4RB0A

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-apo-fur
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 40
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb0A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb0A02
4IRIA 4M73A 4S05A 3LWFA 3BPXA 2HZTA 3FZVA 1ZYRF 2O61A 4G7HF 5F64A 4L9JA 5D4RA 2FXAA 1D8KA 4BH9A 5IT9Z 3V8JA 2COMA 2FNAA 2H6BA 1K78B 2DK5A 4OIPF 1GVJA 4WXDA 2MH2A 5JFRA 4ENKA 2EK5A 3F72A 1T0FA 2TDXA 1D5VA 3BJAA 5DDGA 3RPUA 5IT3A 2ZO4A 5BMZA 2MLKA 4KUMA 1ZREA 1ZGAA 3E6CC 3HRTA 1OPCA 2Z9OA 2IVMA 2VC0A 1DPUA 2Z99A 3H92A 5F6FA 1LDDA 2VE9A 1YQAA 1FP1D 1W7PB 1XD7A 3C7JA 5L3BA 3ZPLA 2A61A 3GF2A 2GQQA 2QUFA 4XSZF 3GFLA 2RDPA 1O7FA 3QU3A 2JRTA 1JXSA 3LQRA 1FYKA 1UHMA 1BJAA 3V7SA 3K1MA 3ZMUA 1X3UA 5FGMA 1AOYA 2FNPA 3GXOA 3WGIA 4UNOA 2GIVA 1IN4A 5D5WB 2FU4A 3FXQA 4IPAA 3KP2A 4ZYDA 1H9TA 2V79A 4LLGF 3ZQ7A 3BJOA 4KIBA 2PFBA 1HXDA 5DUKA 1HW2A 5HLHA 5AIPA 4ENMA 1CF7A 2VBYA 3FHZA 5BOXA 3HRUA 3IRQA 3RKWA 1G4DA 3R0JA 4HLYA 2O6GE 1SMYF 1XSDA 1MJBA 2VT2A 2P5VA 1KQ8A 1I5ZA 1DUXC 3WTUC 3CLOA 1PP7U 4M74A 2RKHA 3I71A 2P5KA 2Q8KA 4FX0A 3WU0A 2ZXJA 4G9YA 2CG4A 3R4KA 4EGZA 4WXHA 3LAPA 1FBQA 5H6QA 4LLNA 4B09A 2PMHA 3QP5A 4ZYEA 5BS6A 2QQAA 3RYPA 1U5TA 2KJBA 4IVNA 5HDNA 1XN7A 5IT9K 4HQMA 1GXQA 4HZFA 4ZZDA 1S7OA 4UHTA 4DNCA 3AAFA 4I2OA 5J6XA 1ZARA 1XCBA 5L3DA 3F8BA 1XCVA 2VOOA 2G9WA 1T38A 3IKVA 4L9VA 3DP7A 5FD5A 3M7GA 4YFXF 3HIFA 1HSTA 1UHWA 4MTEA 2NS0A 3TKYA 2IA2A 2DO7A 1F9NA 4BHCA 5K1YA 4L9TA 3ELKA 3LAJA 1SFXA 4R1HA 1RZ4A 2DPDA 4O3MA 1QBJA 1YW9A 2PN6A 3G73A 2DAOA 5CVIA 4N9HA 2YPRA 3TOBA 3JSOA 3KEQA 1YW7A 2YX4A 4CYDA 3WTZA 2WC2A 2ZNYA 3K2ZA 1PDNC 3I59B 3HSEA 3KFWX 1HBXG 2MLGA 3K1NA 2EV6A 1P92A 4HOBA 3ECHA 2W84A 2ZCWA 3HOTA 2B0LA 1MD0A 2FMYA 5BPDA 1TTYA 1TW3A 3F6VA 1SAXA 5FD6A 4XLPF 4GYGA 3ZN0A 4WX9A 4MQVA 4IF4A 1ZG1A 1P6RA 2KIMA 2XAQA 2DBBA 3TQNA 4O6JA 4IRHA 1WRJA 2O3FA 2G7HA 1WKMA 1Z7UA 4JQFA 3JTGA 3PFIA 5EEHA 2GXBA 4MQ9F 3DKWA 5ILSA 3WU1B 4OMZA 1S6LA 3MAJA 2CW0F 5ICCA 3OV8A 4ASNA 1IN7A 3P9IA 3FWEA 3GFMA 3TO6A 1R22A 5LHIA 5KK1A 2UZKA 3WG9A 2RV8A 3EQLF 2OU2A 2XAGA 4PCQA 2GWRA 4UXNA 2X0LA 2IA0A 1U2WA 2IP2A 2KKOA 2PG4A 4RS8A 1F4KA 5CVJA 1LEBA 2RVCA 1ONVA 4LB6B 1B6AA 1OR7A 5FFZA 2ELHA 4EM1A 5K5RA 1Z1DA 2H6CA 2PBIA 2XHKA 5J8FA 5D5VB 1Z9CA 4Q4ZF 2P7CB 2ISYA 1HKQA 3GZ5A 3WE3A 3QP6A 2HYGD 1KYWA 2FEZA 2MBFA 4L5IA 1ZN2A 2ZJ2A 4UVBA 2F2EA 5K5QA 4KN4X 1D3YA 4CXFA 3ZMSA 4Q48A 3HHGA 2KIUA 4IHSA 3EETA 1QZZA 2XRNA 3E6MA 1FYMA 1Z91A 1KU2A 4UV9A 3M9AA 2GZWA 1K6OA 2R7FA 3GFIA 3FMSA 4M6XA 3TDUC 4IXAA 5DYMA 2UWMA 1IXCA 2QQBA 1B1BA 3RI4A 5F1RA 3J7AO 3WE2A 5LBQA 3V7CA 2XUBA 3IC7A 5CYVA 2H09A 2G7UA 2KIFA 4UV8A 4XSXF 2VBZA 1XGSA 1OMIA 1FBSA 2P4WA 1O3QA 4A12A 1WI9A 1G3SA 1Z6TA 2W24A 3SZTA 1U6GA 4GGGA 5KVRA 4CZZA 4XBFA 2IPQX 1BOAA 2FBHA 2ZNZA 3DV8A 1FY7A 4KMFA 2ESHA 3PQJA 1C0WA 1STZA 2IW5A 1UFMA 1FT9A 2FSWA 4M72A 2OBPA 3BPVA 5L3EA 2QQ9A 3CUQA 2EB7A 4I0BA 1RI7A 1H9GA 4OIQF 1Y0UA 1YYVA 2EFOA 2A07F 4OIRF 5CLSA 5EEGA 3CJNA 3SHFA 3FXRA 1O3TA 2R3SA 3F21A 1J2XA 5DD4A 3HUGA 2YU3A 4L9NA 4RGSA 1FYLA 4FX4A 2DQLA 1GHCA 3E3VA 1K79A 4U0WA 1FSEA 2PEXA 1SD4A 1Z05A 3R6SA 4A5NA 1DDNA 4MNUA 3J80Z 5DCMB 2KJCA 3E97A 2OAZA 3IWZA 4GXOA 5HVQC 5D6EA 1R36A 2FMLA 1KGSA 2HEOA 2QBYB 2MD5A 3L9FA 2OQGA 1LDKB 4HAMA 1ZRFA 3KEOA 5CJ9A 1T98A 1QNTA 3I5UA 1ZLKA 3WODF 5H20A 2EV0A 2PJPA 2VXZA 3V8LA 3RTRA 4HF2A 2W85A 3I59A 4YFKF 3B02A 3GVAA 1HSJA 2STWA 1KQ9A 4TV7A 1ZG3A 2F5DA 3V7RA 1OYYA 2AS5F 1KA8A 1YFHA 1LJ9A 2KRFA 1FPQA 5HLGA 5HOOA 4LG0B 2XVCA 3D5LA 2EFQA 2LF8A 1WSUA 1GXPA 5ILUA 5ILVA 2L02A 1ON2A 4A2UA 3RJPA 2DFIA 1RUNA 3I53A 2IT0A 1ZH5A 5CVUA 5HS9A 1LQ1A 2NAZA 3GX4X 2M1BA 4PZJA 4M71A 3GEZA 4HF1A 2CQKA 3BP8A 1W5SA 4U0VA 1P4AA 2NNNA 1O3RA 6PAXA 1ZAOA 4P55A 4MEYF 1R5HA 4YFNF 1YIOA 3K1PA 2L54A 3HTSB 2K7LA 2HTJA 5LLQA 3BOQA 4PGGA 1FSHA 4AWXB 2P5LC 3VB2A 2D1VA 2RGVA 4AIJA 1I27A 3L09A 4KICA 2W25A 3GO5A 1QZYA 4ESJA 5ICEA 2RN7A 4FT8A 4CICA 3E5QA 2O0YA 3WGHA 3J80K 2DQRA 2ETHA 2RNJA 4WWCA 4M9SA 4ZYHA 4ETSA 3KP6A 4MHGA 4BNCA 3P9CA 1R1UA 3N97A 4I09A 2EA2A 5HDKA 4AVPA 3MWMA 1RNLA 2EFPA 3C18A 2A5YB 3IKTA 2EV5A 4ON0A 1G3YA 4LGWA 3CO6C 3RYRA 4RGRA 2D2WA 3HSFA 4HW0A 2VC1A 4KT5C 3CDHA 2HQRA 1YG2A 1IW7F 2V1UA 4GO1A 4ESFA 3GWZA 1RUOA 3LA3A 1JHFA 4UVAA 4UUVA 2GA2A 3VOEA 2AXLA 1USTA 4G6DA 2EJRA 5E1XA 3ZMZA 2XAFA 1T6SA 1ON1A 3EYYA 2VOPA 1ZRDA 4Q47A 1IXRC 3KZYA 2E1CA 4BYYA 2GAUA 2FRHA 4KYWA 3EDPA 1BN5A 4I0AA 3BDDA 3QPTA 3M8FA 3WTWC 5DD8A 3K9TA 5L3FA 2CO5A 4OIOF 2E7XA 3SFZA 2PI0A 1FWZA 1J0RA 5D6FA 5FLXZ 3SQNA 5LGUA 2K27A 4YIFA 2HYFA 5L3CA 1S29A 2JPBA 4IRGA 1VTNC 1CGPA 2P6SA 4HV6A 2XAHA 2Y75A 3DPTA 1IRFA 3ECOA 3HHHA 2Q0OA 1NHAA 1XB4A 3TGNA 4R8HA 1R23A 3HRMA 3KLNA 4LMYA 1IXSB 1S8NA 4EMSA 4KFCA 2XGXA 2J5OA 2LSOA 3LQQA 1F1ZA 1EH7A 3WTVC 2ZBKA 2DU9A 2L3DA 1TLHB 5D8KB 4BAYA 3ZMVA 2VODA 4WK8F 1BIAA 1CF7B 3MZYA 4EJTA 4R79A 3R61A 5HS8A 2XAJA 5HLIA 4OOIA 2HWVA 3MCZA 2HKXA 1T2KA 1YO5C 3KE2A 1MDMA 1TW2A 2ZMEB 5JR3A 2H27A 1ZHFA 3KLOA 4M9XA 2QZ8A 2ZKZA 1QQIA 5ERIA 1J75A 2D45A 3RDIA 3KZZA 5DCMA 2IRFG 1IN8A 1FBUA 1K78A 2BV6A 1KU3A 1DPRA 3KCCA 2QBYA 4S04A 4YG2F 3T1BA 2QYOA 4A5MA 3RIRA 3WTSC 1W5TA 2XKOA 1U5TB 1ZLJA 3JSPA 5HS7A 1BC7C 2DI3A 3T5XA 4FHTA 2FBIA 2Z33A 1BBYA 2HKOA 2OQRA 1P4XA 1YW8A 1IF1A 2K4JA 4WF2A 2V9VA 1BI0A 3P7NA 3EUHA 1FX7A 3DF8A 4ENNA 1MZBA 1E2XA 1PP8F 1W7PA 5BQTA 3ISPA 2QWWA 1LB2A 3WTXC 3QRFF 4WXCA 5A2QZ 2K4BA 3KP7A 2A6EF 3JW4A 5LHGA 5LEJA 4CHUA 3RKYA 5TJJA 4NHJA 3JTHA 1R7JA 2CSOA 4RB0A 1E17A 5E20A 3TO7A 3LSTA 4ZH4F 5JHUA 4BHPA 2K86A 1G6NA 5FLXK 3I4PA 1BM9A 3DPLC 4MGRA 1XMAA 2Q2EA 5LGNA 4E70A 2E1NA 3ROUA 3BZ6A 3LFKA 1PUEE 3VEPA 1L3LA 3KP3A 5ED4A 4RGUA 4HA8A 2RQPA 1K7AA 3N4MA 1EH8A 4JBAA 2EA4A 2HTSA 2MA3A 2DPUA 1G3TA 2XROA 3RKXA 5JVTA 1FP2A 3SXYA 3DXJF 4BQAA 4IHTA 1TQMA 2M45A 2QM3A 3R0AA 1S7AA 2WV0A 4M9ZA 1D8JA 3NEUA 4D0PA 2BGCA 4LB5A 1XGNA 2BEOA 1XSVA 2OZUA 2A3SA 3QPHA 4HF0A 2DTRA 1IZ1A 2X4HA 4KNYA 3KETA 2YR2A 3GZ6A 1L0OC 3HSRA 1O57A 4HX4A 3L7WA 2D1HA 1FC3A 2UXNA 3E5XA 2STTA 2A68F 3I58A 3ML6A 4CDGA 1I1GA 2ESNA 2GXGA 2O03A 4ZYGA 1I6XA 1QO0D 4ZZLA 4OU0A 4RAZA 1OYIA 4A0XA 5BPIA 2JPCA 5H6RA 4U7BA 4BXUA 1KYZA 3SZPA 4QWQA 4NB5A 4RB1A 4HDVA 3CO7C 1O3SA 3B73A 1B9MA 1MJAA 2ZFWA 4RAYA 5FO5A 4MEXF 2CWEA 5A2QK 3F6OA 2QENA 4L18B 3ERED 4LK0F 3S2WA 3F8FA 1ODDA 2BBYA 2FF4A 4PDKA 4EGYA 3FX3A 3V4GA 1RIOH 2FE3A 2CGPA 1MJ9A 1R58A 2P6TA 5DEQA 1SFUA 4G8XA 2M30A 1JHHA 2K02A 4L5JA 5ICGA 1IN6A 1U5TC 1FZPB 1XSXA 4P9FA 4ENJA 2C6YA 1U8RA 5L3GA 4N0BA 2V6CA 5DCFA 3O6BB 5HDGA 1HKSA 4HLXA 5E1ZB 2A69F 4EJWA 4RB2C 2OZ6A 4A6DA 2PQ8A 1TQIA 2L4MA 3V8KA 2ACJA 2W57A 4EV0A 2HR3A 1UB9A 4YIIA 1J5YA 1KQ0A 2Z5UA 1TNTA 3J81Z 4B8XA 3ABTA 3F8CA 5CVRA 4KIGA 5CVVA 2LF7A 4G7OF 2UXXA 3QOPA 5D5XB 4WCGA 3F23A 3MZHA 2ZMEA 4L0YB 2HQNA 3K69A 1SMTA 1QPMA 1R1VA 4EJVA 4LK1F 2V1DA 4U88A 4F7ZA 4KDPA 2EFWA 3ZP5A 2MH9A 5E1WA 4Z2YA 2LDUA 3FXUA 4MTDA 4KIFA 1LDJA 3P9KA 4AIHA 3CUQB 1G3WA 4G6QA 1BIBA 4UVCA 2YSRA 5E18F 1EV7A 3I54A 4P9UA 4A0YA 5E8GA 2F5EA 1ZGJA 1HW1A 3VODA 2H94A 1USSA 3W6JB 4L0ZB 2CFXA 3C3WA 2RC4A 2HGCA 5D5UB 1FLIA 2NRAC 3QU6A 1SD6A 1ZRCA 4DQ2A 1ZG5A 4Q5SF 1V4RA 5DV5A 3W6KB 3TDZC 1BC8C 3R60A 2VBWA 4LD5A 1V3FA 2DK8A 2M5WA 1S3JA 1W4MA 1KU7A 4IJAA 1IRGA 1TNSA 3ABUA 1XMKA 4G94A 3D0SA 1W7PD 4G7ZF 4EQQA 5JI6A 3HOSA 1XGMA 3U2RA 1H0MA 2FQ3A 2YX7A 3LA2A 3TOAA 5DUIA 4HYEA 2QVOA 4M6YA 3EYIA 3T8RA 2VONA 4ESBA 1YTYA 2EFNA 1J59A 3WTYC 2NNYA 2A6HF 4HDUA 1EH6A 1HKTA 2VBXA 2EWNA 1P4WA 4AD9A 3E6BA 2VE8A 4O5VA 3HRSA 3Q9SA 1LVAA 1R1TA 5E8IA 3CUOA 1Q1HA 3NRVA 2XIGA 1A04A 3F8NA 2DT5A 2WTEA 1IUYA 5AONA 4LFUA 2L4AA 3GLXA 4N9IA 4NQWA 2Z3YA 1UCRA 2XASA 4AIKA 3T0YA 2E7WA 3FM5A 1LEAA 3O3KA 1Z6RA 4GCVA 3IRRA 4KN7X 3J81K 1TQPA 3C1DA 1REPC 3BROA 3GFJA 1XDSA 3MQ0A 1LNWA 4K2EA 3Q5FA 2ADUA 1SD5A 2JZYA 3WGGA 4A6EA 1YLFA 4Y13A 3NQOA 4RGXA 1U78A 4CO8A 4PGHA 4RB3C 3HTUA 3O2PE 5AIQA 4EM0B 4EJOA 3M8EA 3COAC 4Y15A 4OMYA 4KA4A 2F5FA 1U3EM 3U9GA 5FFXA 5E17F 2F5CA 3F3XA 3OOPA 2DW4A 3L2CA 3REOA 3I64A 3VFZA 1XDUA 1YS7A 3DEUA 5D4SA 1JGSA 1I1SA 2IA1A 1AWCA 3KP5A 1MGTA 2CYYA 2HS5A 2OD5A 4P96A 4EVIA 2JTVA 1JE8A 1J9IA 3WTTC 2M87A 5LGTA 3FMRA 2GA1A 3TO9A 1OYWA 4HV5A 4OINF 5TRDA 4H0EA 2FBKA 2P8TA 1BI1A 2BYVE 3ULQB 2HFHA 3JAMZ 1MKMA 3M1EA 1FOKA 1B4AA 4U7DA 2V1XA 1XGOA 3IHUA 3GW2A 3CUQC 4HBLA 3QAHA 2L01A 1R5GA 4A0ZA 3ZMTA 2VT3A 3IWFA 3IL2A 3PQKA 5K5OA 3ZN1A 5ICFA 4LJZF 4I02A 1R00A 2BE5F 1TBXA 3F22A 1KU9A 1J7KA 4LG0A 3H3ZA 4XLNF 3LA7A 3MFKA 1B59A 4QLCU 3GYHX 2LNBA 3E6DA 5J8CA 3KP4A 4XRFA 3GUDA 4I01A 1HQCA 3FM3A 1IAWA 2HOEA 4EJUA 3BY6A 3I0TA 4HX8A 5LRRA 5LRSA 1WQ2A 3Q9VA 3U1DA 1B9NA 3HYIA 2MC3A 2FOKA 2M8EA 3FF5A 1P2FA 2DLLA 4Y17A 4HQEA 3MEXA 2PMUA 2HDCA 2ISZA 2JSCA 1T39A 5D8LB 5LHHA 3BJ6A 1SD7A 4GYIA 2R7DA 3G3ZA 1WWXA 2NYXA 1BI2A 3L00A 4I98B 2Y0MA 1O7LA 1QGPA 1SFEA 3BWGA 4BHBA 5FB2A 3DQVC 2OA4A 3H3UA 3CTAA 2LKPA 3T8TA 3K0LA 4JK1X 4HX7A 3DFGA 1FNNA 4P5OA 3FMQA 2QLZA 5LEKA 2JT1A 3F8MA 2O8XA 3ZMDA 4U0YA 1ULYA 2VN2A 2XV4S 3RPQA 4KMUX 2J5PA 4LLLA 2WWYA 1BI3A 2IJLA 1OKRA 1HW5A 2XKPA 4EM2A 2P7VB 4I7HA 2PLYA 4CGZA 1YS6A 1F5TA 1DP7P 2FA5A 1MDMB 3E5UA 3JAMK 2Y48A 1IN5A
chains in the Genus database with same CATH superfamily
4IRIA 4M73A 4M3BA 4S05A 3KZIC 2CU7A 3BPXA 3LWFA 2K5CA 3MZ8A 2R7XA 2HZTA 3FZVA 1ZYRF 4IWYA 4Y7NJ 3KALA 2O61A 1BJZA 4CCNA 4G7HF 4EEFG 2YW2A 2YS9A 5F0FA 4L9JA 5F64A 2RNGA 5D4RA 1N33H 2FXAA 1D8KA 4BH9A 3Q8SB 4M3GA 2OCEA 5IT9Z 2DYRH 3DF7A 5F9LA 3V8JA 3T5JA 1VQNI 2COMA 2VQCA 3HOXG 4LF4H 2FNAA 4IRCA 2H6BA 4IRDA 1WCMJ 1K78B 2DK5A 3D5SC 1R49A 3K2AA 4OIPF 1GVJA 5DG8A 1JUMA 4WXDA 2VQDA 2L7MP 1R4MB 2MH2A 1K4TA 3R23A 5EOYA 5JFRA 4ENKA 2EK5A 1FKAH 5KFBA 3F72A 3N8DA 4JI7H 1T0FA 2VKVA 2OPTA 2TDXA 3G1MA 2R93G 2JQ7A 4XL9A 1ZR2A 1D5VA 2EQRA 4J9PA 2BHYA 3BJAA 5DDGA 3RPUA 5IT3A 5JLXA 1VI0A 2ZO4A 4ECVA 3TMOA 4C2MJ 5BMZA 3KIOA 2MLKA 4KUMA 1ZREA 1ZGAA 2M8GX 5T14A 5HV6A 3S1MJ 3E6CC 1PVEA 2Z16A 3HRTA 1OPCA 5KG3A 2R85A 2Z9OA 4CA0A 5C4XJ 2ZC2A 2X1CA 3GTQA 2IVMA 2VC0A 1DPUA 4E7IA 4XRSA 2HPIA 2Z99A 1XX5A 2VPSA 2HGSA 2V26A 3H92A 5F6FA 1M0TA 4RMNA 1S9HA 2R93J 3TINA 1LDDA 2VE9A 3BJYA 1YQAA 2LD5A 1FP1D 1W7PB 1XD7A 4BDYA 3C7JA 3CP8A 4GRIA 4UUTA 5L3BA 2A61A 3ZPLA 3GF2A 4A3BJ 2NUAB 5IT9W 1Y8RB 2GQQA 4NLGA 2QUFA 4XSZF 3GFLA 1R71A 2RDPA 1O7FA 3QU3A 2JRTA 1JXSA 3LQRA 2OWOA 1FYKA 4GKKH 1UHMA 1BJAA 3G1OA 5JUMA 2ME6A 2JSPA 3G71I 3V7SA 3K1MA 2OCCH 3ZMUA 4DV0H 1X3UA 3AKZA 4GDFA 5C1OA 3WO1A 5FGMA 4O4LF 2ZB9A 2K40A 3N40P 1AHDP 4XLCA 5KFGA 1AOYA 1BJTA 1X1DA 4O3OA 3KYDB 3BQ1A 1Z0XA 5DLGA 3S3MA 3QFFA 2ALZA 1V54H 2FNPA 3GXOA 3WGIA 3L2RA 4UNOA 2GIVA 2XGQA 1IN4A 2W8LA 3FDSA 3GIDA 1YX5A 1R5ID 4D7MA 5D5WB 3ORQA 2FU4A 3FXQA 1TWCA 3O8GA 4IPAA 1FTZA 5JH7F 2JA5G 3CDIA 3KP2A 4ZYDA 1H9TA 2V79A 4LLGF 5KFWA 1SEUA 3GTJJ 1BW6A 3ZQ7A 3BJOA 2LRDA 4EBEA 4KIBA 4YHHH 2PFBA 1RJPA 2X51A 1HXDA 4HYKA 3TQ1A 4Z6YA 2G0EA 2FB9A 5FKOA 2XCAA 5DUKA 2MYSA 3GLKA 3RJ0A 1ZR4A 1HW2A 3H9GA 5HLHA 2P0AA 4J9KA 2KRHA 5GP9A 2VQGA 2MW8A 5GPAA 5AIPA 4AYBN 3AL0C 5GAEJ 4X0GA 4ENMA 1CF7A 3RZOJ 1ENHA 5DTDA 2VBYA 2R5ZA 2YS7A 3FHZA 1JTYA 3FMAA 2RDIA 4TQSA 4JI8H 5BOXA 3HRUA 3IRQA 3RKWA 2IMWP 4LF9H 1G4DA 1UZCA 2XPUA 3R0JA 4HLYA 4IEJA 2O6GE 1JKOC 1M0WA 4ZDLA 1SMYF 1XSDA 3BR2A 1MJBA 2VT2A 2P5VA 4DBRA 4HNUA 1KQ8A 2EIMH 1I5ZA 1DUXC 2HHHH 2CV1A 3CCEI 1B8IB 2E2HA 2KHMA 3HOVG 3WTUC 4BXFA 3CLOA 5KFNA 1PP7U 5EG0B 3GZNB 5HLTA 4IZZA 4E7LA 4M74A 1MBEA 1GO3E 2RKHA 1KJ8A 1N36H 3IH3A 4ECZA 3I71A 2X9DA 5KG5A 2P5KA 2KSWA 4BBRG 2Q8KA 3WHBA 4ZOLF 4BL0B 3ZQCA 4FX0A 3WU0A 1POGA 4XRMA 2KISA 2ZXJA 4G9YA 3K70D 2CG4A 3R4KA 5IP6A 1IOVA 4EGZA 4WXHA 3RAXA 2UUBH 3LAPA 2R5YA 1FBQA 5H6QA 4LLNA 3K6GA 1B6SA 1GSOA 4B09A 2PMHA 3QP5A 2EZHA 4ZYEA 5I47A 2VQLA 5BS6A 1MH3A 4A93G 2E60A 2VOBA 4ED6A 2QQAA 3C2HA 3S1RJ 2W6NA 2DT6A 3RYPA 2W00A 3R5XA 1LE8A 3SE7A 4JX5A 1LFBA 2BHZA 4JV0A 3T1YH 1U5TA 2LKXA 3DWLE 2KJBA 1WZ2A 1N56A 4IVNA 5HDNA 2IP4A 1XN7A 3VDXA 5IT9K 4HQMA 1GXQA 4BBRJ 3RSNA 4HZFA 4ZZDA 5IYBG 3L1PA 1WJEA 2GM4A 2FMAA 4MV9A 2R8KA 2IGKA 4LFCH 2K9MA 5FPRA 1S7OA 4ECWA 1TT5B 4UHTA 4DNCA 3BQYA 3AAFA 2VPLA 4D7NA 4I2OA 3HUGB 1Z67A 1JT0A 5J6XA 2V9PA 1ZARA 1XCBA 3DEWA 4XICA 2XGDA 5L3DA 3F8BA 4A3KG 1E4FT 2WAQN 2GPWA 1XCVA 4A93J 2VOOA 2WB1N 2CRGA 4C2TA 2G9WA 4X6AJ 3F0CA 1OCCH 4BQNA 1T38A 3IKVA 4B3XA 2R7WA 3QZ8A 3MR5A 4L9VA 3DP7A 5FD5A 3VSLA 3M7GA 4YFXF 1RJRA 1BXRA 3HIFA 4M9UA 5BMVF 1HSTA 1UHWA 2ZFUA 4MTEA 3I56I 4I4TF 5IYBJ 1E4GT 1RPWA 3DTKA 2NS0A 4QWCA 4O3SA 2R7ZA 2VUMA 5CA1F 4A3GJ 2CQYA 3KXYT 3G6YA 3TKYA 2IA2A 2DO7A 1MBHA 1WVRA 1DIKA 1F9NA 4ZDPA 4XNFA 4BHCA 1CE8A 2HVRA 3UFXB 4O3RA 5K1YA 4L9TA 4B1RA 3K5HA 1BR4A 4JV5H 3ELKA 2BVMA 3ZCOA 4CCJA 3LAJA 1SFXA 4R1HA 4IHYA 1RZ4A 2DPDA 2YU9A 2E1MC 2VJIA 4O3MA 1RYSA 1QBJA 3BC8A 2K9NA 2Y69H 3VMMA 5LA6F 2MGQA 4A3CJ 1WJBA 1YW9A 1Y56A 2HI3A 1E4EB 4YP3A 2IS2A 2PJRB 2PN6A 5KFKA 4UCRA 3G73A 1IRXA 2JMWA 1RRJA 1VQLI 2DAOA 5KFDA 5CVIA 4N9HA 2HVSA 3OHBA 2YPRA 3TOBA 1U0JA 3KEQA 3JSOA 4BY1J 5FRNA 4YR2A 1BNCA 1YW7A 2YX4A 2FJ1A 4CYDA 1L2ZA 2R92A 2J9GA 2CQQA 2YZGA 3WTZA 3MKYB 2WC2A 2ZNYA 2LBFA 3OTOH 3K2ZA 5EF6A 5KNLA 1PDNC 1IDZA 3I59B 3HSEA 3KFWX 2XSDC 4QIWE 5BNGA 1HBXG 1HA8A 2MLGA 2JUGA 2VB6A 4ABZA 3OY9A 2Y9ZA 3K1NA 3OYAA 1N32H 2EV6A 3Q0WA 5LMNH 1P92A 4D5FA 3CP2A 2NVUB 4E7HA 4HOBA 4YAKB 3ECHA 4PJNA 4QPOA 2I10A 2W84A 3JRHA 3JCUC 5HNFA 4ED7A 2EH3A 1WJFA 1QVUA 2ZCWA 3HOTA 5KFQA 2B0LA 1E3PA 4XN3A 2XB5A 1MD0A 2FMYA 4IOAF 5BPDA 1TTYA 2WY7Q 4NXMH 1X1PA 1XMQH 2PMZA 1TW3A 3F6VA 1SAXA 3CC2I 4BU2A 2DLNA 2W9BA 4KHPH 5FD6A 4XLPF 2X48A 3U21A 4A3EJ 4GYGA 3ZN0A 4A3IG 3RQIA 5CPRB 4WX9A 3EUHC 4MQVA 4NUBA 4IF4A 1ZG1A 1R9TA 2BOLA 1T56A 2EZLA 3QYFA 1ETVA 1TA8A 4OAZA 4IZOA 4M3EA 5FJ8G 1T3NA 3CZ6A 4BXXJ 1P6RA 2KIMA 2XAQA 2XSJC 4B3RH 4YR0A 4FM9A 1B72A 2DBBA 1GVDA 3TQNA 2DMTA 1FVIA 2TCTA 3QYBA 1SFKA 4O6JA 3L2VA 4IRHA 4Y4RA 1WRJA 2O3FA 3CCJI 1W5CC 2G7HA 1W96A 4TUYF 5CAEB 2FLLA 4BY7G 1WKMA 1RK6A 5J2TF 5EZGA 1Z7UA 4JQFA 2MG4A 3JTGA 2ZDQA 1I7NA 4MV8A 3PFIA 5F27A 5EEHA 2GXBA 3JRCA 4MQ9F 1XC5A 3VPDA 2JEIA 2JA8J 4A3IJ 3GTLA 2CQXA 5DQGA 5E3MA 3DKWA 3DKYA 5ILSA 3WU1B 3CLQA 1ETXA 4OMZA 1S6LA 3MAJA 4AVZA 5FJ8J 2CW0F 5EWGA 2XF5A 2UXCH 4MV1A 3HOYG 1ETWA 2W48A 5ICCA 3OV8A 4ASNA 1IN7A 3P9IA 3FWEA 2E2IA 3OYHA 1TP4A 2R7QA 3GFMA 2QKMB 4ECUA 3OYDA 4BEHA 1YJNI 1XS9A 1HOMA 4JI1H 3TO6A 1R22A 4RAGA 5LHIA 3GTQJ 4BY7J 2CW7A 4C9YA 5KK1A 4XORA 2UZKA 1ZKGA 3CC4I 4WBNF 1D1BA 4BKXA 1YOVB 3BA8A 4UCUA 3WG9A 2RV8A 1T94A 4EYHB 1ETQA 3EQLF 2J6TA 1Y6IA 1LPQA 2OU2A 1N48A 2XAGA 1OQYA 4PCQA 2GWRA 1HNZH 4UXNA 2X0LA 5EEAA 1F36A 2IA0A 1U2WA 2IP2A 2KKOA 4QPQA 1HDDC 2O5RA 2PG4A 3HOYJ 3LMLA 4RS8A 1F4KA 5CVJA 1LEBA 5KG1A 2RVCA 3LOCA 5KAFC 2YS6A 3OS1A 5D8DA 1ONVA 4W97A 4LB6B 5KFSA 1B6AA 1OR7A 5FRMA 1DV2A 5FFZA 2ELHA 4DV7H 4EM1A 5K5RA 1Z1DA 2YZNA 3OSNA 2H6CA 3FK6A 2ASDA 4F55A 3Q0VA 2PBIA 2GXAA 2XHKA 4LH6A 5J8FA 5D5VB 3ZQIA 1UC8A 3IH4A 2OUMA 1Z9CA 1Z3XA 2VASA 4Q4ZF 2P7CB 3LP8A 2ISYA 5EYRA 1HR0H 1HKQA 1TWCJ 3FISA 3GZ5A 3WE3A 3CVZA 2VIXA 2HYGD 3QP6A 5KG4A 3ORRA 1EKEA 3VWBA 1KYWA 2FEZA 2MBFA 3QYEA 1JLLB 4L5IA 1ZN2A 2DA5A 2ZJ2A 3AG1H 2F2EA 3AG3H 3BR3A 4UVBA 1IRZA 1WH2A 5DM7F 5L9XA 5K5QA 2AQEA 3HKZE 4KN4X 4YB8B 1M7JA 3I9V2 1D3YA 4CXFA 3ZMSA 1I3AA 2FK3A 4IR1A 1MMDA 1S03G 4Q48A 3HHGA 4U87A 1LKXA 2KIUA 4DV4H 2NVYA 1FMWA 2B63A 5FLVA 4IHSA 3EETA 1QZZA 3OHAA 2XRNA 3E6MA 1FYMA 3SZGA 2DT7B 4O4IF 4PJ0C 5LOVF 3MVPA 1Z91A 4QJFA 1VZ0A 1OCRH 2HDDA 4CSWA 1FOXA 1KU2A 1B6RA 4JV2A 5E79C 4UV9A 3BT9A 3M9AA 2GZWA 3NARA 1VQOI 1A5JA 3Q2OA 2M4GA 1YX3A 3K4KA 2HNHA 2W1OA 3OYEA 1K6OA 4R8UB 5JVLA 2R7VA 1OCZH 2R7FA 3GTPA 2W7PA 3GFIA 3G1LA 1A9XA 3FMSA 2Y0SA 4RLFA 1AKHA 4M6XA 3TDUC 3BA9A 4IXAA 3PO2G 3OSGA 1CQIB 5J2UF 5DYMA 1JKPC 1D1AA 4BUPA 1V4YA 2UWMA 3RB4A 2V7FA 1IXCA 1XMXA 2PVPA 3U9TA 2QQBA 1B1BA 1JKRC 3KEYA 4D9JA 3RI4A 5IP7J 5F1RA 1U8BA 4Q43A 2Y2ZA 4B47A 1UJ8A 2BY3A 3WE2A 3J7AO 2V9WA 5LBQA 3V7CA 1Q1VA 2XUBA 3G6EI 3BQZA 3IC7A 4M3DA 5CYVA 3ZQHA 5D1OB 4A3LG 2R8HA 3BG3A 2H09A 2G7UA 2KIFA 4S0HB 3TW7A 2VKEA 4UV8A 1K1SA 4XSXF 2VBZA 1XGSA 3X2QH 2VJJA 1OMIA 3ASNH 1ZHSA 2D5VA 3DTEA 3MMYB 1FBSA 4HEA2 2W6QA 4BJ6C 2P4WA 1O3QA 4A12A 1WI9A 4G12A 2E19A 4ZC3A 3FDYA 1G3SA 1Z6TA 4JI0H 4Y33A 4F3QA 2ZJPF 2W24A 2WADA 3K4CA 3SZTA 3KPHA 1AUXA 2DZDA 2ID6A 4RM3A 3TIIA 1U6GA 2JN6A 4GGGA 2R7ZG 5KVRA 2NVXA 2CV2A 1VQ7I 3A2KA 2VPRA 3LL7A 4RA2A 3OUUA 1Y0NA 3DLLF 4DR5H 4CZZA 1SEIA 3OYLA 4XBFA 2IPQX 3G8CA 4ZQIA 3FIWA 1BOAA 2LREA 1GYFA 2FBHA 2ZNZA 4NQWB 3DBRB 4W1UA 3DV8A 4R7RA 1DGRM 1FY7A 5JHFA 3MFHA 3L2WA 4DV6H 4KMFA 3GIKA 4N4NB 2UU9H 2FLPA 4D5CA 2ESHA 1B8IA 3PQJA 4DYQA 4OWRB 4RM2A 4B4CA 1RK5A 5EG0A 4IWXA 2NS8A 3NWSA 2XDVA 3SDGA 1IOWA 2BQUA 4IRKA 2UUAH 4IKFA 2R7ZJ 4BE2A 3S3OA 2VUMJ 1C30A 3LFUA 5DGBA 2BY1A 4WD3A 1C0WA 1STZA 2IW5A 4DV3H 2BXZA 2CMPA 1UFMA 1FT9A 2FSWA 3T5LA 3OR1C 4JX4A 4M72A 2BY0A 2OBPA 2RAEA 4FCYA 3BPVA 5L3EA 5EZYF 2W9CB 4JOMA 3I12A 4ZJZA 3LMMA 2QQ9A 1IO2A 3CUQA 1PUFA 1Z2PX 1RC9A 4EBDA 2EB7A 3RF2A 4I0BA 1RI7A 4IQJA 1H9GA 1J5EH 3L2QA 1DV1A 4CCKA 4RUCA 4OIQF 2YU9J 5C3EG 1KJ9A 1Y0UA 1KONA 1YYVA 2EFOA 2JJ7A 2A07F 4OIRF 3K5IA 5CLSA 4FBTA 1JGGA 3V4SA 5KFXA 4FS2A 4OAYA 5EEGA 4CCMA 1QRYA 4P1WA 1BOBA 3CJNA 1EZ1A 3K10A 4XR6A 5CQEA 3SHFA 2GIZA 2L2OA 2CFOA 1S9FA 5IOYA 4MA0A 2JK3A 3DEEA 3FXRA 3RB6A 1O3TA 4ANJA 5KFFA 2R3SA 3BTCA 2KL4A 4J9MA 2V4QA 4GLXA 1Z21A 3F21A 1J2XA 2UVUA 2R92J 1WCMG 1OJLA 4EFBA 3JREA 1BR2A 1FMVA 5DD4A 5TISC 2RQQA 3HUGA 2W6ZA 2R8GA 2YU3A 4L9NA 3GQCA 4RGSA 4XLEA 1IC8A 4FX4A 1FYLA 2JA6A 2XPVA 2DQLA 3RZDJ 1GHCA 2LFBA 2E1MB 5C3EJ 3E3VA 1K79A 4U0WA 1FSEA 1VQ6I 4MV3A 2PEXA 3E1SA 1DP3A 1SD4A 5HODA 4DR6H 1Z05A 3R6SA 3UR3C 5GADJ 4A5NA 1DDNA 4MNUA 3J80Z 5DCMB 2KJCA 2MC4A 1BR1A 3HPGA 3JSNA 3E97A 4XYMB 2OAZA 5JVGF 3NGDA 3IWZA 1TC3C 4GXOA 3TQTA 5HVQC 3CCUI 3F9KA 4DIQA 2QYZA 5D6EA 2R7SA 1Y1VA 2CQ7A 4EG0A 3K3PA 1R36A 2W6MA 2ZSHB 5C4XG 3CJRB 1X4PA 2FMLA 2KRCA 3DCFA 3VSKA 1KGSA 2DA1A 3CQZA 5J1YA 3QOEA 1R9TJ 2HEOA 2QBYB 4J9NA 1DU0A 5KT4A 5F04A 4ZTFA 3PN1A 5DLFA 2M7AA 2MD5A 3L9FA 2DFFA 2E71A 2XPWA 3HXLA 2XC7A 2V4RA 2OQGA 1LDKB 4HAMA 2MCTA 2LKSA 3OIOA 1ZRFA 3GIPA 3N42B 3ASOH 3KEOA 2OH2A 3G6VA 4A3BG 3UQ8A 3IN5A 5CJ9A 4XLAA 5M5YJ 2X85A 5KT5A 3OS0A 1T98A 1QNTA 3I5UA 3I3LA 4NBQA 5E3LA 5F0HA 2XAUA 2H8WA 1CQJB 1TWFA 2QQ8A 4CH7A 1E4EA 2R82A 4I76A 2PJRA 2YRXA 2WYOA 1OCOH 5KHDA 1U9NA 5K7FA 1ZLKA 3D5RC 3DKXA 3WODF 5DS9A 2DXIA 5KFMA 5H20A 1P7IA 2FOWA 2EV0A 2PJPA 2DN0A 3GTLJ 3RB0A 2W6OA 2VR1A 4EFEA 2VXZA 3V8LA 2DMPA 5KFEA 1T8IA 3RTRA 4HF2A 3LSRA 1OLTA 2VA2A 3RTXA 1UELB 2W85A 3I59A 4YFKF 1X1CA 2BY2A 3B02A 3GVAA 2GOMA 1Y39A 3J80W 2MSYA 3OMYA 4MO7A 1VQMI 1HSJA 2E2IJ 2BXYA 2STWA 1KQ9A 1LUJB 3PNYA 4TV7A 5H80A 3GTMA 4NC6A 4QWEA 4DV2H 1T08B 3H36A 1ZG3A 2R86A 3A0BC 3H5NA 3HOWG 2F5DA 1XPXA 3QPLA 4M3FA 3QQAA 3V7RA 1OYYA 2AS5F 1KA8A 1YFHA 3WO0A 1V55H 1LJ9A 3NWTA 3G6XA 2KRFA 1FPQA 2LK2A 5EJCA 5HLGA 2LH9A 3PO3J 5HOOA 4LG0B 4A3DJ 2XVCA 2ATLA 3ZQLA 3D5LA 3U9SA 2EFQA 1KBLA 2LF8A 1WSUA 3S1NJ 1CS0A 2FK1A 4XIDA 1WHUA 1GXPA 5ILUA 2Y31A 1V9PA 1K1QA 5ILVA 2L02A 3HGGA 1ON2A 1Y1WA 4AM3A 4A2UA 3EPZA 3RJPA 2DFIA 2Q2EB 1RUNA 4XM3A 1ETYA 3I53A 2IT0A 1NG6A 5J1RA 4E4HA 3H0GA 1WH5A 2ZXHA 1X3ZB 4E7ZA 3HOWJ 1ZH5A 5CVUA 2E5ZA 4I99C 5HS9A 2WE6A 1LQ1A 2NAZA 3FHNA 3GV5B 3GX4X 4BE0A 1KJIA 2EPFA 1P9QC 2M1BA 1OWTA 4TV8F 3OYGA 4PZJA 4M71A 2GBYA 1D5YA 2EILH 3GEZA 1VBGA 4DL4A 4AYBE 1E3HA 4HF1A 3LSIA 2J6SA 2CQKA 3M9NB 3BP8A 3RV3A 3N43B 4EGQA 4PFPA 1OFCX 2CUZA 4RNMA 1W5SA 2ZDGA 5GTHC 5KT2A 4U0VA 3M4OJ 5DG9A 3MKLA 2VKDA 4B3MH 1P4AA 2NNNA 2ECCA 1WJCA 3ZR8X 2A5WA 1O3RA 6PAXA 1ZAOA 4P55A 2NVYJ 2B63J 1ZTRA 2DOFA 2M0CA 4MEYF 3RQ4A 1QA6A 1R5HA 2ZXIA 3C0FB 2BW3A 5KFUA 4YFNF 3KHHA 1Z2NX 4C30A 2DJNA 1YIOA 3BLYA 1A36A 3TIGA 3K1PA 4NDLA 5LP6F 2L54A 5IPAA 4DV5H 5DG7A 3GIMA 5FKKA 3HTSB 2K7LA 2HTJA 1IBKH 2L9SA 2FP4B 4DBQA 5LLQA 2DA3A 2FPIB 2LYCA 4II2A 3CCVI 1SC7A 4YAJB 4MV7A 2HOAA 3BOQA 4PGGA 1FSHA 4LF8H 1FTTA 4AWXB 4EBCA 1KJJA 1VKZA 3JSLA 1S5LC 2P5LC 3GTPJ 3VB2A 4BGDA 2D1VA 2RGVA 4AIJA 2W4SA 1VQ4I 1I27A 4LG3A 3L09A 2C2EA 2Y9YA 2ASJA 1HDPA 4KICA 2W25A 1D0YA 2PX9A 4NNJA 3GO5A 3U1KA 1QZYA 1ETOA 3H0DA 5ICEA 4ESJA 3MJFA 3MWDA 2RN7A 3JZIA 4DZJA 4FT8A 4CICA 3E5QA 4MFEA 2O0YA 2AXTC 1TWGA 1CQTA 2CZGA 3WGHA 2Y30A 3J80K 2NU7B 2JEFA 3HC7A 2R84A 5TGTA 2DQRA 2ZJQF 3MN2A 1ETKA 2ETHA 3OUZA 3GV7B 2RNJA 4RLQA 2VA3A 4WWCA 2DIKA 4A3GG 4M9SA 4QWBA 4ZYHA 4ETSA 3KP6A 2ECBA 4MHGA 3P9CA 3SFIA 3J7ZI 4BNCA 1R1UA 5KFJA 3N97A 1S7EA 2R7KA 4I09A 5KT7A 2WY8Q 1MBJA 4B43A 3MR2A 2EA2A 4QW8A 5HDKA 2WAQE 4ECYA 5M5WJ 4AVPA 3MWMA 2F4MB 5LMUH 1RNLA 2EFPA 3C18A 3HBLA 2WB1E 3JRGA 3BTIA 2A5YB 3VPBA 3IKTA 2K85A 1S72I 3FK7A 3M3YJ 3HOZG 2EV5A 4ON0A 1NK2P 2NVXJ 2KDZA 1G3YA 3CD6I 2NU9B 3Q8RB 4A3CG 1YIJI 4FTHA 4LGWA 3CO6C 3RYRA 4RGRA 2D2WA 3HSFA 4HW0A 2VC1A 1MSEC 4KT5C 4BJTA 1A6QA 3CDHA 2HQRA 3SEQA 1YG2A 4BY1G 5IYDG 1IW7F 4DL7A 2V1UA 4O4HF 4YBZB 2GPSA 4GO1A 1X19A 2AQFA 3S8PA 4ESFA 2R87A 1HF0A 4FS1A 3PZPA 2F4OB 3BTJA 3GWZA 1RUOA 5KX5F 4ECQA 3LA3A 1FJLA 1JHFA 2ICWG 1H88C 3N44B 4I50F 4UVAA 2MABA 3L4KA 4UUSA 3ZOBA 1J09A 2VPQA 2L7FP 4UUVA 2GA2A 4XK4A 2IXSA 3VOEA 3HOZJ 4ECTA 4DW6A 2AXLA 1USTA 4QIWA 4G6DA 3JRFA 5GPCA 1G59A 3V4ZA 2EJRA 5E1XA 3ZMZA 2XAFA 1T6SA 1SVMA 1ON1A 2VXDA 4LITA 5GAGJ 3OYCA 3EYYA 3KHRA 2RF4A 2UUCH 2K9SA 5IYDJ 1UAAA 3HB9A 2K3FA 1WI3A 1ZK8A 2VOPA 1ZRDA 4Q47A 1IXRC 1VQ9I 1B33N 3K70C 4U6PA 3KZYA 3ZRGA 4BWSC 3PFYA 2E1CA 5C44G 4A3EG 2JA7A 3BZKA 4BYYA 2GAUA 1UG0A 2FRHA 4KYWA 5KFOA 5IYZF 2CUJA 3EDPA 1LFUP 5KAIC 2IGOA 1BN5A 4I0AA 4KISA 3A1YA 4BXXG 3BDDA 2EZKA 1WR2A 3QPTA 3M8FA 1AN7A 4Y8VB 3WTWC 2ZXWH 4J9SA 2JRMA 1NTCA 4JYKA 5DD8A 3K9TA 2R4GA 5L3FA 2CO5A 4CCOA 3OYMA 4OIOF 3AYHB 5L1JA 1K6YA 3ZGKA 3JRXA 4RU9A 2E7XA 4F92B 4DL5A 3SFZA 3C2GA 2V4JC 2M3AA 2PI0A 1A6IA 2JA6J 4F4YA 1JDBB 1FWZA 3CCYA 1J0RA 5D6FA 3LSPA 1ZELA 3LSKA 3SQNA 5FLXZ 3TW6A 3N6XA 2M34A 2IS1A 5L1LA 5LGUA 2K27A 5C44J 3PIPF 3H20A 1IV6A 2JA8G 1N78A 4YIFA 2HYFA 1VAJA 4J0MA 5L3CA 1S68A 1S29A 2LP0A 2JPBA 4IRGA 3OYJA 1VTNC 1CGPA 2E2JJ 2P6SA 4HV6A 4Q45A 2FLNA 2XAHA 4LF6H 2R7NA 5M3MJ 2Y75A 3DPTA 3OIPA 1IRFA 3BG5A 3ECOA 3HHHA 2Q0OA 2UXBH 1Y1VJ 2V6EA 1NHAA 1XB4A 3TGNA 2KP6A 3OYFA 1YI2I 3AG4H 1R23A 4R8HA 3R5HA 3ERMA 3HRMA 3LSMA 3FKIA 3CF5F 3KLNA 3CQZJ 4XRSG 3OYBA 4LMYA 2W9CA 1C3OA 1IXSB 1S8NA 2DDAA 1X1BA 4F4WA 5KG7A 4EMSA 2LLKA 2X1DA 3OL3A 3P5JA 2XGXA 4KFCA 1ZQ7A 2J5OA 3QODA 4PJLA 2LSOA 4DV1H 3LQQA 4J9QA 1F1ZA 1EH7A 2L9VA 3WTVC 1YRNA 2ZBKA 1JT6A 4MIMA 2VLAA 3M9OB 1TL8A 2PMZN 2DU9A 1TWFJ 4B3SH 3VYSB 2L3DA 1TLHB 3O8HA 4DZPA 1W0TA 5D8KB 3VYTB 4BAYA 3S14J 3ZMVA 3JRDA 2VODA 4WK8F 1I6HJ 2W7OA 1BIAA 2FQ4A 3MZYA 1CF7B 4EJTA 4R79A 3R61A 3RBDA 5HS8A 2XAJA 2HOSA 2DDBA 5HLIA 5FLXW 3PW2A 4FE7A 5B1AH 4OOIA 2R7TA 1RR7A 3IV5A 2HWVA 2JWTA 3MCZA 3OS2A 2HKXA 1T2KA 2XRLA 3KE2A 1YO5C 3S17J 2DJIA 1MDMA 1TW2A 1IJWC 2ZMEB 5JR3A 2H27A 1VBHA 2M7BA 2W6PA 4YJ3F 1ZHFA 3KLOA 4M9XA 2IBKA 2QZ8A 2ZKZA 1QQIA 5ERIA 1FIPA 1J75A 2J6UA 4IHJF 3GTMJ 2D45A 1NK3P 1W93A 4HSTA 2R7UA 2R7MA 3RDIA 1BGWA 3KZZA 2ZJRF 1EUCB 3BTLA 1KZHA 4U7CA 5DCMA 2DA6A 3V42A 3LNQA 2KDOA 2IRFG 4QSHA 4DJAA 3HKZA 1YE9A 1IN8A 4RZRA 1FBUA 1Z3YA 2HU9A 4RNOA 1WJDA 2ZJTA 4EGJA 2CQNA 1K78A 1VFCA 4JI4H 2R5YB 2BV6A 3AFHA 1KU3A 1MMGA 4TV9F 1SFOA 1IDYA 1DPRA 2DA4A 3KCCA 3C2BA 2BR0A 5FKNA 2QBYA 2L9RA 4S04A 5KFYA 1Y1WJ 4G6TB 1QU3A 1SAUA 3J7AY 3M4IA 1MNDA 4YG2F 3BABA 5IP9G 3T1BA 2QYOA 3PW4A 4A5MA 2EZIA 3RIRA 1LE8B 1X58A 3H0GJ 1PX2A 3WTSC 2K3PA 1W5TA 5KFAA 1FIAA 3RPUD 2I8CA 2L7ZA 1U5TB 1ZLJA 2XKOA 3JSPA 2UXDH 1I3QA 5HS7A 1BC7C 2DI3A 5H2FC 3T5XA 4FHTA 1ORKA 2FBIA 4RZQA 2Z33A 2LG4A 1BBYA 2IGMA 3A0HC 4Q8FA 3I4NG 3OOUA 2HKOA 2OQRA 1P4XA 3W2VA 1YW8A 1IF1A 1GUUA 3CDLA 1I6UA 4HNVA 2K4JA 4WF2A 4FASD 2V9VA 5EGOB 1BI0A 3P7NA 1ZQ3P 3TP3A 4LOCA 3EUHA 4A3JG 5HNHA 5IP7G 3UKGA 2I8DA 1QVTA 3I4MG 1FX7A 3FXOA 5L1IA 2JA5A 3DF8A 5B66C 1MMNA 1MZBA 4ENNA 4HRIA 1E2XA 2ZSIB 5IP9J 2L7KA 2KFDA 3KTMA 3MKZA 1X9NA 1PP8F 9ANTA 1RYRA 1W7PA 4IL6C 5BQTA 3ISPA 2QWWA 3QPSA 1LB2A 1H89C 4PK4A 4NC7A 3WTXC 3QRFF 4WXCA 5A2QZ 4PSXA 2LTPA 2K4BA 4XKCA 1HLVA 3KP7A 2DFEA 4CCLA 5E3NA 1N77A 3I4NJ 2BQRA 4GC6A 2NS7A 2A6EF 3JW4A 5LHGA 5LEJA 4CHUA 3RKYA 3PR5B 5TJJA 2DA2A 3JTHA 4NHJA 5CQGA 2C2RA 2CUFA 1R7JA 5JLWA 2DWCA 4EATA 2CH0A 3TP0A 4IOCF 4APMA 2RGRA 2CSOA 2DCEA 4RB0A 2QA4I 4A3JJ 2WAFA 1E17A 2JEGA 3I4MJ 3AG2H 2IA6A 4JP0A 5E20A 4O3PA 4ED1A 3DBLB 3TO7A 2IGNA 2FPGB 3LSTA 4ZH4F 1WFXA 2VJ4A 5JHUA 2RREA 5KG0A 4BHPA 2K86A 1G6NA 4A3FJ 5FLXK 1M6VA 1VQPI 5LXTF 4HG2A 3I4PA 1BM9A 5J40A 3DPLC 4X64H 3GILA 4MGRA 1XMAA 2B7EA 2EIKH 2Q2EA 2OTJI 3K7AJ 5LGNA 4E70A 3Q8QB 1S0MA 4CUGA 1BL0A 4Y52J 2X6WA 1TWGJ 3LWBA 2E1NA 3FKJA 3ROUA 2R6FA 4X65H 1K83A 1FOWA 3BZ6A 4QW9A 3LFKA 1PUEE 3HGYA 1NG7A 3VPRA 1APLC 4BQOA 3VEPA 1DGSA 1L3LA 3JRWA 3KP3A 4E6KG 2E35A 2CUEA 2E5NA 3B6AA 3CC7I 5ED4A 4E7JA 1A31A 1I50A 2VUMG 2X0SA 4RGUA 4HA8A 3FXKA 4FETA 3BR5A 4O3QA 2RQPA 5KFIA 1K7AA 3N4MA 1EH8A 4JBAA 1JDEA 1BA5A 5K2MA 3KHGA 4FBUA 3GMEA 2ELKA 3KYCB 5A2QW 2EA4A 2HTSA 2MA3A 3H5RA 1T0FC 2DPUA 2GOXB 4AIDA 3I55I 1G3TA 3PW7A 2ASLA 2XROA 3RKXA 4JI2H 1RESA 2FKLA 5JVTA 1FP2A 3SXYA 3DXJF 3GTOA 3PSIA 3L2PA 4PFOA 4DGWB 4O3NA 2I87A 2TRTA 4BQAA 2P81A 4IHTA 1TQMA 4IHXA 4ZYAA 2M45A 2CW8A 2QM3A 3R0AA 1S7AA 2HXOA 4XKVA 3PR4A 4HNTA 2WV0A 2YCHA 4RUAA 1TAEA 4M9ZA 3CCMI 3PJRA 4FU0A 4UB8C 1D8JA 2E5LH 4O2AF 5KFLA 2AQ4A 3NEUA 4D0PA 2E2HJ 2BGCA 3QWLA 4LB5A 1BW5A 3CMAI 3GIQA 4NC8A 2QSFX 1XGNA 3OR2C 2JEJA 3FXLA 5LFAA 3BQ0A 2BEOA 4CZCA 1ERDA 5EWFA 2CS3A 3H9QA 2VQFH 4YEJA 1XSVA 2OZUA 2A3SA 4E7SA 3QPHA 2BZTA 1GDTA 4I55F 4ED3A 2E36A 4HF0A 2DMUA 4F91B 3D1NI 2DTRA 3S1QJ 1IZ1A 2X4HA 2XGEA 4KJZA 4KNYA 3KETA 2YR2A 2ZM6H 3GZ6A 1L0OC 4LSXA 3CESA 2NU8B 3HSRA 1O57A 2XB0X 2Z1DA 2RDJA 4HX4A 5CB4F 3L7WA 4JX6A 2D1HA 1UNNC 3GTKA 4J9LA 1FC3A 2OTLI 2UXNA 4JUZA 3E5XA 2JA7J 2STTA 3MWEA 1LVKA 4HR7A 4C5AA 1KEEA 5K7HA 2A68F 5IY5H 1MIJA 4UCOA 3I58A 3ML6A 1O75A 5LL6b 2AGOA 3T5KA 2UV1A 3NAUA 4CDGA 1I1GA 4BQQA 4J9RA 2ESNA 5KFRA 3DBHB 2ME0A 4BEHB 2HPMA 2GXGA 1PYVA 1LFPA 4PUSA 2AHQA 1XDNA 1K4SA 2O03A 3WHCA 3ZXSA 3Q8PB 4IR9A 1JJ6C 4ZYGA 4MFDA 3EUAA 3RKQA 1I6XA 1QO0D 2DOAA 4ZZLA 3G2BA 2DOEA 4OU0A 4RAZA 1OYIA 4A0XA 5BPIA 2HQAA 2M2EA 2JPCA 1HC8A 1OCTC 5H6RA 4U7BA 3GIJA 2R7OA 5GTIC 1XTAA 1A35A 1ZETA 2R0QC 5KCMA 3MKWB 1RR8C 4BXUA 1KYZA 3SZPA 1UG2A 4QWQA 2LR8A 4NB5A 3CCSI 4MA5A 2ELJA 5C1PA 4RB1A 4HDVA 2CJJA 3K4MA 3W2AA 5KFZA 3PW5A 4JI3H 1VQ5I 4YR3A 4ITVA 3CO7C 2DFHA 5EDWA 1O3SA 3OYNA 2ZMEC 4A3MJ 4C2UA 4QWDA 3B73A 1B9MA 1MJAA 1TWHA 2ZFWA 2HZDA 4XKWA 4RAYA 2O8KA 5FO5A 2UVVA 5IOZA 4MEXF 2CWEA 4L1KA 1X1AA 5A2QK 2XGCA 3F6OA 4ZTJA 3FKIJ 2QENA 4ECXA 3K3VA 3Q3SA 3ERED 2XF7A 4LK0F 3S2WA 2B9SA 3F8FA 1W1WE 4L18B 2V58A 1XMOH 1WGXA 3SI8A 5FPOA 2QEXI 2C28A 1ODDA 2BBYA 2KPMA 2FF4A 2H1LA 2NOGA 3TBIA 4PDKA 5C4JJ 5KFVA 3E7LA 4EGYA 4XX0B 3FX3A 4C3JJ 1MBGA 3PO3G 3S2HJ 3V4GA 1RKWA 1RIOH 5EWEA 2FE3A 2CGPA 4A3DG 1B04A 1MJ9A 2IAIA 4C5BA 1R58A 3W3CA 1FOYA 1ITYA 4ZDOA 3BCBA 3BR6A 3OWTA 2P6TA 1OCPA 3S15J 4HSRA 2F4IA 5DEQA 3HOXJ 3SEZA 1SFUA 4AU7A 1PK8A 4G8XA 3OYKA 5IWAH 2M30A 1JHHA 2K02A 2M9HA 4L5JA 4BACA 5ICGA 4DYRA 1MMAA 1IN6A 1EA3A 3CCQI 3MFIA 3L4JA 1U5TC 5JQWA 2Q2UA 3PUBA 2F4VH 5FKMA 1FZPB 2QSHX 1XSXA 4OX9H 1O4XA 4ED8A 4P9FA 2X6YA 3H9JA 2LY2A 2R7RA 3CMEI 4ENJA 3GCMA 2C6YA 1U8RA 2OF7A 1FJGH 3JRBA 5L3GA 3DLAA 4N0BA 2V6CA 4AYBA 2UVWA 1AKHB 5DCFA 3EPIA 5KKNB 1V5GA 5B5EC 3SYTA 3O6BB 5HDGA 1HKSA 1AU7A 4GKJH 3WU2C 3HL2A 4F4XA 4HLXA 4BE1A 5E1ZB 2B63G 1IV8A 2A69F 1ZHQA 2OV7A 1GT0C 1VQ8I 2C35B 4EJWA 4RB2C 2OZ6A 4A6DA 2PQ8A 1D0ZA 4B3TH 3H40A 1TQIA 1JKJB 4DR1H 4K0KH 2L4MA 1SFOJ 3DU5A 3V8KA 1FEXA 1MBFA 4XONA 2ACJA 4B44A 2W57A 2JUCA 4V2GA 3HJEA 1MSFC 3CJQB 2YRWA 4EV0A 2YUSA 3GTGA 2HR3A 1UB9A 4YIIA 2DTZA 1J5YA 4MAMA 5LYJF 2NOJB 1KQ0A 2CV0A 1I3QJ 1TWAA 2Z5UA 3BR1A 3IH2A 3E5NA 2HOTA 3WNZA 4ZI7F 1TNTA 4B8XA 3ABTA 3J81Z 3DPUA 3F8CA 2FK2A 5CVRA 2KZVA 4KIGA 5CVVA 2LF7A 4G7OF 1E0EA 2FUG2 2HDWA 2UXXA 2CKZB 4UCSA 3A01B 2XD4A 3QOPA 3FXJA 5D5XB 4WCGA 4LH7A 4Q8EA 2MD0A 4Q0YA 3BZCA 3F23A 2JA5J 2E34A 4YJ2F 3MZHA 2ZMEA 2I80A 2LY9A 2XC9A 4L0YB 2HQNA 1EHIA 3K69A 3K4BA 3K4LA 2FJZA 3H5AA 1V5EA 4II3A 5KT6A 1IBMH 5CA0F 1SMTA 4Y3OA 1QPMA 1R1VA 5BR8H 3IP4B 3N41B 4EJVA 4LFBH 4LK1F 2V1DA 5J1UA 3OSPA 1T33A 2L5QA 3OYIA 4U88A 1ACIA 4F7ZA 4KDPA 2EFWA 2WAQA 4HPQA 2KIQA 2MH9A 3ZP5A 1YITI 2E1OA 2QSGX 2GLOA 2WB1A 5E1WA 4Z2YA 2LDUA 3FXUA 2DPIA 1MNEA 4MTDA 4KIFA 4DYCA 1LDJA 3JR9A 4KT6A 3P9KA 4AIHA 3CUQB 1G3WA 1PUFB 4G6QA 1V5FA 4UY8I 3KAJA 2C22A 1BIBA 4UVCA 2YSRA 3GBGA 1R4NB 2KZGA 2WAEA 4KITB 1JJ8C 5E18F 1U9OA 1EV7A 3HPHA 3PUFA 4MV6A 3I54A 4P9UA 3HOVJ 4A0YA 5E8GA 3J81W 3V6KA 2F6CA 2F5EA 2VKHA 3VYUB 3S3NA 1ZGJA 2W70A 1RKTA 1HW1A 5J3LA 4YIRX 3VODA 2H94A 3R5FA 2ID3A 1WSCA 1USSA 3W6JB 3CCRI 4L0ZB 1K83J 2CFXA 3C3WA 2WA0A 2RC4A 2HGCA 3RCOA 5D5UB 1FLIA 4J19A 2NRAC 1M1EB 3QU6A 1MMSA 2WDTA 4LIVA 4CYCB 5BPHA 1SD6A 4F50A 3BCAA 1ZRCA 3K4NA 4DQ2A 1ZG5A 2NU6B 1I50J 4Q5SF 4E4TA 1V4RA 5DV5A 3OL4A 3TDZC 3W6KB 4DOZA 1OISA 1BC8C 1NH3A 4EYIB 5EGOA 3R60A 2VBWA 2W82A 1RETA 1W36D 4LD5A 1V3FA 2DK8A 2KQRA 1SVLA 3LSGA 3T5HA 2M5WA 1S3JA 4PDBA 1W4MA 1KU7A 4IJAA 1TT0A 1IRGA 3BAAA 5JVDF 4J9OA 1TNSA 1DU6A 4DL3A 2JA2A 3ABMH 5L1KA 3ABUA 1XMKA 4G94A 5CKTA 3D0SA 2R8IA 3BG7A 3GTOJ 4X1EA 1W7PD 3PM1A 4G7ZF 4EQQA 3DTIA 5JI6A 4R8UA 2Q2TA 3KAKA 2M4KA 3HOSA 1XGMA 3OIQA 1AA7A 2QF7A 3CF2A 3GLLA 2DMNA 3H1CA 3U2RA 3MD2A 2R8JA 4B3AA 2FD5A 1I39A 4XZ3B 2VI6A 3M07A 2FQ3A 2YX7A 3LA2A 5EZHA 3TOAA 1H0MA 3GIIA 1HNXH 5DUIA 1JUSA 4HYEA 4L5EA 2QVOA 1H8AC 4M6YA 3EYIA 3T8RA 4A3KJ 2VONA 3EUKL 4AQYH 2DPJA 4G3IA 4B48A 4ESBA 1YTYA 2EFNA 1S0OA 1JUPA 1G8XA 1J59A 3IAM2 3PIOF 1YJWI 5DM6F 3WTYC 2JA6G 4N4OB 2M0MA 1WJ5A 2VUGA 5D1OA 2NNYA 2QKLB 1Z7LA 2A6HF 5GAHJ 4HDUA 1EH6A 1EYZA 1GSAA 5KG6A 4IHWA 2VBXA 2EWNA 1HKTA 4CC6A 1Z77A 1P4WA 4AD9A 4ED2A 4TQRA 3E6BA 2VE8A 4O5VA 3N05A 3HRSA 3Q9SA 3FXMA 4JI5H 1LVAA 1T95A 1R1TA 1OR7C 5FKLA 5BPFA 2IS4A 5E8IA 3CUOA 1Q1HA 4M7EA 5C8YF 3NRVA 4GC7A 4ECRA 4DR7H 3H3VK 2XIGA 3TL4X 4RNNA 1Z2OX 1A04A 1DGWY 3F8NA 4A2AA 5IYCG 1Y1VG 2DT5A 2K9QA 3ZQGA 3GTKJ 2WTEA 1IUYA 1P7JA 3B6CA 5AONA 3RAQA 3HM5A 4LFUA 3H35A 2L4AA 2XF6A 4XKBA 4QIWN 2EINH 1F43A 1EUDB 2UVRA 3GLXA 4N9IA 4NQWA 2Z3YA 3HEFA 1UCRA 2IBDA 2XASA 3JRAA 4AIKA 3T0YA 1SVOA 2E7WA 3FM5A 4YELA 4AUXA 5K7ZA 5LD2C 1EF4A 5FLMG 2LC2A 1LEAA 1Y14B 3H4DA 2DODA 3O3KA 3RGZA 4NXNH 3MR3A 2H1KA 5KFTA 4J01A 3PW0A 3HOUG 3BG9A 4C3HJ 3RGXA 1Z6RA 4LF5H 4GCVA 2KLOA 3E0JB 3IRRA 4KN7X 4F4ZA 5M5XJ 1IUFA 3J81K 4A2BA 3MR6A 4UCVA 1TQPA 1SCUB 5IYCJ 3GV8B 3C1DA 1WCMA 4LF7H 1REPC 3BROA 3GFJA 1XDSA 2COBA 2H8RA 3IG0A 2W7NA 3MQ0A 1S97A 3TEDA 2MFZA 1LNWA 1W36C 2V59A 5J47A 3Q0UA 2M05A 4XLFA 4K2EA 4Q44A 2AGQA 3Q5FA 2UUZA 5E3OA 4E7KA 4FE4A 2ADUA 2AO9A 3HZJA 4DL6A 5FLMJ 2R7LA 2DYSH 1TWHJ 2X6OA 3CMMA 1SD5A 2W9AA 2JZYA 4DL2A 3W2WA 2HYJA 5DQIA 3HOUJ 4JI6H 1QHHD 3WGGA 4A6EA 4IX7A 4C2MA 3EPGA 3RB3A 1YLFA 2PMZE 4Y13A 3J7AK 3NQOA 3V6JA 4FISA 3M8JA 2N8GA 4RGXA 4DR2H 4UB6C 5HBRB 3BG6A 1U78A 2NXNB 4CO8A 3L2UA 2Z2SB 4LFAH 4PGHA 2R5ZB 2V9KA 4RB3C 3HTUA 3O2PE 5AIQA 4EM0B 3G4SI 1Y8QB 1SANA 4EJOA 3M8EA 3COAC 3Q1KA 1JI8A 1IGNA 4Y15A 4OMYA 4KA4A 2F5FA 1U3EM 3U9GA 1W0UA 2FPPB 2R93A 3ZQFA 5FFXA 1JIHA 5E17F 2K9LA 4ECSA 2LY1A 2F5CA 3F3XA 3OOPA 2QK4A 3QZ7A 1Y1WG 5F1JA 5DGAA 2BW3B 2DW4A 1UMQA 2WTFA 2R92G 5D1PA 5KFPA 3ZQQA 3L2CA 3DU6A 3LSHA 3H0GG 1MW7A 2OJED 3V6HA 3REOA 3I64A 3VFZA 2SCUB 1N75A 1X3WB 4QTRA 1ZGWA 1SYXB 5DQHA 4XQFA 1E3OC 1WJAA 1XDUA 1YS7A 4XN0A 4C3IJ 4H4KC 3DEUA 2YZMA 3ETHA 5D4SA 1T36A 4F52A 3RFCA 4DUZH 1JGSA 1I1SA 2IA1A 1AWCA 3FBNB 1JTXA 3KP5A 1MGTA 2CYYA 2HS5A 2OD5A 3FBIB 4P96A 4EVIA 3RIZA 4BS9A 2JTVA 2QCOA 3S16J 2JVGA 1JE8A 1J9IA 1QZEA 3WTTC 2M87A 1KC7A 1S10A 3RBEA 2OLSA 2BVLA 5LGTA 1WPKA 1VQKI 3FMRA 3GTJA 2GA1A 5B3SH 2A6TA 3TO9A 1OYWA 3KYLA 4BDZA 3PNVA 3CJTB 4HV5A 4OINF 5TRDA 4IHVA 4H0EA 3RUPA 2FBKA 2P8TA 5J4YA 1BI1A 1HNWH 2BYVE 3ULQB 2KMUA 2V5AA 4YRVA 3HG9A 2HFHA 3JAMZ 1MKMA 5FROA 3M1EA 4JYAH 4RDUA 5F9NA 3H4BA 1FOKA 3CCLI 3JRIA 1B4AA 4BJ5C 4U7DA 3GTGJ 4X62H 2V1XA 1XGOA 3HKZN 3KX2A 3IHUA 1S0NA 3GW2A 4YY3H 1X2MA 3CUQC 4HBLA 1TWAJ 3BR0A 2VL8A 3QAHA 2L01A 1R5GA 4FQGA 4A0ZA 4A3FG 5KFCA 3ZMTA 4XOTA 2VT3A 4ED0A 1VS0A 3IWFA 3IL2A 3PQKA 1D1CA 5K5OA 4EEYA 1JX4A 3ZN1A 1GSHA 5ICFA 4DUYH 1XG1A 4MV4A 4LJZF 4I02A 2A05A 3T1HH 1X2NA 1R00A 2BE5F 4EEQA 1TBXA 3S93A 1QPIA 3F22A 1N34H 1KU9A 5F0CA 3ONQA 1J7KA 4LG0A 4PSWA 2F48A 3H3ZA 2XCPA 1UC9A 1D0XA 2PBZA 1PJRA 1VNDA 4XLNF 3LA7A 4UUSB 2C00A 3MFKA 2VQHA 1B59A 4QLCU 3SDBA 3GYHX 2AU0A 1MBKA 3ESWB 2LNBA 3E6DA 3A03A 5J8CA 2O7OA 3KP4A 3AL0B 4A69C 5M3FJ 4XRFA 3GUDA 3JAMW 3M9MB 1TZLA 2JVHA 4I01A 1HQCA 1GV2A 4YQWA 2DMQA 3FM3A 2NVTJ 1IAWA 1WH7A 4C5CA 2HOEA 1GLNA 3RV4A 3ETJA 4EJUA 3ABLH 3BY6A 3I0TA 4HX8A 1KJQA 5EDNA 4LSAA 5LRRA 1GLVA 5LRSA 1WQ2A 1JKQC 3Q9VA 3U1DA 1B9NA 5B1BH 1DQUA 3HYIA 3OSFA 2BQ3A 4O2BF 3LSJA 2MC3A 2L9NA 2Y0SN 2FOKA 2M8EA 2LBFB 2Y0SE 4UFZA 4CC5A 2IEKA 3FF5A 1P2FA 1K61A 2DLLA 4Y17A 4V19K 4HQEA 3MEXA 2PMUA 2EBIA 2HXIA 2HDCA 1P8LA 3ABKH 1VF9A 3PO2J 4BBSG 2ISZA 4AC0A 2JSCA 2X1EA 2VJ5A 3IUOA 4XLHA 1T39A 4X66H 4D1QA 5D8LB 5J4VA 1MNMC 2YL2A 4XYLB 3K4JA 4RBOA 3W6VA 5LHHA 4QWAA 3BJ6A 1V51A 5C5JA 1SD7A 2QGUA 4PJMA 1HCRA 4ZHQF 3A01A 4XOPA 4J00A 4UCTA 2XCLA 2HVQA 4A3LJ 4GYIA 2W9BB 4GFBA 2R7DA 3G3ZA 1WWXA 2NYXA 1BI2A 3L00A 4IO9F 3S2DJ 1A0IA 5GONF 4I98B 1X4OA 1O7LA 2FX0A 2Y0MA 1ULZA 2LOOA 1QGPA 1SFEA 2ZDHA 2LMDA 3VPCA 5KG2A 3BWGA 3BQ2A 2VQEH 4BHBA 2PN1A 2JA7G 3J7YJ 5FB2A 4BBSJ 4RAFA 1IG7A 1JXLA 4PJJA 3DQVC 4HQ6A 2OA4A 1MH4A 1N25A 1B72B 1AUVA 3H3UA 2AGPA 3CTAA 1XNQH 2EIJH 2I5UA 2LKPA 3UNGC 3T8TA 2F5VA 2WV1A 4F93B 3M1CA 3PVXA 3K0LA 2W8KA 5F08A 2P0WA 3A02A 4HX7A 4JK1X 1GV5A 2HQ5A 1YHQI 1UHSA 3DFGA 4IQ4A 1FNNA 2L0KA 4I6ZA 5KT3A 1EJ9A 1IBLH 4P5OA 1I7LA 2LVSA 3FMQA 3PL8A 2WBMA 1R6RA 4MLOA 4IAJA 2QLZA 5LEKA 4JV1A 2JT1A 3F8MA 2GLTA 2O8XA 1YJ9I 3ZMDA 4U0YA 3CMYA 3S32A 1YRNB 1GGOA 3KHLA 1ULYA 2KT0A 4M6VA 3H3VH 3IAS2 4XMYA 2VN2A 3SJMA 4DR3H 3VYRB 2XV4S 2C2DA 3RPQA 1RJQA 4KMUX 2J5PA 4LLLA 3HDDA 1I94H 2OC6A 2WWYA 1BI3A 2IJLA 3PSFA 1OKRA 1HW5A 2XKPA 4EM2A 2XGPA 4ME6A 4A3MG 2P7VB 2V1NA 4I7HA 2PLYA 4V2FA 4CYCA 5KFHA 1G2HA 2YYAA 4CGZA 2X6XA 3PNTA 1YS6A 2HJWA 4PWQA 1QHGA 2NVQJ 1F5TA 3FKIG 1DP7P 1XNRH 4DR4H 3WG7H 2DA7A 2W71A 2FA5A 4DLKA 4LIUA 1MDMB 3E5UA 2O9LA 2Q1ZB 3JAMK 2Y48A 3A4CA 1IN5A 2IS6A
chains in the Genus database with same CATH topology
4IRIA 4M73A 4S05A 3LWFA 3BPXA 2HZTA 3FZVA 1ZYRF 3KALA 2O61A 4G7HF 5F64A 4L9JA 5D4RA 1N33H 2FXAA 1D8KA 4BH9A 5IT9Z 3DF7A 3V8JA 2COMA 4LF4H 2FNAA 2H6BA 1K78B 2DK5A 4OIPF 1GVJA 4WXDA 2MH2A 5EOYA 5JFRA 4ENKA 2EK5A 1FKAH 3F72A 4JI7H 1T0FA 2TDXA 1D5VA 3BJAA 5DDGA 3RPUA 5IT3A 2ZO4A 5BMZA 2MLKA 4KUMA 1ZREA 1ZGAA 3E6CC 3HRTA 1OPCA 2Z9OA 2IVMA 2VC0A 1DPUA 2Z99A 2VPSA 2HGSA 3H92A 5F6FA 1M0TA 1LDDA 2VE9A 1YQAA 1FP1D 1W7PB 1XD7A 3C7JA 5L3BA 3ZPLA 5IT9W 2A61A 3GF2A 2GQQA 2QUFA 4XSZF 3GFLA 2RDPA 1O7FA 3QU3A 2JRTA 1JXSA 3LQRA 2OWOA 1FYKA 4GKKH 1UHMA 1BJAA 3V7SA 3K1MA 3ZMUA 4DV0H 1X3UA 5FGMA 3N40P 1AOYA 1BJTA 2FNPA 3GXOA 3WGIA 4UNOA 2GIVA 1IN4A 5D5WB 2FU4A 3FXQA 4IPAA 3KP2A 4ZYDA 1H9TA 2V79A 4LLGF 3ZQ7A 3BJOA 4KIBA 4YHHH 2PFBA 1HXDA 5DUKA 3RJ0A 1HW2A 5HLHA 5AIPA 4ENMA 1CF7A 2VBYA 3FHZA 3FMAA 4JI8H 5BOXA 3HRUA 3IRQA 3RKWA 4LF9H 1G4DA 3R0JA 4HLYA 2O6GE 1M0WA 1SMYF 1XSDA 1MJBA 2VT2A 2P5VA 1KQ8A 1I5ZA 1DUXC 2HHHH 3WTUC 3CLOA 1PP7U 4M74A 2RKHA 1N36H 3I71A 2P5KA 2KSWA 2Q8KA 4FX0A 3WU0A 2ZXJA 4G9YA 2CG4A 3R4KA 4EGZA 4WXHA 2UUBH 3LAPA 1FBQA 5H6QA 4LLNA 4B09A 2PMHA 3QP5A 4ZYEA 5BS6A 2VOBA 2QQAA 3RYPA 3T1YH 1U5TA 2KJBA 4IVNA 5HDNA 1XN7A 5IT9K 4HQMA 1GXQA 4HZFA 4ZZDA 4MV9A 4LFCH 5FPRA 1S7OA 4UHTA 4DNCA 3AAFA 4I2OA 5J6XA 1ZARA 1XCBA 5L3DA 3F8BA 1E4FT 1XCVA 2VOOA 2G9WA 1T38A 3IKVA 4L9VA 3DP7A 5FD5A 3M7GA 4YFXF 3HIFA 1HSTA 1UHWA 4MTEA 1E4GT 2NS0A 3KXYT 3TKYA 2IA2A 2DO7A 1F9NA 4BHCA 2HVRA 5K1YA 4L9TA 4JV5H 3ELKA 3LAJA 1SFXA 4R1HA 1RZ4A 2DPDA 4O3MA 1QBJA 1YW9A 2PN6A 4UCRA 3G73A 2DAOA 5CVIA 4N9HA 2HVSA 2YPRA 3TOBA 3JSOA 3KEQA 1YW7A 2YX4A 4CYDA 1L2ZA 3WTZA 2WC2A 2ZNYA 3OTOH 3K2ZA 1PDNC 3I59B 3HSEA 3KFWX 1HBXG 2MLGA 3K1NA 1N32H 2EV6A 5LMNH 1P92A 4HOBA 3ECHA 2W84A 2ZCWA 3HOTA 2B0LA 1MD0A 2FMYA 4NXMH 5BPDA 1TTYA 1XMQH 1TW3A 3F6VA 1SAXA 4KHPH 5FD6A 4XLPF 4GYGA 3ZN0A 4WX9A 4MQVA 4IF4A 1ZG1A 1TA8A 1P6RA 2KIMA 2XAQA 4B3RH 4FM9A 2DBBA 3TQNA 1FVIA 4O6JA 4IRHA 1WRJA 2O3FA 2G7HA 1WKMA 1Z7UA 4JQFA 3JTGA 3PFIA 5EEHA 2GXBA 4MQ9F 3DKWA 5ILSA 3WU1B 4OMZA 1S6LA 3MAJA 2CW0F 2UXCH 5ICCA 3OV8A 4ASNA 1IN7A 3P9IA 3FWEA 3GFMA 4JI1H 3TO6A 1R22A 5LHIA 2CW7A 5KK1A 2UZKA 3BA8A 4UCUA 3WG9A 2RV8A 3EQLF 2OU2A 2XAGA 4PCQA 2GWRA 1HNZH 4UXNA 2X0LA 2IA0A 1U2WA 2IP2A 2KKOA 2PG4A 3LMLA 4RS8A 1F4KA 5CVJA 1LEBA 2RVCA 1ONVA 4LB6B 1B6AA 1OR7A 5FFZA 2ELHA 4DV7H 4EM1A 5K5RA 1Z1DA 2H6CA 2PBIA 2XHKA 4LH6A 5J8FA 5D5VB 1Z9CA 4Q4ZF 2P7CB 2ISYA 1HR0H 1HKQA 3GZ5A 3WE3A 3CVZA 3QP6A 2HYGD 1KYWA 2FEZA 2MBFA 4L5IA 1ZN2A 1WH2A 2ZJ2A 4UVBA 2F2EA 5K5QA 4KN4X 1D3YA 4CXFA 3ZMSA 1S03G 4Q48A 3HHGA 2KIUA 4DV4H 4IHSA 3EETA 1QZZA 2XRNA 3E6MA 1FYMA 1Z91A 1KU2A 4UV9A 3M9AA 2GZWA 1K6OA 2R7FA 3GFIA 3FMSA 4M6XA 3TDUC 3BA9A 4IXAA 5DYMA 2UWMA 1IXCA 2QQBA 1B1BA 3RI4A 5F1RA 3J7AO 3WE2A 5LBQA 3V7CA 2XUBA 3IC7A 5CYVA 5D1OB 2H09A 2G7UA 2KIFA 4UV8A 4XSXF 2VBZA 1XGSA 1OMIA 1ZHSA 1FBSA 2P4WA 1O3QA 4A12A 1WI9A 1G3SA 1Z6TA 4JI0H 2W24A 3SZTA 1U6GA 4GGGA 5KVRA 4DR5H 4CZZA 1SEIA 4XBFA 2IPQX 1BOAA 1GYFA 2FBHA 2ZNZA 4R7RA 3DV8A 1FY7A 4DV6H 4KMFA 2UU9H 2ESHA 3PQJA 2UUAH 1C0WA 1STZA 2IW5A 4DV3H 1UFMA 1FT9A 2FSWA 4M72A 2OBPA 3BPVA 5L3EA 2QQ9A 1Z2PX 3CUQA 2EB7A 3RF2A 4I0BA 1RI7A 1H9GA 1J5EH 4OIQF 1Y0UA 1YYVA 2EFOA 2A07F 4OIRF 5CLSA 5EEGA 3CJNA 3SHFA 3FXRA 1O3TA 2R3SA 4GLXA 3F21A 1J2XA 4EFBA 5DD4A 3HUGA 2YU3A 4L9NA 4RGSA 1FYLA 4FX4A 2DQLA 1GHCA 3E3VA 1K79A 4U0WA 1FSEA 2PEXA 1SD4A 4DR6H 1Z05A 3R6SA 4A5NA 1DDNA 4MNUA 3J80Z 5DCMB 2KJCA 3JSNA 3E97A 2OAZA 3IWZA 4GXOA 5HVQC 5D6EA 1R36A 2FMLA 1KGSA 2HEOA 2QBYB 3PN1A 2MD5A 3L9FA 3HXLA 2OQGA 1LDKB 4HAMA 2MCTA 1ZRFA 3N42B 3KEOA 3UQ8A 5CJ9A 1T98A 1QNTA 3I5UA 2WYOA 1ZLKA 3WODF 5H20A 2EV0A 2PJPA 4EFEA 2VXZA 3V8LA 3RTRA 4HF2A 3RTXA 2W85A 3I59A 4YFKF 3B02A 3GVAA 3J80W 1HSJA 2STWA 1KQ9A 4TV7A 4DV2H 1ZG3A 2F5DA 3V7RA 1OYYA 2AS5F 1KA8A 1YFHA 1LJ9A 2KRFA 1FPQA 5HLGA 5HOOA 4LG0B 2XVCA 3D5LA 2EFQA 2LF8A 1WSUA 1GXPA 5ILUA 1V9PA 5ILVA 2L02A 1ON2A 4A2UA 3RJPA 2DFIA 1RUNA 3I53A 2IT0A 1ZH5A 5CVUA 5HS9A 2WE6A 1LQ1A 2NAZA 3GX4X 2M1BA 4PZJA 4M71A 3GEZA 4HF1A 2CQKA 3BP8A 3N43B 1W5SA 4U0VA 4B3MH 1P4AA 2NNNA 1O3RA 6PAXA 1ZAOA 4P55A 4MEYF 1R5HA 3C0FB 4YFNF 1Z2NX 1YIOA 3K1PA 4DV5H 2L54A 3HTSB 2K7LA 2HTJA 1IBKH 5LLQA 4MV7A 3BOQA 4PGGA 1FSHA 4LF8H 4AWXB 3JSLA 2P5LC 3VB2A 2D1VA 2RGVA 4AIJA 1I27A 3L09A 4KICA 2W25A 3GO5A 1QZYA 4ESJA 5ICEA 2RN7A 4FT8A 4CICA 3E5QA 2O0YA 3WGHA 3J80K 2DQRA 2ETHA 2RNJA 4WWCA 4M9SA 4ZYHA 4ETSA 3KP6A 4MHGA 4BNCA 3P9CA 1R1UA 3N97A 4I09A 2EA2A 5HDKA 4AVPA 3MWMA 5LMUH 1RNLA 2EFPA 3C18A 2A5YB 3IKTA 2EV5A 4ON0A 1G3YA 4LGWA 3CO6C 3RYRA 4RGRA 2D2WA 3HSFA 4HW0A 2VC1A 4KT5C 3CDHA 2HQRA 1YG2A 1IW7F 2V1UA 4GO1A 4ESFA 3GWZA 1RUOA 3LA3A 1JHFA 3N44B 4UVAA 3L4KA 4UUVA 2GA2A 3VOEA 2AXLA 1USTA 4G6DA 2EJRA 5E1XA 3ZMZA 2XAFA 1T6SA 1ON1A 3EYYA 2UUCH 2VOPA 1ZRDA 4Q47A 1IXRC 3KZYA 4BWSC 2E1CA 4BYYA 2GAUA 2FRHA 4KYWA 3EDPA 1BN5A 4I0AA 3BDDA 3QPTA 3M8FA 1AN7A 3WTWC 5DD8A 3K9TA 5L3FA 2CO5A 4OIOF 2E7XA 3SFZA 2PI0A 1FWZA 1J0RA 5D6FA 5FLXZ 3SQNA 3N6XA 5LGUA 2K27A 3H20A 4YIFA 2HYFA 4J0MA 5L3CA 1S68A 1S29A 2JPBA 4IRGA 1VTNC 1CGPA 2P6SA 4HV6A 2XAHA 4LF6H 2Y75A 3DPTA 1IRFA 3ECOA 3HHHA 2Q0OA 2UXBH 1NHAA 1XB4A 3TGNA 4R8HA 1R23A 3HRMA 3KLNA 4LMYA 1IXSB 1S8NA 4EMSA 4KFCA 2XGXA 2J5OA 2LSOA 4DV1H 3LQQA 1F1ZA 1EH7A 3WTVC 2ZBKA 2DU9A 4B3SH 2L3DA 1TLHB 5D8KB 4BAYA 3ZMVA 2VODA 4WK8F 1BIAA 1CF7B 3MZYA 4EJTA 4R79A 3R61A 5HS8A 2XAJA 5HLIA 5FLXW 4OOIA 2HWVA 3MCZA 2HKXA 1T2KA 1YO5C 3KE2A 1MDMA 1TW2A 2ZMEB 5JR3A 2H27A 1ZHFA 3KLOA 4M9XA 2QZ8A 2ZKZA 1QQIA 5ERIA 1J75A 2D45A 3RDIA 1BGWA 3KZZA 5DCMA 2IRFG 1IN8A 1FBUA 2ZJTA 1K78A 4JI4H 2BV6A 1KU3A 1DPRA 3KCCA 2QBYA 4S04A 3M4IA 4YG2F 3BABA 3T1BA 2QYOA 4A5MA 3RIRA 3WTSC 1W5TA 2XKOA 1U5TB 1ZLJA 3JSPA 2UXDH 5HS7A 1BC7C 2DI3A 3T5XA 4FHTA 2FBIA 4RZQA 2Z33A 1BBYA 2HKOA 2OQRA 1P4XA 1YW8A 1IF1A 1I6UA 2K4JA 4WF2A 2V9VA 1BI0A 3P7NA 3EUHA 1FX7A 3DF8A 4ENNA 1MZBA 1E2XA 1X9NA 1PP8F 1W7PA 5BQTA 3ISPA 2QWWA 1LB2A 3WTXC 3QRFF 4WXCA 5A2QZ 2K4BA 3KP7A 2A6EF 3JW4A 5LHGA 5LEJA 4CHUA 3RKYA 5TJJA 4NHJA 3JTHA 1R7JA 2RGRA 4APMA 2CSOA 4RB0A 1E17A 5E20A 3TO7A 3LSTA 4ZH4F 5JHUA 4BHPA 2K86A 1G6NA 5FLXK 3I4PA 1BM9A 4X64H 3DPLC 4MGRA 1XMAA