;  4ZKI A;  2LP7 A;  2B9Z A;  5KHH A;  4I50 A;  1GO3 F;  4W4L A;  3ABL C;  2EIK C;  5EBL C;  2Q67 A;  2A06 H;  5JVD A;  2VWK A;  2BTO A;  4X1K A;  2CTP A;  1XBL A;  3K79 A;  1Q5O A;  4B3T O;  5B5E Z;  2F93 B;  4GYC B;  2ZCE A;  2Q0O C;  4P9O A;  1Y6X A;  3TET A;  1NVP B;  4DV2 B;  2HVK C;  2XAG A;  4X89 A;  1WP7 A;  2EIM C;  4P2Z A;  1BQZ A;  5ITZ B;  1PNK A;  4JI2 B;  1PNM A;  1KMI Z;  2OIE A;  3AEI A;  4PA6 A;  1NR1 A;  2DJV A;  5LL6 Y;  3ASO B;  4J7Z A;  5B1O A;  1PNL A;  2ZE8 A;  3ZCC A;  3WU2 Z;  2EIL B;  1UPG A;  1DTO A;  2P90 A;  2JS5 A;  3RYC B;  2JS3 A;  3CJH B;  1FJG O;  4UB8 Z;  1R6N A;  5KX5 B;  1SKV A;  4O4L A;  2ZKO A;  2A3Q A;  5KA5 A;  1EZJ A;  1AJP A;  1K3E A;  4EB6 B;  1IBM B;  3MD0 A;  3JD4 A;  4UCV A;  2JGD A;  4X62 B;  1YHQ V;  1JMK C;  4O4H A;  1EBO A;  2DYR B;  5DN6 G;  4UFZ A;  1HNX O;  4MVQ A;  3B77 A;  2DN9 A;  3C3S A;  5IJ0 A;  2AW9 A;  3MAQ A;  4IIJ B;  5LHH A;  5LP6 C;  4CH5 A;  1YF2 A;  1BL8 A;  4I5S A;  4BW5 A;  1NT2 B;  3K3W A;  2ZQM A;  2JIZ G;  1ZL8 A;  4MT8 A;  1I5X A;  1M4U A;  2A9H A;  2M7W A;  3ABL B;  4FVM A;  4Z1V A;  1N33 O;  4O4I A;  2BTQ B;  3CX5 F;  4PD4 F;  3W7W A;  2EIJ C;  1GM9 A;  4X65 B;  1F4N A;  3IJ4 A;  5EZY B;  1VQ6 V;  3ABM C;  5IE9 A;  4TUY B;  5KHK A;  1KC8 W;  1B04 A;  4YJ3 B;  5C8Y B;  1OCO B;  5LMN O;  2EIM B;  1SZT A;  4UVB A;  2EIN C;  1JVM A;  4WF9 V;  2FTK A;  1NTM H;  3CRC A;  1H38 A;  3S3X A;  1UJW B;  2Y0P A;  3OAA G;  5J2U B;  1FXV A;  3P3N A;  4UXN A;  1XHZ A;  4YJ2 B;  2ZR2 A;  1JJO A;  3ICX A;  4O2A A;  1SQQ H;  1FXK A;  1FYJ A;  4Q6G A;  3CCE V;  2LW7 A;  4JI1 B;  4F4L A;  5A9G A;  2YSU B;  4DR4 O;  2UXN A;  1MA1 A;  4WBN B;  1YI2 V;  3TCU A;  1OZ0 A;  2DW4 A;  4JI6 O;  5L3F A;  3K08 A;  4B08 A;  4JV5 B;  1YJW V;  1Y67 A;  2UXC B;  3LSQ A;  2ITC C;  3UKM A;  4GZR B;  2ZM6 B;  2WLJ A;  2XAF A;  3JD0 A;  5LP6 B;  1NTK H;  1OJH A;  4CH4 A;  1XMO B;  5B1A C;  4JI7 O;  4GX5 A;  2VQF O;  5EIB C;  3KCY A;  3LNM B;  2HHH O;  2EIJ B;  5LXT B;  1MSW D;  4FLW A;  4R6Z A;  1D5A A;  5IDJ A;  5HFM A;  1S0V A;  2ATK C;  4TWK A;  3ABM B;  4GX1 A;  4TV8 B;  5JJE B;  4B3M O;  4K8X A;  4UVA A;  3OR7 C;  4DV7 O;  1MG1 A;  1FAF A;  2EIN B;  5DED A;  2W0F C;  1XOU A;  1FD9 A;  4X64 O;  1XUQ A;  1MZF A;  2H94 A;  2EJ7 A;  2BSK A;  3CS5 A;  3HPL C;  3OMN B;  4DRX B;  2QA4 V;  5CBG A;  1YJ9 V;  3CXC U;  2PYJ A;  4H0L B;  2Z3Y A;  1EN5 A;  4FM2 A;  1AVM A;  1H2S B;  3SPI A;  1YEW A;  3SJC C;  5B66 Z;  2HEP A;  4NXM O;  4LBE C;  4E4E A;  5LYJ A;  2CH7 A;  3UT5 A;  2AZ2 A;  3ABK C;  2ZDI A;  3J80 N;  3HKD B;  4D7T A;  3FYE B;  3L74 H;  4QPK A;  3VQW A;  1VEW A;  5B1B C;  1R3K C;  1SRY A;  1K8A W;  1TUB A;  5KAF Z;  2ZT9 B;  1SA0 A;  4HAM A;  2DWD C;  3E8F A;  5FLX N;  1Q6I A;  3Q4H A;  5B1N A;  4FIP C;  2VQE O;  2N04 A;  3H1H H;  3H1J H;  1GKF A;  2QJ1 A;  4KFM A;  2IH3 C;  4HBN A;  4UCS A;  2BOC C;  1KEC A; 
#chains in the Genus database with same CATH homology
 1K92 A;  1S5H C;  4UV9 A;  3ML0 A;  1K4C C;  2QM8 A;  5IYB O;  1HWY A;  3WFV A;  2A0L A;  4MTO A;  2X6C A;  5HFL A;  3W7T A;  2H8P C;  1VQN V;  1QLE C;  3OMI B;  3UM7 A;  3F5W C;  3FKS G;  4WFF A;  3B8M A;  3FB7 C;  4R7C A;  4PDM A;  3P32 A;  4FK5 C;  2WLI B;  4FJC C;  2WLI A;  2KB1 A;  3CP1 A;  3QO5 A;  1VQ4 V;  4P9P A;  3CC4 V;  1PD3 A;  1K4D C;  2ZXW B;  2K1E A;  4JAV A;  1VQO V;  3CCR V;  2XAQ A;  4EKW A;  2P6J A;  2QTO A;  1W0K G;  4X8A A;  3D3I A;  4N21 A;  1S3J A;  4X88 A;  4Z1M G;  3ETD A;  1NH2 D;  2QKS A;  3LSS A;  2BOB C;  3ZMT A;  2PI4 A;  4WFG A;  4QJF B;  3FB6 C;  3E89 A;  1M56 C;  5LGU A;  3OM3 B;  4QE7 A;  2WLM A;  3F7V C;  2DQ0 A;  3K03 A;  1V54 B;  4JYC A;  3CPW U;  4WFB V;  4KP4 A;  3ABK B;  1J95 A;  3FYI B;  5EBM C;  3SPG A;  2IJI A;  3JD3 A;  4R8C A;  3QO7 A;  1K9M W;  4XDL A;  4CBC A;  1PKX A;  2HLD G;  3SJQ C;  1H8E G;  3ZMS A;  3KG2 A;  2DYS B;  2Q69 A;  4PDR A;  1Q82 W;  1YJN V;  2OCC B;  5EC2 C;  4L87 A;  1RPO A;  1EFR G;  1AI7 A;  2MK3 A;  3GB7 C;  4BIZ A;  1KD1 W;  5C93 A;  3SYQ A;  5LHI A;  5L3E A;  1JCH A;  1GM7 A;  5L3B A;  1DF4 A;  2P7T C;  4UUJ C;  2A79 B;  3CC7 V;  1DLB A;  4Q20 A;  1E1Q G;  3LDD A;  1KP2 A;  1YTF B;  2IJK A;  3JD2 A;  4MVZ A;  4JF3 A;  3QNE A;  1VQP V;  1K97 A;  1VQ9 V;  3X2Q B;  5KUM A;  1K7D A;  1RPR A;  4GX0 A;  3I56 V;  4JTC B;  4MW3 A;  4RO2 A;  4PA7 A;  1CPY A;  2EIL C;  2WSS G;  1QVF U;  3ZMV A;  2NLJ C;  5J9P C;  2WLN A;  4QNH B;  2EIK B;  1K5Q A;  1R3I C;  2GHY A;  3ZRS A;  3OMA B;  3ZRX A;  5BZB A;  3SPH A;  3E86 A;  1QLE B;  2IJJ A;  3WG7 C;  2Z5U A;  1QR9 A;  4TT3 G;  2IU0 A;  3ZIA G;  5LHG A;  4CZZ A;  2F43 G;  2ITD C;  1QR8 A;  3BEH A;  2C2A A;  4GCZ A;  3VBB A;  1S72 V;  2OCC C;  5EBW C;  1MOF A;  5FL7 G;  1G8M A;  2ZR3 A;  3AG4 C;  1DF5 A;  2HG5 C;  3W7X A;  1QLN A;  2DYR C;  1BHA A;  5IYC O;  4GT1 A;  2HR3 A;  4R50 A;  2YEV A;  2PI5 A;  3P30 A;  4FMT A;  5L3D A;  1B6Q A;  2QEX V;  1GTO A;  3SPJ A;  4LC1 A;  2WLL B;  3LUT B;  2WLL A;  1QCE A;  4E2L A;  3A0R A;  2EZO A;  1Q81 W;  3T2M A;  2X7R B;  1Q86 W;  1M90 W;  1JX9 A;  1GK9 A;  1ZWI C;  4PDL A;  4G27 B;  3E83 A;  4JTD B;  4ZKI A;  3OUS A;  2LP7 A;  3IC7 A;  1N8R W;  1NR7 A;  1M56 B;  1RM1 C;  3DTU B;  3NXS A;  1FXH A;  3SYO A;  1GO3 F;  3ABL C;  4QPJ A;  2EIK C;  5EBL C;  2Q67 A;  2B1I A;  1XL4 A;  3ZMZ A;  2WLK A;  4DO2 A;  2V1D A;  4JTA B;  1COW G;  3JCZ A;  1FXK B;  3HB3 B;  3EHB B;  4JAS A;  4UVC A;  3K79 A;  2EBO A;  3T4D A;  2WWW A;  3ABU A;  3E8G A;  4P9O A;  2OTL V;  3LDC A;  1NVP B;  3TET A;  2X6B A;  2IH1 C;  2HVK C;  2XAG A;  4X89 A;  3F7Y C;  2EIM C;  4P2Z A;  1PNK A;  4RUE A;  2XND G;  1PNM A;  3ETG A;  4YXW G;  3AEI A;  2IJH A;  1NR1 A;  2QE7 G;  4OXS A;  4PA6 A;  1S76 D;  4PA3 A;  3OE7 G;  1WLE A;  3ASO B;  2DWE C;  2X0L A;  5B1O A;  3ZN0 A;  4MVR A;  1PNL A;  3ZCC A;  1ROP A;  2EIL B;  3AG3 C;  3ETE A;  1DTO A;  2P90 A;  3CCU V;  3VOU A;  1ENV A;  1OCR C;  2LFR A;  1R6N A;  3AG2 C;  1SET A;  1OCC C;  4G28 B;  3WG7 B;  5KA6 A;  1FXK C;  5KA5 A;  3TK1 A;  1EZJ A;  1AJP A;  4PEL A;  4TSF G;  2XAS A;  4MTG A;  1AR1 B;  5H9C A;  2Y69 C;  1K3E A;  3ASN C;  3MD0 A;  3AG4 B;  3JD4 A;  4BIU A;  1YHQ V;  4P30 A;  4WFH A;  1EBO A;  2DYR B;  1IXM A;  5DN6 G;  3K0G A;  1GM8 A;  5EC1 C;  1YIT V;  3H01 A;  2WLH A;  4MVQ A;  3B77 A;  1YIJ V;  3OFN G;  3STZ C;  3E2E A;  4MS2 A;  5L3C A;  1SES A;  1W0J G;  5H6Q A;  3CYO A;  2HFE C;  2P67 A;  4MVU A;  5LHH A;  3ASO C;  5CBF A;  5IY5 C;  1BL8 A;  4I5S A;  4BW5 A;  1RM1 B;  3GWO A;  3K3W A;  2ZQM A;  1R6K A;  2JIZ G;  2LFS A;  5E1A C;  3E8B A;  1I5X A;  4MT8 A;  2A9H A;  2M7W A;  3ABL B;  2WAM A;  3CMA V;  1SER A;  1VQ5 V;  5DM6 V;  1VQM V;  2W6J G;  1AI6 A;  3OW2 U;  5CMU A;  3K04 A;  5CA3 A;  1TUE B;  2V7Q G;  3W7W A;  2EIJ C;  1GM9 A;  2HVJ C;  4WCE V;  4J9Y B;  1S77 D;  2B5U A;  2OT5 A;  1YTF D;  1F4N A;  2JEX A;  3ZRW B;  3ZRW A;  1VQ6 V;  1BHB A;  3ABM C;  2R9I A;  3LDE A;  1KC8 W;  4QE9 A;  4DXW A;  1F23 A;  4XBF A;  2WPD G;  3SYC A;  4JAU A;  2GSM B;  1OCO B;  3SYP A;  2EIM B;  3ZN1 A;  1SZT A;  4UVB A;  2EIN C;  1JVM A;  3RW0 A;  5B3S C;  4WF9 V;  3ZRV A;  1OCZ C;  2XAJ A;  1JQ0 A;  2FTK A;  3K9A A;  3OEH G;  1H38 A;  1UJW B;  2XAH A;  3FB8 C;  4RAI A;  3OAA G;  3RVZ A;  1FXV A;  3JD1 A;  1M1K W;  3D36 A;  4QIW F;  3MHS C;  3AG3 B;  4MTX A;  5B1A B;  4UXN A;  1L1F A;  1K34 A;  1JPX A;  2NNU A;  1NJI W;  1AJQ A;  3AG1 C;  4MSW C;  2ZR2 A;  5LBQ A;  1OCR B;  3AG2 B;  1OCC B;  3G6E V;  2DQ3 A;  1CEZ A;  1FXK A;  2HKO A;  5LGT A;  3MHH C;  1Y66 A;  3CCE V;  2Y69 B;  3ASN B;  4F4L A;  2YSU B;  1NH2 B;  4ZBM A;  3CCM V;  2UXN A;  3CCS V;  1M57 C;  1VQK V;  3I55 V;  1YI2 V;  3TCU A;  1P7B A;  4H33 A;  2ZDI C;  4PDV A;  1AI5 A;  4WFE A;  1OZ0 A;  2DW4 A;  1I5Y A;  1OCO C;  2XOK G;  5L3F A;  3K08 A;  5H6R A;  3SYA A;  1E1R G;  1YJW V;  3JYC A;  2X6A A;  3LSQ A;  1M9N A;  2ITC C;  2W6I G;  4LCU C;  3K06 A;  4H37 A;  3UKM A;  2WLJ A;  2XAF A;  3JD0 A;  1K5S A;  3E35 A;  4U7O A;  5IY5 B;  1KKD A;  3FB5 C;  1AJN A;  4J9Z B;  2Q6A A;  5B1A C;  4GX5 A;  2D3O W;  1H2G A;  3CCV V;  3OR6 C;  4LP8 A;  4MW8 A;  4GX2 A;  2HJF C;  1K33 A;  4G2K A;  3K0D A;  1E79 G;  3CD6 V;  1NVP D;  1JJ2 U;  1K73 W;  3LNM B;  2EZP A;  2IW5 A;  2EIJ B;  1MSW D;  4JGS A;  4MTF A;  4R6Z A;  5IDJ A;  1G4Y B;  5HFM A;  3DGE A;  1S0V A;  1VQL V;  1THZ A;  2ATK C;  1OHH G;  3QO8 A;  1VQ7 V;  4TWK A;  3ABM B;  4GX1 A;  5KUK A;  1R3J C;  1FFT B;  2Q68 A;  4I9W A;  2CK3 G;  4RQE A;  1H8H G;  4UVA A;  3CCJ V;  3T1C A;  3OR7 C;  3CCQ V;  1MG1 A;  1YSC A;  2EIN B;  5B3S B;  3OGC C;  1OCZ B;  2W0F C;  3G4S V;  5B1B B;  1V55 B;  1NQT A;  4ASU G;  1PL0 A;  4HZ3 A;  4FPP A;  1AI4 A;  2JDI G;  2ZXW C;  2AHZ A;  2H94 A;  2JJ2 G;  2ZD9 A;  3RBZ A;  4KUM A;  1JOY A;  5GW7 A;  5L3G A;  3HPL C;  3OMN B;  4U7N A;  5IYD O;  3T4Z A;  2QA4 V;  3IGA C;  5CBG A;  3OEE G;  4N23 A;  4XDJ A;  1YJ9 V;  1VQ8 V;  4XDK A;  3AG1 B;  1F4M A;  2IU3 A;  3CXC U;  3ZMU A;  4HYO A;  1QBZ A;  2Z3Y A;  3STL C;  1R3L C;  1FS0 G;  1QVG U;  3CC2 V;  2QM7 A;  4RQF A;  3SPI A;  4JYB A;  1KP3 A;  1KQS U;  3M99 B;  4LBE C;  1F51 A;  2B1G A;  2UXX A;  3B8N A;  1W2B U;  3E8H A;  4WFA V;  1BMF G;  2JK5 C;  2Y48 A;  1M57 B;  1NBM G;  1V54 C;  2R9R B;  5CBH A;  5EK0 A;  3BY6 A;  4UV8 A;  5CN0 A;  3ABK C;  4MVS A;  2ZDI A;  4PA4 A;  4RUF A;  2JEU A;  3EFF K;  1WPX A;  3FYE B;  2EJR A;  2AHY A;  3OUF A;  4QPK A;  1Q7Y W;  5B1B C;  1V55 C;  3CME V;  3SPC A;  2DYS C;  1R3K C;  3IFX A;  1SRY A;  1ORQ C;  1CP9 A;  3ABT A;  5LGN A;  1K8A W;  4PA9 A;  1XL6 A;  4MVM A;  2YEV B;  4HAM A;  1ARO P;  3PJS K;  2DWD C;  3E8F A;  3R65 A;  1R73 A;  3CCL V;  1GMG A;  4BAY A;  4MVO A;  3RVY A;  5B1N A;  1P4R A;  3ZJZ A;  3W7S A;  4FIP C;  4JPR A;  2JJ1 G;  2OTJ V;  1NKD A;  1LNQ A;  1GKF A;  1Y4M A;  4KFM A;  1MAB G;  2IH3 C;  3X2Q C;  3W7U A;  3G71 V;  2BOC C;  1KEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...