4RB0A

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-apo-fur
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 40
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb0A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb0A02
1YYVA 3KP6A 3KP5A 5HS7A 3FZVA 2ZO4A 5A2QK 2PN6A 5FD6A 2QUFA 1HBXG 3SFZA 3IWFA 2R7FA 1T6SA 3VEPA 2PBIA 1I5ZA 3BY6A 3LQRA 3LSTA 5JVTA 3QAHA 3T5XA 3GEZA 4BNCA 2PJPA 1UHWA 2OBPA 4WK8F 1IN8A 3NEUA 1S3JA 2NS0A 1FLIA 5J8FA 3W6JB 4RGSA 5ILSA 4LK1F 3V7CA 4Y17A 2VBZA 3NQOA 1RNLA 3H92A 4KN4X 4R1HA 4MQVA 2STWA 3GLXA 1WSUA 4OIRF 4UUVA 5FLXK 2B0LA 2IW5A 4OIQF 2YR2A 1Z9CA 5L3BA 1A04A 3K9TA 1MJAA 3C3WA 3WTUC 3RDIA 1Z7UA 4ENJA 3CUQB 2Z9OA 1U3EM 1IN4A 4KIGA 2KJCA 3DPLC 4R8HA 1B4AA 1KYZA 1XGMA 2E7WA 1KU3A 3LQQA 1G3TA 2K02A 3ZMTA 2Z3YA 4HF1A 1ZRCA 1Z05A 2E1NA 1O7FA 3F72A 5L3CA 2F5CA 3E97A 1L3LA 2IA1A 3I71A 5ICFA 2CQKA 4RGUA 5D4SA 4Y15A 2QQAA 4CDGA 2KIFA 1IZ1A 2P6TA 2PG4A 3TQNA 2M5WA 1YQAA 1U2WA 1XDUA 4LB5A 4UVCA 5LGUA 2EFQA 1L0OC 3W6KB 2M45A 2FXAA 1FT9A 2HTSA 3ULQB 1U5TC 1DPUA 3SZTA 2XAJA 1P4WA 1STZA 2MLKA 2W57A 2XKOA 3MEXA 2JRTA 2EV5A 4HAMA 2PEXA 4GXOA 1YW9A 2HKXA 5D5XB 2GWRA 1GHCA 4HDVA 2KJBA 3GFIA 3WTTC 1IRGA 4AVPA 2M1BA 2DPDA 4M6YA 2CWEA 1JGSA 3HRSA 4IRGA 2EWNA 3GYHX 2V9VA 5F64A 1FSHA 5IT3A 3MAJA 2J5PA 2K86A 1ULYA 3U2RA 4P55A 2KRFA 4EM2A 3MZYA 2E7XA 2D1HA 3QP5A 1EV7A 4IHTA 3RIRA 1ZAOA 1R22A 3GFJA 3CUQA 4A5MA 2W85A 5HDKA 3K0LA 2H6BA 1OYIA 2Q0OA 5J6XA 3R4KA 4BXUA 4KIBA 1D5VA 4HF0A 4P9UA 2L02A 4N9IA 4I09A 4A0XA 5LGTA 3BOQA 3V8LA 1AWCA 3RYPA 4IRHA 2BEOA 4FX4A 4YIFA 1O3TA 4N9HA 1OYWA 2HEOA 5J8CA 4I02A 1TQPA 1BJAA 2ZXJA 2ZBKA 4HLYA 1YG2A 1D8JA 5HLHA 1I27A 1OPCA 1FBUA 5KK1A 1LNWA 4ENNA 2ETHA 5HS9A 4QWQA 1BI2A 3GF2A 2P5VA 1H0MA 1R1TA 2MLGA 1G3WA 1NHAA 2O61A 4WF2A 2EFPA 2CG4A 5K5RA 1EH6A 3LAJA 5E20A 4HW0A 2IA0A 5H6QA 3KZYA 1B9MA 1EH7A 2HGCA 5CJ9A 4XBFA 4MTDA 3R61A 3H3UA 4G7HF 2GXGA 1USSA 1J0RA 1SD6A 1J75A 1RUNA 2FU4A 5D5WB 5LRSA 4Q47A 5BPIA 2F5FA 4P5OA 3D5LA 2NAZA 2KIUA 2GA2A 4M9SA 3RJPA 1FYLA 3RKYA 1DUXC 5AONA 3Q9SA 3F3XA 4FT8A 1SD5A 2PI0A 5LBQA 4U0YA 2XV4S 1YW8A 2OQGA 5FO5A 4L5JA 4YFNF 4UVBA 1TBXA 5K1YA 3JAMZ 3K1PA 4HV5A 1BIAA 3K1NA 3R0AA 3BJOA 3GXOA 3P9IA 1SAXA 4GCVA 1UHMA 1GXQA 1QZYA 1S6LA 2R7DA 4EM1A 3TO6A 2VXZA 2Z99A 1TTYA 3V4GA 3J81Z 1ZG5A 4ESBA 1QPMA 1ZG1A 2WC2A 2X0LA 4N0BA 5LRRA 1W5TA 2F2EA 4I2OA 5E8GA 4ZH4F 4HQEA 2XKPA 2ADUA 3I53A 5CLSA 3V7RA 5HS8A 1XB4A 3EETA 1FX7A 2VE8A 3HSEA 3CO7C 5ICEA 3OOPA 1G3SA 2V79A 2OD5A 3E3VA 3T8RA 1IUYA 4JQFA 1P6RA 1B59A 5CVRA 3TDUC 2EFNA 3KP7A 4BHCA 5D5VB 1W4MA 4MEYF 1CGPA 5D5UB 4MEXF 3T1BA 1BBYA 3F8NA 2HDCA 4HX7A 4PDKA 3L00A 1LDDA 2DBBA 5LEJA 2VONA 3WU1B 5D6FA 4IF4A 3P9KA 2IA2A 5L3DA 1F1ZA 3BP8A 1J59A 3WGGA 3AAFA 2DK5A 4CZZA 3ZP5A 2RDPA 3F6OA 2V6CA 4RB0A 1YIOA 3PQKA 2ISYA 3E6MA 3QU6A 3I59A 4P9FA 2M30A 1JHHA 4EMSA 5LGNA 4KMUX 3TDZC 4S04A 1HXDA 4L9TA 3HOTA 2O03A 5ILVA 3J80K 2QBYB 1IN5A 1ZGJA 2UWMA 1SD7A 5FB2A 2VC1A 2CFXA 2IP2A 1TW2A 2JZYA 1T39A 1YFHA 1DDNA 4BAYA 3T8TA 2KIMA 3JSOA 4IPAA 3GWZA 2EB7A 2O6GE 3QOPA 4CGZA 3HYIA 1DP7P 1PP7U 2H94A 3GFLA 3I54A 2OZUA 1TNTA 3E5XA 3ISPA 3LA2A 4K2EA 4OIOF 1EH8A 3IRQA 2H6CA 3QP6A 2VBYA 4RGRA 3K69A 2EJRA 5K5OA 1B1BA 4BHPA 1B9NA 4L9NA 1V3FA 1IAWA 1FOKA 4KA4A 1SFXA 4YFKF 4WXDA 4HZFA 1ON1A 2F5EA 1QQIA 5TJJA 2WWYA 5H20A 4WXCA 2DPUA 1CF7B 4PGGA 2LKPA 4Y13A 4ON0A 5A2QZ 4EVIA 4WCGA 4GO1A 1ZLJA 4BHBA 3V8JA 1XMKA 5D4RA 2QVOA 4KUMA 3EQLF 2UZKA 4KMFA 3HOSA 3IKVA 3ZMZA 3ELKA 3FF5A 1P4AA 2K27A 5AIPA 1HKSA 3DQVC 1XGNA 2BYVE 4EQQA 1BOAA 4I0AA 3WTYC 3E6CC 2Y0MA 4ZYEA 2EA2A 1GXPA 4MQ9F 4LD5A 1SFUA 4A2UA 1E17A 1RI7A 3DFGA 3LA3A 4ZZLA 4CYDA 3ZMSA 1MDMB 1OYYA 2CO5A 1F4KA 3WGHA 1XGOA 1FY7A 4G7OF 3GFMA 4LK0F 2FE3A 1IXCA 1V4RA 1U8RA 1KU9A 3IHUA 3RPQA 5HLIA 2GQQA 3FM5A 1X3UA 4ZYGA 3ZMVA 2YSRA 2P8TA 4YIIA 5FLXZ 4WWCA 5L3EA 5D8KB 2XROA 2YX4A 4HV6A 3I4PA 1FBQA 2DQRA 3N4MA 1IN7A 4AIKA 2W25A 5E17F 3KP3A 2IT0A 4UV9A 2AXLA 1T38A 4OIPF 4IJAA 1XD7A 3V7SA 4A12A 5HLGA 1Z91A 4XLPF 3WODF 4CXFA 2X4HA 2STTA 3MWMA 1E2XA 3F8CA 1W7PB 4M9ZA 3SQNA 3WTWC 4FHTA 2VN2A 2ZMEB 4MGRA 1HQCA 2L3DA 1FBSA 2E1CA 2DFIA 2L54A 3CLOA 1LJ9A 2MBFA 2GAUA 4IHSA 2EFOA 1HKQA 2HKOA 2RNJA 2ACJA 1CF7A 2QM3A 4A5NA 1OR7A 2CW0F 1P92A 1FYMA 3F8BA 4LLGF 2P5KA 2G7UA 2D2WA 1R1UA 4IRIA 2NYXA 3EDPA 5LLQA 3GZ5A 3H3ZA 3KP4A 2XAFA 3DPTA 5JHUA 3ZPLA 5E8IA 3C1DA 1YS7A 3IL2A 3SZPA 2RVCA 4U7BA 1HW2A 2VBWA 1P2FA 3RYRA 2FMLA 5IT9Z 1FP2A 4XSXF 5DCFA 1IF1A 2JSCA 5D6EA 2HQNA 1HW5A 4B09A 1MDMA 5DUIA 4MTEA 1WKMA 4HYEA 1XGSA 1KQ9A 3DXJF 4E70A 1LEAA 2JTVA 1O3SA 3ZQ7A 4OOIA 3PQJA 3WTSC 4L0YB 3MCZA 4UXNA 1IXRC 2FSWA 2ZNYA 1IW7F 4MNUA 2PMUA 1QGPA 4ENKA 4A6EA 5DUKA 3RKXA 3WE3A 5BS6A 5FFXA 5ERIA 4LGWA 1B6AA 1ODDA 3F23A 3G73A 1TQIA 3BJAA 3L7WA 5HOOA 2G7HA 1QZZA 3CTAA 3HSFA 2VE9A 3KE2A 2D1VA 3V8KA 2LSOA 2FBKA 1T2KA 1WI9A 1J5YA 1G6NA 2BBYA 2AS5F 3ML6A 1C0WA 3FXRA 2ZMEA 4DNCA 3MZHA 3KLNA 3LWFA 5K5QA 1DPRA 2QYOA 1K78B 2HOEA 2MH2A 2ISZA 2OA4A 1LDJA 1K6OA 2LNBA 1LVAA 2W24A 2DU9A 4B8XA 2P7VB 3IWZA 4IVNA 5LEKA 4KFCA 1KU2A 5EEGA 1UFMA 4O5VA 4LMYA 4EJWA 2JPCA 4JK1X 1TLHB 2QZ8A 2P4WA 2DI3A 1PDNC 2PQ8A 5AIQA 5HVQC 4RGXA 1AOYA 4KT5C 2Z33A 4HX4A 1D8KA 2VOOA 3DEUA 3IC7A 4HBLA 1ONVA 4LG0B 5CYVA 5DV5A 5EEHA 2A6EF 2DW4A 4O6JA 3ERED 2G9WA 3T0YA 5ILUA 1XCBA 1ZRFA 4NQWA 1BC7C 3FMSA 1MKMA 5LHIA 4HX8A 1LQ1A 2H27A 5FGMA 4NB5A 2H09A 4G94A 4WXHA 3BROA 1ZGAA 3G3ZA 2EFWA 5CVIA 1MD0A 4ZYDA 4A6DA 3KLOA 3JTHA 3ZMDA 2JT1A 4KDPA 5LHGA 4L5IA 2F5DA 3ZN1A 1XSDA 1BM9A 1D3YA 2DK8A 1ON2A 3HHGA 1YW7A 1F9NA 2V1XA 2MC3A 3M8FA 2C6YA 2UXNA 3S2WA 3GVAA 2ELHA 1VTNC 5CVJA 1IXSB 1RUOA 2VT3A 4OINF 4HF2A 1IN6A 1Q1HA 3DV8A 4AIHA 3ABTA 3KZZA 2ZCWA 2P5LC 3RI4A 1JHFA 1R7JA 1JXSA 3KEQA 1UB9A 2WTEA 5BMZA 1SFEA 4U0VA 4YFXF 2QQ9A 1W5SA 3C7JA 3HRMA 1K78A 4HDUA 4H0EA 1FWZA 1ZYRF 4ASNA 4KYWA 2Q2EA 3WE2A 4UVAA 4RAZA 3IKTA 1BC8C 3I64A 2DLLA 4G8XA 3JTGA 3L09A 2NRAC 5DYMA 1Z6TA 4RS8A 4KNYA 5E18F 3KCCA 3WU0A 4P96A 2XUBA 2XAGA 4ESFA 2O3FA 3NRVA 3GO5A 4ZZDA 1U5TB 4XSZF 2YPRA 4LG0A 3WGIA 2RC4A 1Y0UA 1O3QA 2ZFWA 3FX3A 4DQ2A 4M73A 3OV8A 1JE8A 3ZN0A 6PAXA 1S29A 1Z1DA 4AIJA 3ECOA 2EV6A 3RKWA 3HRTA 1QO0D 2HZTA 1YO5C 1XDSA 3FHZA 1O3RA 4HA8A 2BV6A 3CDHA 3KEOA 3EUHA 1J9IA 2XHKA 2M8EA 1QBJA 4EM0B 4Z2YA 2L4AA 1LB2A 1SMTA 3M8EA 2MH9A 2V1DA 3M7GA 3GW2A 2LDUA 2HYGD 3ECHA 3C18A 4BH9A 4EJUA 4KICA 3F8FA 4WX9A 2K4BA 1KYWA 2HS5A 2GA1A 2OZ6A 3L9FA 3J80Z 5BOXA 2VT2A 4NHJA 1R5GA 2OU2A 2R3SA 3I0TA 2CYYA 2TDXA 1QNTA 1PP8F 5KVRA 4G9YA 2XASA 3B73A 2FEZA 4LLLA 3U9GA 3BPVA 4I98B 1KA8A 1GVJA 2FNAA 5JI6A 2RKHA 4GYIA 2J5OA 3TOAA 4CICA 3E6DA 1KGSA 2IPQX 5FFZA 4TV7A 4UV8A 1WRJA 2W84A 3PFIA 4M72A 3TGNA 3GZ6A 2IJLA 2HYFA 3FMQA 1FP1D 4BYYA 5TRDA 5JR3A 3Q9VA 2ZKZA 3Q5FA 3LFKA 2GZWA 3K2ZA 1Z6RA 1H9GA 2QBYA 5CVVA 4L9JA 1U5TA 1ZARA 3I58A 3TO7A 1MJ9A 3I5UA 1USTA 3WTZA 1HW1A 2YX7A 3HHHA 2RN7A 4BQAA 2DO7A 1YTYA 2ZNZA 3CUOA 3TO9A 3KETA 1FC3A 3ROUA 3BJ6A 1I1GA 3ZMUA 2VOPA 3RPUA 1OKRA 2QQBA 2VBXA 1LEBA 1WWXA 1SMYF 2L01A 1XSXA 1IRFA 1O57A 1KQ0A 3COAC 4I7HA 4L9VA 2D45A 2VODA 4U88A 3VODA 2HQRA 1T0FA 5CVUA 2JPBA 3EYYA 4Q48A 3WTVC 5IT9K 3F21A 2P6SA 1BI3A 4GYGA 3WG9A 5BPDA 5DDGA 4HQMA 2RGVA 3DP7A 4OMYA 3P7NA 1KQ8A 4S05A 5ICGA 2XAQA 3DF8A 3FWEA 4M71A 2L4MA 2IRFG 3FMRA 4OMZA 1BI0A 3P9CA 4M9XA 2MA3A 4M74A 5F1RA 1G4DA 2EV0A 5ICCA 3KP2A 2LF8A 4Q4ZF 4EJTA 4FX0A 5DD8A 5F6FA 1ZLKA 4LB6B 1I1SA 4QLCU 4XRFA 3QPTA 4L0ZB 2NNYA 3BDDA 3WTXC 3HTSB 3F6VA 1SD4A 4CO8A 3KFWX 5ED4A 1OMIA 3CUQC 3K1MA 2PMHA 5L3FA 4A0YA 4HOBA 2Y48A 1MJBA 3REOA 5FD5A 1W7PD 3HIFA 5LHHA 1T98A 1H9TA 1TQMA 2ESNA 3FXQA 3R60A 2XRNA 3SXYA 1RZ4A 3GUDA 4HLXA 2Q8KA 3CJNA 4ZYHA 2HTJA 3TKYA 2BGCA 2P7CB 2FF4A 4MHGA 3MFKA 2QWWA 4ESJA 1FZPB 3IRRA 1ZG3A 4I01A 1G3YA 3LA7A 5D8LB 1F5TA 1S7OA 3D0SA 3M1EA 1HSTA 1R23A 2FRHA 3JAMK 2Y75A 2XIGA 2COMA 1REPC 3J7AO 1W7PA 2Z5UA 3SHFA 1RIOH 5DD4A 4OU0A 2A69F 3J81K 3JW4A 2DAOA 1I6XA 2MD5A 4IXAA 3VB2A 4AD9A 4G6QA 3E6BA 2LF7A 4GGGA 2PFBA 3N97A 4LLNA 1BIBA 2FBIA 5E1ZB 2FA5A 2FQ3A 4PGHA 2K7LA 3R0JA 1K7AA 3E5QA 1UCRA 2O8XA 2K4JA 2XAHA 2YU3A 2A07F 1R1VA 3I59B 5HDGA 1J7KA 2XVCA 2FNPA 2GXBA 4RAYA 2XGXA 5DCMB 3E5UA 4YG2F 2CGPA 2OQRA 1J2XA 5E1XA 4G7ZF 2HFHA 1XSVA 4UHTA 1YLFA 1HSJA 1ZREA 1ZH5A 2VC0A 4LFUA 2V1UA 1MZBA 2KKOA 1FNNA 1HKTA 3GX4X 4UNOA 3FM3A 4CHUA 4EGZA 2RQPA 3DKWA 4U0WA 4KIFA 2IVMA 2QLZA 1FSEA 5DEQA 5HDNA 3CO6C 1LDKB 4PCQA 3QPHA 1ZN2A 4U7DA 3HRUA 4G6DA 2QENA 4I0BA 1U6GA 2FOKA 2NNNA 1S8NA 4EV0A 1PUEE 3BPXA 4D0PA 1K79A 2FBHA 2DTRA 3U1DA 4A0ZA 3HSRA 3RTRA 2ZJ2A 4RB2C 3F8MA 1ZRDA 4M6XA 3TOBA 5E1WA 3BZ6A 2GIVA 3VOEA 5H6RA 1WQ2A 4L18B 5L3GA 4RB3C 1ZHFA 3BWGA 2OAZA 2ESHA 3LAPA 3HTUA 1TW3A 4ENMA 1XMAA 2EK5A 1R36A 1YS6A 4RB1A 2DQLA 4PZJA 3QRFF 2WV0A 1XCVA 3B02A 3O3KA 2HR3A 4AWXB 2EA4A 1KU7A 3F22A 2CSOA 3VFZA 4LJZF 4XLNF 1O7LA 4O3MA 3EYIA 2HWVA 1FPQA 3L2CA 1BN5A 2BE5F 2A61A 1S7AA 3R6SA 3M9AA 2A68F 2M87A 4KN7X 4F7ZA 4Q5SF 1R00A 4EJOA 1U78A 1TNSA 4EJVA 3FXUA 2PLYA 2A5YB 1R5HA 4R79A 3JSPA 1FYKA 4EGYA 2O0YA 1P4XA 1R58A 3O2PE 3O6BB 2RV8A 2FMYA 5DCMA 3ABUA 2DT5A 2A3SA 2A6HF 4ETSA 3MQ0A 5BQTA 1MGTA 2UXXA 1BI1A 3QU3A 5JFRA 1XN7A 3HUGA 4JBAA
chains in the Genus database with same CATH superfamily
1YYVA 2M9HA 3KP6A 5H80A 3KP5A 2JK3A 1GV2A 1VZ0A 5HS7A 4PJJA 3FZVA 5EG0A 1VQLI 2FKLA 3LNQA 3S2HJ 2ZO4A 2M7AA 5A2QK 4QIWE 3BQ2A 2PN6A 3PUBA 5FD6A 2R7ZJ 1ACIA 2QUFA 3CD6I 1FOXA 4RNOA 5KFEA 1HBXG 4ED3A 4J9OA 3SFZA 3IWFA 1C3OA 1RPWA 3LSRA 1IRZA 2R7FA 4W97A 1T6SA 1SEIA 3VEPA 2PBIA 3VYRB 4FTHA 1I5ZA 3BY6A 3CCVI 5FLMJ 2UVRA 3LQRA 1J09A 5JLXA 2M3AA 4RA2A 2DA5A 2ELKA 3LSTA 5JVTA 1DV1A 5L9XA 3QAHA 4CA0A 2AHQA 1Z2PX 2HU9A 3T5XA 5LMUH 4DUZH 3GEZA 3MJFA 4BNCA 4KT6A 1U9OA 2PJPA 1SVMA 3M9OB 2QEXI 1UHWA 2WY8Q 2OBPA 1K1SA 4IRKA 2FX0A 3CCUI 3W2AA 1I50A 4WK8F 4X66H 3GCMA 3U9SA 3VYTB 3K7AJ 1IN8A 5FLVA 2XCAA 3H9GA 2NS8A 5EJCA 3NEUA 4IL6C 1XDNA 2W6PA 1S3JA 1A6QA 2NS0A 3HXLA 2DJNA 4AVZA 3K4LA 1APLC 1FOWA 3DTKA 5J8FA 4A3LJ 1FLIA 3GLKA 4R8UB 5L1JA 3BR1A 2D5VA 1WSCA 3W6JB 3KHLA 4RGSA 4U7CA 2K9SA 3U1KA 3EUHC 5ILSA 4BQQA 4LK1F 3V7CA 4Y17A 2VBZA 3NQOA 2HJWA 4A3GG 2MYSA 3SYTA 2WDTA 1RNLA 2CZGA 4ED2A 1OWTA 3H92A 2UV1A 4LIUA 1GLNA 1KC7A 4AUXA 4IOCF 4KN4X 3L1PA 1Y39A 4R1HA 4MQVA 2STWA 3GLXA 3MR5A 5KFQA 2ZFUA 3K3VA 1WSUA 4OIRF 4UUVA 1NG6A 3HOWJ 5FLXK 2B0LA 2IW5A 4OIQF 3CCLI 2J9GA 2YR2A 1Z9CA 5L3BA 3Q8SB 1Y1VA 3Q3SA 4JOMA 3UR3C 1A04A 3K9TA 1MJAA 3F0CA 3JSLA 3OYAA 3A03A 3C3WA 3WTUC 2R8IA 3RDIA 2AQ4A 2IA6A 1Z7UA 1ETWA 5BNGA 2I80A 2IXSA 4C5CA 1TWHA 4XKCA 3K70C 1EYZA 4RZRA 2HGSA 5TISC 4ENJA 1HDPA 3CUQB 4A3FJ 3MWEA 2YU9A 2Z9OA 1N33H 1U3EM 1IN4A 2KRHA 3HM5A 4EBDA 1MMSA 4KIGA 4DZPA 5KFXA 2KJCA 3DPLC 4R8HA 1IJWC 3RQIA 3RV3A 1WH7A 1D5YA 5E3NA 1B4AA 1KYZA 1XGMA 2E7WA 4XLFA 1BR1A 3E0JB 1KJ9A 1KU3A 3LQQA 2E1MC 1G3TA 4IHVA 1ZETA 2K02A 2YRWA 3ZMTA 4ED1A 2Z3YA 3RPUD 4YIRX 1GYFA 1GSHA 4ECXA 4HF1A 2NS7A 4XONA 4BU2A 1ZRCA 2DPIA 1Z05A 1Y0NA 2E1NA 1O7FA 4ZC3A 2HXOA 3F72A 4F92B 2QYZA 3H40A 2KDZA 1VQMI 5L3CA 2AO9A 2F5CA 3HOVJ 3E97A 2UXBH 2IBKA 4ZTJA 1W36D 3A0HC 2K9MA 4EBCA 1L3LA 4D5FA 3F9KA 3Q8QB 2IA1A 3I71A 3PSIA 1QHGA 5ICFA 3JRHA 2EBIA 4ZQIA 2CQKA 2V6EA 5E3MA 2KT0A 3CQZJ 4RGUA 5D4SA 1IBMH 4Y15A 2TRTA 3PW0A 4DYQA 2QQAA 2R7NA 4CDGA 2KIFA 1IZ1A 2P6TA 2HXIA 2JWTA 2PG4A 3TQNA 4UCTA 1BOBA 2Z2SB 2M5WA 5KAIC 1VQKI 4JV0A 4RUAA 1YQAA 1U2WA 1X4PA 1XDUA 4UUSB 4LB5A 2QF7A 3BJYA 4UVCA 1M0WA 1WGXA 3I4NG 3LMMA 5LGUA 2YL2A 2EFQA 1L0OC 2QQ8A 3W6KB 2VIXA 1MBJA 2YZNA 2NU8B 4GLXA 2M45A 4LF7H 2CQ7A 4CYCA 4CH7A 2CV0A 1TWGA 1VNDA 4CC5A 2FXAA 3RCOA 1FT9A 2HTSA 3KEYA 3T5LA 4NC8A 3ULQB 1U5TC 4ED6A 2WB1E 1DPUA 3FDSA 4J0MA 2IS4A 1VFCA 4MA5A 2W9CB 3SZTA 2CQYA 1QVTA 2PVPA 2DFHA 2XAJA 5F27A 5KT5A 4HNVA 4PSWA 4BY1J 1Z7LA 3RV4A 1YOVB 1P4WA 1STZA 1MMGA 1E0EA 2ALZA 2MLKA 1VBHA 5KFFA 2GPSA 1G59A 2G0EA 2W57A 3MFIA 2XKOA 2MGQA 3MEXA 1HNWH 5B5EC 2JRTA 2EV5A 2HYJA 1WJCA 3FISA 5J40A 4O3PA 4HAMA 4F3QA 2XB0X 2PEXA 4GXOA 1YW9A 2HKXA 3H20A 5CQEA 1TP4A 3LSMA 5D5XB 2GWRA 3BZKA 1BW5A 4C3JJ 5IP9J 4R8UA 5IYDG 4C5AA 1GHCA 1V54H 5M5YJ 1Y1WA 2J6SA 1TC3C 4HDVA 3GTJJ 2KJBA 3GFIA 3WTTC 1IRGA 4AVPA 2M1BA 4ZHQF 1PJRA 1UG2A 2DPDA 3RAQA 4M6YA 3VPRA 2CWEA 1JGSA 3HRSA 2VA2A 4IRGA 1AHDP 2EILH 3SDBA 2EWNA 4ECVA 1R5ID 1QU3A 3GYHX 2NOJB 2V9VA 4BE2A 4A3BJ 5F64A 1FSHA 5GADJ 5IT3A 3FKIA 5EWFA 2JMWA 3MAJA 4ECQA 3O8GA 4ZI7F 4D1QA 1OCRH 2JA6G 2J5PA 4DL4A 5J47A 2K86A 1ULYA 2M2EA 3U2RA 1KBLA 4P55A 2KRFA 4EM2A 2FK2A 3MZYA 1HC8A 4LG3A 2E7XA 2BVLA 4EYHB 2D1HA 5C4JJ 2DZDA 3QP5A 1EV7A 3OWTA 1V5GA 2HQ5A 2LMDA 4IHTA 1S0NA 5J4VA 2A05A 1ITYA 4ZOLF 5DLFA 4YEJA 3RIRA 2QK4A 1ZAOA 1A9XA 1R22A 2X6OA 3GFJA 3CUQA 2CUZA 4A5MA 2YZMA 4LH7A 2FJZA 1WJBA 3JRAA 1E3OC 3K4JA 2W85A 3R5XA 4AQYH 5HDKA 3N42B 3AL0C 3K0LA 2H6BA 1OYIA 2Q0OA 5J6XA 3G6YA 3R4KA 4Q8FA 4NDLA 4BXUA 4ITVA 3CC4I 4KIBA 1D5VA 3JZIA 3JRXA 4HF0A 5KFUA 3DKXA 4P9UA 3CQZA 3V4ZA 2L02A 3JSNA 2EQRA 2GLOA 1ZELA 4N9IA 3ZOBA 4I09A 2FP4B 2VPRA 2CKZB 4A0XA 3OIQA 1ZQ7A 5LGTA 3BOQA 4DV1H 3QYBA 3EPIA 5FKLA 2DN0A 3CCSI 3V8LA 1AWCA 3RYPA 4BJ6C 2W7NA 4IRHA 2YS7A 2HPIA 2BEOA 1E3PA 1A35A 1M1EB 3HOUG 5KT3A 1Z2OX 3OYHA 4FX4A 4YIFA 1O3TA 4N9HA 2ME6A 2C2RA 1OYWA 4MFDA 5J1RA 2HEOA 2FOWA 1AU7A 3N6XA 5J8CA 4I02A 3W2WA 1TQPA 4F4ZA 1BJAA 2ZXJA 2ZBKA 1XTAA 1B8IA 1MIJA 3PNVA 1X3ZB 1YG2A 4HLYA 2JA8J 4JI0H 3GTGA 1Z21A 3ASNH 4E7IA 2JVGA 1D8JA 4F4WA 2V9WA 5HLHA 3L2VA 4JI5H 1I27A 1OPCA 4DV3H 1FBUA 4M3DA 3SEZA 1SVOA 5KK1A 1LNWA 3IAM2 2OV7A 3E5NA 1U8BA 4ENNA 2ETHA 1G8XA 3M8JA 3PNTA 1ZR2A 2PMZE 5HS9A 4J9MA 2DMPA 2K9QA 4ECZA 1MBKA 1TWAA 4QWQA 1BI2A 2H1KA 3RUPA 3GF2A 3OOUA 3ZR8X 4ED0A 1JKRC 2P5VA 5F04A 3H5NA 4A2AA 2VUGA 2KDOA 3K4MA 5DG8A 4BGDA 1H0MA 4JI4H 2R92G 2L2OA 1R1TA 3B6CA 2MLGA 3NARA 1G3WA 1NHAA 3K4CA 2JA7A 1JTYA 2O61A 4WF2A 2EFPA 2EIJH 3GIIA 2W9CA 4PJLA 2CG4A 4EYIB 5K5RA 2F48A 2YYAA 1EH6A 2BY2A 3KZIC 4FE7A 3LAJA 2ATLA 2XD4A 5E20A 4HW0A 2IA0A 2R7ZG 1CQJB 3CVZA 2W48A 3BR3A 5H6QA 5KFBA 1KEEA 2W7OA 4IWYA 4DV5H 2CJJA 1YI2I 3S8PA 2XF7A 3CCQI 1J5EH 2WAFA 2X0SA 1TAEA 4RUCA 1Y8RB 2DPJA 2Y2ZA 4NXNH 5FKOA 5LFAA 2RDJA 4ZYAA 1IC8A 3KZYA 3JRFA 1I94H 4U6PA 1B9MA 1EH7A 2HGCA 2E5LH 5CJ9A 4MV7A 5FLMG 4XBFA 3ZQGA 2KPMA 4EG0A 4MTDA 3R61A 2ZJQF 3MFHA 3H3UA 4G7HF 2X1CA 3GTOJ 2GXGA 1USSA 1J0RA 3HPHA 5CQGA 1SD6A 1J75A 1I6UA 2C22A 3H3VH 2OCEA 1S97A 5EDNA 2KMUA 2WAQE 4B48A 3M4IA 2I8DA 1IUFA 3ZXSA 4QPOA 4LF4H 1RUNA 2LKXA 3MZ8A 1JLLB 2E2HJ 2FU4A 1ETOA 1IOWA 4QWDA 2JEGA 1ETXA 1SFOA 4B47A 5D5WB 3JR9A 1T33A 3LSGA 5EOYA 3TIIA 2C2EA 5LRSA 4Q47A 5BPIA 4NUBA 3QPLA 5F0HA 2E2IJ 2F5FA 1HR0H 3AFHA 4P5OA 3W3CA 3ZQIA 4QTRA 3D5LA 1X1BA 2NAZA 4A3LG 2KIUA 4FQGA 2GA2A 1OCTC 4M9SA 1A6IA 3RJPA 2J6TA 2H8WA 3VMMA 1FYLA 3G8CA 5LYJF 3RKYA 4XORA 3N05A 2ZJTA 4M7EA 1DUXC 3PL8A 5AONA 3Q9SA 1UHSA 1E4FT 3CCYA 3F3XA 4FT8A 1SD5A 1X19A 2PI0A 4BY7G 3SJMA 1LUJB 1MNDA 3S15J 5LBQA 3PW5A 2JN6A 2XV4S 4U0YA 5LA6F 1YW8A 1HNZH 2OQGA 5FO5A 4L5JA 4YFNF 4UVBA 4I4TF 4DL3A 1TBXA 5K1YA 3KHGA 3HOWG 3JAMZ 3K1PA 3H9QA 4LH6A 4HV5A 2PJRB 3KHRA 1BIAA 3K1NA 3OYCA 4P1WA 2VQFH 3R0AA 3BJOA 3BA9A 5L1IA 3OMYA 1YX5A 4BS9A 3GXOA 5EZYF 3GMEA 4A2BA 5IP7J 3P9IA 5J1UA 1RYSA 1SAXA 3QOEA 4MV8A 2ZDHA 5D1OA 4GCVA 1GXQA 1S6LA 1QZYA 1UHMA 2R7DA 2VUMJ 5EZHA 4A3FG 4BE0A 2WY7Q 4EM1A 3DU6A 3H9JA 3TO6A 4DV2H 2VXZA 2Z99A 4WBNF 1TTYA 4LSAA 3V4GA 5C8YF 2BQ3A 3J81Z 1ZG5A 3BTJA 2WAEA 3G1OA 3KX2A 4PFPA 1N56A 4ESBA 1BA5A 1FOYA 2RQQA 2X6WA 1QPMA 1ZG1A 1VQ8I 2XAUA 1H8AC 2WC2A 1V9PA 5DQIA 1D0ZA 1P9QC 2X0LA 4N0BA 2X9DA 3IH3A 5LRRA 4DLKA 1W5TA 1ZGWA 2F2EA 4B3MH 3BCBA 4I2OA 5E8GA 4ZH4F 4J9NA 2K3PA 2V26A 1IDZA 4HQEA 1B6SA 3ZQHA 3S17J 1HA8A 2XKPA 4DUYH 2ADUA 1RKWA 1JUMA 3QPSA 4HNUA 4XYLB 2IGKA 3IUOA 2OF7A 4XK4A 3HOVG 3WO1A 3I53A 5CLSA 1I3QA 3MKYB 3V7RA 5HS8A 3ORQA 3GILA 4Y4RA 1XB4A 2VQCA 3EETA 5KFHA 1W5CC 2QCOA 1S9HA 4UFZA 2RREA 1FX7A 5BPFA 3QZ8A 4BBRG 4V2GA 3C2HA 3GLLA 3V6KA 2VE8A 4DR7H 2ZM6H 4A3KJ 4RMNA 5B1BH 2DOAA 1MBHA 3EUKL 4OAYA 1DP3A 3K5IA 3HSEA 3CO7C 1S10A 4BUPA 3M3YJ 5ICEA 3OOPA 4XOTA 1SC7A 1G3SA 1PUFB 3WNZA 2VXDA 2OUMA 3PO3J 2J6UA 4OWRB 1JUSA 2BOLA 2V79A 4DV0H 2DA1A 1I50J 5J4YA 2K9NA 2OD5A 3E3VA 4UB8C 3GTLJ 3T8RA 1IUYA 4JQFA 5GONF 2ASLA 1P6RA 4B43A 1B59A 2VKVA 3H5RA 5CVRA 1MMNA 3TDUC 3H3VK 5EEAA 4FU0A 2EFNA 3KP7A 4NLGA 4BHCA 3GTPA 5D5VB 1W4MA 4MEYF 4BL0B 1CGPA 2AGOA 5D5UB 4MEXF 4C3HJ 4O4HF 3T1BA 1RETA 1BBYA 3G1LA 1OCZH 3F8NA 2HDCA 4TV9F 2R7VA 4FISA 4HX7A 5LMNH 3RSNA 4PDKA 3L00A 2E1MB 3OSFA 1WZ2A 1LDDA 2HNHA 2DBBA 1RK5A 5LEJA 3QODA 2JEFA 3FDYA 4G6TB 1VQ9I 2FK1A 3JRBA 4ED7A 2VONA 2GPWA 1TWFA 3A0BC 1TA8A 2MW8A 4O3QA 3WU1B 1FEXA 3LFUA 5D6FA 4YJ3F 5F9LA 5CAEB 2LK2A 4IF4A 2LRDA 3P9KA 3RQ4A 5JQWA 2OWOA 2E71A 2IA2A 2O7OA 4DYRA 4O3RA 2LP0A 4ECWA 1CS0A 1V51A 3H0GA 1Y1VJ 1F1ZA 4XLCA 3BP8A 5L3DA 1J59A 3WGGA 3AAFA 2DK5A 1D1BA 3RGXA 4CZZA 3ZP5A 2RDPA 3AKZA 3WHCA 1H89C 1AA7A 1LVKA 3F6OA 2V6CA 3C0FB 4YR0A 4L1KA 4JI8H 1QHHD 1TWHJ 2UXDH 4E7JA 4RB0A 3TEDA 5IP9G 3DBLB 1YIOA 3LSJA 3PQKA 1KJIA 3VWBA 2VKDA 3HL2A 2YU9J 2ISYA 5GAHJ 2VQGA 3E6MA 3QU6A 3I59A 4P9FA 2M30A 1JHHA 4QIWA 2L7MP 4EMSA 5LGNA 1N48A 3MMYB 4KMUX 2LC2A 2PBZA 1ETYA 2JA5A 3LOCA 5IY5H 3HJEA 2VA3A 4PJNA 3TDZC 2K3FA 5K7ZA 4A3BG 2VQLA 2XCPA 2BZTA 2MFZA 1WJ5A 4UUTA 5FKMA 3I4MJ 4S04A 1JT6A 1WPKA 3CCRI 1HXDA 1Z2NX 4L9TA 2RDIA 2N8GA 5GPAA 2WA0A 4IOAF 3HOTA 2O03A 5ILVA 3PIOF 3J80K 2QBYB 2YRXA 1IN5A 2PJRA 1DV2A 2JVHA 2L0KA 1ZTRA 1ZGJA 3BR2A 1Z67A 5GPCA 2UWMA 1FJGH 2W1OA 1SD7A 2M7BA 4O4IF 5FB2A 1MMDA 2VC1A 2CFXA 2IP2A 3D1NI 4HYKA 2M34A 4E7LA 3DTEA 4YR2A 1TW2A 2UVUA 2JZYA 1MSFC 1EKEA 1DU0A 1T39A 4O4LF 3VDXA 1FVIA 1YFHA 4XKBA 1DDNA 4BAYA 3T8TA 4DR1H 4DGWB 5HLTA 2KIMA 3Q2OA 3JSOA 4IPAA 2KISA 4QIWN 3GWZA 2DMTA 2CV1A 2EB7A 3RB6A 1IBKH 1RYRA 1VQPI 5KFDA 3ORRA 1N34H 2O6GE 3QOPA 4CGZA 2LTPA 1T3NA 1MBGA 3HYIA 2GBYA 1DP7P 1SVLA 4PWQA 3OIOA 2UUCH 4TUYF 1PP7U 3D5SC 4EFEA 2YZGA 2H94A 3GFLA 3I54A 1A0IA 3A1YA 2OZUA 1TNTA 5C1PA 2R8KA 2F4MB 2KZVA 1TWGJ 3E5XA 3ISPA 2R93J 3LA2A 3G1MA 4K2EA 3LWBA 2CUEA 4BBSJ 2L9VA 4OIOF 2VASA 1EH8A 1YE9A 4ZTFA 1N75A 3CF2A 3IRQA 1JIHA 2H6CA 4DV4H 2R8JA 3CDIA 3QP6A 2VBYA 3GTLA 5M3FJ 2E1OA 4QWEA 4RGRA 3K69A 2EJRA 5K5OA 1B1BA 4BE1A 2ASJA 1JKJB 5KG2A 3KYDB 1Y56A 2Y0SA 4BHPA 3L4JA 3GV5B 2FB9A 3QWLA 2QSHX 1B9NA 5IP6A 1I7LA 2JA8G 5CA0F 1PUFA 3OYLA 4L9NA 1V3FA 1RJRA 1IAWA 1FOKA 4KA4A 2QSGX 4G12A 1N78A 2V58A 3VYSB 2KIQA 1FKAH 3BT9A 1SFXA 2DOFA 2B63A 4BY7J 4YFKF 4W1UA 4HZFA 4WXDA 1ON1A 2F5EA 1QQIA 2BW3B 5TJJA 2WWYA 5H20A 2O5RA 1LFUP 2HVQA 4YR3A 4WXCA 2XC7A 3S1MJ 2I5UA 3CCEI 3OR1C 3T5JA 2NUAB 4FETA 1Y1WJ 2Y9YA 2DPUA 5KAFC 1JKPC 1CF7B 4PGGA 3AL0B 2LKPA 2AXTC 3HG9A 4ON0A 4Y13A 1X2MA 1FTTA 2H1LA 5A2QZ 1WH2A 5EWGA 5L1KA 2XPWA 3SDGA 4E7ZA 4D9JA 2Y0SN 1I39A 4EVIA 2W00A 5CPRB 4WCGA 4GO1A 2FK3A 3FKIJ 3KALA 5F08A 1KONA 3CLQA 3CCJI 2KLOA 2VQEH 1ZLJA 1A31A 4NC7A 3V8JA 4BHBA 1XMKA 2GXAA 4HRIA 5D4RA 2WE6A 2QVOA 4Z6YA 4KUMA 3EQLF 3TMOA 2UZKA 2Z16A 4KMFA 1DGSA 4DL2A 2JEIA 3HOSA 2C00A 1BW6A 2QKMB 3IKVA 3ZMZA 4RDUA 3Q8RB 3NWSA 1E3HA 2VL8A 3ELKA 3FF5A 1P4AA 3M9MB 1BJZA 1YRNA 3N43B 2K27A 5AIPA 1HKSA 3JAMW 3K6GA 3DQVC 3E1SA 5FKKA 2V9KA 3RZOJ 1XGNA 4IEJA 5M5WJ 2BYVE 4EQQA 1BOAA 4I0AA 4DR3H 3WTYC 2K85A 2WADA 3E6CC 2Y0MA 4ZYEA 2EA2A 2JA2A 1MBEA 2P0AA 1GXPA 3P5JA 4MQ9F 2HZDA 4LD5A 1SFUA 3VSLA 4A2UA 5L1LA 4YAJB 3TW6A 1H88C 1RI7A 3DFGA 3LA3A 1OJLA 2WB1A 4CYDA 4ZZLA 1E17A 2R84A 3ZMSA 1MBFA 4MV4A 3J81W 4XR6A 4BBRJ 1MDMB 1UC8A 1OYYA 2CO5A 1F4KA 2DLNA 5KT7A 3WGHA 1S5LC 2E35A 1XGOA 1FY7A 4YAKB 4G7OF 3GFMA 1ZR4A 3MWDA 3CC2I 4J00A 3OYGA 4RU9A 4ECUA 4LK0F 2FE3A 1IXCA 5KFYA 2R82A 1V4RA 2Y9ZA 1OISA 1W93A 1U8RA 2R8HA 1KU9A 3IHUA 3RPQA 3S3MA 3N44B 2B7EA 3UKGA 1X9NA 5HLIA 2GQQA 4A3IJ 2L7ZA 3FM5A 1X3UA 4ZYGA 4HR7A 3ZMVA 2YSRA 2P8TA 5DG7A 5EDWA 4YIIA 5EYRA 2R7MA 5FLXZ 4WWCA 5L3EA 2R93A 5D8KB 2ZJPF 2XROA 2YX4A 3M4OJ 1K83A 4HV6A 2DYRH 4RAFA 4A3EJ 2M05A 3I4PA 3GTGJ 1FBQA 3RAXA 3OIPA 2DQRA 3N4MA 1IN7A 4AIKA 1E4EB 2KZGA 2A6TA 2NU6B 4PK4A 2JA5G 2W25A 4CZCA 5E17F 1FMVA 4EGQA 4MIMA 5IP7G 3TP0A 3H0DA 5DGAA 2OJED 3KP3A 2IT0A 2WB1N 1SANA 2BQUA 4UV9A 2TCTA 3Q0UA 2VUMG 4CCMA 2AXLA 4QPQA 1BGWA 5JUMA 1T38A 5JLWA 3BQZA 3CESA 1TWAJ 3PZPA 3MKLA 4X62H 3ETHA 2UXCH 5LOVF 3HZJA 4OIPF 1XC5A 2JUCA 3R23A 4BJ5C 1LKXA 4MA0A 4ED8A 1R9TA 4IJAA 2DDAA 1XD7A 3V7SA 2DFEA 4O3NA 2QGUA 5CB4F 1M6VA 5DLGA 1YITI 2LG4A 4A12A 5HLGA 2JA7J 1Z91A 4XLPF 2W7PA 4JP0A 3WODF 3DU5A 2E36A 4CXFA 2X4HA 2STTA 3MWMA 4DJAA 5IYZF 1E2XA 1T95A 4XRMA 4X64H 3F8CA 1W7PB 4M9ZA 3SQNA 3WTWC 4FHTA 2V4RA 2VN2A 2ZMEB 4MGRA 2WYOA 2LOOA 1HQCA 3TL4X 4QJFA 5KX5F 2L3DA 1R4NB 4I76A 5FPOA 1FBSA 3V42A 3K5HA 2E1CA 3UNGC 1BJTA 2DFIA 1FMWA 2L54A 3S16J 5JVDF 3VPDA 4TQRA 3CLOA 3MR6A 1LJ9A 3RB0A 4GKJH 2BY0A 2MBFA 1W36C 3FBNB 2GAUA 2MD0A 4IHSA 2EFOA 2IS2A 2BW3A 1HKQA 2HKOA 3J7AY 2OPTA 4A3KG 2Z1DA 2R5YB 4JI7H 2RNJA 2W9BA 3H36A 2ACJA 3TIGA 2X48A 1T0FC 1D1CA 1WI3A 4EATA 2QM3A 4A5NA 1OR7A 4B3XA 1CF7A 1JI8A 2CW0F 3PO3G 1P92A 1ZK8A 1FYMA 3F8BA 1SFOJ 3MKZA 3PW4A 2ZXHA 4LLGF 2P5KA 4DW6A 2R7OA 1WR2A 1K4TA 2G7UA 2D2WA 5LD2C 1SEUA 3LP8A 3N8DA 2DMQA 1R1UA 1QA6A 2R7SA 3PFYA 4KJZA 1NK2P 4IRIA 2W8LA 1QRYA 2MABA 5KFIA 4J9KA 1Z3YA 2NYXA 4IX7A 3EDPA 4QSHA 3PO2J 5LLQA 3GZ5A 3H3ZA 4CCLA 3KP4A 2XAFA 4E7SA 3DPTA 5JHUA 3ZPLA 5E8IA 3C1DA 3JCUC 3PSFA 1YS7A 3DPUA 3IL2A 2X1DA 3SZPA 1ZKGA 3LMLA 2RVCA 3O8HA 4U7BA 1HW2A 3OTOH 4S0HB 3KAKA 5KFZA 3BC8A 4IWXA 2LLKA 2VBWA 4O2BF 4LFCH 4Q45A 1P2FA 3RYRA 2FMLA 5KG6A 2Y69H 3A01B 2XGDA 5KFAA 5C3EG 4EBEA 2PMZA 5E79C 5IT9Z 1FP2A 3AYHB 5KT4A 4XSXF 5DM7F 5DCFA 1Y1VG 1Y14B 4PUSA 1IF1A 3ONQA 2JSCA 3OYEA 2RF4A 2IGMA 3KIOA 5D6EA 4UCUA 2HQNA 1SCUB 3U9TA 4XM3A 1FJLA 4NQWB 3G6XA 2EZLA 1HW5A 4B09A 3EPGA 2FJ1A 5FROA 1MDMA 4YQWA 5DUIA 4GRIA 4MTEA 4WD3A 1WKMA 2FD5A 4TQSA 3QYEA 4HYEA 1XGSA 3IN5A 2KFDA 3L4KA 1KQ9A 2XC9A 3DXJF 4E70A 3NGDA 4RLQA 1BNCA 1YHQI 1LEAA 4UUSA 1BXRA 2JTVA 1O3SA 3SEQA 3ZQ7A 9ANTA 3R5FA 3A2KA 4ME6A 1HOMA 1U0JA 4OOIA 2NVXA 4B44A 3DCFA 1UG0A 5I47A 3I4MG 2X6YA 3PQJA 3QQAA 3WTSC 4L0YB 3MCZA 4UXNA 4V19K 3S1NJ 1JDBB 1IXRC 2FSWA 2ZNYA 4LITA 1IW7F 4MNUA 2PMUA 1RJPA 3KTMA 4MV9A 3L2PA 3VYUB 1QGPA 4J9RA 4ENKA 2E34A 4A6EA 5DUKA 2DA3A 2DODA 2XF6A 2BHZA 4JV1A 2PMZN 4J9SA 3RKXA 3WE3A 5BS6A 5IYCJ 5FFXA 3LSIA 4LGWA 5ERIA 4O2AF 3D5RC 1B6AA 3AG1H 1GT0C 1E4EA 1ODDA 5GTIC 1JGGA 3F23A 3G73A 1TQIA 2WAQA 2HDDA 3BJAA 2FLLA 2F5VA 5C4XJ 4MAMA 1I3QJ 3L7WA 3BZCA 2RNGA 3HKZA 5LXTF 2V9PA 5HOOA 3GV8B 2O8KA 2G7HA 4LF5H 1QZZA 3CTAA 3ZQLA 3HSFA 4XN3A 2VE9A 1LPQA 2VPQA 3CMYA 3KE2A 4DL7A 2D1VA 4K0KH 3V8KA 4IR9A 4F52A 2IS6A 3IV5A 3TINA 4A3CJ 2LSOA 4FS1A 2FBKA 4FS2A 4XRSA 1T2KA 3ABMH 4RZQA 1Z77A 4UCRA 1WI9A 3DKYA 1J5YA 1G6NA 2BBYA 5JVGF 3PJRA 2AS5F 3ML6A 1C0WA 2K9LA 3L2UA 3MR3A 3FK7A 4FM9A 3FXRA 4BXFA 2ZMEA 2DFFA 3K4BA 4DNCA 3RZDJ 3MZHA 3KLNA 3LWFA 3HBLA 2ZJRF 3GTPJ 4ECYA 3PVXA 5K5QA 2R93G 1DPRA 1S0MA 1X4OA 1TT0A 1VQ7I 1JJ6C 1POGA 2QYOA 1K78B 4BBSG 2HOEA 3BTIA 3OYDA 3N40P 1IV8A 5A2QW 2MH2A 1TT5B 1D0XA 2ISZA 4XL9A 2WAQN 2NVYA 2DDBA 4APMA 4BKXA 3OYNA 2OA4A 1LDJA 3HKZN 2IEKA 2LNBA 4LOCA 1LVAA 2ZXIA 1K6OA 1EJ9A 2W24A 3BG5A 5J3LA 2DU9A 3RIZA 2P81A 2Q2EB 4B8XA 2AQFA 1XS9A 2P7VB 2V5AA 2R5YA 3LL7A 3IWZA 2EH3A 3OS2A 4IVNA 5LEKA 1TWFJ 4KFCA 5C5JA 1ETQA 4M3FA 1KU2A 2DA7A 4RNNA 1I7NA 5EEGA 1UFMA 4BEHB 1B33N 4F4YA 3W2VA 1B6RA 5M5XJ 3BQ0A 2R8GA 4O5VA 3SFIA 3H0GJ 4A69C 4IRDA 2FUG2 4LMYA 2NOGA 2JPCA 4EJWA 2QA4I 1PVEA 4JK1X 3VSKA 4C2MA 5K7FA 4QWAA 1TLHB 2QZ8A 4DIQA 2P4WA 2DI3A 4M3GA 4BXXJ 1PDNC 4RNMA 2PQ8A 4QW8A 5AIQA 3L2QA 3PNYA 4XLEA 1PYVA 1UAAA 5HVQC 4FBTA 4RGXA 1AOYA 1Y1WG 4KT5C 1JXLA 2W6OA 2Z33A 3HGGA 4HX4A 3PUFA 1D8KA 3JRWA 2VOOA 1IG7A 5HNFA 3DEUA 3IC7A 4HBLA 1ONVA 2R0QC 2HOSA 2JA5J 2VR1A 2W4SA 1VI0A 2CW7A 1O4XA 4LG0B 4X6AJ 2V4QA 3JRCA 3CP8A 2XF5A 2JEJA 5CYVA 3FKIG 5DV5A 5KFNA 2OH2A 5EEHA 2A6EF 2DW4A 4O6JA 3ERED 1XMQH 2VLAA 3BR6A 3MR2A 1DIKA 1JTXA 3AG2H 2G9WA 3T0YA 5IPAA 2VJ5A 2QKLB 1D1AA 3OS0A 2E5NA 5ILUA 2ZDGA 2KP6A 2HHHH 1UMQA 1EF4A 2HQAA 4UY8I 3OYJA 2NXNB 1XCBA 3GQCA 1HCRA 1ZRFA 4KISA 5FLXW 2IMWP 1WFXA 2EIKH 4NQWA 4I6ZA 1BC7C 1NK3P 2DA2A 1MKMA 3FMSA 4HX8A 3SZGA 5LHIA 4MV1A 1LQ1A 2H27A 2EIMH 5FGMA 4NC6A 4XYMB 4NB5A 2H09A 3J7YJ 2LH9A 4G94A 4WXHA 3BROA 4HEA2 2EZKA 1X1CA 1ZGAA 1UJ8A 3G3ZA 1MSEC 2HVRA 1GSOA 4I55F 4B3SH 3DWLE 3JRIA 1B72B 4DV6H 4ANJA 2EFWA 5CVIA 3OYMA 3KXYT 1MD0A 4ZYDA 5KT6A 4A6DA 3KYLA 1OFCX 3KLOA 3Q0VA 3JTHA 4O3SA 3ZMDA 2JT1A 4KDPA 5KFKA 3OR2C 5LHGA 4DR2H 5J1YA 2ZXWH 4L5IA 2BY1A 2F5DA 4IHXA 2L7FP 2Y30A 3ZN1A 4NBQA 1XSDA 1BM9A 2Y31A 1D3YA 1ORKA 3OUUA 3N41B 2DK8A 1ON2A 4IKFA 2HPMA 4LF8H 2ZC2A 3HHGA 4EFBA 1YW7A 1F9NA 2V1XA 1XPXA 2MC3A 3M8FA 2R4GA 1T94A 2C6YA 2UXNA 3S2WA 2R7XA 4NXMH 3GVAA 3GTKA 2ELHA 3K4KA 4A3IG 1VTNC 2OTJI 5CVJA 2VJIA 4F91B 1IXSB 2HVSA 1EZ1A 3S1RJ 1RUOA 2VT3A 4OINF 2QSFX 3S3NA 2ID3A 4HF2A 4PJMA 1IN6A 2V4JC 2YUSA 3ZQCA 1Q1HA 2DT6A 2W8KA 4E7HA 3DV8A 4A3EG 4AIHA 3ABTA 3KZZA 2ZCWA 2P5LC 3RI4A 4KHPH 1JHFA 1W0TA 1WJFA 3S14J 1ERDA 1R7JA 1M7JA 1JXSA 3KEQA 1UB9A 2XGEA 3FMAA 2JRMA 3HOXJ 2ZDQA 2B63J 2XCLA 5FRNA 2WTEA 5BMZA 1RC9A 1SFEA 4U0VA 4YFXF 1JKQC 3HPGA 3IG0A 4JI6H 2QQ9A 1W5SA 3C7JA 3HRMA 5KFTA 5FPRA 4AYBE 3C2GA 1K78A 3CJRB 4HDUA 2GOMA 5C3EJ 5KG5A 2ECCA 3G2BA 5DG9A 1JKOC 4H0EA 1IGNA 1OLTA 1FWZA 2EINH 3A4CA 3RKQA 2JA7G 4D7MA 1JT0A 1ZYRF 4ASNA 5KFPA 2DMUA 5KG1A 4ECTA 5KNLA 5KG3A 3T5HA 4KYWA 3DEWA 2Q2EA 2HOAA 3WE2A 1YJ9I 4UVAA 4RAZA 4GC7A 2F4VH 4BJTA 3IKTA 1BC8C 1LFBA 2P0WA 3I64A 2DLLA 4G8XA 2VJ4A 3JTGA 1SAUA 3L09A 3U21A 4DBQA 2NRAC 1KJ8A 3Q1KA 4JX5A 5DYMA 3VPCA 2ZSHB 2AU0A 1Z6TA 4RS8A 5KFLA 3BLYA 4KNYA 1CE8A 4YBZB 3KCCA 5E18F 3WU0A 4P96A 1F36A 3RBEA 2XUBA 4IHWA 3BR0A 1JDEA 4AC0A 4PDBA 2OCCH 2R7WA 2XAGA 4BQNA 1TL8A 5IT9W 4ESFA 3V6HA 1FIPA 2O3FA 3NRVA 4HSTA 3BR5A 3GO5A 4ZZDA 4C2UA 3NAUA 4EEYA 1U5TB 3FK6A 4CCJA 2JUGA 1T36A 1IO2A 1RRJA 4LF6H 4XSZF 2YPRA 3H1CA 1WJDA 1D0YA 4LG0A 4B3RH 4AIDA 4MV3A 4I99C 3WGIA 2RC4A 3BG9A 4YHHH 1Y0UA 2WV1A 3FXJA 2BR0A 3I55I 4QWCA 1O3QA 2DTZA 2ZFWA 4D5CA 1V4YA 3FX3A 3GTMA 4DQ2A 3DBRB 1C30A 2R85A 3PO2G 4M73A 3ESWB 4HSRA 4PFOA 3OV8A 1JE8A 4A93J 5JVLA 1XG1A 2DA4A 3ZN0A 1YIJI 4IRCA 6PAXA 4HG2A 1S29A 1Z1DA 3LSHA 5HODA 5K2MA 3ERMA 4CCNA 4AIJA 3ECOA 2EV6A 3K70D 1PX2A 2IP4A 5DQGA 3RF2A 2MC4A 2FPPB 4U87A 3RKWA 3HRTA 3MVPA 5TGTA 5IOZA 3BQYA 5IOYA 1QO0D 2HZTA 1YO5C 1IRXA 1XDSA 4CYCB 3FHZA 1O3RA 4XKVA 5C44J 4HA8A 1XX5A 2BV6A 3CDHA 1B72A 1K83J 2R87A 5IYBJ 3KEOA 1X58A 3EUHA 1GUUA 3C2BA 3T5KA 3HOYG 1KJQA 4RAGA 2FLNA 1P7JA 1J9IA 4FBUA 3BA8A 2XHKA 1T56A 2M8EA 4L5EA 4YB8B 3RB3A 3JRGA 1IOVA 1QBJA 2V59A 2E60A 2EZIA 2BVMA 4EM0B 1VS0A 1HNXH 4Z2YA 2L4AA 1LB2A 4X1EA 2K40A 1SMTA 3M8EA 4HNTA 2MH9A 1N25A 2V1DA 4I50F 5KG7A 4XOPA 4GDFA 1EHIA 1W96A 3K3PA 1KJJA 2UUAH 4JI3H 2E2JJ 2JA6A 3BG7A 1XNRH 1EUCB 4UCSA 3M7GA 1R9TJ 2R7TA 4GKKH 3GW2A 2M4KA 1N77A 3H5AA 3I12A 2LDUA 1GO3E 4EEQA 2HYGD 3ECHA 3C18A 5F9NA 4BH9A 4EJUA 3IH2A 4KICA 4II3A 2CQXA 3F8FA 4WX9A 1Y8QB 1KYWA 2K4BA 5B1AH 2NU7B 3OSGA 1WCMJ 2HS5A 5JH7F 3V6JA 2GA1A 2OZ6A 3L9FA 1E4GT 3J80Z 1K61A 5BOXA 2FLPA 4YJ2F 2VT2A 4E7KA 4N4OB 5IYCG 4NHJA 3HDDA 1R5GA 1W0UA 2OU2A 4Y3OA 3CJQB 2R3SA 3I0TA 2XSDC 3DLLF 2CYYA 2TDXA 1QNTA 1PP8F 4IQJA 5KVRA 4G9YA 2V1NA 2VJJA 2FQ4A 5C4XG 2XASA 3MD2A 3B73A 1V55H 3GTQA 2WBMA 2CFOA 1ETVA 4R7RA 2FEZA 4LLLA 2H8RA 4X65H 2Q2TA 3DTIA 3RTXA 4J19A 2JSPA 2JJ7A 3U9GA 3QYFA 4B4CA 3BPVA 1X3WB 4I98B 1KA8A 1XNQH 1GVJA 2L9RA 5KFRA 4A3CG 1VF9A 2FNAA 5JI6A 5EF6A 2RKHA 2M8GX 4GYIA 1RESA 2J5OA 3M1CA 4YELA 3TOAA 1OCCH 4A3JJ 1S72I 2Y0SE 1W1WE 2YW2A 4C5BA 4IR1A 1S9FA 4CICA 5J2TF 1UELB 1VQNI 4IO9F 4DZJA 3E6DA 2AGPA 1KGSA 2IPQX 3LSPA 1RR8C 5FFZA 2FPGB 5KFWA 4DBRA 1MH4A 3CDLA 4TV7A 4UV8A 2NVQJ 1WRJA 1FIAA 2W84A 3PFIA 1K1QA 4M72A 3TGNA 3GZ6A 4GC6A 2IJLA 2VKHA 1HF0A 2HYFA 3FMQA 5FJ8J 4A3MJ 3GIDA 1TWCA 4CSWA 5DS9A 1FP1D 4BYYA 4F55A 2EZHA 5TRDA 2VPSA 4HQ6A 1S03G 2Q1ZB 5JR3A 4XMYA 3KYCB 2BXZA 3Q9VA 2ZKZA 3CCMI 3Q5FA 5KFSA 3LFKA 2GZWA 4CCOA 1CQIB 3K2ZA 5B3SH 3V4SA 3CF5F 1Z6RA 4II2A 4C2TA 1H9GA 2QBYA 2LY2A 5CVVA 4ABZA 2HDWA 4IQ4A 1U5TA 1ZARA 4L9JA 3I58A 3X2QH 3ABLH 3TO7A 3H0GG 3Q0WA 1MJ9A 2ME0A 4BQOA 2R92A 4XKWA 1I3AA 3I5UA 2LR8A 1USTA 3JREA 3M07A 5GP9A 4M6VA 4BXXG 3OL3A 4G3IA 3PR4A 2CUJA 3OYBA 2GLTA 3WTZA 1IBLH 1HW1A 2XPUA 2R7ZA 4X0GA 2YX7A 3HHHA 2LD5A 5E3LA 4IHJF 3H4DA 2RN7A 2DYSH 5CKTA 4A3DJ 4BQAA 2Q2UA 3CC7I 2DO7A 1YTYA 2MSYA 3BG3A 1S7EA 2ZB9A 4C9YA 4BACA 1B8IB 3GIQA 2ZNZA 3CUOA 3TO9A 3KETA 5J2UF 3G6VA 3WG7H 1FC3A 2RAEA 2COBA 1DGRM 2LFBA 3CZ6A 2HOTA 3ROUA 2XDVA 3FXMA 3BJ6A 3S1QJ 1I1GA 2NVXJ 3ZMUA 2CS3A 4MO7A 2VOPA 3RPUA 1OKRA 3OY9A 2QQBA 2VBXA 1O75A 1PK8A 2FMAA 4Y33A 1LEBA 2R6FA 1WWXA 5FKNA 4Q0YA 1L2ZA 2ZSIB 2XGQA 1P8LA 2YS6A 2HI3A 1SMYF 5LP6F 1P7IA 4KITB 2L01A 1V5FA 5HNHA 2VB6A 2A5WA 1XSXA 4LIVA 1JJ8C 4UCOA 1IRFA 1WCMA 2UU9H 4B3TH 1O57A 1KQ0A 3EUAA 2L5QA 3COAC 2W6QA 4I7HA 4L9VA 5DQHA 2OLSA 2D45A 2VODA 4U88A 2CRGA 2HQRA 3VODA 2CW8A 2LVSA 1F43A 1T0FA 3ASOH 5CVUA 2JPBA 4BWSC 3EYYA 1WJAA 4Q48A 1GLVA 5M3MJ 2VI6A 3WTVC 3HOZJ 3F21A 2P6SA 2IGOA 1BI3A 4ZJZA 3G71I 5IT9K 1S0OA 1K6YA 3E7LA 4GYGA 2BY3A 2GM4A 3WG9A 3S32A 5DM6F 1EUDB 3SE7A 2LYCA 4ZDLA 5F0CA 3KPHA 5BPDA 2LY9A 3ABKH 2MG4A 5DDGA 1YX3A 4RM2A 3T1YH 4HQMA 1VKZA 2DIKA 2R7KA 4JYAH 2RGVA 3DP7A 3NWTA 4OMYA 3P7NA 1KQ8A 4S05A 3AG3H 5F1JA 5GTHC 1BL0A 5ICGA 4IZZA 5KT2A 2XAQA 2XB5A 4MV6A 4QW9A 3JRDA 4J01A 2FPIB 3DF8A 2NU9B 2NVYJ 3RGZA 1GV5A 5LL6b 3FWEA 4M71A 2L4MA 2GOXB 2IRFG 3FMRA 3ZCOA 1Z3XA 2DMNA 4OMZA 4IZOA 5HBRB 5IWAH 1BI0A 5HV6A 3P9CA 4XLHA 1SFKA 3RBDA 4M9XA 2MA3A 4Y7NJ 4M74A 5F1RA 1G4DA 1FTZA 2R86A 2KSWA 1VAJA 4NNJA 2EV0A 5ICCA 1UC9A 5KG0A 4AU7A 2LBFB 3KP2A 2LF8A 4Q4ZF 4EJTA 3QFFA 2BXYA 3HOXG 1GVDA 1JX4A 4FX0A 2LY1A 2CQNA 4YRVA 2B63G 3IP4B 4C2MJ 2ID6A 2R5ZB 5DD8A 5C1OA 3I56I 3FHNA 3UFXB 5F6FA 1ZLKA 3GIJA 4JYKA 4LB6B 1I1SA 4QLCU 4F4XA 2VQHA 4XRFA 3QPTA 4JX4A 4XICA 2DCEA 3TW7A 1RK6A 1OR7C 4L0ZB 2X6XA 2NNYA 2UUBH 3BDDA 4C3IJ 3WTXC 3BTLA 3HOYJ 3SI8A 3HTSB 2WTFA 1MW7A 3J7ZI 2E5ZA 1VQ5I 4DL5A 3F6VA 3ZQFA 5D1OB 4PJ0C 1SD4A 3GIKA 2R7RA 3FXOA 4CO8A 4DR5H 3KFWX 2W82A 3MN2A 5ED4A 1OMIA 3CUQC 1AN7A 1ZHSA 3IAS2 4UB6C 3K1MA 2PMHA 4Y8VB 3RFCA 5L3FA 4A0YA 4HOBA 2LKSA 4O3OA 2VOBA 2Y48A 3WO0A 3H35A 2B9SA 4JI2H 1MJBA 3CP2A 3G4SI 4LFBH 4UCVA 3PIPF 4CC6A 3REOA 3TP3A 5FD5A 3UQ8A 1W7PD 3HIFA 5B66C 5FRMA 5LHHA 4GFBA 1T98A 1AKHB 4TV8F 1H9TA 1WJEA 3MKWB 3H4BA 1TQMA 2ESNA 3L2WA 2CV2A 3FXQA 2R7LA 3K4NA 2OC6A 3R60A 2XRNA 4XN0A 3TBIA 3DLAA 4BDYA 4BDZA 3GBGA 3SXYA 3BCAA 4CCKA 5KFVA 2V7FA 2VKEA 3OL4A 3CMEI 1S68A 1RZ4A 3GUDA 3BABA 4ZDPA 4HLXA 2Q8KA 2M0CA 2W9BB 1MNEA 1QVUA 3CJNA 2XPVA 5DGBA 1IDYA 1R6RA 4B3AA 2HTJA 4ZYHA 4A3GJ 2PX9A 3TKYA 2BGCA 5K7HA 2P7CB 2X51A 2FF4A 1M0TA 4MHGA 3MFKA 2QWWA 4B1RA 4ESJA 1FZPB 3IRRA 4PSXA 4ECSA 3OUZA 3OSPA 1ZG3A 4I01A 1TZLA 2VQDA 1G3YA 2IGNA 3LA7A 5D8LB 2ECBA 1F5TA 1XMOH 4A93G 5KFGA 2YS9A 1S7OA 3D0SA 3CMMA 2JQ7A 4E4HA 2DXIA 3M1EA 1HSTA 1GGOA 1R23A 2FRHA 3PN1A 2DJIA 4JV5H 1V5EA 3JAMK 2BHYA 2Y75A 3S2DJ 2XIGA 4DR6H 2COMA 4EGJA 3BTCA 3J80W 3GTKJ 3ZQQA 1REPC 3J7AO 4D7NA 1DQUA 1W7PA 2GIZA 1X1PA 2Z5UA 4XIDA 3J7AK 3ZRGA 4RM3A 5C44G 1GSAA 3OSNA 3T1HH 5IYBG 3SHFA 1IV6A 3GTJA 1AUVA 1RIOH 1X1AA 5DD4A 4MLOA 5GAEJ 1R49A 1OCPA 3W6VA 5H2FC 4LFAH 1X1DA 1RJQA 4OU0A 3OS1A 2A69F 2X85A 3J81K 1YJNI 1LE8B 2NVTJ 5KG4A 4ECRA 2CU7A 2K5CA 2DAOA 3JW4A 4MFEA 1I6XA 2MD5A 4IXAA 2W71A 2MCTA 1MH3A 3VB2A 4AD9A 4DL6A 2F4OB 3I9V2 4G6QA 1T8IA 2XGPA 3E6BA 3PM1A 2I10A 3HB9A 1YJWI 1DGWY 3HKZE 2LF7A 4GGGA 4FCYA 2PFBA 5JHFA 3N97A 4LLNA 1BR4A 1BR2A 3EPZA 1BIBA 2FBIA 2I8CA 3HC7A 5E1ZB 3Q8PB 2FA5A 2C2DA 2F4IA 2L9NA 2FQ3A 5EGOB 4PGHA 2CH0A 1WCMG 2E19A 2IBDA 2K7LA 3R0JA 1K7AA 2ZMEC 4XZ3B 1XMXA 2ELJA 1RR7A 1LFPA 2XSJC 3E5QA 1UCRA 2O8XA 2K4JA 2XAHA 4FASD 1N36H 2YU3A 2A07F 1R1VA 3I59B 2AGQA 2LBFA 5HDGA 1MMAA 4XNFA 1J7KA 2DT7B 2XVCA 2FNPA 4M3BA 5BMVF 2F6CA 3WHBA 2GXBA 4JI1H 4RAYA 1QPIA 1KZHA 4C30A 3I4NJ 2KQRA 1JUPA 2XGXA 3KHHA 5DTDA 1VQ4I 1EA3A 2R5ZA 1VBGA 3HEFA 5DCMB 4JX6A 4DR4H 3OYIA 3E5UA 3HGYA 4YG2F 3OYKA 3AG4H 3A01A 2UVVA 5KKNB 4N4NB 2CGPA 3VPBA 5KFCA 1R4MB 1WHUA 5D8DA 2OQRA 1J2XA 5E1XA 4G7ZF 2HFHA 2W6NA 1XSVA 4UHTA 3HUGB 4A3JG 1YLFA 1Z0XA 1HSJA 4V2FA 1ZREA 4M9UA 4Q43A 5EWEA 2DOEA 5T14A 1ETKA 2AQEA 1ZH5A 5E3OA 2VC0A 2ASDA 4LFUA 3KAJA 2V1UA 4J9LA 2BQRA 3R5HA 1MZBA 2KHMA 5EG0B 3A02A 4J9QA 2KKOA 1FNNA 1HKTA 2C35B 4J9PA 3GX4X 4UNOA 3FM3A 4CHUA 2W70A 2RGRA 3GTMJ 2W6MA 1WH5A 4EGZA 4FE4A 5FJ8G 5EZGA 3PR5B 4A3MG 2RQPA 3DKWA 4U0WA 4KIFA 3GV7B 2IVMA 3CMAI 2QLZA 1FSEA 2R7QA 5DEQA 3M9NB 5HDNA 3CO6C 1NH3A 1LDKB 4PCQA 2W6ZA 3QPHA 1OCOH 1ZN2A 2KRCA 4U7DA 1AKHA 3FBIB 3QZ7A 3HRUA 4G6DA 1K4SA 2QENA 4RBOA 4I0BA 1U6GA 2FOKA 2NNNA 3OYFA 1S8NA 5CA1F 4EV0A 1PUEE 3BPXA 3PW2A 5IYDJ 4D0PA 1K79A 4IHYA 1RKTA 2XGCA 2FBHA 4XX0B 2UVWA 4YP3A 1N32H 2DTRA 1ZQ3P 1NTCA 2DA6A 4AYBA 5KFMA 3FXLA 3K2AA 3U1DA 4A0ZA 1CQTA 3BG6A 4Q8EA 3HSRA 1A36A 3RTRA 3OHBA 2ICWG 4Y52J 2ZJ2A 2YCHA 4CUGA 4H4KC 4RB2C 2W9AA 2C28A 3FIWA 2NVUB 3F8MA 2I87A 1ZRDA 4ZDOA 4F93B 1ZHQA 4M6XA 3TOBA 4DV7H 4A3DG 5E1WA 2R7UA 2PN1A 4LSXA 2JA6J 3BZ6A 3TQTA 1WVRA 2GIVA 2LREA 3VOEA 5H6RA 4AM3A 3BAAA 1WQ2A 5KFJA 5KHDA 4Q44A 3OHAA 2IAIA 4L18B 5L3GA 4IAJA 1QZEA 4E6KG 4RB3C 1ZHFA 3BWGA 1AUXA 3GTOA 2OAZA 2ESHA 5KCMA 4OAZA 3LAPA 1R71A 2L7KA 3HTUA 3GIMA 3PW7A 1VQOI 3G6EI 1TW3A 4ENMA 1T08B 1Q1VA 1XMAA 2EK5A 1R36A 1UNNC 3LSKA 1YS6A 3CJTB 4RB1A 4F50A 3GIPA 2E2HA 5D1PA 2DQLA 2CUFA 4PZJA 3QRFF 1NG7A 2UUZA 2WV0A 1XCVA 1X2NA 3B02A 1MNMC 4AYBN 3O3KA 4XQFA 1LE8A 2OTLI 2HR3A 4AWXB 2EA4A 1A5JA 3FKJA 3F22A 2CSOA 1KU7A 2VPLA 3S3OA 2IS1A 3VFZA 1I6HJ 5KFOA 4LJZF 5F0FA 3GTQJ 2M4GA 4XLNF 4BY1G 2E2IA 4JV2A 4RLFA 1O7LA 4M3EA 5GAGJ 4O3MA 3RB4A 3EYIA 2HWVA 3RJ0A 3GZNB 1FPQA 3L2CA 3TQ1A 1BN5A 4DOZA 4BEHA 2BE5F 2A61A 2XRLA 1S7AA 4QWBA 3R6SA 3M9AA 3S93A 3ZGKA 5BR8H 3HOZG 2CMPA 4JUZA 2CQQA 4XRSG 2A68F 1DU6A 1G2HA 4E4TA 2M87A 5EGOA 1GDTA 1HDDC 3HOUJ 3DF7A 4KN7X 4F7ZA 4Q5SF 1R00A 3DBHB 1YRNB 4EJOA 1U78A 1TNSA 1OQYA 3ETJA 1B04A 2EPFA 3FXUA 4EJVA 2PLYA 2A5YB 3B6AA 1R5HA 4R79A 3JSPA 1FYKA 4XLAA 2KL4A 1U9NA 4EGYA 2O0YA 2DWCA 4HPQA 4OX9H 1P4XA 1R58A 3WU2C 3O2PE 3O6BB 1TWCJ 2M0MA 2RV8A 4YY3H 2FMYA 5DCMA 2O9LA 3ABUA 1VQ6I 2VUMA 1ULZA 5BPHA 2DT5A 2A3SA 2A6HF 3I3LA 1ENHA 4EEFG 4ETSA 3IH4A 3FXKA 3MQ0A 5BQTA 3DEEA 2X1EA 1UZCA 1MGTA 2UXXA 2SCUB 3BQ1A 1BI1A 3QU3A 5JFRA 4LF9H 1XN7A 4DYCA 3HUGA 4JBAA 3K10A 2L9SA 3L2RA 1HLVA 1Y6IA 1SYXB 2R92J
chains in the Genus database with same CATH topology
1YYVA 3KP6A 3KP5A 5HS7A 3FZVA 2ZO4A 5A2QK 2PN6A 5FD6A 2QUFA 1HBXG 3SFZA 3IWFA 2R7FA 1T6SA 1SEIA 3VEPA 2PBIA 1I5ZA 3BY6A 3LQRA 3LSTA 5JVTA 3QAHA 1Z2PX 5LMUH 3T5XA 4DUZH 3GEZA 4BNCA 2PJPA 1UHWA 2OBPA 4WK8F 4X66H 1IN8A 3NEUA 1XDNA 1S3JA 2NS0A 3HXLA 1FLIA 5J8FA 3W6JB 4RGSA 5ILSA 4LK1F 3V7CA 4Y17A 2VBZA 3NQOA 2WDTA 1RNLA 3H92A 4KN4X 4R1HA 4MQVA 2STWA 3GLXA 3K3VA 1WSUA 4OIRF 4UUVA 5FLXK 2B0LA 2IW5A 4OIQF 2YR2A 1Z9CA 5L3BA 1A04A 3K9TA 1MJAA 3JSLA 3C3WA 3WTUC 3RDIA 1Z7UA 2HGSA 4ENJA 1N33H 3CUQB 2Z9OA 1U3EM 1IN4A 4KIGA 2KJCA 3DPLC 4R8HA 1B4AA 1KYZA 1XGMA 2E7WA 1KU3A 3LQQA 1G3TA 2K02A 3ZMTA 2Z3YA 1GYFA 4HF1A 1ZRCA 1Z05A 2E1NA 1O7FA 3F72A 5L3CA 2F5CA 3E97A 2UXBH 1L3LA 2IA1A 3I71A 5ICFA 2CQKA 4RGUA 5D4SA 1IBMH 4Y15A 2QQAA 4CDGA 2KIFA 1IZ1A 2P6TA 2PG4A 3TQNA 4UCTA 2M5WA 1YQAA 1U2WA 1XDUA 4LB5A 4UVCA 1M0WA 5LGUA 2EFQA 1L0OC 3W6KB 4GLXA 2M45A 4LF7H 4CC5A 2FXAA 1FT9A 2HTSA 3ULQB 1U5TC 1DPUA 4J0MA 3SZTA 2XAJA 1P4WA 1STZA 2MLKA 2W57A 2XKOA 3MEXA 1HNWH 2JRTA 2EV5A 4HAMA 2PEXA 4GXOA 1YW9A 2HKXA 3H20A 5D5XB 2GWRA 1GHCA 4HDVA 2KJBA 3GFIA 3WTTC 1IRGA 4AVPA 2M1BA 2DPDA 4M6YA 2CWEA 1JGSA 3HRSA 4IRGA 2EWNA 3GYHX 2V9VA 5F64A 1FSHA 5IT3A 3MAJA 2J5PA 2K86A 1ULYA 3U2RA 4P55A 2KRFA 4EM2A 3MZYA 2E7XA 2D1HA 3QP5A 1EV7A 4IHTA 3RIRA 1ZAOA 1R22A 3GFJA 3CUQA 4A5MA 4LH7A 2W85A 4AQYH 5HDKA 3N42B 3K0LA 2H6BA 1OYIA 2Q0OA 5J6XA 3R4KA 4BXUA 4KIBA 1D5VA 4HF0A 4P9UA 2L02A 3JSNA 4N9IA 4I09A 4A0XA 5LGTA 3BOQA 4DV1H 3V8LA 1AWCA 3RYPA 4IRHA 2BEOA 1Z2OX 4FX4A 4YIFA 1O3TA 4N9HA 1OYWA 2HEOA 3N6XA 5J8CA 4I02A 1TQPA 1BJAA 2ZXJA 2ZBKA 4HLYA 1YG2A 4JI0H 1D8JA 5HLHA 4JI5H 1I27A 1OPCA 4DV3H 1FBUA 5KK1A 1LNWA 4ENNA 2ETHA 5HS9A 4QWQA 1BI2A 3GF2A 2P5VA 4A2AA 2VUGA 1H0MA 4JI4H 1R1TA 2MLGA 1G3WA 1NHAA 2O61A 4WF2A 2EFPA 2CG4A 5K5RA 1EH6A 3LAJA 5E20A 4HW0A 2IA0A 3CVZA 5H6QA 4DV5H 1J5EH 1TAEA 4NXNH 3KZYA 1I94H 1B9MA 1EH7A 2HGCA 2E5LH 5CJ9A 4MV7A 4XBFA 4MTDA 3R61A 3H3UA 4G7HF 2GXGA 1USSA 1J0RA 1SD6A 1J75A 1I6UA 3M4IA 4LF4H 1RUNA 2FU4A 5D5WB 5EOYA 5LRSA 4Q47A 5BPIA 2F5FA 1HR0H 4P5OA 3D5LA 2NAZA 2KIUA 2GA2A 4M9SA 3RJPA 1FYLA 3RKYA 2ZJTA 4M7EA 1DUXC 5AONA 3Q9SA 1E4FT 3F3XA 4FT8A 1SD5A 2PI0A 5LBQA 4U0YA 2XV4S 1YW8A 1HNZH 2OQGA 5FO5A 4L5JA 4YFNF 4UVBA 1TBXA 5K1YA 3JAMZ 3K1PA 4LH6A 4HV5A 1BIAA 3K1NA 2VQFH 3R0AA 3BJOA 3BA9A 3GXOA 4A2BA 3P9IA 1SAXA 5D1OA 4GCVA 1UHMA 1GXQA 1QZYA 1S6LA 2R7DA 4EM1A 3TO6A 4DV2H 2VXZA 2Z99A 1TTYA 4LSAA 3V4GA 3J81Z 1ZG5A 4ESBA 1QPMA 1ZG1A 2WC2A 1V9PA 2X0LA 4N0BA 5LRRA 1W5TA 2F2EA 4B3MH 4I2OA 5E8GA 4ZH4F 4HQEA 2XKPA 4DUYH 2ADUA 3I53A 5CLSA 3V7RA 5HS8A 1XB4A 3EETA 4UFZA 1FX7A 4DR7H 2VE8A 2ZM6H 3HSEA 3CO7C 5ICEA 3OOPA 1G3SA 2V79A 4DV0H 2OD5A 3E3VA 3T8RA 1IUYA 4JQFA 1P6RA 1B59A 5CVRA 3TDUC 2EFNA 3KP7A 4BHCA 5D5VB 1W4MA 4MEYF 1CGPA 5D5UB 4MEXF 3T1BA 1BBYA 3F8NA 2HDCA 4HX7A 5LMNH 4PDKA 3L00A 1LDDA 2DBBA 5LEJA 2VONA 1TA8A 3WU1B 5D6FA 4IF4A 3P9KA 2OWOA 2IA2A 5L3DA 1F1ZA 3BP8A 1J59A 3WGGA 3AAFA 2DK5A 3RGXA 4CZZA 3ZP5A 2RDPA 3F6OA 2V6CA 3C0FB 4JI8H 2UXDH 4RB0A 1YIOA 3PQKA 2ISYA 3E6MA 3QU6A 3I59A 4P9FA 2M30A 1JHHA 4EMSA 5LGNA 4KMUX 3TDZC 4S04A 1HXDA 1Z2NX 4L9TA 3HOTA 2O03A 5ILVA 3J80K 2QBYB 1IN5A 1ZGJA 2UWMA 1FJGH 1SD7A 5FB2A 2VC1A 2CFXA 2IP2A 1TW2A 2JZYA 1T39A 1FVIA 1YFHA 1DDNA 4BAYA 3T8TA 4DR1H 2KIMA 3JSOA 4IPAA 3GWZA 2EB7A 1IBKH 1N34H 2O6GE 3QOPA 4CGZA 3HYIA 2UUCH 1DP7P 1PP7U 4EFEA 2H94A 3GFLA 3I54A 1A0IA 2OZUA 1TNTA 3E5XA 3ISPA 3LA2A 4K2EA 4OIOF 1EH8A 3IRQA 2H6CA 4DV4H 3QP6A 2VBYA 4RGRA 3K69A 2EJRA 5K5OA 1B1BA 3L4JA 4BHPA 1B9NA 4L9NA 1V3FA 1IAWA 1FOKA 4KA4A 1FKAH 1SFXA 4YFKF 4WXDA 4HZFA 1ON1A 2F5EA 1QQIA 5TJJA 2WWYA 5H20A 2HVQA 4WXCA 2DPUA 1CF7B 4PGGA 2LKPA 4Y13A 4ON0A 1WH2A 5A2QZ 4EVIA 4WCGA 4GO1A 3KALA 2VQEH 1ZLJA 4BHBA 3V8JA 1XMKA 5D4RA 2WE6A 2QVOA 4KUMA 3EQLF 2UZKA 4KMFA 1DGSA 3HOSA 3IKVA 3ZMZA 3ELKA 3FF5A 1P4AA 3N43B 2K27A 5AIPA 1HKSA 3JAMW 3DQVC 1XGNA 2BYVE 4EQQA 1BOAA 4I0AA 4DR3H 3WTYC 3E6CC 2Y0MA 4ZYEA 2EA2A 1GXPA 4MQ9F 4LD5A 1SFUA 4A2UA 1E17A 1RI7A 3DFGA 3LA3A 4ZZLA 4CYDA 3ZMSA 3J81W 1MDMB 1OYYA 2CO5A 1F4KA 3WGHA 1XGOA 1FY7A 4G7OF 3GFMA 4LK0F 2FE3A 1IXCA 1V4RA 1U8RA 1KU9A 3IHUA 3RPQA 3N44B 1X9NA 5HLIA 2GQQA 3FM5A 1X3UA 4ZYGA 3ZMVA 2YSRA 2P8TA 4YIIA 5FLXZ 4WWCA 5L3EA 5D8KB 2XROA 2YX4A 4HV6A 3I4PA 1FBQA 2DQRA 3N4MA 1IN7A 4AIKA 2W25A 5E17F 3KP3A 2IT0A 4UV9A 2AXLA 1BGWA 1T38A 4X62H 2UXCH 4OIPF 4IJAA 1XD7A 3V7SA 4A12A 5HLGA 1Z91A 4XLPF 3WODF 4CXFA 2X4HA 2STTA 3MWMA 1E2XA 4X64H 3F8CA 1W7PB 4M9ZA 3SQNA 3WTWC 4FHTA 2VN2A 2ZMEB 4MGRA 2WYOA 1HQCA 2L3DA 5FPOA 1FBSA 2E1CA 1BJTA 2DFIA 2L54A 3CLOA 4GKJH 1LJ9A 2MBFA 2GAUA 4IHSA 2EFOA 1HKQA 2HKOA 4JI7H 2RNJA 2ACJA 1CF7A 2QM3A 4A5NA 1OR7A 2CW0F 1P92A 1FYMA 3F8BA 4LLGF 2P5KA 2G7UA 2D2WA 1R1UA 4IRIA 2NYXA 3EDPA 5LLQA 3GZ5A 3H3ZA 3KP4A 2XAFA 3DPTA 5JHUA 3ZPLA 5E8IA 3C1DA 1YS7A 3IL2A 3SZPA 3LMLA 2RVCA 4U7BA 1HW2A 3OTOH 3KAKA 4LFCH 2VBWA 1P2FA 3RYRA 2FMLA 5IT9Z 1FP2A 4XSXF 5DCFA 1IF1A 2JSCA 5D6EA 4UCUA 2HQNA 1HW5A 4B09A 1MDMA 5DUIA 4MTEA 1WKMA 4HYEA 1XGSA 3L4KA 1KQ9A 3DXJF 4E70A 1LEAA 2JTVA 1O3SA 3ZQ7A 4OOIA 3PQJA 3WTSC 4L0YB 3MCZA 4UXNA 1IXRC 2FSWA 2ZNYA 3L2PA 1IW7F 4MNUA 2PMUA 4MV9A 1QGPA 4ENKA 4A6EA 5DUKA 3RKXA 3WE3A 5BS6A 5FFXA 5ERIA 4LGWA 1B6AA 1ODDA 3F23A 3G73A 1TQIA 3BJAA 3L7WA 5HOOA 2G7HA 4LF5H 1QZZA 3CTAA 3HSFA 2VE9A 3KE2A 2D1VA 4K0KH 3V8KA 2LSOA 2FBKA 1T2KA 4RZQA 4UCRA 1WI9A 1J5YA 1G6NA 2BBYA 2AS5F 3ML6A 1C0WA 4FM9A 3FXRA 2ZMEA 4DNCA 3MZHA 3KLNA 3LWFA 5K5QA 1DPRA 2QYOA 1K78B 2HOEA 3N40P 5A2QW 2MH2A 2ISZA 4APMA 2OA4A 1LDJA 1K6OA 2LNBA 1LVAA 2W24A 3RIZA 2DU9A 4B8XA 2P7VB 3IWZA 4IVNA 5LEKA 4KFCA 1KU2A 5EEGA 1UFMA 4O5VA 4LMYA 4EJWA 2JPCA 4JK1X 1TLHB 2QZ8A 2P4WA 2DI3A 1PDNC 2PQ8A 5AIQA 5HVQC 4RGXA 1AOYA 4KT5C 2Z33A 4HX4A 1D8KA 2VOOA 3DEUA 3IC7A 4HBLA 1ONVA 2CW7A 4LG0B 5CYVA 5DV5A 5EEHA 2A6EF 2DW4A 4O6JA 3ERED 1XMQH 2G9WA 3T0YA 5ILUA 2HHHH 1XCBA 1ZRFA 5FLXW 4NQWA 1BC7C 3FMSA 1MKMA 5LHIA 4HX8A 1LQ1A 2H27A 5FGMA 4NB5A 2H09A 4G94A 4WXHA 3BROA 1ZGAA 3G3ZA 4B3SH 2HVRA 4DV6H 2EFWA 5CVIA 3KXYT 1MD0A 4ZYDA 4A6DA 3KLOA 3JTHA 3ZMDA 2JT1A 4KDPA 5LHGA 4DR2H 4L5IA 2F5DA 3ZN1A 1XSDA 1BM9A 1D3YA 3N41B 2DK8A 1ON2A 4LF8H 3HHGA 4EFBA 1YW7A 1F9NA 2V1XA