4RB0A

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-apo-fur
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
135
Chain Sequence
b'GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 40
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb0A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb0A02
3GVAA 3TGNA 4OMYA 2P5VA 2EFPA 3AAFA 2BYVE 4FHTA 3J80K 1XMKA 2ELHA 1MJ9A 3SXYA 2O3FA 3E6DA 2QUFA 2DPDA 1XD7A 3KP6A 2P4WA 3LWFA 1DDNA 3LSTA 2G7HA 4DNCA 1IAWA 2IT0A 2LKPA 4WWCA 4ESFA 2IP2A 3TKYA 5L3CA 2XVCA 4M72A 2ZO4A 3RKXA 1U5TA 5E1ZB 3TOBA 1OYYA 3P7NA 4B8XA 3C7JA 3T0YA 2PN6A 4AIJA 1HQCA 5KK1A 1HBXG 1B1BA 5CVJA 3FWEA 3IKTA 1VTNC 1H9TA 4AVPA 2FBIA 4CYDA 1T6SA 2KKOA 4EJTA 1LEAA 3CUQC 1HW5A 4ESJA 4YFNF 1LVAA 1ZGJA 2EFWA 1SMTA 4XLNF 1FNNA 3DF8A 4IVNA 2KJBA 2DBBA 1WQ2A 3CJNA 1XN7A 2DQRA 2P6TA 2AXLA 2LF8A 4WXDA 2XAGA 1QZYA 3V4GA 3QU3A 4G7HF 4L9NA 1Q1HA 2STWA 1XDSA 2ZMEA 1J59A 2YR2A 5ICGA 2Y0MA 3O6BB 2RNJA 3BY6A 4RAYA 3ROUA 1ODDA 1G3YA 1KGSA 2A68F 1TTYA 1PDNC 2GQQA 3ZP5A 1USSA 2EB7A 1XMAA 2M1BA 1L0OC 1PUEE 1TQMA 5ICCA 2XGXA 2FBHA 2ZMEB 5JFRA 3WG9A 3PQJA 5FLXZ 4GYGA 4HBLA 1BI3A 1FZPB 1QZZA 2KIMA 3E97A 2KRFA 3NQOA 4LG0A 2CYYA 3V7RA 3F23A 3BPVA 4HZFA 1D5VA 4PZJA 5D5XB 3U9GA 4ESBA 4GCVA 2IW5A 1B9NA 1W7PA 1WI9A 4KUMA 5DCMA 2FXAA 2Z9OA 5TRDA 3VB2A 2HEOA 2NNNA 1C0WA 2QWWA 2XIGA 2L4MA 5J8CA 3WTXC 1BC8C 1G4DA 4LB5A 2OQRA 4EMSA 4FX0A 2X4HA 1WKMA 3F6VA 1IF1A 4PGGA 4UXNA 1R36A 4ZYGA 4M6YA 3O3KA 4LK0F 3D0SA 1F5TA 3DP7A 1KQ9A 1FBSA 2M5WA 3GW2A 3TQNA 2FSWA 2Z5UA 4O6JA 3P9IA 2EFQA 2VODA 4XLPF 4CHUA 4A2UA 4KIGA 1XDUA 3E6MA 2G9WA 3QP5A 1JXSA 3KZZA 2RDPA 1AWCA 3GX4X 1K6OA 1EV7A 4HV6A 1ONVA 4LLNA 2JSCA 1R23A 3HRUA 3ZMZA 1D8KA 2HFHA 3ZMVA 5K5RA 3JTHA 2WWYA 2PI0A 1XGSA 5JI6A 1U3EM 1HKSA 1HW2A 2OBPA 1J0RA 2W24A 4IF4A 1ZRDA 4I98B 3R4KA 2UZKA 2A3SA 2XAJA 3K69A 2QYOA 2C6YA 5FFZA 4KMFA 1FPQA 3FF5A 2GA1A 1B59A 3VEPA 4E70A 4BNCA 3J80Z 1R5GA 3L7WA 3PQKA 3O2PE 2L02A 1B9MA 2VC1A 4IHSA 5IT9K 1KYWA 2JZYA 1YW8A 1QO0D 4NB5A 2OZ6A 3BJOA 4XBFA 1FYMA 1R00A 4YIIA 4A6DA 2B0LA 1A04A 4EM2A 4A6EA 3BZ6A 4HAMA 2V9VA 2V6CA 2JPCA 1S29A 2YX4A 4M9XA 4ENJA 3M9AA 3T5XA 2O0YA 4RGUA 1SFEA 4D0PA 3RPQA 1IXRC 1BI1A 3EDPA 4WXCA 3B02A 2M8EA 2DW4A 1REPC 4CDGA 4OMZA 3M8FA 2YX7A 1K79A 2Q2EA 3HTSB 4HQEA 3VFZA 3NEUA 1T0FA 4XSZF 4LJZF 1O57A 2VBXA 3RYRA 3HYIA 4LMYA 4BHPA 1LNWA 4MTEA 2A5YB 3CDHA 4I7HA 2GIVA 1YW7A 3ECHA 1PP8F 3ZMTA 4OIOF 2ZJ2A 2WV0A 1IN5A 3ZN1A 1UHMA 4TV7A 4HLXA 4ZZDA 3U1DA 1IN6A 3IRQA 4LK1F 2XROA 4R79A 4OIQF 3GFJA 2DO7A 5HDKA 1K7AA 3CTAA 2RQPA 3JTGA 4LD5A 5LBQA 2VN2A 2ZNYA 3DPLC 3HSRA 4R1HA 4ENNA 2VONA 4WX9A 4U0YA 4Q5SF 1E17A 2NAZA 2XAQA 1KA8A 1KU9A 4RB2C 3KP5A 1QGPA 5LGUA 2L4AA 2D1VA 2DLLA 5A2QK 4JK1X 1JHHA 2DFIA 4A0ZA 1XSVA 3R0JA 3QOPA 2OU2A 1IN7A 2O03A 2UXXA 3CUOA 2VE9A 3ZPLA 5ILUA 1O3RA 1O7FA 2FNPA 3PFIA 4XSXF 4ZYHA 5ERIA 3N97A 3KEQA 5E1XA 2PLYA 1E2XA 4IRIA 3KETA 3MFKA 5CLSA 5D6FA 1JHFA 4CO8A 1ULYA 3KP7A 2XASA 2VT3A 2XV4S 1BOAA 5D4RA 1ZARA 1FOKA 2ISYA 1IXSB 2IVMA 2R3SA 5IT3A 5F1RA 3CUQA 4RB3C 1U2WA 3DFGA 3ABTA 1PP7U 2HOEA 4BXUA 1CGPA 2ZKZA 5EEGA 3GWZA 2F5DA 2HDCA 2CO5A 3L9FA 3GLXA 2P7VB 2L01A 3E6BA 2FRHA 2BE5F 1YS7A 3RTRA 2PJPA 1S3JA 4HX4A 3BOQA 2E1NA 4MEYF 2HWVA 1MJBA 2FA5A 2MD5A 3OOPA 5DUIA 5LHHA 4B09A 3DXJF 1DPUA 1KQ0A 3DEUA 2QM3A 4EJVA 2VXZA 2K02A 2K86A 1QQIA 2RV8A 4L9TA 4CZZA 4BHBA 2UWMA 4MHGA 3HSEA 1H9GA 3FXRA 3GYHX 1ZRFA 1BIBA 1IRFA 1USTA 2W25A 3EYYA 1LEBA 1RUOA 2OQGA 4ENMA 1V4RA 2IA0A 1LDDA 2O61A 3MAJA 3ML6A 5E20A 3JW4A 2MH9A 3L00A 1G3TA 3QU6A 3I59B 1K78B 2YSRA 4LGWA 3J81K 3N4MA 1LB2A 5FD5A 2R7FA 5D8KB 2TDXA 3ZMSA 3IWFA 1HSJA 5LLQA 4RAZA 2P6SA 5BPDA 5ILVA 1QBJA 1FP2A 1FX7A 3KP2A 4BHCA 1UB9A 4FX4A 1B4AA 5H6RA 3JSPA 3F21A 2A61A 5F6FA 4M73A 5IT9Z 2ZCWA 3GXOA 4RB1A 2P5KA 2PQ8A 5L3FA 2M30A 1W5SA 5J8FA 3TO7A 3K1MA 5L3BA 4UUVA 3WTSC 2JRTA 4I0BA 1FP1D 4HF0A 1S6LA 1XB4A 3HSFA 1KQ8A 1Z91A 2K4BA 4ASNA 4HX7A 3KFWX 2R7DA 5D8LB 5E8IA 1DPRA 4LLGF 1HKQA 3I54A 5CVIA 1BC7C 5DD4A 4I09A 1TW3A 2PBIA 5D6EA 2RKHA 3TDZC 5HS9A 3K9TA 1IW7F 4EGZA 2CW0F 1UHWA 5LGNA 4GGGA 5DV5A 5E8GA 4EM0B 4HLYA 4G8XA 3F8MA 1I1SA 2ESHA 3BJ6A 1LDKB 3R6SA 2H94A 5D5WB 1WRJA 1Z6TA 1T98A 1W5TA 2STTA 2D45A 1TW2A 2CQKA 1L3LA 1ON1A 4I0AA 2FNAA 4A12A 1J5YA 4G94A 1NHAA 3WE3A 1GXQA 5JVTA 1R5HA 2M45A 2H27A 3QP6A 5HS7A 5E17F 4HF1A 1HXDA 1P4AA 3ERED 3RIRA 2EWNA 5ED4A 5A2QZ 4I02A 2EFOA 3EYIA 2FMYA 1MKMA 4N9HA 1YQAA 4P55A 1J7KA 2IA2A 3LA2A 3FXQA 1SD6A 1OMIA 4Y13A 5FFXA 2J5PA 3F8CA 2ZXJA 1RIOH 2F2EA 3FZVA 2QLZA 4GO1A 4NHJA 3BP8A 3W6KB 2YPRA 4QLCU 5J6XA 4Z2YA 4OU0A 4L5IA 4YG2F 1KU3A 3DPTA 5HLGA 2WTEA 5HDGA 2Y75A 1EH7A 4RGSA 2MH2A 5F64A 1R22A 2CFXA 2QZ8A 2NNYA 4EV0A 2RGVA 2F5FA 3FMQA 2GZWA 3FX3A 5H20A 4BQAA 1F1ZA 3HRMA 1DP7P 2BV6A 1S7OA 3I64A 3K2ZA 2ESNA 4DQ2A 2EA2A 1O3TA 1P2FA 1W7PD 3KE2A 1FLIA 1R1VA 2GAUA 2H6CA 2NYXA 4KIFA 4KN4X 1YFHA 5DEQA 3HOTA 3GF2A 4HW0A 4P96A 1ZG3A 3G3ZA 2Y48A 1QPMA 3GZ6A 4G6DA 2OD5A 2A6EF 2P8TA 2QBYB 4I2OA 4YFXF 2XKOA 3V7SA 3LAJA 1R1TA 3HRSA 5HDNA 1R1UA 2HZTA 1JGSA 1XGMA 4EGYA 4LFUA 1STZA 2JTVA 5DD8A 4HYEA 4M6XA 5HLIA 2IJLA 1YLFA 3RKYA 2O8XA 4HQMA 4P5OA 1FSEA 5BOXA 1RNLA 3R60A 5D4SA 1BJAA 3J81Z 4BYYA 2WC2A 1ZG1A 4LLLA 1SD5A 3HHHA 2FBKA 3KZYA 1MD0A 5BQTA 1TNSA 1P6RA 2FE3A 1Z9CA 1Y0UA 1SD4A 4QWQA 3RI4A 2YU3A 2JPBA 3GEZA 2DAOA 2Z33A 1LDJA 4L0YB 4YFKF 3BDDA 3GFMA 3IL2A 3Q9VA 3RJPA 5L3EA 3WE2A 2BEOA 3SZTA 1I6XA 4XRFA 1ZGAA 4N0BA 3GUDA 3ZMUA 1BN5A 5D5UB 2O6GE 2GXBA 5L3GA 3WTWC 3I5UA 4MGRA 4KYWA 1MJAA 3WTYC 1KU2A 5LHIA 4CICA 3F3XA 1CF7B 1FYLA 2QQ9A 4KN7X 4EVIA 3I58A 5BMZA 5LRRA 4S05A 3LA7A 4KFCA 3CLOA 3HIFA 1R58A 5HS8A 2LNBA 5DYMA 3KLOA 2MLGA 1U8RA 4UVBA 3E5UA 4PGHA 3F22A 2HKXA 2HQRA 1ZYRF 1TNTA 2VOPA 1FYKA 3MZYA 4MTDA 1BI2A 4HDUA 2J5OA 5KVRA 4OINF 2DPUA 2A6HF 3LQRA 2FMLA 1XSDA 3GO5A 2W57A 4IPAA 1I27A 3ECOA 3TOAA 5LEJA 4AWXB 3M1EA 1RUNA 2EFNA 4NQWA 4HDVA 4RGXA 1X3UA 2AS5F 3LAPA 3HOSA 3KP4A 3EETA 3RKWA 4EJWA 3WTZA 1BBYA 2VOOA 1MDMB 2VBWA 4U7DA 1P4XA 2E7XA 1ZLJA 2V1DA 2DK8A 1Z05A 1FC3A 3E5QA 4O3MA 5D5VB 3ELKA 4ZH4F 4KMUX 2HTJA 1SFXA 5AIPA 4EM1A 2K27A 2QENA 4UV8A 2W85A 3REOA 3WGHA 2HYGD 1IUYA 3LQQA 1D3YA 3J7AO 4M71A 2D1HA 3SFZA 2V79A 2A69F 1OKRA 3V8JA 5BS6A 2EV0A 4WCGA 2XUBA 1UFMA 1H0MA 2ISZA 5LEKA 2P7CB 3IHUA 2KJCA 5FD6A 3FM5A 1IXCA 1DUXC 3E6CC 2PMHA 3FXUA 4FT8A 4U0WA 3U2RA 2CG4A 2XAFA 4UVAA 2MLKA 3ABUA 3I59A 2G7UA 1K78A 2Q8KA 1SAXA 1YW9A 3WGGA 1ZLKA 4KIBA 4U0VA 2EV6A 4PCQA 5EEHA 1UCRA 5LGTA 4F7ZA 2GA2A 4BH9A 3MWMA 2BBYA 3TO9A 2H09A 3IKVA 1OR7A 4IRGA 3RYPA 3F8NA 5AONA 2HS5A 3H92A 2FEZA 1R7JA 4GYIA 1AOYA 4MNUA 5E1WA 1BIAA 3T8RA 1IN4A 3TO6A 4Y17A 3HTUA 3H3ZA 3SQNA 2EV5A 3V8LA 5DDGA 1RI7A 4IRHA 1OYIA 2XHKA 4A0YA 5CYVA 2HKOA 5K1YA 3IWZA 2IPQX 4UVCA 2PEXA 1Z7UA 5JR3A 4ON0A 3CO6C 4G7ZF 1I5ZA 1GVJA 1P4WA 2KIUA 2OAZA 4EJOA 2ETHA 1EH6A 3GZ5A 2GXGA 2W84A 1U6GA 1SD7A 3T1BA 3BPXA 4IXAA 1Z6RA 1U5TB 1GXPA 1G3SA 3LA3A 4HX8A 4MEXF 5HLHA 3Q5FA 2V1UA 1W4MA 5L3DA 4RB0A 3WU1B 4U7BA 3I71A 2RVCA 1XGNA 3JAMK 4ENKA 2MC3A 4G7OF 3ISPA 3M8EA 2HR3A 3D5LA 2COMA 3V8KA 2OZUA 3VODA 1J2XA 3WTTC 3W6JB 2NS0A 1HW1A 2KIFA 5HVQC 3KLNA 4L9JA 1ZHFA 3F8BA 1LJ9A 4EJUA 2FOKA 3SHFA 2IRFG 1WSUA 2HGCA 3JSOA 2ZNZA 6PAXA 3QPTA 3NRVA 4L5JA 3K1PA 3I0TA 2DU9A 1I1GA 1FSHA 4K2EA 4CGZA 1U5TC 2X0LA 1O3QA 3DQVC 2ADUA 4YIFA 2LSOA 4KNYA 2Z99A 4EQQA 2DT5A 3ULQB 2EA4A 1SMYF 2ZBKA 3LFKA 1SFUA 2PMUA 4UNOA 2DTRA 1T39A 1RZ4A 3EQLF 4MQ9F 4MQVA 2QQAA 3CO7C 1OYWA 1OPCA 2LDUA 2CGPA 2DK5A 1JE8A 2Q0OA 4HF2A 2VBZA 2E7WA 1J9IA 1FT9A 3WTUC 1YO5C 5CVRA 4LG0B 2IA1A 1B6AA 3HRTA 1F9NA 3RDIA 2NRAC 3OV8A 3R0AA 3DKWA 1MZBA 1IN8A 1YYVA 1IRGA 1W7PB 2MA3A 1ZREA 4KICA 1FBUA 4S04A 1S8NA 4ETSA 3R61A 4Q48A 5BPIA 3M7GA 5DCMB 5JHUA 4BAYA 4Q4ZF 2ZFWA 4AD9A 2Z3YA 4KT5C 3T8TA 3MEXA 1FBQA 1FY7A 3E3VA 3H3UA 4ZYDA 1MGTA 1XCBA 3C3WA 2PG4A 4IHTA 2QBYA 1S7AA 3GFLA 1LQ1A 3ZQ7A 4I01A 5ICFA 3KP3A 5CVVA 4WXHA 3FHZA 1YTYA 2FU4A 3C1DA 5CJ9A 4P9UA 2F5CA 2L3DA 1ZH5A 4OIRF 1IZ1A 3GFIA 1ZAOA 1ZG5A 1ZRCA 1FWZA 3K0LA 4A5MA 5HOOA 3F6OA 2V1XA 4N9IA 3HUGA 2F5EA 5TJJA 3VOEA 5K5QA 2EK5A 2VBYA 2JT1A 5E18F 1T38A 3MQ0A 5K5OA 5ILSA 1V3FA 1HSTA 1HKTA 1YG2A 2XAHA 4JBAA 1Z1DA 4Q47A 3G73A 3KEOA 4G9YA 2M87A 5H6QA 3FMRA 4M9ZA 2DQLA 1XCVA 2E1CA 2HYFA 3F8FA 1CF7A 4OIPF 3IC7A 2D2WA 3BJAA 4LB6B 1ZN2A 3L09A 2L54A 3F72A 4U88A 3BROA 2VT2A 4R8HA 2UXNA 4H0EA 3K1NA 3EUHA 3I4PA 2FQ3A 3FMSA 3SZPA 1TLHB 5CVUA 3L2CA 2MBFA 4L0ZB 4WK8F 4HA8A 3TDUC 5FLXK 1BI0A 2XKPA 1XSXA 2DI3A 3MZHA 4HOBA 1XGOA 2BGCA 1QNTA 3P9KA 4UHTA 2LF7A 4OOIA 1O7LA 4A5NA 3I53A 2EJRA 1U78A 3DV8A 4UV9A 3QAHA 3ZN0A 2VC0A 4WF2A 4L18B 1TQIA 3JAMZ 2QQBA 1MDMA 3IRRA 4GXOA 2HTSA 5ICEA 4HV5A 5FGMA 2XRNA 2QVOA 4RS8A 1P92A 4M9SA 4L9VA 3WU0A 2ACJA 4ZZLA 2H6BA 3P9CA 4KDPA 1G3WA 4O5VA 4G6QA 2P5LC 1TQPA 3QRFF 4JQFA 4AIKA 3S2WA 2RN7A 1EH8A 4PDKA 5LHGA 2HQNA 1YIOA 3WGIA 3B73A 2K7LA 5FO5A 2A07F 1O3SA 4ZYEA 2RC4A 3MCZA 1J75A 3HHGA 3FM3A 3QPHA 3WODF 5DUKA 3BWGA 4KA4A 4P9FA 1D8JA 5DCFA 1KU7A 4IJAA 1ON2A 4CXFA 3C18A 2PFBA 1KYZA 5LRSA 1G6NA 2GWRA 4AIHA 5FB2A 4A0XA 1YS6A 1GHCA 4Y15A 1F4KA 2OA4A 3RPUA 2K4JA 3Q9SA 3V7CA 2VE8A 4M74A 5AIQA 1T2KA 1BM9A 1TBXA 3KCCA 3ZMDA 2CSOA 3E5XA 3WTVC 1WWXA 4RGRA 3COAC 2FF4A 3CUQB 2CWEA
chains in the Genus database with same CATH superfamily
3FISA 3GVAA 3IH2A 1EHIA 3TGNA 4OMYA 2P5VA 3BG6A 4II3A 4F4WA 2VKDA 1JI8A 4LSXA 1G2HA 2EFPA 2IAIA 3AAFA 4AC0A 4YHHH 2BYVE 4FHTA 5CAEB 3J80K 2KISA 4PJ0C 4BBSJ 1XMKA 2R7XA 2ELHA 1MJ9A 3SXYA 2O3FA 5FJ8J 1RJPA 3E6DA 1Y39A 2QUFA 4ZDPA 4JI4H 2DPDA 2YZGA 5KKNB 1XD7A 2O5RA 5FROA 5EGOA 4M9UA 3AFHA 3KP6A 2ZFUA 1IRXA 2P4WA 2KL4A 3GTLA 1Y8QB 3LWFA 3A03A 2XDVA 1DDNA 3LSTA 2G7HA 2RAEA 3HOXG 4DNCA 4YIRX 3RKQA 4YQWA 4APMA 1IAWA 1E0EA 2ATLA 2R7SA 1YJWI 1X3WB 2WA0A 3CQZJ 3MKLA 1OCTC 2IT0A 2LKPA 2AQ4A 2IP4A 5J1UA 2WY8Q 2B63J 5FRNA 1ULZA 4WWCA 1HR0H 5C4XJ 2MC4A 4ESFA 3UFXB 2IP2A 4IOAF 3TKYA 3V4SA 5L3CA 2DA4A 2XVCA 3T5JA 4M72A 4Q44A 2UV1A 2ZO4A 3RKXA 1U5TA 3MD2A 5E1ZB 2DYRH 3TOBA 3G71I 3S1RJ 4JI0H 3PM1A 1OYYA 3P7NA 3TW6A 4HRIA 3FXLA 2AQFA 4B8XA 3HOWG 3C7JA 3CCEI 3T0YA 4BY7G 2PN6A 4CZCA 1W36D 3RB4A 4AIJA 3DBRB 1D0YA 5LMUH 1HQCA 1Z3YA 4DV4H 5KK1A 4D5FA 1HBXG 1B1BA 5FPOA 3C0FB 5CVJA 2X1DA 3FWEA 3IKTA 2JK3A 1VTNC 1M7JA 2YYAA 1OCRH 2RDIA 1H9TA 3QPSA 4AVPA 2H1KA 2FBIA 5KT5A 2V9KA 2I10A 4CYDA 1LE8B 1T6SA 2KKOA 4NNJA 3TL4X 2JA7G 1E4EB 4EJTA 1LEAA 3PW2A 4W97A 3J7ZI 1VKZA 2LY1A 3CUQC 1HW5A 4ESJA 2XAUA 4LF8H 3VSKA 4EEQA 4YFNF 1HNZH 4HSRA 1A36A 1LVAA 1WJ5A 4HG2A 3KHGA 4BKXA 2EPFA 2R5YA 3FKIJ 4BGDA 1ZGJA 1VQPI 1W36C 2EFWA 1SMTA 4XLNF 5HNHA 2EZKA 1IBMH 2R93G 1FNNA 3DF8A 3OMYA 4IVNA 3OYBA 2FPIB 2QK4A 2KJBA 4EGQA 5KFHA 2DBBA 3A4CA 4UCRA 4X1EA 4YY3H 1ZR4A 1WQ2A 2DFHA 3DKYA 4ZDOA 4DGWB 3CJNA 1XN7A 2DQRA 1FOXA 2P6TA 3DF7A 5E3LA 2E2HJ 2KHMA 2LR8A 3CCYA 2BOLA 2AXLA 3IP4B 2LF8A 3PNVA 4WXDA 4BS9A 2XAGA 1QZYA 4M3DA 3V4GA 3QU3A 5C4JJ 1GDTA 2VPSA 5IP7G 4G7HF 2HHHH 4L9NA 1Q1HA 4DBRA 4NUBA 1KJJA 2STWA 1LVKA 2R7ZA 3LWBA 1XDSA 2WY7Q 3H3VK 2ZMEA 1WH2A 1J59A 2YR2A 5ICGA 3ZR8X 1TL8A 4J9SA 3ZGKA 2Y0MA 5KFCA 3BQ2A 3O6BB 4DJAA 1JDEA 1XMXA 2K9NA 4XIDA 3GIPA 2RNJA 2HVSA 3ORQA 3BY6A 4RAYA 4XORA 1FEXA 1V9PA 3BQ0A 3K10A 1P7IA 2ZDGA 3ROUA 5M3FJ 1QVUA 4F52A 4XOTA 1NK2P 1GLVA 1ODDA 1G3YA 1KEEA 1P7JA 2OUMA 1KGSA 4DZPA 2A68F 2V6EA 2MYSA 1TTYA 2GLOA 2X1EA 1PDNC 2GQQA 3ZP5A 3NWSA 5B5EC 3RQ4A 2WV1A 2W8KA 1V55H 3W6VA 1USSA 2EB7A 3BR6A 4EATA 1XMAA 2M1BA 2K3PA 3E5NA 4EGJA 4GC7A 2J6TA 3SFIA 5LXTF 4PJMA 2HOTA 4HSTA 1U9NA 1L0OC 3FHNA 1FOYA 3LSRA 3SEQA 4HNUA 1RK6A 1PUEE 1TQMA 5ICCA 3GIJA 1LFUP 2XGXA 2R92J 2FBHA 2ZMEB 1IO2A 4B3TH 1AU7A 1CQTA 5JFRA 3WG9A 3PQJA 2XB0X 1FMWA 5FLXZ 1RPWA 4GYGA 3DTIA 1WR2A 4HBLA 3X2QH 2E5LH 3QPLA 1TWCA 3GV5B 3RB3A 5IYCG 1BI3A 3H4BA 1BR4A 1MMGA 4LIUA 1FZPB 1DGSA 4IZOA 4M6VA 3EUAA 1QZZA 2KIMA 3E97A 3AG1H 5F0CA 2LG4A 5IOZA 2KRFA 5F04A 1N56A 2IBDA 3NQOA 2DCEA 2VA2A 3HEFA 3UR3C 4LG0A 2CYYA 3V7RA 3F23A 3TP3A 4FTHA 2FX0A 3BPVA 4XQFA 1NG7A 5IY5H 4HZFA 5C44J 2LH9A 4PZJA 3CCQI 1D5VA 1JTXA 3LSJA 1DIKA 2MCTA 4HEA2 3JRIA 4PK4A 5D5XB 2OF7A 5KFVA 3U9GA 3H0DA 2BQ3A 4OAYA 3RSNA 4ESBA 5FJ8G 2KDOA 4GCVA 2IW5A 2RQQA 3P5JA 1JKQC 4ECZA 1B9NA 1W7PA 2F48A 3S1MJ 2K3FA 1SFOJ 1B72B 2W6PA 1FIAA 2CH0A 1WI9A 5M3MJ 3HL2A 2X1CA 4KUMA 5JLXA 2E1MB 5DCMA 4BJTA 2L9SA 4BBRG 2FXAA 2LFBA 2Z9OA 4PUSA 3VB2A 5TRDA 3OOUA 2HEOA 2DA2A 1MSEC 2CQXA 2NNNA 1YX5A 2IMWP 4JV1A 1MNDA 1C0WA 2QWWA 5LA6F 3TQ1A 2B63G 2KP6A 3OS0A 5C4XG 5BPFA 2GBYA 1QA6A 4LSAA 3GIIA 2XIGA 2L4MA 5J8CA 3WTXC 1BC8C 1G4DA 4LB5A 1C3OA 3BZCA 2OQRA 4EMSA 4FX0A 1D5YA 4DYRA 2X4HA 1WKMA 2IS2A 3F6VA 3A02A 2JA6A 1MBGA 2V26A 1UAAA 1IF1A 4PGGA 2KPMA 2K9QA 4UXNA 1R36A 4ZYGA 1Y1VJ 1XDNA 4P1WA 4ECXA 4M6YA 1L2ZA 3GTMA 2ZXWH 4BL0B 4E7IA 3C2HA 2L5QA 3O3KA 4QW8A 3JAMW 4LK0F 2FLPA 1ZELA 3D0SA 4I76A 3DP7A 1F5TA 3HBLA 3SI8A 2VQDA 2VQHA 1N75A 2BZTA 1KQ9A 3N43B 1BGWA 1FBSA 2KFDA 4D5CA 3W3CA 3JRAA 2M5WA 1TZLA 3GW2A 3TQNA 5IYBJ 2O8KA 2AGQA 3TQTA 2FSWA 2Z5UA 4O6JA 2JJ7A 1CE8A 3OYLA 4MIMA 3U21A 3P9IA 5KG0A 2EFQA 4A69C 2VQCA 1POGA 2VODA 2IEKA 2OCCH 2Z16A 3FKIG 5KFTA 1W5CC 1X1CA 2LY2A 1MMNA 2DA6A 4XLPF 4CHUA 1RK5A 4A2UA 3TIIA 4KIGA 1ENHA 1XDUA 3E6MA 2G9WA 3QP5A 5CQEA 1JXSA 4E7LA 4ED3A 1S0MA 3KZZA 4XKCA 1CQJB 3H20A 2FPGB 2F4VH 2CQQA 2FQ4A 3OS1A 3BC8A 3RZDJ 1T36A 4GC6A 2RDPA 1AWCA 4IHWA 2E1MC 3GTJA 4X0GA 2GXAA 4O3SA 3HPGA 2ZXHA 4C2UA 1TWAJ 2L9VA 3GX4X 1K6OA 1EV7A 4HV6A 1ONVA 4LLNA 2JSCA 2JEFA 1H8AC 4B3XA 1R23A 4FISA 3VYTB 3HRUA 1K83J 3L4KA 4BE1A 2W9BB 1WGXA 4WBNF 4TV8F 4YELA 3ZMZA 1D8KA 4MV8A 2HFHA 4WD3A 2UUAH 5JLWA 3ZMVA 5K5RA 2VL8A 3JTHA 2WWYA 2OC6A 2Y2ZA 1JJ8C 2PI0A 1XGSA 1ZQ7A 1JUPA 2W82A 2PBZA 3BTJA 5JI6A 1SVLA 1U3EM 4C9YA 1HNWH 3VSLA 1HKSA 1S72I 1HW2A 1N48A 2XPVA 5KT3A 2OBPA 1J0RA 2W24A 4IF4A 4QWDA 2WE6A 1ZRDA 2PMZN 4U6PA 4O3RA 4Q0YA 4I98B 1JDBB 3R4KA 1HDPA 2WADA 2ASDA 3K4BA 4Q8EA 2UZKA 2A3SA 3A1YA 2XAJA 1TWHA 3K69A 2BY0A 2EBIA 3KTMA 4YR3A 2QYOA 4E7HA 2C6YA 3S3MA 1HNXH 1WI3A 5FFZA 4RMNA 1NTCA 4KMFA 3DLAA 5KHDA 2LKXA 1FPQA 1R9TJ 4ED7A 3FF5A 1K1QA 2GA1A 2XGQA 1B59A 5KT2A 2HPMA 1GYFA 3N40P 3OYEA 3M9OB 5DGBA 3VEPA 4E70A 1M1EB 2ICWG 4BNCA 5B3SH 5CQGA 3J80Z 1IV8A 1R5GA 4GKJH 4M3FA 4UB8C 3L7WA 1Z77A 1GUUA 2VIXA 3LSHA 3O2PE 3PQKA 4XLEA 4EYHB 2L02A 3TW7A 4K0KH 5C1PA 2VQFH 1B9MA 2VC1A 3ORRA 3GIDA 1IOWA 4IHSA 5IT9K 5F0HA 1KYWA 2JZYA 1YW8A 1QO0D 2E60A 4NB5A 2OZ6A 2ELJA 3BJOA 4ZYAA 4XBFA 1FYMA 3G8CA 1X1BA 2YW2A 2CQNA 1R00A 1I50A 3WHCA 4YIIA 2ZJQF 3CMMA 2L7FP 2DLNA 5E3MA 4JOMA 4A6DA 2B0LA 2VXDA 1XMQH 4DR4H 1A04A 5C44G 4EM2A 4Q45A 1Y1WA 1JJ6C 4A6EA 4QPQA 4BQQA 3BZ6A 2K9SA 3AG3H 3H0GJ 4HAMA 2NS7A 2L9NA 4NC8A 1VQKI 2V5AA 2V9VA 1BW5A 2V6CA 1K6YA 4DL5A 2JPCA 2CKZB 1S29A 2YX4A 4YAJB 4LF6H 4M9XA 2OJED 3M9AA 4ENJA 5GAGJ 1DQUA 1HA8A 3T5XA 3LMLA 1XG1A 3MKZA 5LYJF 3OYKA 4F4ZA 1QVTA 4MO7A 3RAXA 4TQRA 2O0YA 5JQWA 2DOEA 3IAS2 2LY9A 1QHHD 2M4GA 4DUZH 3ZQIA 4ZDLA 3S1NJ 4RGUA 2VQEH 1SFEA 4D0PA 2X6WA 1G59A 2XSJC 4IQJA 1Q1VA 2LP0A 3RPQA 5DM7F 1IXRC 1BI1A 3JSNA 2L7ZA 3D5RC 3EDPA 1YI2I 4WXCA 2E2JJ 1V5EA 4E7KA 2P0AA 3QFFA 1PUFA 4IAJA 3B02A 3S14J 4DR5H 2M8EA 2ME0A 2DW4A 1REPC 4CDGA 4YR2A 2OWOA 5BR8H 1QZEA 3KYCB 4RM3A 4OMZA 3GTOJ 2CUJA 3M8FA 1XPXA 5GP9A 2YX7A 3MR2A 2HNHA 1K79A 2I80A 2JA2A 2DA1A 1I6HJ 2Q2EA 3HTSB 4E7ZA 4HQEA 3OSGA 4AUXA 4YJ3F 3VFZA 2R5ZA 3NEUA 4RU9A 1T0FA 2VI6A 2R8JA 4XSZF 1X9NA 4LJZF 1O57A 2K5CA 2VBXA 1I3QA 5TISC 3PW7A 1Y56A 1Y1VG 3RYRA 3HYIA 4LMYA 4BHPA 3OSNA 3RB0A 3QODA 4FCYA 1LNWA 1HF0A 3V6JA 4MTEA 2A5YB 3CDHA 4I7HA 2GIVA 1YW7A 3ASNH 3JRCA 5D1OA 3CMAI 4J9NA 3ECHA 1PP8F 3ZMTA 2AHQA 3EUKL 1PK8A 4OIOF 2ZJ2A 1FTTA 2OTLI 2WV0A 3KHLA 3M8JA 1IN5A 3L2WA 3ZN1A 1UHMA 4TV7A 5E3NA 4BY1J 2BW3B 4HLXA 5IYBG 4ZZDA 4KISA 3DWLE 3GIMA 3U1DA 2MFZA 3LFUA 1IN6A 3M3YJ 3IRQA 4LK1F 3GILA 2XROA 1FVIA 1T56A 2A05A 4R79A 1T3NA 4OIQF 1AUVA 1KJIA 1FKAH 4B3AA 3T1HH 3GFJA 4O4IF 2DO7A 3BTIA 4RAFA 5HDKA 1K7AA 2LKSA 3CTAA 2Q2TA 2RQPA 1VQ9I 3JTGA 2JQ7A 5DQIA 3FXJA 5T14A 4HYKA 4LD5A 5LBQA 2PN1A 1JKJB 2WYOA 1ETVA 3PW4A 2VN2A 4X65H 3L2UA 2EIJH 5E3OA 3VPBA 2ZNYA 3DPLC 3BQZA 2F4IA 3QWLA 5BMVF 1TWFA 3HSRA 4R1HA 3OSPA 2LBFA 4ENNA 3ESWB 2VONA 4AYBN 5KG3A 3GTQJ 4WX9A 4U0YA 4Q5SF 3DBHB 2OCEA 1E17A 2ECCA 2NAZA 1S68A 2PMZA 2XAQA 2HDDA 1JLLB 1KBLA 1KA8A 2DN0A 1KU9A 4RB2C 3KP5A 1R49A 1QGPA 1ETQA 3ASOH 2VJ4A 1X3ZB 1T8IA 1YRNA 2V59A 5LGUA 2L4AA 1MBKA 2D1VA 2ZJRF 1B33N 1Z3XA 4TQSA 2NOJB 2DLLA 2DZDA 4D7MA 5A2QK 4JK1X 1JHHA 2DFIA 4A0ZA 1XSVA 2VQLA 2F5VA 4RA2A 2V9WA 1G8XA 3R0JA 1RYRA 3QOPA 2R7RA 2OU2A 1VQ6I 3OR2C 4Y52J 3BA8A 1IN7A 2O03A 2UXXA 3CUOA 2VE9A 3CCVI 3ZPLA 4A3BJ 4ED2A 3PW5A 5ILUA 1O3RA 4ED8A 1YJ9I 3OL4A 1O7FA 2KMUA 2FNPA 2ZXIA 4MA0A 2YRWA 2HU9A 4A3CJ 3C2BA 3PFIA 3M07A 3GQCA 1VBGA 2LMDA 1X19A 4XSXF 4ZYHA 2M4KA 1W93A 5ERIA 3T5KA 3N97A 1LUJB 2I8CA 3KEQA 5E1XA 2NU8B 2BY3A 3L2RA 3HOVJ 3H5RA 1AKHB 1LPQA 1CQIB 5F9LA 1EUDB 3HGYA 2PLYA 3H40A 3BR0A 1E2XA 1OQYA 1KC7A 4NC7A 5EZHA 4IRIA 3KETA 2AXTC 3MFKA 3HKZN 4BEHA 5CLSA 2DMUA 3PJRA 2LYCA 5D6FA 2O9LA 3MFHA 3G6XA 1JHFA 3ETHA 1A6QA 3RQIA 4CO8A 1ULYA 5FKOA 3KP7A 1XX5A 2XASA 2VT3A 2XV4S 3BR2A 3PR5B 1BOAA 5D4RA 1ZARA 1FOKA 3CC7I 1IBLH 2UU9H 2JEGA 2ISYA 1GLNA 1IXSB 4DYCA 3N8DA 4M3BA 2IVMA 5GTIC 2R3SA 4GRIA 3K6GA 4A3IJ 2NVYA 5IT3A 5F1RA 3CUQA 2QSGX 5KFSA 5DG7A 5H80A 3PUFA 3CC2I 3CJTB 3AKZA 2FKLA 4RB3C 1U2WA 2CUZA 5KFXA 3WU2C 3DFGA 3L2PA 5FLXW 3ABTA 1PP7U 2DIKA 2HOEA 2EILH 4NQWB 3H0GG 2B7EA 3FDSA 4BXUA 3W2AA 2HQ5A 1CGPA 5KFRA 2ZKZA 3EUHC 1AHDP 5EEGA 5DLFA 1R5ID 1KJ8A 3GWZA 4UFZA 2F5DA 1DU0A 4PJJA 1GSHA 4EFBA 1EJ9A 4NXNH 2HDCA 1R6RA 2LOOA 2CO5A 3L9FA 4ZTJA 3GLXA 4A3EJ 3FDYA 5J2TF 2P7VB 4BJ6C 2L01A 4Y8VB 2QCOA 3E6BA 2FRHA 2BE5F 4A3GJ 2M7BA 4QIWE 4XKWA 3R5FA 1YS7A 2Y31A 3RTRA 2PJPA 4A2BA 1S3JA 4HX4A 1TT5B 3BOQA 2ECBA 2XPUA 2WB1E 3HG9A 2E1NA 4MEYF 4XOPA 2HWVA 2XSDC 4YB8B 5J2UF 4YAKB 1J5EH 2R8GA 3OYMA 1MJBA 1MMDA 2DA3A 2EZHA 2FA5A 2MD5A 3OOPA 5DUIA 3GTLJ 1BJTA 5LHHA 2FLNA 1K4TA 4B09A 1UZCA 3DXJF 1DPUA 3KAJA 1APLC 2CRGA 1SEUA 1KQ0A 3L4JA 1OJLA 3DEUA 1BW6A 2R0QC 2QM3A 2BHYA 3SZGA 4UCOA 1VI0A 4EJVA 2HQAA 2ZSHB 1YX3A 1I3AA 2VXZA 2K02A 2K86A 1RJQA 4S0HB 5GTHC 1WH5A 4BQOA 1ETWA 1QQIA 2RV8A 4L9TA 3A0BC 1B8IB 4IRDA 4CZZA 4BHBA 4JI8H 1S03G 2UWMA 4MHGA 3HSEA 4JX5A 1H9GA 1KJQA 4AYBA 3K70C 4EEYA 3FXKA 3FXRA 3GYHX 1ZRFA 4AM3A 5DQHA 1BIBA 1IRFA 1WJCA 4BY1G 1TWGA 1USTA 2W25A 3EYYA 1EUCB 1LE8A 1MIJA 1LEBA 4TUYF 1RUOA 4J9MA 1E4EA 5KG2A 2OQGA 4NLGA 5J4YA 1Z67A 1V4RA 4ENMA 1TAEA 5KT7A 1AA7A 2IA0A 2R87A 1LDDA 3CMYA 2O61A 3MAJA 3ML6A 3V6KA 1A35A 3O8GA 5E20A 3FK7A 3JW4A 5C1OA 1RC9A 3WHBA 5JVDF 2MH9A 1YHQI 3L00A 4L1KA 1G3TA 5KFYA 3RJ0A 3G4SI 3QU6A 4Y3OA 3KX2A 3SYTA 1KJ9A 4IOCF 3JRXA 3I59B 3LMMA 1HDDC 2V7FA 2JSPA 4FQGA 4HR7A 1K78B 2YSRA 3EPIA 1BJZA 5KFKA 4J00A 4LGWA 5IPAA 3J81K 3N4MA 1LB2A 5FD5A 1ETYA 2C00A 2KIQA 2R7FA 5D8KB 5L1KA 2TDXA 3ZMSA 2QSFX 4KITB 3IWFA 1HSJA 3KZIC 5LLQA 4RAZA 2P6SA 4XM3A 5BPDA 3HKZA 5ILVA 1QBJA 1RETA 1FP2A 3RBEA 1FX7A 1XMOH 3KP2A 4BHCA 2F4OB 3ZQHA 5KFEA 1UB9A 4FX4A 4A3BG 1B4AA 4J9OA 3DEWA 4JX6A 5H6RA 5HBRB 2R7ZJ 3JSPA 3S2HJ 4MLOA 2R7OA 3PL8A 3I4NJ 3RPUD 3F21A 4A3CG 2A61A 5F6FA 1M6VA 5IYDJ 4E7JA 4IEJA 4M73A 1WPKA 3CLQA 5IT9Z 5K2MA 5JHFA 4IWYA 4RNMA 2ZCWA 2CQYA 4C30A 3GXOA 2QQ8A 2MW8A 4RB1A 4LIVA 2P5KA 2PQ8A 4JI3H 5L3FA 2AGOA 4B3RH 2IGMA 4B3MH 4FE7A 1I39A 1S9FA 2M30A 1W5SA 2NOGA 2OPTA 5J8FA 4ZHQF 1IJWC 3N41B 3HPHA 3K4KA 3BJYA 4B47A 3TO7A 2LLKA 3K1MA 3ZQQA 5L3BA 4QTRA 4JP0A 5K7FA 4UUVA 1FOWA 4JX4A 4XK4A 3WTSC 2JRTA 4I0BA 1V4YA 2MG4A 3KAKA 1FP1D 4HF0A 4C3IJ 1S6LA 1XB4A 3HSFA 2NXNB 3IUOA 1KQ8A 4A3IG 1Z91A 2K4BA 4ASNA 5KFOA 4HX7A 3KFWX 2R7DA 5D8LB 3A01B 1VQ5I 3H35A 5E8IA 2UUZA 4XN3A 1DPRA 2RREA 4LLGF 4O3NA 4JYAH 1N34H 3J80W 3HDDA 5J3LA 3RF2A 1VF9A 1TWCJ 1DV2A 5D1PA 3W2WA 1HKQA 3I54A 5CVIA 3ABKH 2Z1DA 2KDZA 1MNEA 4NBQA 4DBQA 1BC7C 1N33H 4I6ZA 2ZDHA 3ZRGA 4IO9F 2R8HA 3K3VA 2W9AA 1S5LC 3DLLF 1VQMI 1B72A 2DOFA 5DD4A 4E4HA 2MGQA 4F92B 1EKEA 4I09A 5EWEA 2QKMB 1TW3A 2PBIA 1FTZA 5D6EA 1GO3E 4A3EG 3WO1A 2RKHA 3TDZC 4D9JA 5HS9A 3K9TA 1IW7F 4Y33A 3OYJA 2XRLA 3K4JA 2CW0F 4EGZA 3RZOJ 3LNQA 4CCNA 1UHWA 1IC8A 5LGNA 4GGGA 4UCTA 1IOVA 3VPCA 2FOWA 5DV5A 5E8GA 5J1YA 1Z2PX 2W6NA 1EA3A 1OR7C 2R7KA 4EM0B 1BL0A 4HLYA 4G8XA 1H89C 2LTPA 2BR0A 3F8MA 1I1SA 3VPRA 2O7OA 2R7NA 2ESHA 1VQLI 3BJ6A 3GMEA 1LDKB 2LC2A 3R6SA 4RUAA 4RAGA 2H94A 5D5WB 1SC7A 1JUSA 2NVXA 2G0EA 4MV3A 3GCMA 3PIOF 3SJMA 1WRJA 1OFCX 5KFMA 4BBSG 1Z6TA 1JXLA 1T98A 1W5TA 2STTA 3S15J 4UCSA 2D45A 3H9QA 1TW2A 2CQKA 1L3LA 2R84A 1ON1A 1W0TA 4PDBA 4I0AA 5C3EJ 2V58A 2ZDQA 4A3JJ 2FNAA 4PSWA 4A12A 1PX2A 1J5YA 4G94A 3Q0VA 3OIQA 1NHAA 3GTKA 3WE3A 2L9RA 1GXQA 5JVTA 4JI5H 2J6UA 1WJDA 1R5HA 2M45A 3H9JA 2H27A 2EZLA 3QP6A 1GV5A 2GOMA 3BG3A 5B1BH 2ASJA 5HS7A 4LFBH 4CC5A 5E17F 3BABA 4BACA 2XCPA 4HF1A 4DR2H 4FS1A 1HXDA 4QPOA 4C2MA 1P4AA 3GTMJ 3ERED 3G2BA 3RIRA 1UC9A 4PWQA 2EWNA 1RRJA 5J4VA 5ED4A 2PVPA 3Q1KA 2TCTA 5A2QZ 1MSFC 4I02A 3IV5A 2W6ZA 4BU2A 3VMMA 3NGDA 2K40A 2EFOA 3EYIA 2FMYA 4IL6C 2W7NA 1MKMA 3J7YJ 3AYHB 1S9HA 4LFCH 4N9HA 1YIJI 4F4YA 3KEYA 1YQAA 2HVRA 2W8LA 3HZJA 2DODA 2VUMA 4P55A 4ANJA 1JKOC 4FBUA 3RUPA 1J7KA 4PFOA 2IA2A 4ZJZA 4B4CA 2R82A 3LA2A 2MD0A 2OTJI 3BG7A 4Y7NJ 3FXQA 3KXYT 1SD6A 5EG0A 3C2GA 2YS9A 3ONQA 1NG6A 1OMIA 5FLMJ 4D1QA 3RIZA 2UXDH 4X64H 4OX9H 4Y13A 4YRVA 2XCAA 5FFXA 5LL6b 1QRYA 2NU7B 2W9BA 4ZQIA 3H4DA 4F55A 2J5PA 2FUG2 3F8CA 3I55I 4DZJA 3M4OJ 4KHPH 2ZXJA 1RIOH 4G3IA 1K1SA 1P8LA 2F2EA 2CV1A 2MABA 2PJRB 3FZVA 5KFIA 2QLZA 4GO1A 3GTJJ 4NHJA 2R7ZG 3BP8A 2W9CB 3JRHA 3AL0C 3W6KB 2K9MA 4AU7A 2YPRA 4QLCU 5J6XA 3I4NG 1Y8RB 4Z2YA 1A5JA 2UUBH 1LKXA 3GTGA 4OU0A 4L5IA 5IYDG 1OCOH 2KZVA 4YG2F 1KU3A 3S2DJ 3DPTA 1DP3A 2EIKH 4XRSA 5HLGA 2H1LA 5J1RA 3CCRI 1OWTA 3IG0A 3PZPA 2WTEA 5HDGA 2Y75A 3BR5A 1N32H 1TP4A 1EH7A 3JR9A 4RGSA 3ERMA 2MH2A 5F64A 1R71A 1NH3A 4ZI7F 1R22A 3FMAA 3QZ8A 5L1LA 2CFXA 3G6EI 2CUEA 4DLKA 1PJRA 1IDYA 2QZ8A 4F91B 5K7ZA 5EG0B 2NNYA 3VPDA 4Y4RA 4EV0A 5LD2C 2RGVA 2F5FA 3FMQA 2GZWA 3FX3A 5H20A 4BQAA 1F1ZA 3PW0A 2Z2SB 5CA0F 2R86A 5HV6A 4YR0A 3PR4A 4ABZA 1OCCH 3HRMA 4AQYH 1TWHJ 3BZKA 2WDTA 1JKPC 1DP7P 2JEIA 2BV6A 1S7OA 1VQ4I 3I64A 3K2ZA 2HI3A 3TMOA 3KALA 1FJGH 2ESNA 4DQ2A 1MH3A 3RGZA 5KFDA 5EWFA 2EA2A 4V2FA 5F27A 1AN7A 1MW7A 1O3TA 5FKKA 4J9LA 1P2FA 1W7PD 3KE2A 2ZC2A 4ECRA 1FLIA 1R1VA 4DV7H 2GAUA 3BCBA 2W48A 2EIMH 1YJNI 2H6CA 2V4JC 2NYXA 2BXZA 4KIFA 4KN4X 5L1JA 1YFHA 4DV6H 1JTYA 5DEQA 1ZKGA 3HOTA 3GF2A 2CV2A 2FD5A 4FE4A 4HW0A 1OLTA 4P96A 2W6MA 1M0TA 1ZG3A 1LFBA 1X58A 3KYLA 4HQ6A 3T1YH 3G3ZA 2Y48A 2W6QA 1I50J 1AUXA 4IRCA 3JRDA 5JVGF 1T95A 2R92G 1TWAA 1QPMA 2I8DA 2ZJTA 3UQ8A 1Y1WJ 3GZ6A 1UHSA 4G6DA 3RFCA 2OD5A 4M3GA 2ELKA 3UKGA 2BQUA 2A6EF 2P8TA 2QBYB 4DL4A 2WAQN 4XKVA 2E2IJ 4D7NA 4I2OA 1EZ1A 3GLKA 2DTZA 4YFXF 1XNRH 2VR1A 2XKOA 2X48A 4QWCA 1Z2OX 3Q3SA 4XR6A 2HGSA 3V7SA 3JSLA 3VYUB 3PN1A 2DMTA 3MKWB 2OV7A 3LAJA 3TEDA 4RLQA 2XGCA 1R1TA 2R6FA 4F3QA 3B6CA 3HRSA 5HDNA 4QJFA 1R1UA 2E35A 2HZTA 1JGSA 1XGMA 3WO0A 4RBOA 1YE9A 4EGYA 5C3EG 1V51A 4A3JG 4LFUA 4ZTFA 2BXYA 3D5SC 5J40A 2V4QA 1STZA 1XNQH 2Q1ZB 2R7VA 2E1OA 2YCHA 4JYKA 2DMQA 2JTVA 2JUGA 5DD8A 1N77A 4HYEA 4M6XA 3KYDB 2ID3A 5HLIA 1E3HA 2IJLA 2X6XA 1YLFA 2BW3A 1ZQ3P 3RKYA 4CCJA 2O8XA 3QZ7A 1X4OA 4HQMA 2DT6A 4P5OA 1FSEA 2JA5A 1I3QJ 1RNLA 5BOXA 3R60A 5D4SA 1WSCA 3HUGB 1A9XA 3GV8B 1BJAA 1WVRA 3J81Z 4BYYA 4LH6A 4YEJA 1WCMA 4MV7A 1B6SA 3JRBA 1M0WA 4RUCA 2WC2A 1ZG1A 4LLLA 1SD5A 1WZ2A 2DYSH 3J7AY 3HHHA 3K5IA 2FBKA 3HOYJ 3KZYA 3CCJI 2CW8A 3G1LA 1ERDA 1MD0A 2X9DA 4RNOA 5BQTA 4YP3A 1TNSA 2W1OA 2FB9A 1P6RA 2FE3A 1Z9CA 2FK2A 1W96A 4J9KA 1Y0UA 1SD4A 4QWQA 5M5WJ 3RI4A 4CA0A 3NWTA 2YU3A 3HXLA 2JPBA 3GEZA 2HPIA 2DAOA 2VPLA 2Z33A 1LDJA 4L0YB 4YFKF 3BDDA 1D1BA 2VJJA 3GFMA 1KZHA 4CCKA 1DV1A 3IL2A 4ECTA 1RKTA 3Q9VA 3RJPA 5F1JA 5L3EA 2BY1A 3WE2A 2BEOA 3SZTA 1I6XA 3T5LA 4XRFA 1UNNC 1ZGAA 4N0BA 5EJCA 2XGEA 5FLMG 3GUDA 3ZMUA 3B6AA 1BN5A 5D5UB 2O6GE 2GXBA 1VFCA 5L3GA 2FK1A 4EG0A 3BT9A 1TWFJ 1UJ8A 3MR5A 3VYRB 3EPGA 3WTWC 5KG5A 3I5UA 1X1DA 4MGRA 5FKLA 4KYWA 1MJAA 5DG9A 3WTYC 2KT0A 2ZSIB 2XPWA 1KU2A 3Q8PB 5EDWA 4LFAH 1JKRC 4IR1A 3RV4A 4XONA 4RDUA 3R5XA 3OIPA 4CICA 5LHIA 1E3OC 5KT4A 3F3XA 1CF7B 1FYLA 5HNFA 2QQ9A 4MAMA 2K85A 4KN7X 1SFKA 2NVTJ 4EVIA 3I58A 3HOXJ 5LRRA 5BMZA 1V54H 4S05A 3LA7A 4KFCA 3CLOA 3HIFA 1UG2A 3BG5A 1R58A 3L2QA 9ANTA 5HS8A 2C35B 1AKHA 1OISA 3U1KA 2LNBA 5DYMA 3KLOA 2MLGA 4GDFA 5CPRB 1WJEA 1U8RA 4UVBA 1EYZA 3RGXA 3E5UA 2KSWA 2VUGA 4PGHA 4RM2A 5KAIC 3F22A 1E4GT 5KFJA 2HKXA 3V6HA 2HQRA 5GPCA 4XZ3B 1ZYRF 3QQAA 2P81A 5EOYA 2YL2A 1TNTA 2VOPA 1FYKA 3MZYA 3OYHA 4MTDA 1BI2A 2L7MP 5KFQA 3CCMI 4HDUA 4CC6A 3KHRA 2HXOA 4ECVA 2J5OA 4DOZA 2VPRA 4O2AF 3CF2A 5KVRA 4OINF 2DPUA 4DR7H 2A6HF 2H8WA 2BQRA 2L7KA 3HOWJ 3LQRA 5IT9W 3QYBA 3H36A 1S10A 1S97A 2Y0SE 2FMLA 1XSDA 2W6OA 4JI7H 3PO2J 3GO5A 2W57A 3IH3A 2L0KA 2CU7A 3CDIA 4IPAA 4N4OB 3OHBA 1U8BA 1PYVA 3OS2A 2ID6A 1I27A 3RCOA 4XLAA 5EZGA 4UY8I 4ED0A 2GOXB 2WAQA 3FBNB 3ECOA 3H9GA 1MMAA 3TOAA 2VKHA 1R4NB 5LEJA 4AWXB 3A2KA 2PMZE 3M1EA 1S7EA 1RUNA 2YU9A 1IUFA 4EYIB 2EFNA 4NQWA 4HDVA 1NK3P 4RGXA 2I87A 1X3UA 2WBMA 2AS5F 4O3PA 2VJ5A 3LAPA 3HOSA 4IQ4A 3OUZA 3MN2A 3KP4A 4J9PA 3EETA 3RKWA 4EJWA 3WTZA 1BBYA 2VOOA 3CCLI 1VQOI 2VBWA 1MDMB 2FMAA 1Y1WG 2P0WA 4CH7A 4U7DA 1P4XA 1JGGA 3CD6I 2E7XA 5FRMA 1ZLJA 2DDAA 2V1DA 1BXRA 1O75A 1MH4A 1N36H 2DK8A 1Z05A 3PVXA 2W70A 2IS4A 1FC3A 3E5QA 4O3MA 2JA7A 1X1PA 2ASLA 5D5VB 3H5NA 3ELKA 4ZH4F 4DL6A 4JV2A 2M34A 1T33A 2L2OA 3FIWA 5KFGA 4KMUX 3GIKA 1S0OA 2HTJA 1SFXA 5AIPA 4MV1A 5HLTA 4EM1A 4UUSB 2K27A 3H3VH 5KNLA 4BDZA 1WFXA 5IOYA 5LP6F 4CCMA 1WHUA 2QENA 4MV4A 2R93A 4UV8A 2W85A 3REOA 1WJFA 3WGHA 2HYGD 2SCUB 3VDXA 1IUYA 1LFPA 3K2AA 2V4RA 4FASD 1HLVA 4BUPA 4RZRA 3FXMA 3GBGA 3HOUJ 3LQQA 2HXIA 4R7RA 4M7EA 1D3YA 1B8IA 3J7AO 4DR1H 3GTPA 4FM9A 4FETA 4M71A 2X85A 2D1HA 4F93B 3SFZA 5EDNA 2V79A 1EF4A 2X0SA 2A69F 5GONF 3PIPF 1OKRA 3V8JA 4KT6A 1UC8A 5BS6A 2EV0A 4WCGA 2XUBA 2XCLA 1IBKH 1UFMA 2M7AA 1H0MA 2ISZA 5LEKA 4R8UB 3PO3J 2K9LA 2P7CB 1WJAA 3IHUA 3K3PA 2KJCA 5FD6A 3K4CA 3HOZJ 1F36A 3FM5A 5KFBA 2R8IA 3E7LA 1IXCA 1D1CA 1DUXC 3E6CC 5KG7A 2DPIA 3OYIA 4V19K 2PMHA 1U0JA 2M05A 3FXUA 4XYLB 3HOYG 4FT8A 4U0WA 3U2RA 4O3OA 4ED1A 2XC9A 1FIPA 2CG4A 2E34A 2XAFA 4A2AA 3V4ZA 1TWGJ 4UVAA 2MLKA 5KT6A 5CB4F 4FS2A 2IXSA 3ABUA 3I59A 2XD4A 4DV2H 2G7UA 1K78A 2NU9B 2Q8KA 1JIHA 1SAXA 1YW9A 1QHGA 2E5NA 3WGGA 1ZLKA 4KIBA 2C2DA 1UG0A 4U0VA 3U9TA 4XNFA 2DXIA 5A2QW 2EV6A 5KG6A 2I5UA 4PCQA 3LSKA 4C5CA 5EEHA 1RYSA 1UCRA 4ECYA 3BR1A 5DLGA 2EZIA 2CFOA 5LGTA 2YS6A 3OTOH 1E4FT 4Q8FA 4F7ZA 1ZK8A 2GA2A 2YS7A 4BH9A 1UMQA 3MWMA 3K5HA 1V5GA 2BBYA 3W2VA 4GKKH 2QF7A 4UB6C 3TO9A 1QPIA 2UVVA 2H09A 2ZJPF 1C30A 1R4MB 3IKVA 1OR7A 4IRGA 5DM6F 3BQYA 2X6YA 3RYPA 4B3SH 3MR6A 3Q0UA 2FK3A 2QKLB 3S32A 4BBRJ 1MBEA 3F8NA 5AONA 3KPHA 2HS5A 1IRZA 2M0CA 1X2NA 1R7JA 2FEZA 3H92A 4CCOA 4GYIA 1AOYA 4AYBE 1MBHA 2GM4A 4MNUA 3JREA 5E1WA 4ZOLF 3FXOA 1BIAA 4LH7A 3T8RA 3EPZA 3MWDA 2UVUA 1IN4A 3TO6A 4Y17A 3L1PA 3HTUA 3TIGA 2Y9YA 4IX7A 3H3ZA 3M9NB 4J9RA 4J01A 2OLSA 3SQNA 2C2RA 1ETKA 2IBKA 2EV5A 3BLYA 5FPRA 3R5HA 3QYEA 3IAM2 3V8LA 5DDGA 1RI7A 4IRHA 4XICA 1OYIA 2ME6A 4EBCA 2XHKA 5IP9J 4A0YA 5E79C 2H8RA 3FKJA 3OIOA 4UCVA 2F4MB 5KFAA 1VNDA 3CQZA 2Y9ZA 5CYVA 1K61A 5JUMA 2B63A 3PO2G 2HKOA 5K1YA 3IWZA 2IPQX 4UVCA 2PEXA 5EGOB 1Z7UA 5JR3A 4ON0A 1IDZA 1V5FA 3CO6C 3SDGA 4G7ZF 1O4XA 4B43A 1I5ZA 1GVJA 3A01A 1P4WA 3Q8RB 1RJRA 2KIUA 2OAZA 4EJOA 1Y6IA 2ETHA 2QSHX 1EH6A 2RF4A 3GZ5A 4TV9F 3CZ6A 3OYNA 3HOVG 3OYFA 2GXGA 3SEZA 2D5VA 1VBHA 2QGUA 3RTXA 3RB6A 4NXMH 2W7PA 2W84A 1T94A 1GT0C 1U6GA 3MJFA 2AO9A 1SD7A 2VKVA 2YZNA 5CKTA 1W0UA 3T1BA 3HKZE 2GPWA 2VLAA 4LG3A 3BPXA 4FU0A 4IXAA 4ME6A 3UNGC 1Z6RA 1T08B 3RV3A 1U5TB 1GXPA 1G3SA 3LA3A 4HX8A 2DJIA 3WG7H 2CJJA 4MEXF 5HLHA 3MMYB 4XLHA 1PVEA 4E7SA 3HJEA 3Q5FA 2V1UA 3K4NA 1VQ8I 4AVZA 1SYXB 1RR7A 4A3DJ 1W4MA 5L3DA 3ZQLA 1X4PA 3KHHA 3MWEA 5M5XJ 3BTLA 3K7AJ 2C2EA 4RB0A 4U7BA 1J09A 3WU1B 3I71A 2RVCA 3ZQFA 5FLVA 3FKIA 5L9XA 1XGNA 3JAMK 3I3LA 2JN6A 4PJLA 4QWBA 2FP4B 3OR1C 4DV3H 4ENKA 4M3EA 2XC7A 3ABLH 2MC3A 1D0XA 2XF5A 4G7OF 3ISPA 3BTCA 1A0IA 3M8EA 1OCPA 2DFFA 3I4MJ 2VOBA 3M4IA 2HR3A 3HOUG 3BCAA 4ECQA 1JX4A 1P9QC 2E2HA 1MNMC 3ETJA 2CV0A 1ZETA 1Z0XA 3HGGA 4II2A 4A3FJ 2M0MA 3D5LA 2R5YB 5KX5F 5KFNA 1JUMA 2FJZA 2COMA 3V8KA 2OZUA 2NVXJ 1ACIA 3N44B 2DJNA 3VODA 1F43A 3LSIA 5EF6A 2DMPA 1J2XA 2HOSA 4A3GG 4XRMA 1BA5A 3WTTC 4CYCA 2LRDA 3HM5A 3M9MB 3W6JB 4ECUA 3PO3G 2R7UA 5JH7F 2NS0A 1HW1A 2KIFA 2KLOA 5EYRA 5HVQC 1I7NA 4O4LF 3HOZG 1ZTRA 3KLNA 4W1UA 5KFWA 4L9JA 5L1IA 4EBEA 4NC6A 4A3MJ 3AG2H 4YJ2F 1ZHFA 3GTKJ 3F8BA 4OAZA 1LJ9A 2DFEA 4EJUA 3JRFA 3JZIA 4JI2H 2FOKA 2ZM6H 3PSFA 3SHFA 5KFPA 2IRFG 2ZB9A 1WSUA 1DU6A 3AL0B 4J0MA 2HGCA 3G6VA 3JSOA 2HJWA 4O2BF 2NUAB 2ZNZA 3DTEA 6PAXA 4IZZA 1D0ZA 3QPTA 3NRVA 4C2MJ 3MKYB 4L5JA 4RZQA 3K1PA 3I0TA 2DU9A 1I1GA 3J81W 1FSHA 3IH4A 2W71A 1MMSA 4K2EA 1QU3A 3OYGA 4CGZA 1U5TC 2X0LA 5B1AH 1O3QA 3DQVC 4DIQA 3NARA 2R92A 2ADUA 4YIFA 1Z2NX 2LSOA 4KNYA 4E4TA 2AQEA 1N25A 2Z99A 4EQQA 2JA6J 2DT5A 3ULQB 1ETOA 3CF5F 3WNZA 4Q43A 2EA4A 2VJIA 1SMYF 1HCRA 3GIQA 2VUMJ 2ZBKA 4CYCB 4PFPA 4DL2A 3LFKA 3FK6A 4V2GA 1SFUA 2W00A 3GV7B 2PMUA 4NDLA 2PJRA 4UNOA 2DTRA 3O8HA 3ZCOA 1T39A 1RZ4A 2DA7A 3EQLF 2KQRA 4MQ9F 2W9CA 1GSAA 4MQVA 3R23A 2QQAA 2V1NA 2WAEA 3GZNB 2DT7B 4XKBA 3CO7C 2UVRA 1OYWA 1OPCA 2LDUA 3FBIB 2DK5A 2CGPA 1BNCA 4J9QA 1ITYA 5DQGA 1JE8A 2LD5A 2Q0OA 4DV1H 4IHJF 4HF2A 1YITI 2VBZA 4BDYA 1IGNA 1VQNI 3SDBA 2CUFA 2E7WA 2R7TA 1VZ0A 3OYAA 1J9IA 1MBFA 1FT9A 4Z6YA 3WTUC 2GLTA 2R7WA 5B66C 5F08A 3E0JB 1YO5C 4GFBA 1SFOA 2Y30A 5CVRA 3BQ1A 4LG0B 3GTGJ 2IA1A 5EZYF 2CS3A 3S93A 2ALZA 1B6AA 3BR3A 3HRTA 4XLCA 2MSYA 3S8PA 3LSPA 1F9NA 4IHVA 5IP9G 3RDIA 4GLXA 5FKNA 2NRAC 3OV8A 3R0AA 3DKWA 5GPAA 1MZBA 3K4MA 1IN8A 1YYVA 1IRGA 1W7PB 2ZMEC 2LREA 2MA3A 3DCFA 1ZREA 2WTFA 4KICA 1FBUA 3DEEA 1U9OA 3LSMA 4S04A 1S8NA 4ETSA 3R61A 4Q48A 5BPIA 2NVUB 4HNVA 2XF7A 3M7GA 5DCMB 3S17J 2HVQA 2HZDA 2VASA 3MR3A 3QYFA 4PJNA 2FLLA 5JHUA 2CW7A 4BXXJ 4BAYA 4RNNA 4Q4ZF 2GPSA 2ZFWA 4AD9A 2Z3YA 3S16J 4FBTA 2DA5A 3CCUI 5HODA 1Y1VA 2YZMA 4KT5C 1SANA 3T8TA 4XN0A 1VAJA 1A31A 5KFZA 1ZR2A 3DU6A 3G1OA 3MEXA 2XGPA 1FBQA 1FY7A 3E3VA 1VS0A 3H3UA 1DGRM 5KG4A 4ZYDA 5DG8A 3OL3A 2COBA 4MFDA 4U7CA 1MGTA 1XCBA 3C3WA 3Q8QB 2PG4A 5GADJ 5I47A 4IHTA 2QBYA 1S7AA 3QOEA 1JT0A 3GFLA 1LQ1A 3ZQ7A 4I01A 1DGWY 3BA9A 4A3DG 5ICFA 3KP3A 5BPHA 3CP2A 1BR1A 3TINA 2HYJA 5CVVA 4WXHA 1JT6A 3FHZA 1YTYA 2FU4A 2C28A 2E36A 4A93J 4XYMB 3C1DA 5CJ9A 4P9UA 3TP0A 2F5CA 1A6IA 1TA8A 2L3DA 4UUTA 4H4KC 2R85A 3K4LA 2JA8J 1XC5A 3GLLA 4CCLA 1ZH5A 4OIRF 4B48A 3I4MG 1IZ1A 2R7LA 3GFIA 2Y0SN 3JCUC 1ZAOA 3IN5A 1ZG5A 4LF7H 2QYZA 1ZRCA 4I50F 2YUSA 3DKXA 1SVOA 3VYSB 5JVLA 1FWZA 4A3FG 3K0LA 3CMEI 4XX0B 2A6TA 5TGTA 2DMNA 2V9PA 5FKMA 2EQRA 4A5MA 3OYCA 2JVGA 1X2MA 5HOOA 1UELB 3F6OA 2BHZA 4XL9A 5BNGA 4BQNA 5D8DA 3H1CA 2V1XA 5CA1F 4N9IA 4I4TF 4A3KJ 1K83A 3S3OA 1XTAA 3HUGA 3Q0WA 4F50A 2F5EA 4QWEA 2VB6A 5TJJA 3VOEA 2RDJA 4I55F 2F6CA 3J7AK 5K5QA 2EK5A 2VBYA 4A3MG 3CESA 1FJLA 3ZOBA 2JT1A 3ZQGA 5E18F 1T38A 3S1QJ 1N78A 4HNTA 2BVMA 2IGOA 3MQ0A 5K5OA 3BAAA 4JV0A 3PUBA 5F9NA 1VQ7I 4DR3H 5IYZF 2IS1A 3DPUA 1B6RA 4JI1H 4LITA 5ILSA 4IHXA 2JA5J 3HB9A 3CJRB 1ETXA 3DTKA 2VQGA 2IGKA 1KONA 4JI6H 3OUUA 2JEJA 3I56I 5C8YF 1WCMJ 1V3FA 1HSTA 1HKTA 4MA5A 1YG2A 2XAHA 4KJZA 2NVQJ 1Z7LA 3TBIA 4CUGA 5DS9A 5LFAA 4JBAA 1R9TA 4LF4H 3LL7A 5IWAH 1Z1DA 4Q47A 1RR8C 4BWSC 5GAEJ 2M8GX 5F0FA 4C3JJ 3G73A 4OWRB 1SCUB 1BR2A 3KEOA 1D1AA 2UVWA 2JA6G 4G9YA 4PSXA 2C22A 3D1NI 2M87A 5H6QA 2VUMG 3FMRA 4M9ZA 2DQLA 1XCVA 2QEXI 2XB5A 4A3LJ 2E1CA 2NU6B 3RAQA 1FMVA 3ZXSA 2Y69H 2KRCA 3V42A 2DDBA 2J9GA 2HYFA 3F8FA 1W1WE 3HC7A 1CF7A 3VWBA 4OIPF 5C5JA 3IC7A 2D2WA 1IV6A 3OYDA 3CVZA 3AG4H 3BJAA 1BOBA 4LB6B 1ZN2A 3OSFA 4QW9A 3G1MA 3L09A 4ECWA 2L54A 2VA3A 3JRGA 2RGRA 3MVPA 4QIWN 3F72A 2DPJA 4U88A 3H0GA 4L5EA 3BROA 2X51A 2VT2A 3CJQB 4R8HA 1GVDA 1TT0A 2UXNA 4H0EA 5IP6A 4IHYA 2WB1N 2TRTA 2CZGA 2R4GA 4IWXA 4LF5H 3K1NA 3JRWA 2J6SA 3EUHA 2E5ZA 3I4PA 2FQ3A 4CSWA 3FMSA 4DUYH 3SZPA 1I94H 1SEIA 4DW6A 3ZQCA 1TLHB 5CVUA 3L2CA 2MBFA 3PNYA 2KZGA 4XRSG 2HDWA 2UXCH 2B9SA 3CDLA 4XLFA 4B1RA 1WH7A 4X66H 5LOVF 4L0ZB 4UCUA 4WK8F 4HA8A 3TDUC 5FLXK 4F4XA 3OHAA 1BI0A 2CMPA 1K4SA 2XKPA 4BE2A 1XSXA 2DI3A 4MFEA 3MZHA 2X6OA 4C3HJ 1CS0A 3GTOA 4HOBA 4ZC3A 1XGOA 2BGCA 4C2TA 1HC8A 2OH2A 5KAFC 1QNTA 3L2VA 3P9KA 2GIZA 2LF7A 4UHTA 2W4SA 4OOIA 4AIDA 1O7LA 4A5NA 4BXXG 3I53A 2EJRA 1U78A 1PUFB 4ED6A 1TC3C 3DV8A 4UV9A 4DL7A 3LOCA 2EH3A 3QAHA 3F0CA 1ZHQA 3ZN0A 4EBDA 2VC0A 4WF2A 3NAUA 4JUZA 2JWTA 4L18B 1TQIA 3JAMZ 5EWGA 4DV5H 4IR9A 2QQBA 2XF6A 1MDMA 2Q2EB 3IRRA 4GXOA 3OWTA 2UXBH 4N4NB 1GSOA 1I6UA 2Y0SA 3RBDA 1XS9A 3N42B 4O4HF 2YU9J 1SAUA 2HTSA 2BY2A 2R5ZB 5ICEA 4HV5A 4DL3A 5FGMA 2NS8A 2UUCH 3N05A 3Q2OA 2XRNA 3T5HA 1ORKA 4BY7J 2QVOA 2IA6A 2DWCA 3LSGA 3M1CA 2IS6A 2R7MA 2M9HA 5K7HA 2XGDA 4G6TB 3F9KA 3BG9A 4RS8A 2R7QA 4UUSA 3MFIA 4A93G 1P92A 5D1OB 1SVMA 3G6YA 4X6AJ 3ABMH 4M9SA 4L9VA 1E3PA 2M2EA 4G12A 5DTDA 3WU0A 1ZHSA 2JA8G 2EINH 2ACJA 4ZZLA 2H6BA 1HOMA 3PSIA 2JA7J 5KG1A 3P9CA 3MZ8A 4KDPA 2E71A 2N8GA 4IKFA 4O3QA 4HPQA 2W7OA 4DV0H 2R8KA 3GTQA 5J47A 1G3WA 3PNTA 4O5VA 5M5YJ 1IG7A 4G6QA 2P5LC 2NVYJ 2FJ1A 1TQPA 2M3AA 3DU5A 3QRFF 4MV6A 3SE7A 5H2FC 5GAHJ 4JV5H 4I99C 2R93J 4JQFA 1RKWA 4LOCA 1I7LA 4AIKA 3S2WA 2RN7A 1EH8A 3KIOA 4PDKA 5LHGA 3CCSI 1GGOA 2HQNA 1YIOA 4A3KG 2LBFB 3WGIA 3B73A 4BXFA 1ZGWA 1YOVB 3CC4I 4R8UA 4C5AA 2WAQE 2K7LA 5FO5A 4MV9A 1WJBA 2A5WA 3GTPJ 2A07F 5IP7J 1O3SA 4X62H 4ZYEA 3OY9A 2RC4A 1GV2A 3CP8A 3MCZA 4EEFG 1Y14B 2VPQA 1J75A 5KFLA 2AU0A 3HHGA 3FM3A 3QPHA 2IGNA 1YRNB 2AGPA 3WODF 1Z21A 1S0NA 2RNGA 2Q2UA 5DUKA 4EFEA 2JA5G 3BWGA 4KA4A 4P9FA 3DBLB 1D8JA 5DCFA 1KU7A 1WCMG 4IJAA 3I9V2 4C5BA 3I12A 4QSHA 2CQ7A 2HOAA 2KRHA 1ON2A 1H88C 4DYQA 4ECSA 4CXFA 3C18A 2PFBA 4QIWA 4E6KG 2BVLA 5LMNH 1T0FC 4DR6H 4XMYA 1KYZA 5LRSA 1G6NA 2FPPB 3U9SA 2WB1A 3N6XA 2GWRA 3LP8A 4AIHA 4RLFA 3Q8SB 4B44A 5KFFA 3E1SA 5FB2A 4A0XA 2JVHA 5EEAA 4QWAA 1YS6A 1GHCA 4ITVA 1X1AA 2VKEA 2E19A 4U87A 4Y15A 1F4KA 4IRKA 4A3LG 2OA4A 1MBJA 2JMWA 4YBZB 3A0HC 3RPUA 2K4JA 2LVSA 5KFUA 3Q9SA 2DOAA 4BEHB 1B04A 4LF9H 3V7CA 1RESA 2VE8A 2JRMA 2QA4I 4M74A 2YRXA 5KCMA 2WAFA 5AIQA 1T2KA 1Y0NA 1BM9A 1TBXA 2PX9A 3KCCA 5DGAA 3ZMDA 2CSOA 3E5XA 2LK2A 3PFYA 2JUCA 3WTVC 4J19A 5IYCJ 1WWXA 4BJ5C 3S3NA 4RGRA 4BE0A 3K70D 1OCZH 3H5AA 3COAC 2FF4A 2E2IA 3CUQB 2CWEA
chains in the Genus database with same CATH topology
3GVAA 3TGNA 4OMYA 2P5VA 4LSXA 2EFPA 3AAFA 4YHHH 2BYVE 4FHTA 3J80K 1XMKA 2ELHA 1MJ9A 3SXYA 2O3FA 3E6DA 2QUFA 4JI4H 2DPDA 1XD7A 3KP6A 2P4WA 3LWFA 1DDNA 3LSTA 2G7HA 4DNCA 4APMA 1IAWA 2IT0A 2LKPA 4WWCA 1HR0H 4ESFA 2IP2A 3TKYA 5L3CA 2XVCA 4M72A 2ZO4A 3RKXA 1U5TA 5E1ZB 3TOBA 4JI0H 1OYYA 3P7NA 4B8XA 3C7JA 3T0YA 2PN6A 4AIJA 5LMUH 1HQCA 4DV4H 5KK1A 1HBXG 1B1BA 5FPOA 3C0FB 5CVJA 3FWEA 3IKTA 1VTNC 1H9TA 4AVPA 2FBIA 4CYDA 1T6SA 2KKOA 4EJTA 1LEAA 3CUQC 1HW5A 4ESJA 4LF8H 4EEQA 4YFNF 1HNZH 1LVAA 1ZGJA 2EFWA 1SMTA 4XLNF 1IBMH 1FNNA 3DF8A 4IVNA 2KJBA 2DBBA 4UCRA 4YY3H 1WQ2A 3CJNA 1XN7A 2DQRA 2P6TA 3DF7A 2AXLA 2LF8A 4WXDA 4R7RA 2XAGA 1QZYA 3V4GA 3QU3A 2VPSA 2HHHH 4G7HF 4L9NA 1Q1HA 2STWA 1XDSA 2ZMEA 1WH2A 1J59A 2YR2A 5ICGA 2Y0MA 3O6BB 2RNJA 2HVSA 3BY6A 4RAYA 1V9PA 3ROUA 1ODDA 1G3YA 1KGSA 2A68F 1TTYA 1PDNC 2GQQA 3ZP5A 1USSA 2EB7A 1XMAA 2M1BA 1L0OC 1PUEE 1TQMA 5ICCA 2XGXA 2FBHA 2ZMEB 4B3TH 5JFRA 3WG9A 3PQJA 5FLXZ 4GYGA 4HBLA 2E5LH 1BI3A 1FZPB 1DGSA 1QZZA 2KIMA 3E97A 2KRFA 3NQOA 4LG0A 2CYYA 3V7RA 3F23A 3BPVA 4HZFA 1D5VA 4PZJA 2MCTA 5D5XB 3U9GA 4ESBA 4GCVA 2IW5A 1B9NA 1W7PA 1WI9A 4KUMA 5DCMA 2FXAA 2Z9OA 5TRDA 3VB2A 2HEOA 2NNNA 1C0WA 2QWWA 4LSAA 2XIGA 2L4MA 5J8CA 3WTXC 1BC8C 1G4DA 4LB5A 2OQRA 4EMSA 4FX0A 2X4HA 1WKMA 3F6VA 1IF1A 4PGGA 4UXNA 1R36A 4ZYGA 1XDNA 4M6YA 1L2ZA 3O3KA 3JAMW 4LK0F 3D0SA 1F5TA 3DP7A 1KQ9A 3N43B 1BGWA 1FBSA 2M5WA 3GW2A 3TQNA 2FSWA 2Z5UA 4O6JA 3P9IA 2EFQA 2VODA 4XLPF 4CHUA 4A2UA 4KIGA 1XDUA 3E6MA 2G9WA 3QP5A 1JXSA 3KZZA 3H20A 2F4VH 2RDPA 1AWCA 3GX4X 1K6OA 1EV7A 4HV6A 1ONVA 4LLNA 2JSCA 1R23A 3HRUA 3L4KA 3ZMZA 1D8KA 2HFHA 2UUAH 3ZMVA 5K5RA 3JTHA 2WWYA 2PI0A 1XGSA 5JI6A 1U3EM 1HNWH 1HKSA 1HW2A 2OBPA 1J0RA 2W24A 4IF4A 2WE6A 1ZRDA 4Q0YA 4I98B 3R4KA 2UZKA 2A3SA 2XAJA 3K69A 2QYOA 2C6YA 1HNXH 5FFZA 4KMFA 1FPQA 3FF5A 2GA1A 1B59A 1GYFA 3N40P 3VEPA 4E70A 4BNCA 3J80Z 1R5GA 4GKJH 3L7WA 3PQKA 3O2PE 2L02A 4K0KH 2VQFH 1B9MA 2VC1A 4IHSA 5IT9K 1KYWA 2JZYA 1YW8A 1QO0D 4NB5A 2OZ6A 3BJOA 4XBFA 1FYMA 1R00A 4YIIA 4A6DA 2B0LA 1XMQH 4DR4H 1A04A 4EM2A 4A6EA 3BZ6A 4HAMA 2V9VA 2V6CA 2JPCA 1S29A 2YX4A 4LF6H 4M9XA 4ENJA 3M9AA 3LMLA 3T5XA 2O0YA 4DUZH 4RGUA 2VQEH 1SFEA 4D0PA 3RPQA 1IXRC 1BI1A 3JSNA 3EDPA 4WXCA 4IAJA 3B02A 4DR5H 2M8EA 2DW4A 1REPC 4CDGA 2OWOA 5BR8H 4OMZA 3M8FA 2YX7A 1K79A 2Q2EA 3HTSB 4HQEA 3VFZA 3NEUA 1T0FA 4XSZF 1X9NA 4LJZF 1O57A 2VBXA 3RYRA 3HYIA 4LMYA 4BHPA 1LNWA 4MTEA 2A5YB 3CDHA 4I7HA 2GIVA 1YW7A 5D1OA 3ECHA 1PP8F 3ZMTA 4OIOF 2ZJ2A 2WV0A 1IN5A 3ZN1A 1UHMA 4TV7A 4HLXA 4ZZDA 3U1DA 1IN6A 3IRQA 4LK1F 2XROA 1FVIA 4R79A 4OIQF 1FKAH 3T1HH 3GFJA 2DO7A 5HDKA 1K7AA 3CTAA 2Q2TA 2RQPA 3JTGA 4LD5A 5LBQA 2WYOA 2VN2A 4X65H 2ZNYA 3DPLC 3HSRA 4R1HA 4ENNA 2VONA 4WX9A 4U0YA 4Q5SF 1E17A 2NAZA 1S68A 2XAQA 1KA8A 1KU9A 4RB2C 3KP5A 1QGPA 5LGUA 2L4AA 2D1VA 2DLLA 5A2QK 4JK1X 1JHHA 2DFIA 4A0ZA 1XSVA 3R0JA 3QOPA 2OU2A 3BA8A 1IN7A 2O03A 2UXXA 3CUOA 2VE9A 3ZPLA 5ILUA 1O3RA 1O7FA 2FNPA 3PFIA 4XSXF 4ZYHA 5ERIA 3N97A 3KEQA 5E1XA 2PLYA 1E2XA 4IRIA 3KETA 3MFKA 5CLSA 5D6FA 1JHFA 4CO8A 1ULYA 3KP7A 2XASA 2VT3A 2XV4S 1BOAA 5D4RA 1ZARA 1FOKA 1IBLH 2UU9H 2ISYA 1IXSB 2IVMA 2R3SA 5IT3A 5F1RA 3CUQA 4RB3C 1U2WA 3DFGA 3L2PA 5FLXW 3ABTA 1PP7U 2HOEA 4BXUA 1CGPA 2ZKZA 5EEGA 4UFZA 3GWZA 4EFBA 2F5DA 4NXNH 2HDCA 2CO5A 3L9FA 3GLXA 2P7VB 2L01A 3E6BA 2FRHA 2BE5F 1YS7A 3RTRA 2PJPA 4A2BA 1S3JA 4HX4A 3BOQA 2E1NA 4MEYF 2HWVA 1MJBA 2FA5A 2MD5A 3OOPA 5DUIA 1BJTA 5LHHA 4B09A 3DXJF 1DPUA 3KAJA 1KQ0A 3L4JA 3DEUA 2QM3A 4UCOA 4EJVA 2VXZA 2K02A 2K86A 1QQIA 2RV8A 4L9TA 4CZZA 4BHBA 4JI8H 1S03G 2UWMA 4MHGA 3HSEA 1H9GA 3FXRA 3GYHX 1ZRFA 1BIBA 1IRFA 1USTA 2W25A 3EYYA 1LEBA 1RUOA 2OQGA 4ENMA 1V4RA 1TAEA 2IA0A 1LDDA 2O61A 3MAJA 3ML6A 5E20A 3JW4A 2MH9A 3L00A 1G3TA 3RJ0A 3QU6A 3I59B 1K78B 2YSRA 4LGWA 3J81K 3N4MA 1LB2A 5FD5A 2R7FA 5D8KB 2TDXA 3ZMSA 3IWFA 1HSJA 5LLQA 4RAZA 2P6SA 5BPDA 5ILVA 1QBJA 1XMOH 1FP2A 1FX7A 3KP2A 4BHCA 1UB9A 4FX4A 1B4AA 5H6RA 3JSPA 3F21A 2A61A 5F6FA 4M73A 5IT9Z 2ZCWA 3GXOA 4RB1A 2P5KA 2PQ8A 4JI3H 5L3FA 4B3RH 4B3MH 2M30A 1W5SA 5J8FA 3N41B 3TO7A 3K1MA 5L3BA 4UUVA 3WTSC 2JRTA 4I0BA 3KAKA 1FP1D 4HF0A 1S6LA 1XB4A 3HSFA 1KQ8A 1Z91A 2K4BA 4ASNA 4HX7A 3KFWX 2R7DA 5D8LB 5E8IA 1DPRA 4LLGF 4JYAH 1N34H 3J80W 3RF2A 5D1PA 1HKQA 3I54A 5CVIA 1BC7C 1N33H 3K3VA 5DD4A 4I09A 1TW3A 2PBIA 5D6EA 2RKHA 3TDZC 5HS9A 3K9TA 1IW7F 4EGZA 2CW0F 1UHWA 5LGNA 4GGGA 4UCTA 5DV5A 5E8GA 1Z2PX 4EM0B 4HLYA 4G8XA 3F8MA 1I1SA 2ESHA 3BJ6A 1LDKB 3R6SA 2H94A 5D5WB 1WRJA 1Z6TA 1T98A 1W5TA 2STTA 4UCSA 2D45A 1TW2A 2CQKA 1L3LA 1ON1A 4PDBA 4I0AA 2FNAA 4A12A 1J5YA 4G94A 1NHAA 3WE3A 1GXQA 5JVTA 4JI5H 1R5HA 2M45A 2H27A 3QP6A 5HS7A 4LFBH 4CC5A 5E17F 3BABA 4HF1A 4DR2H 1HXDA 1P4AA 3ERED 3RIRA 2EWNA 5ED4A 5A2QZ 4I02A 2EFOA 3EYIA 2FMYA 1MKMA 4LFCH 4N9HA 1YQAA 2HVRA 4P55A 1J7KA 2IA2A 3LA2A 3FXQA 3KXYT 1SD6A 1OMIA 3RIZA 2UXDH 4X64H 4OX9H 4Y13A 5FFXA 5LL6b 2J5PA 3F8CA 4KHPH 2ZXJA 1RIOH 1P8LA 2F2EA 3FZVA 2QLZA 4GO1A 4NHJA 3BP8A 3W6KB 2YPRA 4QLCU 5J6XA 4Z2YA 2UUBH 4OU0A 4L5IA 4YG2F 1KU3A 3DPTA 5HLGA 3IG0A 2WTEA 5HDGA 2Y75A 1N32H 1EH7A 4RGSA 2MH2A 5F64A 1R22A 3FMAA 2CFXA 2QZ8A 2NNYA 4EV0A 2RGVA 2F5FA 3FMQA 2GZWA 3FX3A 5H20A 4BQAA 1F1ZA 3HRMA 4AQYH 2WDTA 1DP7P 2BV6A 1S7OA 3I64A 3K2ZA 3KALA 1FJGH 2ESNA 4DQ2A 3RGZA 2EA2A 1AN7A 1O3TA 1P2FA 1W7PD 3KE2A 1FLIA 1R1VA 4DV7H 2GAUA 2H6CA 2NYXA 4KIFA 4KN4X 1YFHA 4DV6H 5DEQA 3HOTA 3GF2A 4HW0A 4P96A 1M0TA 1ZG3A 3T1YH 3G3ZA 2Y48A 1QPMA 2ZJTA 3UQ8A 3GZ6A 4G6DA 2OD5A 2A6EF 2P8TA 2QBYB 4I2OA 4YFXF 1XNRH 2XKOA 1Z2OX 2HGSA 3V7SA 3JSLA 3PN1A 3LAJA 1R1TA 3HRSA 5HDNA 1R1UA 2HZTA 1JGSA 1XGMA 4EGYA 4LFUA 1XNQH 1STZA 2YCHA 2JTVA 5DD8A 4HYEA 4M6XA 5HLIA 2IJLA 1YLFA 3RKYA 2O8XA 4HQMA 4P5OA 1FSEA 5BOXA 1RNLA 3R60A 5D4SA 1BJAA 3J81Z 4BYYA 4LH6A 4MV7A 1M0WA 2WC2A 1ZG1A 4LLLA 1SD5A 3HHHA 2FBKA 3KZYA 2CW8A 1MD0A 5BQTA 1TNSA 1P6RA 2FE3A 1Z9CA 1Y0UA 1SD4A 4QWQA 3RI4A 2YU3A 3HXLA 2JPBA 3GEZA 2DAOA 2Z33A 1LDJA 4L0YB 4YFKF 3BDDA 3GFMA 3IL2A 3Q9VA 3RJPA 5L3EA 3WE2A 2BEOA 3SZTA 1I6XA 4XRFA 1ZGAA 4N0BA 3GUDA 3ZMUA 1BN5A 5D5UB 2O6GE 2GXBA 5L3GA 3WTWC 3I5UA 4MGRA 4KYWA 1MJAA 3WTYC 1KU2A 4LFAH 5LHIA 4CICA 3F3XA 1CF7B 1FYLA 2QQ9A 4KN7X 4EVIA 3I58A