4RB0A

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-apo-fur
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 40
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb0A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb0A02
3BPXA 3WTWC 3HUGA 4OOIA 1RZ4A 4EVIA 3VB2A 5D4SA 1OYYA 2LNBA 3QAHA 2F5CA 2DPDA 1ZLJA 2DLLA 4NHJA 3CTAA 4A0ZA 1QO0D 3HSEA 4MHGA 2Z3YA 3SZPA 3WGHA 5F64A 2A68F 2VN2A 3ZMSA 1T0FA 5FLXZ 3ABTA 2ZXJA 4AIJA 2JT1A 2ZKZA 3DF8A 4KN4X 4O5VA 4BNCA 2XAQA 3F6OA 4BYYA 1D5VA 4I0BA 2YX7A 4I0AA 4P9UA 2L54A 2ETHA 3KZYA 1BM9A 1ZH5A 3PFIA 2CFXA 3WU0A 4M72A 4UV9A 3MCZA 2X0LA 2Y48A 1TNSA 1FBQA 2LF8A 5TJJA 4MGRA 3F72A 5J6XA 3L7WA 2NNYA 4LLGF 1IXCA 1TQIA 5E1WA 2VODA 2Q2EA 3M8FA 1HSJA 2PBIA 5E8GA 2E1CA 5A2QK 3KP5A 1MDMA 3VOEA 4M6YA 1U5TA 2V79A 3AAFA 5KK1A 3L09A 4ZYDA 1DDNA 2QLZA 2XKOA 3PQJA 3ZN0A 5E1ZB 4RB1A 1BN5A 1IF1A 1L0OC 1ZRFA 4JK1X 4CHUA 5FLXK 3O2PE 1KQ0A 4L9TA 2D45A 4IPAA 3DKWA 4ZH4F 2DO7A 2M1BA 4UVBA 4Y17A 3D5LA 3KP3A 2L3DA 4A2UA 2LSOA 1RUNA 4A0XA 5HLHA 5LHGA 1PUEE 1YQAA 3ZMTA 1SD6A 1LVAA 4YFKF 1R1UA 3FX3A 3JTHA 2WTEA 3F8BA 3KP4A 1W7PB 3CO6C 1YS7A 5D5XB 3K9TA 2MBFA 3E6MA 4A6DA 2ZBKA 2HZTA 3JW4A 2EFWA 4MTEA 3RDIA 1AWCA 1FZPB 4OINF 2FE3A 3E5XA 5LLQA 4UVCA 4MEXF 1S7AA 2P6TA 1R00A 4GCVA 3T1BA 3HRSA 1OR7A 4L9JA 4HF0A 2D2WA 2CGPA 1XDSA 3QRFF 2O6GE 2XVCA 4L0YB 4LG0A 1ZGJA 4S05A 2R7FA 2Z9OA 2W25A 1IN8A 4YIIA 4M71A 1EV7A 2A6HF 4KIBA 5CVJA 2FA5A 1QQIA 3HTUA 1R5HA 3GYHX 1IUYA 1J9IA 2IA2A 1F4KA 1FSHA 3H3ZA 3RYRA 5CVUA 1SD5A 2EFPA 1FPQA 6PAXA 3GUDA 5FD5A 3KP2A 3WTTC 2IJLA 1GVJA 5LGTA 3BJOA 4EM2A 4EJVA 1JHHA 4BHPA 1B6AA 5DD4A 2RV8A 2WC2A 4ENNA 3FMSA 1V3FA 2HOEA 2O61A 4FX4A 1YS6A 3EYIA 5FGMA 2K02A 2R3SA 4Q47A 2BEOA 2HDCA 2EV0A 1BI0A 4HA8A 1DP7P 1W5TA 5LGNA 2XROA 1SD4A 4I02A 1LDJA 1WWXA 4M9XA 1MGTA 2TDXA 4EGYA 4AD9A 4L9VA 5K5RA 1UHMA 2EB7A 2VONA 4ON0A 4Q4ZF 2M5WA 1ZREA 5HDGA 5LHIA 4I2OA 2OQGA 1OMIA 2H09A 1TTYA 2W85A 2PMUA 3SQNA 2JPCA 5LRSA 2V1XA 3HSRA 3CO7C 3IWFA 4WWCA 3C18A 4G7ZF 3ZN1A 3G3ZA 4CYDA 3WG9A 4CO8A 1I27A 2PI0A 3GO5A 5L3FA 1R23A 4HYEA 1XCVA 1D3YA 5ICGA 2HKOA 2DTRA 3HSFA 4I7HA 1IN5A 2MLKA 4FX0A 3MZYA 2QBYB 1WI9A 3T0YA 2OA4A 3RKXA 3KFWX 4YFXF 5E8IA 5DDGA 3I71A 3WGGA 5DUIA 3O6BB 5H6RA 3GEZA 1WRJA 3I0TA 1YW7A 3T8RA 1FBUA 3JSPA 3L9FA 5LEKA 3SXYA 3CLOA 1T2KA 2KIFA 2PJPA 2VE8A 4BXUA 1V4RA 3EDPA 4KDPA 2RQPA 2ZNZA 2JSCA 5L3EA 4XRFA 2QYOA 3BDDA 4M9SA 4MQVA 2Y0MA 2STWA 2AS5F 4LK1F 2W84A 2ISYA 2BV6A 2GWRA 2OD5A 3WTVC 2R7DA 4GYIA 4G6DA 3HHHA 2JTVA 2LDUA 1FC3A 1BJAA 3FF5A 3BPVA 5IT3A 2OU2A 4HQEA 1SFUA 1IZ1A 2L02A 2VE9A 4ESJA 1E2XA 1B1BA 1YW8A 1B4AA 2RN7A 2EJRA 3RTRA 3WODF 3RPQA 1P92A 3ZP5A 1KU2A 2DPUA 2STTA 1ZG5A 5DUKA 3F21A 5ICEA 1T6SA 2FQ3A 2J5OA 3QU6A 1O3RA 4IJAA 3V7SA 4YG2F 5HS7A 1B59A 1ULYA 2EFNA 1W4MA 3TDUC 1LB2A 4LLLA 2QQ9A 1STZA 1WSUA 2W24A 2NYXA 2F5FA 1MD0A 3GX4X 3I4PA 2L01A 3MZHA 1YTYA 5L3GA 3K1NA 1ON1A 3R60A 3IHUA 4KMUX 3I59B 2G7UA 4HZFA 4MEYF 1JHFA 4TV7A 5BOXA 2DI3A 4NB5A 3LWFA 2XAJA 3GFJA 2QVOA 1MKMA 5D8KB 2ZJ2A 3ZPLA 4HX4A 1KA8A 3L2CA 3CUQC 3K0LA 3E5QA 1USSA 2VT2A 2HYGD 2FRHA 2LF7A 4GO1A 1IAWA 1HQCA 1G4DA 3ML6A 5JFRA 1X3UA 2XAHA 3GFMA 1BC8C 4DNCA 2XAFA 3LA2A 2XIGA 3OV8A 4GYGA 2H6CA 3TDZC 3I54A 3LSTA 4AWXB 4F7ZA 1Z1DA 4I01A 1BC7C 3BY6A 3CUQB 2HTJA 1FYKA 4Z2YA 4GXOA 1HKSA 4IHSA 4M74A 2FNPA 1VTNC 4KICA 3R0AA 1EH7A 2EFOA 3FMQA 3WTYC 3QU3A 1HKQA 3JTGA 2VBZA 3BJ6A 3WTZA 3FXUA 5LEJA 3IL2A 2KJCA 5DEQA 4KIGA 4A12A 3ZMUA 3CUQA 1IRGA 3H92A 3FXRA 3KEQA 4KN7X 1YFHA 2OBPA 5CYVA 4U0WA 4BQAA 1FSEA 1F5TA 2F2EA 3P9CA 2P5LC 2P8TA 3K69A 2WV0A 3BOQA 4R1HA 2UXXA 3BP8A 1D8JA 2DQRA 4ENKA 3TQNA 2NNNA 2ZMEB 1PDNC 3GZ5A 2A3SA 5F6FA 3V8LA 1J2XA 2FBIA 4LGWA 4PGGA 1YG2A 4XSXF 2ADUA 4GGGA 2OZUA 1J5YA 4FHTA 3I59A 1QZYA 2QQAA 4G7HF 4O6JA 1R58A 3KETA 3DPTA 4EMSA 2HFHA 4N9IA 1GXPA 4A0YA 2F5DA 1NHAA 2ESNA 3DXJF 4RGSA 5HDNA 3MQ0A 2QZ8A 1G3YA 5ERIA 1FT9A 3HRUA 1UCRA 1U78A 5H20A 1JE8A 2J5PA 1FX7A 4QLCU 3C7JA 3ISPA 1ZAOA 1KQ9A 4OMZA 1U8RA 2RVCA 2OQRA 2IRFG 4HF2A 2VBWA 4IRHA 2XV4S 3R61A 1LQ1A 4RB2C 1AOYA 1G3TA 3E6DA 2NAZA 2YX4A 4B8XA 3VODA 4CICA 3I53A 4HX7A 2LKPA 2CQKA 3KEOA 4Y15A 3F3XA 1K78A 3KP7A 1GXQA 3FHZA 2EV6A 5E18F 1BBYA 5FD6A 1P6RA 2HQNA 3WGIA 2A61A 2GAUA 1J59A 2CG4A 1LDDA 2EFQA 4U7BA 3F8NA 2XASA 2JZYA 3N4MA 4HX8A 3NQOA 5ILVA 1S7OA 4IF4A 5DD8A 3F23A 2DT5A 3O3KA 5D5VB 2EA2A 2VBXA 3LFKA 4RAYA 2RKHA 1XB4A 3M7GA 2EV5A 2HYFA 2BBYA 5CVRA 1SAXA 2QWWA 1XMAA 4LFUA 3LAJA 3QOPA 4M6XA 2PN6A 2P7CB 1YLFA 1SD7A 2BGCA 1CF7A 4HAMA 1O3SA 1OPCA 5TRDA 1T38A 1HW5A 2GXBA 4ESBA 1QBJA 4OIPF 1HBXG 3KZZA 3ROUA 1JXSA 1IN6A 5K5QA 4JQFA 3TO7A 4IRIA 1FBSA 5ICCA 2FXAA 1XGOA 4PCQA 2A69F 3TKYA 2VXZA 1RIOH 1TBXA 2XHKA 1R22A 3FZVA 5HDKA 2HWVA 3QPHA 5ILSA 2CW0F 1FYLA 1R5GA 4UXNA 2VOOA 3ZMDA 5CLSA 2XKPA 1DPRA 4XSZF 4E70A 3TOAA 4ZYHA 4OU0A 2PEXA 2XGXA 4EJUA 4UNOA 1ON2A 1Z91A 3MFKA 4ENMA 1HXDA 1XSDA 2FF4A 2HKXA 2KIMA 5BMZA 3DQVC 3LA3A 4UV8A 1ODDA 4A6EA 1TQMA 3C3WA 4NQWA 4HBLA 1RNLA 4LB6B 4AVPA 4HW0A 1W5SA 4G6QA 1XGSA 3WU1B 5D8LB 3H3UA 1EH8A 4OIQF 4YIFA 1B9NA 1MJAA 2FOKA 4RB3C 4I09A 2V1DA 2GIVA 2K27A 1QNTA 1WQ2A 1E17A 1CGPA 2P7VB 4KT5C 4OMYA 1S29A 3I64A 1BIBA 5FB2A 2QM3A 2DK8A 4ZYEA 4U0VA 3M9AA 1LJ9A 4WXDA 1LEAA 4G7OF 2IA1A 1Z6TA 3LQQA 4XLPF 5D4RA 2VOPA 3ERED 5ICFA 5FO5A 3F8CA 2ESHA 4HQMA 3E6CC 4LK0F 2UXNA 3MEXA 4RS8A 2MH9A 4MQ9F 1XDUA 4MTDA 2ZMEA 4PDKA 4BH9A 4QWQA 4PGHA 1WKMA 2G7HA 2MH2A 3U9GA 1Z6RA 1FYMA 4CGZA 3RPUA 4ZZDA 5DCMA 1ZG1A 2Y75A 5HLGA 1SMTA 1OYWA 3LA7A 1IN4A 2EWNA 1H9TA 3WE3A 2K7LA 3LAPA 3GFLA 3U1DA 3B02A 1S3JA 3R4KA 2XUBA 2BE5F 1QPMA 4ETSA 3P7NA 3W6KB 5JI6A 1ZRCA 2PMHA 2L4AA 3S2WA 5HS8A 1UFMA 3R0JA 5JR3A 4K2EA 5HOOA 1S6LA 4H0EA 3JAMK 4D0PA 4P96A 2ZNYA 4EV0A 3EQLF 5LHHA 1BOAA 3KLOA 2E1NA 1IXRC 3HYIA 5CVIA 4CZZA 1U2WA 1FY7A 3V7RA 4RGUA 3D0SA 2ELHA 1O7LA 3ZMVA 2Z33A 3VFZA 1FP2A 2MD5A 2Z99A 2IVMA 1H0MA 1P4WA 4P5OA 1TLHB 1MJBA 1REPC 2IT0A 3CUOA 3RIRA 4EM0B 1D8KA 3FMRA 3GW2A 2KIUA 1A04A 4IXAA 2DK5A 3WTSC 1O7FA 4IHTA 1SFEA 4EJOA 2MC3A 3K1MA 1JGSA 1MDMB 4ZZLA 4XBFA 4IRGA 4LLNA 2C6YA 4P55A 3TO9A 3HOTA 4HV6A 4WXHA 1ZN2A 2F5EA 3HRMA 3ULQB 3MWMA 5F1RA 1Z7UA 1QZZA 2QQBA 5K5OA 3I58A 3JAMZ 2FBKA 1IN7A 5L3CA 2Z5UA 3Q9SA 4KNYA 1XN7A 1LEBA 3RKWA 1P4XA 5AIPA 4A5MA 1TQPA 5EEGA 3DPLC 3GF2A 5BPDA 3E6BA 5D6FA 3IWZA 3JSOA 2Q0OA 2M30A 5DCFA 2M45A 2EA4A 3FXQA 3V8KA 4WX9A 2O0YA 2BYVE 2KJBA 5FFZA 1GHCA 2DAOA 5JVTA 2MLGA 3KE2A 3BROA 1KGSA 2FMYA 2YR2A 4WF2A 3SFZA 1OKRA 1T98A 4UHTA 5EEHA 1P2FA 2RDPA 3OOPA 2NRAC 1UHWA 1LNWA 1HSTA 2FSWA 5HLIA 4LB5A 3GLXA 5D5UB 2V1UA 2ZFWA 1U3EM 4DQ2A 2E7WA 4YFNF 1FOKA 5DYMA 1BI3A 4FT8A 1B9MA 2FEZA 1ZLKA 2IW5A 3ELKA 2XRNA 4MNUA 4AIKA 1YO5C 1Z9CA 3SHFA 1RUOA 1YW9A 2A07F 2V6CA 1ZARA 5KVRA 1ZYRF 1KU9A 2UZKA 4LG0B 1IXSB 1ZGAA 2CO5A 5L3DA 4L5JA 4BAYA 3J80K 3GVAA 2PLYA 3IKVA 2X4HA 4IVNA 3TO6A 4B09A 2DW4A 1BIAA 2L4MA 3IC7A 1DUXC 2P4WA 3HHGA 1Z05A 3F8MA 3KCCA 5E17F 3I5UA 2G9WA 3DFGA 1I1SA 1R36A 4RAZA 2RC4A 2W57A 3REOA 2GZWA 2RGVA 1H9GA 3W6JB 2IA0A 1MZBA 3QPTA 3NEUA 3KLNA 4AIHA 5IT9K 4KFCA 2VBYA 1HW1A 4G94A 2GQQA 2A5YB 2P5KA 3IRRA 1TW3A 5E1XA 2PG4A 1J75A 3R6SA 3MAJA 2HR3A 2H94A 1S8NA 3K2ZA 3IKTA 3GZ6A 4R8HA 3WTUC 5HVQC 3GWZA 2VC0A 1R1TA 4S04A 1CF7B 3QP5A 3G73A 3HTSB 1YIOA 3J80Z 2COMA 5D6EA 1XSXA 2K4BA 3E3VA 3BJAA 4ESFA 3ABUA 4P9FA 3GXOA 5CJ9A 3B73A 2ZCWA 4CDGA 3P9KA 3VEPA 1K79A 5JHUA 1USTA 4HV5A 4BHCA 3V4GA 5CVVA 3TOBA 4EQQA 5LBQA 5LGUA 3CJNA 4WXCA 3Q9VA 2DBBA 1DPUA 3U2RA 5IT9Z 5BQTA 2VT3A 5FFXA 1FLIA 3HRTA 2KKOA 1W7PA 2GXGA 2M87A 4ZYGA 2YSRA 3EETA 4HOBA 1K7AA 4EJTA 1G3SA 1U5TC 1IRFA 1HW2A 2DFIA 4Y13A 2A6EF 5J8CA 4KUMA 1K6OA 2H6BA 3WTXC 2XAGA 2QUFA 4LJZF 1J7KA 2ISZA 3NRVA 4I98B 2IP2A 1BI2A 3N97A 4O3MA 4PZJA 3F22A 3CDHA 2JRTA 5HS9A 3Q5FA 4Q5SF 3PQKA 1SMYF 5BPIA 2HTSA 1F9NA 2D1HA 4R79A 2PFBA 4L9NA 1XSVA 2FBHA 2OAZA 2CYYA 1TW2A 2O03A 3EYYA 1O3QA 3F6VA 3M1EA 4Q48A 1U6GA 5J8FA 1U5TB 1MJ9A 3V8JA 2M8EA 3L00A 4OIOF 4UVAA 2K86A 3HIFA 3J7AO 2V9VA 3V7CA 3J81Z 4RGRA 3FM5A 2VC1A 4N0BA 2ACJA 1Q1HA 2K4JA 2CSOA 3M8EA 1RI7A 1XGNA 1OYIA 1W7PD 4HF1A 2B0LA 2HQRA 4LMYA 1I6XA 2JPBA 3C1DA 3ZQ7A 3SZTA 4HLYA 5H6QA 3LQRA 1G6NA 4KMFA 1R1VA 3F8FA 1PP8F 5L3BA 1PP7U 3EUHA 2GA2A 4WCGA 1F1ZA 1ZRDA 4OIRF 2WWYA 3E97A 3KP6A 2DU9A 5DCMB 1P4AA 4KA4A 5E20A 2RNJA 3DV8A 2P6SA 3TGNA 4EGZA 2UWMA 3T8TA 2Q8KA 2HS5A 3ECHA 1ONVA 1IW7F 2O8XA 1HKTA 2YPRA 3FWEA 2MA3A 4L5IA 4G8XA 1O57A 5LRRA 3J81K 1BI1A 2PQ8A 4RGXA 3GFIA 4KIFA 3ECOA 3RJPA 1SFXA 2FU4A 5A2QZ 3IRQA 3E5UA 2DQLA 3COAC 5ED4A 3ZMZA 3BWGA 1KU3A 5AONA 4G9YA 2O3FA 4EM1A 5BS6A 1XMKA 4UUVA 1XD7A 1L3LA 4HDVA 1XGMA 2FNAA 4EJWA 2QBYA 3WE2A 4N9HA 4U0YA 4HDUA 1EH6A 2CWEA 1T39A 3QP6A 3RKYA 1KU7A 5K1YA 1ZG3A 4WK8F 1FNNA 1ZHFA 3T5XA 1K78B 4M9ZA 1FP1D 2KRFA 4BHBA 5D5WB 3K1PA 1C0WA 1G3WA 4KYWA 2EK5A 2IPQX 5AIQA 1I5ZA 2AXLA 4ENJA 3P9IA 4L0ZB 2HEOA 1KYZA 1J0RA 3RI4A 2NS0A 3DEUA 4U88A 2FMLA 1LDKB 2P5VA 3DP7A 3BZ6A 3RYPA 1KYWA 1R7JA 1I1GA 4HLXA 2GA1A 2YU3A 4CXFA 4M73A 5ILUA 4L18B 4A5NA 2OZ6A 2E7XA 3FM3A 2HGCA 1Y0UA 4LD5A 1KQ8A 5DV5A 1O3TA 1UB9A 2ZO4A 2D1VA 1XCBA 1TNTA 3HOSA 4U7DA 4JBAA 1QGPA 4RB0A 1YYVA 2H27A 4ASNA 1FWZA 2QENA 4XLNF
chains in the Genus database with same CATH superfamily
1Y1VJ 1RYSA 4B4CA 4PJ0C 2XGDA 3BPXA 3CD6I 3WTWC 5KT7A 3HUGA 4OOIA 4XYLB 5KCMA 5EZYF 5CA0F 1AN7A 1KJQA 3S15J 3SJMA 1RZ4A 4EVIA 4AUXA 3VB2A 5D4SA 3OS0A 2HOTA 1MIJA 1OYYA 2LNBA 2L2OA 2M7BA 3H5AA 3BQZA 4L5EA 4XLFA 3QAHA 2IBDA 2WBMA 2F5CA 4NDLA 3G6EI 1YITI 5J1YA 4NC6A 2DPDA 2ECCA 1JI8A 1ZLJA 2JEGA 2CUJA 2WA0A 4IZOA 2DLLA 3U1KA 4NHJA 3CTAA 3QPSA 1V5GA 2F6CA 2L9VA 1VZ0A 4A0ZA 1M6VA 1QO0D 3HSEA 1MH3A 1JKOC 1TZLA 2FP4B 1Z7LA 4MHGA 1OFCX 3BR6A 5KFHA 2Z3YA 3SZPA 3WGHA 2I80A 4X66H 3HOVG 5H2FC 5F64A 2A68F 1VF9A 4B3RH 3WO0A 1Y1VA 2VN2A 3ZMSA 5KFLA 2NVXA 4JI5H 1XNRH 3MR5A 5IYZF 3RBEA 1T0FA 3GCMA 2LRDA 1N75A 4BL0B 3RUPA 3PW4A 5FLXZ 3LMMA 5DGBA 2YZNA 3ABTA 1ZHSA 2ZXJA 4AIJA 2AHQA 2JT1A 2VKEA 2ZKZA 3HOYG 3DF8A 4KN4X 2E36A 2QQ8A 4O5VA 3HOZJ 2E60A 3OWTA 4BNCA 3PO2J 2XAQA 3F6OA 4PJNA 4BYYA 1D5VA 2W8LA 4I0BA 2YX7A 3CF2A 2RNGA 2V9PA 4I0AA 1P7IA 2CV0A 1XG1A 4DUZH 4P9UA 2L54A 2ZSIB 1S0OA 2ETHA 4F4XA 4EGJA 3PNYA 3KZYA 4BY7G 1BM9A 5J4VA 5JVLA 1ZH5A 3OUZA 5KFPA 4QSHA 3PFIA 2CFXA 2K40A 5D1OA 3WU0A 4DOZA 3AL0C 4M72A 3VMMA 1T95A 4UV9A 3S32A 1FKAH 4EATA 3MCZA 3TP3A 1W93A 2X0LA 4JI0H 1K1SA 2Y48A 1TNSA 4Y4RA 1FBQA 3PR5B 2LF8A 3BAAA 5TJJA 3VYTB 2GPWA 5KFZA 4MGRA 3F72A 5J6XA 1HNXH 5B66C 3L7WA 2NNYA 4LLGF 1IXCA 1TQIA 5E1WA 4A3IJ 3RZDJ 2VODA 2Q2EA 3M8FA 1MMNA 3I4NJ 3MJFA 1HSJA 2PBIA 5E8GA 2E1CA 1Z0XA 2ZFUA 5A2QK 4A3GG 2MD0A 3S1QJ 4AQYH 1FOWA 2OC6A 4PUSA 2HOAA 4I99C 5FLMJ 4XM3A 4APMA 4FBTA 3KP5A 1MDMA 4ECZA 3VOEA 1U9NA 1YE9A 4BJ6C 1B72A 1HDDC 4M6YA 4NC7A 4E7HA 1IUFA 1U5TA 2V79A 5IOZA 3AAFA 5KK1A 4O4HF 4YR3A 1XTAA 3L09A 5KG1A 4F91B 3DTIA 1BW6A 4ZYDA 2WTFA 1DDNA 3BCBA 2QLZA 5B5EC 1Z2NX 2XKOA 3KZIC 1MBHA 3L2VA 1MBFA 3HPHA 5J1RA 4E7LA 2YZGA 1S9HA 1JX4A 3PQJA 2L7ZA 2VI6A 3ZN0A 5E1ZB 4RB1A 3TIIA 1BN5A 5KFAA 2LVSA 2Q2TA 1IF1A 1L0OC 1ZRFA 4DYCA 2NU7B 3OL3A 4JK1X 4CHUA 4HQ6A 5FLXK 2IS4A 4PWQA 3O2PE 1KQ0A 4L9TA 2HVQA 1N32H 5GAGJ 4XQFA 2D45A 3LSKA 1ZR4A 1WJAA 4IPAA 3KHLA 3DKWA 4ZH4F 2DO7A 2K9MA 2M1BA 2XD4A 2VQCA 4UVBA 4HNTA 9ANTA 1EA3A 4Y17A 3D5LA 3KP3A 2PJRB 5FLMG 2NU8B 1HDPA 2E34A 2L3DA 5FKKA 3FXKA 2E19A 1BJZA 4DV6H 4A2UA 2LSOA 3JRBA 1RUNA 2FPGB 1OLTA 4A0XA 3JRAA 5HLHA 5LHGA 1PUEE 4YBZB 3TINA 4Y3OA 1KJIA 4GC6A 1YQAA 3CMAI 1N25A 2DIKA 3ZMTA 3OHAA 1SD6A 2EQRA 3KEYA 2CW8A 2DA6A 5HV6A 4XN3A 3K4MA 4DYQA 3QODA 4EEFG 2W70A 3N43B 1LVAA 4YFKF 1UNNC 3T1HH 3TMOA 4DBRA 1IC8A 4ED0A 3PL8A 4O3OA 1E4EA 3RB6A 1R1UA 1DU6A 3FX3A 3HKZN 3JTHA 2WTEA 1OCOH 2WB1N 3F8BA 4ZYAA 4A3BJ 1I6HJ 3MKLA 3PIOF 3KP4A 4E7JA 4UUSA 1W7PB 4QPQA 3CO6C 4Q45A 4KHPH 1YS7A 5D5XB 3K9TA 3RIZA 2MBFA 3RGZA 2KZVA 1BR1A 3E6MA 1LE8B 5KFFA 4A6DA 1OCRH 2ZBKA 2HZTA 3JW4A 1S7EA 2EH3A 4GDFA 2ICWG 1JT0A 4EFEA 2AGPA 3GTJA 1L2ZA 2VA2A 2EIKH 4V19K 2EFWA 3SEZA 1WJCA 4B48A 1E4GT 4DL2A 4L1KA 3LSGA 2UV1A 4MTEA 4XX0B 3RDIA 1FTTA 3KHHA 3ZQQA 1Q1VA 4BWSC 1AWCA 3OR1C 1FZPB 2ELKA 4OINF 3MFIA 2FE3A 2W6ZA 3CQZA 3E5XA 3ZQHA 5LLQA 4UVCA 5LMNH 4MEXF 1AKHB 1S7AA 2P6TA 1R00A 4ECSA 2GXAA 4GCVA 4NBQA 3T1BA 2X85A 3HRSA 5E3LA 1K4SA 4YR0A 3BG6A 1OR7A 3ABKH 4L9JA 2X51A 2M4KA 4HF0A 2D2WA 2CGPA 1JTYA 1XDSA 3QRFF 2O6GE 4GKKH 2XVCA 3N05A 4QIWE 5IWAH 3CJQB 4L0YB 2LY2A 4LG0A 4FE4A 1ZGJA 4S05A 2DFHA 2IGMA 4RA2A 5GP9A 1VFCA 5F9LA 3OYBA 2R7FA 4YAJB 3FDYA 2Z9OA 2W25A 2I8CA 3MWEA 1IN8A 4QPOA 4YIIA 3BTLA 2OCEA 4X62H 2FQ4A 1ZKGA 4M71A 3RB4A 1EV7A 3P5JA 2A6HF 2I8DA 4KIBA 4PJMA 5CVJA 3Q8SB 5KKNB 1RKTA 3I55I 2FA5A 4DGWB 4ZDPA 4JI7H 2VPQA 1QQIA 3M9MB 3HOUG 3HTUA 1R5HA 1UC9A 3GIJA 3GYHX 1IUYA 1J9IA 1EKEA 2IA2A 3BTIA 1F4KA 1FSHA 3OYCA 1V51A 3H3ZA 4HNVA 4BS9A 2AGQA 3RYRA 5CVUA 1HR0H 4V2GA 2QGUA 3KYLA 2X6YA 3K6GA 4ECVA 4JX4A 4LSXA 1SD5A 3PNVA 4LIVA 4J9NA 2EFPA 2JSPA 2V59A 4O3SA 5GPAA 5F1JA 1FPQA 2RQQA 5GTIC 6PAXA 2IAIA 3GUDA 3BLYA 5EG0A 5FD5A 2OUMA 4U6PA 3KP2A 3V4SA 3WTTC 2IJLA 3OS1A 1GVJA 1VAJA 3DTEA 5LGTA 2IEKA 3BJOA 4EM2A 3M1CA 5IYBG 4EJVA 1K83A 4F4WA 1JHHA 1I3QJ 5EGOA 2L7KA 3GTPJ 4BHPA 1Y56A 4U7CA 1B6AA 3F0CA 1NK3P 5DD4A 4E7SA 1MNMC 2RV8A 2WC2A 5J1UA 3FMSA 3ZOBA 1V3FA 1PJRA 3IH3A 4ENNA 4TV8F 2HOEA 4E4TA 2O61A 4FX4A 2X6XA 1YS6A 4OAYA 1IG7A 2OF7A 3CDIA 2QA4I 2BY0A 2HDWA 1JJ6C 1QA6A 3OTOH 2M7AA 1TWCJ 2M9HA 4XN0A 1GV2A 4Y7NJ 5FGMA 3EYIA 2MCTA 2K02A 5EWEA 2QSGX 2R3SA 4A3FG 2OCCH 1KONA 4XORA 3Q8RB 3CZ6A 2BEOA 4Q47A 4LOCA 4BU2A 3PZPA 2HDCA 5DG7A 2H1LA 2EV0A 1BI0A 5EG0B 4HA8A 2PJRA 3K3VA 3RCOA 3MZ8A 5B1BH 2FLLA 1DP7P 1W5TA 4C3HJ 1LFPA 4A3GJ 5LGNA 3MFHA 5KG5A 2FX0A 5BNGA 2XROA 3PR4A 1OCPA 2A05A 1SD4A 3AYHB 4I02A 4KISA 3GTPA 1LDJA 3HKZE 4ECYA 4Q43A 1WWXA 4M9XA 3N40P 1VQMI 1MGTA 1ETWA 1A31A 4ECWA 2TDXA 1MSFC 4HR7A 2VKHA 4EGYA 1BOBA 4AD9A 4L9VA 4QW9A 5K5RA 1UHMA 4XLEA 3JRXA 2EB7A 3OYJA 2VONA 2NOJB 3S2DJ 4ON0A 4Q4ZF 3H0GJ 3FKJA 1IBKH 1ETXA 2V4RA 3PM1A 5KT5A 2M5WA 1ZREA 2L9RA 4DR6H 5HDGA 3ONQA 2C28A 5LHIA 2P0AA 4I2OA 5DM7F 4XK4A 3S1MJ 2OQGA 3H36A 1OMIA 2DOEA 1TTYA 2H09A 4PFPA 2M0MA 1QVUA 1RETA 1WH5A 1CS0A 4MLOA 2W85A 3KYCB 2JQ7A 2O8KA 2PMUA 1GUUA 3SQNA 2JPCA 5LRSA 3ZGKA 1XC5A 2V1XA 3HSRA 5KFDA 1HNZH 3CO7C 5KFQA 4RNMA 3CCLI 4NQWB 3IWFA 3LOCA 2CV2A 3LWBA 3BG9A 3N44B 1XMOH 4CCNA 1GLVA 4WWCA 5KX5F 3C18A 2MFZA 4ZHQF 1B04A 4G7ZF 2ATLA 3U9SA 3FBNB 3HOXJ 2JA7A 3ZN1A 3CJTB 5T14A 3G3ZA 4CYDA 4O4IF 2KRCA 1MNDA 3WG9A 2FLNA 4CO8A 2WAQN 4KT6A 3H1CA 3JRDA 1ETQA 1DGWY 4BE2A 1LFUP 2DYSH 3UFXB 3MKYB 2CUFA 2K85A 2WAEA 1CQTA 1I27A 3L2UA 2PI0A 1JKRC 1BW5A 3PW7A 3GO5A 1UG0A 5L3FA 1R23A 4HYEA 1I6UA 1XCVA 4XKWA 1T8IA 1M0TA 2K9NA 1D3YA 5ICGA 5BPHA 2HKOA 3MR3A 3FXOA 2DTRA 1VQOI 1K6YA 2JUGA 3HSFA 2NS8A 4I7HA 3OYIA 2HU9A 2IS6A 1GSHA 3I56I 3L4KA 1IN5A 4DUYH 4LFBH 1B8IB 1T33A 5CPRB 1UC8A 3RKQA 2MLKA 4FX0A 5IYBJ 3MZYA 3C0FB 2QBYB 1WI9A 3TIGA 1W5CC 3T0YA 4EBCA 5KAFC 2OA4A 1YJ9I 3RKXA 4A2AA 3KFWX 1UELB 2PMZA 5CQGA 4YFXF 2IP4A 3IV5A 5DTDA 5E8IA 2R8GA 3L2RA 1EUCB 2ID3A 3LSMA 1VQ7I 5DDGA 3I71A 3WGGA 5DUIA 3O6BB 1OQYA 5H6RA 3GEZA 1WRJA 3I0TA 3JR9A 1YW7A 3T8RA 4MFDA 3T5LA 2ZB9A 1RRJA 1QRYA 1FBUA 1WCMA 2M4GA 4UCUA 2CUEA 3JSPA 4M3GA 2XPVA 2Z2SB 3L9FA 1X4OA 1N34H 5LEKA 4IRDA 1TWAJ 3ZRGA 1APLC 3SXYA 3RPUD 3PFYA 1B8IA 2LFBA 3G8CA 3CLOA 1T2KA 2OH2A 2PVPA 2KIFA 2PJPA 2J6SA 3FK6A 2VE8A 4BXUA 4RU9A 1B6SA 1RJQA 3CQZJ 4BXFA 3H40A 5KG2A 3OY9A 4IRCA 3PO2G 2NVQJ 3BQ0A 2EILH 2M34A 1V4RA 3EDPA 3OS2A 3MKWB 4KDPA 1RJPA 2VUGA 2V4QA 5FKMA 2RQPA 2ZNZA 2JSCA 5L3EA 4XRFA 2QYOA 1VQPI 2YU9A 3BDDA 4M9SA 2BXZA 1IOVA 1SVOA 2DA3A 4MQVA 2Y0MA 2STWA 4CA0A 1IV6A 2E2IJ 3HM5A 4DR3H 3HEFA 3E5NA 4GKJH 2AS5F 4IO9F 1S68A 2E1MC 2IMWP 4LK1F 2W84A 4MV8A 3BG7A 2ISYA 1ZQ7A 2R93G 4CYCA 1PVEA 2BV6A 2HYJA 3H3VH 4W1UA 2GWRA 2OD5A 3WTVC 2W48A 1Y6IA 2R7DA 2WAQA 4GYIA 2W9CA 4G6DA 1TWHA 3DPUA 3HHHA 5M3FJ 4BACA 2JTVA 3VYRB 2Y9YA 3VDXA 2VIXA 3QYFA 1HF0A 3OL4A 2LDUA 1FC3A 3AG3H 2KQRA 1BJAA 3FF5A 4C2TA 3BPVA 5IT3A 2OU2A 1A36A 3FDSA 4OX9H 2R7KA 4HQEA 4E6KG 1SFUA 2YS9A 2KP6A 1IZ1A 2ZC2A 4ZTJA 5J3LA 5TGTA 1I94H 2L02A 2VE9A 4ESJA 3V6JA 1E2XA 1B1BA 4S0HB 1YW8A 1AUXA 2IGKA 3MKZA 1CE8A 1B4AA 4DV3H 4LITA 3DF7A 4GC7A 2IA6A 2DOAA 2EJRA 2RN7A 3RTRA 3WODF 2NVYA 3RPQA 1P92A 2CFOA 1RKWA 3ZP5A 2SCUB 1KU2A 2DPUA 2STTA 5E79C 4BDYA 3KX2A 2W7PA 1ZG5A 5DUKA 4QJFA 4GLXA 3AG4H 2B63G 3F21A 2ZXWH 3HC7A 4KJZA 2E5LH 5ICEA 3JSLA 2X1DA 1T6SA 2FQ3A 4DYRA 4J9QA 3RGXA 5FROA 3GTKJ 4D5FA 1EYZA 1T94A 2HQ5A 2DFFA 2J5OA 2NVUB 2JA7J 3QU6A 4DV2H 4LH7A 2BVLA 2OJED 1O3RA 1WCMG 3GIDA 4IJAA 3J7ZI 4XYMB 3TQTA 3GIMA 3V7SA 4YG2F 3V42A 3WO1A 4F4YA 1WH7A 2DA2A 4FS2A 5HS7A 3PSFA 1B59A 1ULYA 1QPIA 4JV0A 2EFNA 2ZJRF 3KTMA 1W4MA 2XPUA 3TDUC 1LB2A 2GIZA 4LLLA 1EUDB 2QQ9A 1STZA 4CCOA 1WSUA 4ECQA 4IAJA 5DM6F 1A6IA 3N41B 4J01A 2QSFX 2W24A 2NYXA 3CMYA 2F5FA 1MD0A 2KDZA 4YR2A 1ZETA 4MA5A 3DBRB 2BQRA 3GX4X 2NVTJ 2YZMA 3I4PA 3GV5B 2L01A 3A02A 4C30A 1Y1WG 3MZHA 1YTYA 5J2UF 2J9GA 5L3GA 1SAUA 1VBHA 3K1NA 4DIQA 2C2DA 1ON1A 3R60A 5FRMA 1GSOA 2CRGA 3IHUA 2P0WA 4NUBA 2W8KA 4KMUX 3GTQA 3I59B 4DV0H 2G7UA 1G59A 4HZFA 5IP9G 5JLWA 2WAFA 2DMQA 4MEYF 1GVDA 1JHFA 2VKVA 3M07A 3HZJA 4TV7A 3G6YA 3PN1A 2YU9J 2HI3A 1KZHA 3NGDA 3CCQI 2DODA 3MD2A 2RREA 3GMEA 5BOXA 5IYDJ 1U8BA 4UFZA 3OIQA 4J9OA 5L1JA 2DI3A 4NB5A 4FTHA 1FVIA 4I55F 3LWFA 4A3MJ 2XAJA 3GFJA 3OOUA 5LA6F 3M9OB 4B3MH 2Q2EB 2QVOA 3CP8A 1MKMA 5D8KB 2ZJ2A 5KFCA 3ZPLA 4HX4A 2FK2A 2EZHA 1KA8A 2WY8Q 2Y30A 5LOVF 1JXLA 4DL3A 3L2CA 4IQ4A 3CUQC 4DV5H 2CH0A 4CC6A 2ZMEC 1IO2A 3A1YA 3LSJA 3K0LA 1OCTC 3E5QA 1USSA 2VT2A 1UG2A 2HYGD 1G8XA 2FRHA 1WJEA 2LF7A 3VWBA 3V6HA 4GO1A 5JLXA 1HQCA 1X1DA 3O8HA 1IAWA 2E2IA 3AFHA 4Q0YA 3CJRB 5KFJA 2WAQE 1G4DA 3ML6A 5JFRA 5IP9J 1X3UA 1N48A 3WU2C 4C2MJ 2K3FA 3K4KA 2XAHA 2VOBA 2HVSA 3GFMA 1Y0NA 1LFBA 3VYUB 2ALZA 1BC8C 2VUMG 2VJ4A 2AQFA 3E0JB 5DQGA 4QWEA 3IP4B 4DNCA 5TISC 4UCOA 3JRWA 3N6XA 2FJZA 4C5AA 4NXNH 2XAFA 2VLAA 3LA2A 2XIGA 3CMEI 3OV8A 4GYGA 5C5JA 3PIPF 4B1RA 4Y52J 2LK2A 2YRXA 5DLFA 2H6CA 3TDZC 2FKLA 3I54A 3LSTA 4CYCB 3EPIA 2KDOA 4R8UA 4AWXB 1HOMA 1X1AA 4F7ZA 3N8DA 1Z1DA 4I01A 3H4DA 1BC7C 3BY6A 5JVGF 5F0FA 4BJTA 3CUQB 4Q44A 2HTJA 1G2HA 4MIMA 1FYKA 1VQLI 3QZ8A 4JI2H 4Z2YA 4XICA 1S0MA 2YCHA 2R7LA 2LY1A 4GXOA 1HKSA 2C2EA 4IHSA 4M74A 2FNPA 1VTNC 2W6PA 4KICA 3R0AA 1EH7A 5KNLA 2EFOA 1OJLA 1BA5A 3KHGA 4DV4H 5F08A 3FMQA 3WTYC 3QU3A 4LF5H 3A03A 1HKQA 2QYZA 4D7NA 3OYLA 2BR0A 1IV8A 1ETKA 3JTGA 3VPRA 2VBZA 3BJ6A 3WTZA 3GTOJ 4HYKA 3FXUA 2PBZA 5LEJA 3IL2A 3GLKA 4D1QA 3VPCA 2KJCA 5KFWA 1E3HA 1JT6A 5DEQA 4KIGA 3S14J 3HL2A 2R5ZB 3H35A 4RAFA 3JRHA 5GAHJ 3RSNA 3GIQA 4A12A 1MBGA 4M3DA 4JI1H 3ZMUA 1VQKI 3OSGA 3CUQA 1JGGA 1IRGA 3H92A 3ZXSA 3K10A 3FXRA 3KEQA 4KN7X 4ECXA 1YFHA 2OBPA 5HBRB 4HNUA 1NG6A 2WB1A 5CYVA 4LSAA 4BBRJ 1D1CA 4U0WA 4BQAA 4EBDA 1FSEA 1F5TA 2F2EA 2FK1A 1NH3A 4IWYA 4A3MG 3MN2A 3P9CA 4BEHA 2P5LC 3I9V2 3KALA 2P8TA 4QW8A 3K69A 2WV0A 1E0EA 2KIQA 4M6VA 3BOQA 1MSEC 2UUZA 4R1HA 1JKQC 2FK3A 2LOOA 2W82A 2UXXA 4DLKA 3BP8A 4XR6A 4CCJA 1N33H 1D8JA 4BDZA 2QKMB 2DQRA 4O2BF 4ENKA 3TQNA 2NNNA 2ZMEB 1PDNC 2C35B 3Q8PB 1QZEA 3GZ5A 2XCLA 3C2HA 2A3SA 3W6VA 3CVZA 1V4YA 1VI0A 5F6FA 3V8LA 1J2XA 2FBIA 5BR8H 4LGWA 2AQEA 3GTGJ 4JUZA 3ZQIA 3T1YH 1TWGA 1XX5A 4PGGA 2H8RA 1YG2A 4C5BA 2UVVA 1JUMA 2DXIA 3BQ1A 4XSXF 2ADUA 1WJDA 1YOVB 3RB3A 4GGGA 3CCEI 2R7ZJ 2OZUA 1J5YA 5EWFA 4FHTA 5F27A 5FLVA 3I59A 3ZR8X 5M5YJ 1QZYA 2QQAA 4G7HF 4O6JA 2BY1A 1R58A 4HSRA 4DZJA 2R8IA 4A3EG 1K1QA 4F50A 3KETA 2NXNB 2R7MA 3ZQLA 3G71I 3DPTA 4EMSA 2UXCH 4IOCF 1Z3XA 2HFHA 3ASOH 4MO7A 4OAZA 4N9IA 1GXPA 4A0YA 2Y0SE 4XL9A 2F5DA 1NHAA 1WR2A 2ESNA 1RYRA 4LFAH 2LYCA 3DXJF 4RGSA 5HDNA 3MQ0A 1SCUB 5CA1F 4NXMH 2QZ8A 1ZR2A 1PUFB 3CCMI 4F3QA 2WYOA 3CC7I 1W1WE 1G3YA 5ERIA 3ASNH 2HNHA 1FT9A 4CUGA 3HRUA 5EDWA 1ITYA 2VQFH 1UCRA 1U78A 3HOXG 4A3KJ 5H20A 1JE8A 1TWAA 2J5PA 5BMVF 4BUPA 1FX7A 4QLCU 2X6WA 3C7JA 3ZQFA 1IGNA 1M0WA 4O2AF 5L1KA 1WVRA 3ISPA 2JK3A 1ZAOA 4YRVA 3WHBA 5C3EJ 1KQ9A 4DR2H 4OMZA 3MR2A 3E1SA 1X58A 5KG6A 4ECUA 3KAJA 1U8RA 4IOAF 1BR4A 2RVCA 2OQRA 1TA8A 4J9LA 5JVDF 5C44G 3B6CA 2IRFG 4HF2A 2E2HA 4J00A 2EIMH 2BQUA 3M9NB 2VBWA 5M3MJ 4YAKB 4N4NB 2D5VA 1ZQ3P 3T5HA 4IRHA 2RDJA 2XV4S 3R61A 2KRHA 1LQ1A 4RB2C 1AOYA 3N42B 1PX2A 1G3TA 3E6DA 2R8HA 5F0CA 3D5RC 2TRTA 3GTKA 4A3DG 2NAZA 2YX4A 3HOWJ 1DV2A 4B8XA 3JRGA 4IL6C 3RBDA 5KHDA 1FMVA 3VODA 4C3IJ 4CICA 3A2KA 4PFOA 1N36H 3I53A 1RK5A 1Z21A 3GIIA 4HX7A 2LKPA 2ELJA 2F4OB 2CQKA 2XC7A 5DLGA 5KFRA 5L1IA 4XMYA 3KEOA 3QWLA 2XF5A 3TP0A 2CW7A 4Y15A 5KFTA 3F3XA 3OYEA 3BG5A 3QOEA 3KP7A 3CCJI 1K78A 1GXQA 3H4BA 2IXSA 3FHZA 1Z2OX 2EV6A 5E18F 1POGA 1BBYA 5FD6A 1P6RA 2HQNA 1GT0C 3WGIA 2A61A 2GAUA 1J59A 1FIAA 1ZGWA 5CAEB 2CG4A 1SFOA 1DGRM 1LDDA 4IHVA 2EFQA 4U7BA 3F8NA 2XASA 4MV7A 3K4LA 2JZYA 2E71A 3N4MA 4HX8A 3NQOA 4F92B 5ILVA 3VPDA 1S7OA 4IF4A 5DD8A 4LFCH 3NARA 2B7EA 1IOWA 1MBEA 1MMSA 5F04A 2UVRA 1P9QC 5IT9W 4RM2A 3F23A 3UR3C 2Q2UA 2DT5A 5DQIA 3O3KA 5D5VB 2EA2A 2VBXA 2Y2ZA 2R7NA 1ENHA 3LFKA 4RAYA 2RKHA 2W6QA 1XB4A 3MR6A 2LBFB 3M7GA 4AYBN 4EEQA 2DDAA 2LMDA 5C1PA 2V26A 1Y8RB 2BOLA 2EV5A 2JMWA 1OR7C 2IGOA 4IQJA 2HYFA 2E5ZA 3ABMH 2R5ZA 5GONF 4JYAH 2BBYA 5CVRA 1SAXA 4X1EA 2QWWA 4BE0A 3UKGA 1XMAA 1N78A 2R7TA 4O3PA 2UXBH 3EUHC 4LFUA 4FE7A 4I76A 3LAJA 2DMNA 2OWOA 1B6RA 4A3LG 3JRIA 3QOPA 3AG1H 1VQ8I 3K5IA 2JEJA 4LF8H 3WG7H 1VQ4I 2VQEH 4MA0A 4M6XA 2PN6A 3R23A 2P7CB 1YLFA 1SD7A 2DN0A 2BGCA 1CF7A 4J9PA 2E35A 4HAMA 3RTXA 1O3SA 2R84A 1OPCA 1X2NA 5TRDA 3S1NJ 1C3OA 1XPXA 1T38A 5KFYA 1HW5A 5KFVA 2GXBA 2VPSA 3A01B 4ESBA 3S16J 2R7VA 1QBJA 1Z3YA 4OIPF 1WGXA 1HBXG 5GPCA 1GV5A 3KZZA 2M2EA 3ROUA 2JA6A 3OSPA 1JXSA 1IN6A 5K5QA 4JQFA 2BHYA 3TO7A 2HJWA 4IRIA 4RUCA 1FBSA 5ICCA 2HZDA 2FXAA 3TW6A 1XS9A 1RC9A 2QF7A 4MV9A 2CU7A 4B3TH 1XGOA 4PCQA 1QHHD 2A69F 3TKYA 2VXZA 3K4BA 2R7RA 5FPRA 1RIOH 1TBXA 2XHKA 5KFNA 1R22A 3FZVA 4DL5A 4BY7J 3S3NA 5HDKA 1I39A 2HWVA 1B33N 3QPHA 5ILSA 1HNWH 2CW0F 4AVZA 1FYLA 4QWBA 1R5GA 5K2MA 4UXNA 2VOOA 1M7JA 5EWGA 3HOUJ 3ZMDA 3BA9A 3H0DA 4YIRX 2FD5A 1K4TA 5CLSA 2XKPA 5FJ8G 4LF7H 3RAQA 1DPRA 5EYRA 3ZQCA 3BABA 1YX3A 4XSZF 4E70A 2ZDHA 1T36A 3TOAA 4JV2A 4ZYHA 4XRMA 5EF6A 2YS6A 2BY2A 3LSHA 4OU0A 1T08B 2PEXA 2XGXA 2CMPA 2VPRA 3BC8A 2R7QA 4EJUA 2KHMA 1SC7A 4UNOA 1ON2A 1Z91A 2VUMA 3MFKA 2P81A 4ENMA 1HXDA 4QIWA 1XSDA 4A3JG 2FUG2 5KT2A 2FF4A 3GTLA 2NUAB 2HKXA 5C4XJ 1UMQA 1AA7A 1TWCA 2YW2A 4ED7A 1AUVA 2BQ3A 2KIMA 3CMMA 5BMZA 4FASD 2EBIA 3DQVC 3CC2I 3IN5A 3KIOA 1I3QA 3LA3A 1I3AA 3RAXA 4JI6H 4DW6A 1GDTA 1IBLH 4UV8A 1ODDA 4JI4H 4A6EA 1TQMA 3C3WA 2JVHA 3VPBA 4NQWA 4HBLA 5CB4F 1RNLA 4LB6B 4AVPA 3KXYT 4HW0A 4FCYA 1W5SA 2CQNA 2DMUA 2Z16A 4G6QA 1XGSA 3WU1B 3JRFA 1FJLA 5JH7F 5D8LB 3H3UA 5EZHA 1EH8A 4OIQF 1JKJB 4PDBA 2KT0A 4H4KC 4YIFA 1FTZA 1B9NA 4BKXA 3DBHB 1MJAA 2UUCH 3K5HA 4BXXG 2E1MB 2FOKA 4RB3C 4I09A 1ZTRA 2V1DA 2GIVA 1VQNI 3BJYA 4IHXA 2K27A 3DU5A 1WSCA 4DL7A 1QNTA 1WQ2A 1E17A 4YHHH 3K70D 1CGPA 3BCAA 2P7VB 4KT5C 4UB6C 3S3MA 4LF9H 2R93A 4OMYA 2JVGA 5IYDG 2UVUA 1S29A 3I64A 3SDBA 1BIBA 4JOMA 2CUZA 5FB2A 2ZJPF 2QM3A 2EZIA 1MNEA 2DK8A 4ZYEA 3MMYB 2L9SA 4BY1J 1V9PA 4U0VA 4DBQA 1LPQA 4D5CA 3JAMW 1VNDA 2Y0SN 3M9AA 5I47A 4A3KG 1LJ9A 1FJGH 1R6RA 4WXDA 1LEAA 1SFKA 4G7OF 3L4JA 2ZXIA 2IA1A 1Z6TA 2Z1DA 5KFOA 3LQQA 4XLCA 5D4RA 4XLPF 3PO3J 2VOPA 3UQ8A 3ERED 1J5EH 2JA8J 2DPIA 5ICFA 3HGGA 4IKFA 5FO5A 3F8CA 2NU6B 2ESHA 2CS3A 4HQMA 1CQJB 2PN1A 2VKDA 1ZK8A 3E6CC 4LK0F 2UXNA 4XLAA 3L2WA 3IG0A 5CQEA 4ZI7F 5HLTA 1DIKA 3MEXA 5EOYA 2JA7G 4RS8A 1R9TJ 2MH9A 3ABLH 1D0YA 4MQ9F 2DCEA 1XDUA 4MTDA 2ZMEA 4PDKA 3ZQGA 3OMYA 3LP8A 1DQUA 4BH9A 4QWQA 4PGHA 4TV9F 1WKMA 1IRXA 2WADA 2BY3A 2JJ7A 2KMUA 2JA5J 2G7HA 2MH2A 3U9GA 1T56A 1Z6RA 3RFCA 2E2HJ 1FYMA 5B3SH 1E4FT 4FQGA 4CGZA 5GADJ 3DLLF 3FISA 3A01A 3FMAA 3RPUA 2XDVA 4ZZDA 5DCMA 1ZG1A 4MAMA 2XSJC 2Y75A 2YS7A 1E3PA 3IH2A 5HLGA 3BA8A 1SMTA 1OYWA 2BZTA 2BW3B 3LA7A 2R7UA 1IN4A 5DQHA 2ZXHA 2EWNA 1H9TA 1YI2I 2ZDQA 3WE3A 1R4NB 5IP6A 2RDIA 3TQ1A 3FKIJ 3PW5A 4G12A 2UU9H 2K7LA 2WY7Q 1GLNA 4XONA 3QFFA 3LAPA 2DTZA 3GFLA 3U1DA 2AXTC 3K4NA 4IHYA 2LKSA 2IGNA 1ACIA 2XGPA 1XMQH 5B1AH 3L2PA 1TWFA 3B02A 2K9SA 4BQQA 1S3JA 3R4KA 5IPAA 2XUBA 2BE5F 3ZCOA 5E3NA 1QPMA 4ETSA 2CKZB 3P7NA 3W6KB 2OTJI 2PX9A 4UCTA 5JI6A 1ZRCA 2UUBH 4ZDOA 4RNNA 1X9NA 2EZLA 2PMHA 1IDYA 4A2BA 2L4AA 3S2WA 5HS8A 4O3NA 1W36D 1UFMA 3KPHA 2WB1E 4ED2A 1AHDP 3R0JA 3K70C 5KFGA 1J09A 3ERMA 5JR3A 3DEWA 1WI3A 3CCYA 4K2EA 5HOOA 3OYAA 1KC7A 4A3LJ 1I50A 4PSXA 3GV7B 1S6LA 1VQ9I 3ETHA 1ETVA 2PMZN 1R49A 1FOYA 4H0EA 3H5RA 4RZQA 4YJ3F 1WHUA 3CLQA 5KT3A 3JAMK 4D0PA 4P96A 4UUSB 2Y69H 3PW0A 2ZNYA 3SI8A 4EV0A 1BJTA 3CCRI 3CCVI 3EQLF 5LHHA 1CQIB 4NC8A 2ASDA 1BOAA 3KLOA 2E1NA 1IXRC 3EPGA 4RNOA 3HYIA 5CVIA 1YRNB 4CZZA 2R7ZA 3TEDA 1U2WA 1XNQH 1FY7A 3V7RA 3OYNA 4RGUA 3D0SA 2FOWA 3IAM2 2VB6A 2K9QA 2ELHA 1O7LA 2VASA 1TL8A 2KL4A 1WZ2A 3ZMVA 2DJIA 5IY5H 3W2VA 2NOGA 2Z33A 3DEEA 3DKYA 4TQSA 3VFZA 1FP2A 2DZDA 4UY8I 2MD5A 2EIJH 4ED8A 2Z99A 2IVMA 1H0MA 3BR1A 1P4WA 4MFEA 4P5OA 1TLHB 5KG7A 4JYKA 1MJBA 4QIWN 1REPC 2IT0A 4CCMA 3CUOA 3RIRA 1JDEA 2XCPA 1RPWA 5D8DA 3E7LA 4EM0B 1D8KA 3FMRA 3GW2A 4MV6A 2IS2A 3CCSI 1D1BA 3HPGA 3SDGA 2R82A 1H8AC 5DS9A 2KISA 2KIUA 4EYIB 1A04A 2W71A 3IH4A 4IXAA 2DK5A 2V58A 5KFKA 3BR2A 3WTSC 5HODA 1O7FA 4IHTA 3LSRA 4B43A 1SFEA 3LNQA 3LMLA 4EJOA 2MC3A 2VA3A 2WE6A 1I7LA 3K1MA 4J9SA 3EUAA 4IZZA 5C8YF 4DL6A 2R92A 3HGYA 1JGSA 3TBIA 2R7WA 1MDMB 1MBJA 4IEJA 2C22A 4A69C 4WBNF 4ZZLA 1E3OC 4XBFA 4IRGA 4LLNA 2C6YA 3PW2A 3J7AK 4P55A 3TO9A 4EGQA 3HOTA 4B3SH 4HV6A 1TT5B 2R86A 4Y33A 2X1CA 1T3NA 3OYGA 4WXHA 1ZN2A 3A0BC 2F5EA 3HRMA 3HB9A 3ULQB 3MWMA 1HCRA 5J4YA 5F1RA 1Z7UA 3BZCA 1QZZA 2FJ1A 2QQBA 4PK4A 5E3OA 3GTMJ 1VKZA 3FKIG 4ZQIA 5K5OA 2XCAA 3I58A 3JAMZ 2FBKA 4RBOA 3FXJA 2F48A 1KJJA 1IN7A 5L3CA 2W00A 2Z5UA 3FIWA 2HOSA 3Q9SA 3M4OJ 2FB9A 4KNYA 4IRKA 4XRSG 1XN7A 4IWXA 1LEBA 3RKWA 3G1LA 3X2QH 1P4XA 4C5CA 5AIPA 4A5MA 1TQPA 3VSKA 4LIUA 3K2AA 1RR8C 3BQ2A 5EEGA 3DPLC 3GF2A 5BPDA 3E6BA 4RM3A 4QWDA 2W4SA 3AKZA 5FKNA 2LKXA 3G2BA 4RAGA 5FRNA 4J0MA 5D6FA 3R5XA 4JV5H 3FXLA 3IWZA 4M3BA 3JSOA 1C30A 4A3IG 2Q0OA 2C2RA 2JN6A 2M30A 5EGOB 5DCFA 3GTJJ 4E7KA 2M45A 2GOMA 2EA4A 3FXQA 5LFAA 3PSIA 3QYBA 3V8KA 5M5XJ 4WX9A 2V9WA 2ECBA 1K61A 2FPPB 2KLOA 1GYFA 3R5FA 5KFEA 2HXIA 3KAKA 5LMUH 1JIHA 3JZIA 3V4ZA 4EG0A 2O0YA 2COBA 2BYVE 2KJBA 1A9XA 3GTLJ 5J47A 2A6TA 5FFZA 4AM3A 1VBGA 1GHCA 3OYMA 2DAOA 1S10A 2DYRH 5JVTA 1QU3A 2KZGA 3L1PA 1M1EB 4DR4H 2MLGA 3OYFA 1TWHJ 3KE2A 4RMNA 2H1KA 5BPFA 1WFXA 3BROA 3DKXA 3OUUA 1KGSA 2FMYA 1KBLA 2YR2A 4WF2A 3SFZA 3CC4I 1GO3E 3PO3G 3OYDA 1OKRA 1T98A 1FIPA 3IUOA 4UHTA 1MMDA 3SE7A 5EEHA 2V6EA 1P2FA 3K4JA 2RDPA 3EPZA 1WJ5A 5LYJF 5KG4A 4G3IA 3LFUA 3OOPA 2L7FP 4A3FJ 2NRAC 1UHWA 1LNWA 1HSTA 3NWSA 2FSWA 5HLIA 4LB5A 3GLXA 3DU6A 2UUAH 2VQHA 5D5UB 2V1UA 1ZHQA 2XGCA 4A3CG 2ZFWA 1U3EM 4DQ2A 5LD2C 2E7WA 1BR2A 4YFNF 4ZC3A 1DV1A 1FOKA 1KJ8A 2JEIA 3PUFA 5DYMA 1ORKA 3M4IA 1BI3A 2DLNA 2CQ7A 2VQDA 2HPMA 5IYCJ 4FT8A 5EEAA 1W0UA 3HUGB 2NVXJ 1B9MA 2HPIA 3OIOA 3GIPA 3OIPA 4MV3A 2FEZA 4B44A 1LVKA 3Q8QB 1ZLKA 2L9NA 2W6OA 4Z6YA 2IW5A 2NVYJ 2XAUA 3ELKA 2XRNA 4MNUA 1IDZA 2O7OA 4AIKA 4PSWA 1YO5C 1D1AA 1Z9CA 1QVTA 3SHFA 1RUOA 2HVRA 2GBYA 1YW9A 2A07F 4RZRA 1Y1VG 4ED6A 2V6CA 4QWAA 1ZARA 4QTRA 4PJJA 1ZYRF 5KVRA 2GLTA 2I10A 1HC8A 4ANJA 3GTGA 1KU9A 2VJJA 2UZKA 1R71A 3AL0B 2VPLA 4ZJZA 4JP0A 4LG0B 1JUSA 2XF7A 1IXSB 1Y1WA 3ESWB 5L1LA 1WJFA 1N77A 2BVMA 1RR7A 1ZGAA 2M0CA 2VUMJ 2CO5A 2ZJQF 3S2HJ 5L3DA 3QPLA 1UAAA 2X6OA 4A3DJ 2R7OA 4L5JA 1Z2PX 4BAYA 3J80K 2F4MB 3U21A 2R92J 1W96A 3GVAA 3RQ4A 1YIJI 2PLYA 4XOPA 4JV1A 3IKVA 1X2MA 2X4HA 4IVNA 5IYCG 3S8PA 3TO6A 1IJWC 4YELA 4B09A 2DW4A 3G6VA 2R93J 5IP7G 4ZOLF 1BIAA 2L4MA 1V5EA 3IC7A 4RLFA 2I5UA 1DUXC 1XDNA 2TCTA 3D5SC 4CCKA 1K83J 4F55A 3WNZA 4X0GA 2P4WA 3HHGA 4XOTA 2W9BB 1Z05A 3F8MA 2FMAA 3KCCA 5E17F 3I5UA 1RESA 2G9WA 3DFGA 4NNJA 5GTHC 1I1SA 1R36A 3Q0VA 1UHSA 3H5NA 4F4ZA 4RAZA 1IBMH 2RC4A 4IHWA 2YL2A 2V7FA 2W57A 3REOA 2Y31A 4XLHA 1OISA 4C9YA 2CQYA 2GZWA 2O9LA 1A5JA 2RGVA 4J9KA 3SFIA 3FK7A 2DT6A 3CF5F 1V54H 5KG3A 4UB8C 1H9GA 2AO9A 4AIDA 4LH6A 4XNFA 2HHHH 3W6JB 4DV1H 2IA0A 1MZBA 2XF6A 4J9RA 1TWFJ 2R4GA 3QPTA 3BTJA 3NEUA 3KLNA 4AIHA 2OTLI 5IT9K 4JI8H 3GQCA 3K3PA 1AU7A 3H9JA 1WJBA 2B63J 4LG3A 1SFOJ 4KFCA 2O5RA 2VBYA 1HW1A 4G94A 1TAEA 4GFBA 4Q8EA 2GQQA 2A5YB 3H0GA 2P5KA 3IRRA 1TW3A 1JJ8C 5E1XA 2DPJA 2PG4A 4NLGA 3R5HA 2YRWA 2ME0A 1Y39A 3R6SA 1J75A 3MAJA 1FOXA 1MW7A 3W2WA 2HR3A 2H94A 1S8NA 1ERDA 3Q1KA 4M9UA 4O4LF 3K2ZA 4EBEA 3K4CA 3IKTA 3FHNA 4ZDLA 3HKZA 3GZ6A 2MGQA 4R8HA 3WTUC 4R8UB 5HVQC 3GWZA 4X65H 3OHBA 2W9AA 2VC0A 1PK8A 1EZ1A 4I50F 1R1TA 4S04A 1CF7B 1OWTA 2M05A 4BY1G 1FMWA 3QP5A 2J6TA 3G73A 2OPTA 3HTSB 4FM9A 1YIOA 3ORRA 3J80Z 2COMA 1MH4A 5D6EA 1R9TA 1XSXA 2K4BA 3E3VA 5J40A 4BJ5C 4CH7A 4C2MA 3BR3A 2F4VH 3HOYJ 2JWTA 3BJAA 4ESFA 4O3QA 1V55H 3ABUA 3BT9A 3DWLE 1SEIA 4P9FA 3GXOA 2CQXA 3OYHA 5CJ9A 3B73A 4WD3A 4DV7H 4DR1H 2AGOA 4XIDA 2JA5A 4XKCA 2ZCWA 4CDGA 3P9KA 3VEPA 1K79A 1EF4A 5JHUA 1UJ8A 3RZOJ 1USTA 4D9JA 2MSYA 4HV5A 1D5YA 3S17J 2R7ZG 4BHCA 4MV4A 3S93A 4W97A 3S3OA 2ZDGA 3SZGA 3Q3SA 2YUSA 3V4GA 5CVVA 3B6AA 1AKHA 3AG2H 1A0IA 2KSWA 5C1OA 2R87A 2DDBA 3RJ0A 3TOBA 3S1RJ 3D1NI 3G1OA 3LL7A 1DP3A 2L0KA 3LSPA 2ZM6H 2LREA 2WV1A 2GOXB 1O4XA 4BQNA 1R4MB 1TT0A 2QSHX 2RF4A 4EQQA 5LBQA 3GTOA 2EPFA 3FKIA 5EJCA 5LGUA 4OWRB 1WPKA 2F5VA 2R92G 1X19A 3FBIB 2LTPA 1W36C 3CJNA 4WXCA 3Q9VA 2DBBA 2JA6G 2I87A 1DPUA 2R85A 2DJNA 2C00A 2X0SA 3DCFA 3U2RA 5IT9Z 5BQTA 2CJJA 2VT3A 5IP7J 4V2FA 4I4TF 5FFXA 1FLIA 3HRTA 1VQ5I 2E2JJ 1H89C 4JX6A 3JRCA 2KKOA 1W7PA 2GXGA 1E4EB 2OLSA 1HA8A 5J2TF 5L9XA 1PYVA 2M87A 4E7ZA 2X48A 4ZYGA 2YSRA 3KHRA 3I4MG 1TP4A 2VJIA 3PNTA 3EETA 5C44J 4HOBA 2DMPA 1DGSA 2CZGA 3RV3A 3OSNA 1I50J 1SVLA 5FPOA 4YY3H 2VL8A 1K7AA 1T0FC 4EJTA 1G3SA 4LF6H 1P7JA 3RF2A 1MBKA 1IRFA 1U5TC 4A3BG 1HW2A 1RJRA 2DFIA 4Y13A 1QHGA 2A6EF 3BTCA 5J8CA 4KUMA 2FLPA 1K6OA 2H6BA 1JTXA 1X3WB 4XKBA 3BQYA 1WCMJ 4TQRA 3WTXC 5F9NA 2K3PA 2KFDA 2XAGA 3OSFA 4DR5H 2E1OA 2QUFA 4LJZF 2GM4A 1J7KA 2ISZA 3NRVA 1TWGJ 4I98B 3H9QA 2IP2A 5FKOA 2WDTA 1ETYA 1BI2A 3N97A 4O3MA 4PZJA 4PJLA 1YHQI 1YRNA 3CCUI 3F22A 5D1OB 2N8GA 3CDHA 2X9DA 2JRTA 5EDNA 5HS9A 3Q5FA 4Q5SF 1IRZA 5KFMA 3RB0A 2JEFA 3PQKA 1SMYF 3A0HC 5BPIA 3O8GA 5KFXA 2HTSA 1F9NA 2D1HA 4XRSA 2W7NA 4R79A 3TW7A 4UCRA 2PFBA 4L9NA 2Y0SA 1TC3C 5LP6F 1XSVA 2FBHA 3W3CA 2OAZA 1S5LC 3I4MJ 1I7NA 5KFIA 2CYYA 1TW2A 3A4CA 1VQ6I 2O03A 5HNHA 5KT4A 4IR1A 2W7OA 3EYYA 1O3QA 3MWDA 4BE1A 3KYDB 3F6VA 3M3YJ 3M1EA 4AU7A 4Q48A 2AQ4A 2EZKA 1OCZH 1U6GA 5J8FA 1X1BA 1U5TB 2F4IA 5KFUA 5C4JJ 1MJ9A 3V8JA 5DG8A 2MABA 2ASJA 3GTMA 2M8EA 4M3FA 3L00A 2DWCA 3H9GA 4OIOF 3QQAA 4UVAA 1RK6A 3U9TA 5K7ZA 2K86A 3GZNB 3I12A 1U9OA 4B47A 3HIFA 2R0QC 3J7AO 3GILA 2V9VA 3V7CA 3J81Z 3JCUC 4RGRA 3T5KA 1WH2A 3FM5A 2XRLA 3H20A 2VC1A 2XPWA 4ME6A 3WHCA 5DGAA 5F0HA 1NK2P 1MMAA 5D1PA 1Z67A 2DA5A 3FXMA 4N0BA 2ACJA 5HNFA 1Q1HA 3F9KA 5FKLA 2JA5G 1Z77A 2K4JA 2CSOA 2M3AA 2CQQA 3M8EA 1JKPC 1RI7A 1XGNA 4FETA 1OYIA 1W7PD 5K7FA 4HF1A 2XSDC 2R6FA 2B0LA 2HQRA 4LMYA 2XGEA 1I6XA 2JPBA 5DG9A 4U87A 2JA6J 3GIKA 3C1DA 2Q1ZB 3BG3A 3SZTA 3ZQ7A 5KAIC 5C3EG 3ETJA 1A6QA 3DLAA 4HLYA 5H6QA 4A93J 3LQRA 1G6NA 3PUBA 1R1VA 4KMFA 1A35A 3CESA 3F8FA 4CC5A 4FISA 1PP8F 4ECRA 3G6XA 3HBLA 5L3BA 2JUCA 1PP7U 5JQWA 2QKLB 3T5JA 2VR1A 2LP0A 4G6TB 3TL4X 3EUHA 4CCLA 2HDDA 1X3ZB 2GA2A 2K9LA 4WCGA 1F1ZA 3EUKL 4B3XA 1ZRDA 4OIRF 5FLXW 4DL4A 2WWYA 4J19A 3E97A 3KP6A 2DU9A 4E4HA 5DCMB 1P4AA 5KFBA 2HQAA 4GRIA 2QEXI 4KA4A 1Y1WJ 2LC2A 2VQGA 5E20A 2XB5A 3H3VK 2G0EA 2J6UA 2RNJA 3DV8A 2P6SA 5H80A 1MMGA 3TGNA 5LXTF 2XB0X 2QCOA 4EGZA 4M3EA 3Q2OA 1UZCA 2UWMA 5KT6A 3T8TA 2ZJTA 2Q8KA 3OYKA 3L2QA 1GSAA 5FJ8J 3GBGA 3G4SI 2DA7A 5K7HA 2B63A 2E5NA 2HS5A 3HOVJ 3ECHA 3MVPA 1ONVA 2XC9A 3C2GA 1IW7F 2O8XA 1YJWI 1HKTA 4AC0A 4Y8VB 2YPRA 3FWEA 2JRMA 2H8WA 2MA3A 5E3MA 1LE8A 1EHIA 2GLOA 2B9SA 2MW8A 4L5IA 4G8XA 1O57A 3PJRA 2MYSA 3BZKA 1NTCA 4KITB 4A3JJ 4X6AJ 3RV4A 1W0TA 4X64H 1N56A 2LLKA 1O75A 2LD5A 2OV7A 2VQLA 4LF4H 5LRRA 3OR2C 3JSNA 4Q8FA 3RQIA 3ORQA 3J81K 1BI1A 2PQ8A 3IAS2 4RGXA 3GFIA 4ED1A 4KIFA 2UXDH 2W6MA 3GTQJ 3ECOA 4II3A 2A5WA 5CKTA 4YQWA 3G1MA 2ZSHB 4MV1A 4DR7H 5JHFA 2DA1A 5KG0A 1X4PA 3RJPA 1SFXA 2FU4A 5A2QZ 2MG4A 1ETOA 1SVMA 5KFSA 3IRQA 4JX5A 2IBKA 3E5UA 2LG4A 2AU0A 1PUFA 1KEEA 4DJAA 3QZ7A 1SANA 2DQLA 1JLLB 3H0GG 3COAC 3K7AJ 5ED4A 3UNGC 4UUTA 1F36A 2KPMA 2X1EA 3ZMZA 3BWGA 2DOFA 4FBUA 5GAEJ 3GLLA 3QYEA 4HRIA 1KU3A 2M8GX 2ID6A 5AONA 2NU9B 4G9YA 3J7YJ 4BBRG 3J80W 2O3FA 4AYBA 4B3AA 3DTKA 2HGSA 4EM1A 2DT7B 3CP2A 2R8JA 2V4JC 3DBLB 1YX5A 5BS6A 2DFEA 1XMKA 2ME6A 3I3LA 3JREA 4UUVA 1XD7A 3NAUA 1L3LA 4EEYA 3GV8B 1Y14B 4HDVA 2IS1A 1XGMA 1ULZA 3HXLA 4I6ZA 4UCSA 2K5CA 2Y9ZA 4M7EA 2FNAA 2JA2A 2R7XA 1BNCA 4JI3H 1S9FA 4EJWA 1VS0A 2QBYA 4R7RA 3WE2A 5M5WJ 4N9HA 4U0YA 4RDUA 2FPIB 4BQOA 4HDUA 1EH6A 3SEQA 2CWEA 4ZTFA 1BL0A 4AYBE 2NS7A 3CDLA 2JA8G 1DU0A 2DA4A 1T39A 3QP6A 2QK4A 3RKYA 3SYTA 5K1YA 1ZG3A 4WK8F 1KU7A 2CV1A 4RLQA 1FNNA 1S97A 2LH9A 4ITVA 1ZHFA 3M8JA 3NWTA 3T5XA 1NG7A 1S72I 1K78B 2R5YA 4M9ZA 1FP1D 1U0JA 2KRFA 4BHBA 5D5WB 4BBSJ 4XZ3B 2HXOA 1D0XA 3K1PA 1XMXA 3PVXA 4A3EJ 4HG2A 4K0KH 2EINH 1BGWA 1C0WA 1G3WA 1JUPA 4C3JJ 4KYWA 4DZPA 1FEXA 5IOYA 4YP3A 2W9BA 2EK5A 4EFBA 1EJ9A 2IPQX 2MC4A 5AIQA 1I5ZA 3HDDA 2AXLA 4D7MA 4FU0A 4UCVA 4ENJA 3Q0WA 3P9IA 2R8KA 5C4XG 4L0ZB 2W6NA 2HEOA 4CZCA 1B72B 1KYZA 1J0RA 3RI4A 3J81W 1YJNI 1S0NA 1V5FA 2V1NA 3HOZG 2NS0A 2RGRA 1SEUA 1HLVA 4N4OB 1KJ9A 3DEUA 4EYHB 4J9MA 1LKXA 3VSLA 3BR0A 3BR5A 4U88A 2FMLA 5EZGA 2R5YB 1LDKB 1GGOA 2LY9A 4IX7A 1H88C 1JDBB 5LL6b 2VJ5A 2P5VA 2V9KA 2GPSA 4RUAA 4FS1A 3DP7A 4P1WA 4ABZA 1BXRA 2W1OA 3HG9A 4IR9A 3BZ6A 4ED3A 4BBSG 3RYPA 3J7AY 1F43A 1KYWA 1R7JA 3VYSB 4YEJA 5JUMA 1I1GA 2RAEA 4HLXA 4BXXJ 2GA1A 1R5ID 2YU3A 3HOWG 4O3RA 4CXFA 4ECTA 3C2BA 2L5QA 4HPQA 4M73A 3W2AA 5ILUA 2PMZE 4HEA2 2W9CB 4L18B 2L7MP 4TUYF 4A5NA 2OZ6A 2E7XA 4A3CJ 3FM3A 3I4NG 2HGCA 2BHZA 1Y0UA 4LD5A 4E7IA 1KQ8A 1D0ZA 4YJ2F 2DMTA 5DV5A 2R7SA 1O3TA 2YYAA 2ASLA 1LUJB 1UB9A 2ZO4A 3LSIA 2VXDA 3HJEA 2XGQA 4CSWA 4XKVA 2D1VA 1X1CA 1XCBA 1TNTA 1Y8QB 4II2A 4F52A 3HOSA 1S03G 4BGDA 1X1PA 2BXYA 3Q0UA 4JBAA 4U7DA 4IHJF 1ZELA 4BEHB 1SYXB 1QGPA 2LBFA 4HSTA 4RB0A 5A2QW 1OCCH 1YYVA 4F93B 3V6KA 2H27A 2BW3A 4YB8B 2UVWA 4ASNA 1FWZA 2QENA 4QWCA 4C2UA 2V5AA 1P8LA 4XLNF 4A93G 2LR8A
chains in the Genus database with same CATH topology
3BPXA 3WTWC 3HUGA 4OOIA 1AN7A 1RZ4A 4EVIA 3VB2A 5D4SA 1OYYA 2LNBA 3QAHA 2F5CA 2DPDA 1ZLJA 2DLLA 4NHJA 3CTAA 4A0ZA 1QO0D 3HSEA 4MHGA 2Z3YA 3SZPA 3WGHA 4X66H 5F64A 2A68F 4B3RH 2VN2A 3ZMSA 4JI5H 1XNRH 1T0FA 5FLXZ 3ABTA 1ZHSA 2ZXJA 4AIJA 2JT1A 2ZKZA 3DF8A 4KN4X 4O5VA 4BNCA 2XAQA 3F6OA 4BYYA 1D5VA 4I0BA 2YX7A 4DUZH 4I0AA 4P9UA 2L54A 2ETHA 3KZYA 1BM9A 1ZH5A 3PFIA 2CFXA 5D1OA 3WU0A 4M72A 4UV9A 1FKAH 3MCZA 2X0LA 4JI0H 2Y48A 1TNSA 1FBQA 2LF8A 3BAAA 5TJJA 4MGRA 3F72A 5J6XA 1HNXH 3L7WA 2NNYA 4LLGF 1IXCA 1TQIA 5E1WA 2VODA 2Q2EA 3M8FA 1HSJA 2PBIA 5E8GA 2E1CA 5A2QK 4AQYH 4APMA 3KP5A 1MDMA 3VOEA 4M6YA 1U5TA 2V79A 3AAFA 5KK1A 3L09A 4ZYDA 1DDNA 1Z2NX 2QLZA 2XKOA 3PQJA 3ZN0A 5E1ZB 4RB1A 1BN5A 2Q2TA 1IF1A 1L0OC 1ZRFA 4JK1X 4CHUA 5FLXK 3O2PE 1KQ0A 4L9TA 2HVQA 1N32H 2D45A 4IPAA 3DKWA 4ZH4F 2DO7A 2M1BA 4UVBA 4Y17A 3D5LA 3KP3A 2L3DA 4DV6H 4A2UA 2LSOA 1RUNA 4A0XA 5HLHA 5LHGA 1PUEE 1YQAA 3ZMTA 1SD6A 2CW8A 3N43B 1LVAA 4YFKF 3T1HH 1R1UA 3FX3A 3JTHA 2WTEA 3F8BA 3KP4A 1W7PB 3CO6C 4KHPH 1YS7A 5D5XB 3K9TA 3RIZA 2MBFA 3RGZA 3E6MA 4A6DA 2ZBKA 2HZTA 3JW4A 4EFEA 1L2ZA 2EFWA 1E4GT 4MTEA 3RDIA 4BWSC 1AWCA 1FZPB 4OINF 2FE3A 3E5XA 5LLQA 4UVCA 5LMNH 4MEXF 1S7AA 2P6TA 1R00A 4GCVA 3T1BA 3HRSA 1OR7A 4L9JA 4HF0A 2D2WA 2CGPA 1XDSA 3QRFF 2O6GE 4GKKH 2XVCA 5IWAH 4L0YB 4LG0A 1ZGJA 4S05A 2R7FA 2Z9OA 2W25A 1IN8A 4YIIA 4X62H 4M71A 1EV7A 2A6HF 4KIBA 5CVJA 2FA5A 4JI7H 1QQIA 3HTUA 1R5HA 3GYHX 1IUYA 1J9IA 2IA2A 1F4KA 1FSHA 3H3ZA 3RYRA 5CVUA 1HR0H 4LSXA 1SD5A 2EFPA 1FPQA 6PAXA 3GUDA 5FD5A 3KP2A 3WTTC 2IJLA 1GVJA 5LGTA 3BJOA 4EM2A 4EJVA 1JHHA 4BHPA 1B6AA 5DD4A 2RV8A 2WC2A 4ENNA 3FMSA 1V3FA 2HOEA 2O61A 4FX4A 1YS6A 3OTOH 3EYIA 5FGMA 2MCTA 2K02A 2R3SA 4Q47A 2BEOA 2HDCA 2EV0A 1BI0A 4HA8A 3K3VA 1DP7P 1W5TA 5LGNA 2XROA 1SD4A 4I02A 1LDJA 1WWXA 4M9XA 3N40P 1MGTA 2TDXA 4EGYA 4AD9A 4L9VA 5K5RA 1UHMA 2EB7A 2VONA 4ON0A 4Q4ZF 1IBKH 2M5WA 1ZREA 4DR6H 5HDGA 5LHIA 4I2OA 2OQGA 1OMIA 2H09A 1TTYA 2W85A 2PMUA 3SQNA 1HNZH 2JPCA 5LRSA 2V1XA 3HSRA 3CO7C 3IWFA 3N44B 1XMOH 4WWCA 3C18A 1B04A 4G7ZF 3ZN1A 3G3ZA 4CYDA 3WG9A 4CO8A 1I27A 2PI0A 3GO5A 5L3FA 1R23A 4HYEA 1I6UA 1XCVA 1M0TA 1D3YA 5ICGA 2HKOA 2DTRA 3HSFA 4I7HA 3L4KA 1IN5A 4DUYH 4LFBH 2MLKA 4FX0A 3MZYA 3C0FB 2QBYB 1WI9A 3T0YA 2OA4A 3RKXA 4A2AA 3KFWX 4YFXF 5E8IA 5DDGA 3I71A 3WGGA 5DUIA 3O6BB 5H6RA 3GEZA 1WRJA 3I0TA 1YW7A 3T8RA 1FBUA 4UCUA 3JSPA 3L9FA 1N34H 5LEKA 3SXYA 3CLOA 1T2KA 2KIFA 2PJPA 2VE8A 4BXUA 1V4RA 3EDPA 4KDPA 2VUGA 2RQPA 2ZNZA 2JSCA 5L3EA 4XRFA 2QYOA 3BDDA 4M9SA 4MQVA 2Y0MA 2STWA 4DR3H 4GKJH 2AS5F 1S68A 4LK1F 2W84A 2ISYA 2BV6A 2GWRA 2OD5A 3WTVC 2R7DA 4GYIA 4G6DA 3HHHA 2JTVA 2LDUA 1FC3A 1BJAA 3FF5A 3BPVA 5IT3A 2OU2A 4OX9H 4HQEA 1SFUA 1IZ1A 1I94H 2L02A 2VE9A 4ESJA 1E2XA 1B1BA 1YW8A 4DV3H 1B4AA 3DF7A 2RN7A 2EJRA 3RTRA 3WODF 3RPQA 1P92A 3ZP5A 1KU2A 2DPUA 2STTA 1ZG5A 5DUKA 4GLXA 3F21A 2E5LH 5ICEA 3JSLA 1T6SA 2FQ3A 3RGXA 2J5OA 4DV2H 3QU6A 4LH7A 1O3RA 4IJAA 3V7SA 4YG2F 5HS7A 1B59A 1ULYA 2EFNA 1W4MA 3TDUC 1LB2A 4LLLA 2QQ9A 1STZA 1WSUA 4IAJA 3N41B 2W24A 2NYXA 2F5FA 1MD0A 3GX4X 3I4PA 2L01A 3MZHA 1YTYA 5L3GA 3K1NA 1ON1A 3R60A 3IHUA 4KMUX 3I59B 4DV0H 2G7UA 4HZFA 4MEYF 1JHFA 4TV7A 3PN1A 5BOXA 4UFZA 2DI3A 4NB5A 1FVIA 4B3MH 3LWFA 2XAJA 3GFJA 2QVOA 1MKMA 5D8KB 2ZJ2A 3ZPLA 4HX4A 1KA8A 3L2CA 3CUQC 4DV5H 4CC6A 3K0LA 3E5QA 1USSA 2VT2A 2HYGD 2FRHA 2LF7A 4GO1A 1IAWA 1HQCA 4Q0YA 1G4DA 3ML6A 5JFRA 1X3UA 2XAHA 2VOBA 2HVSA 3GFMA 1BC8C 4DNCA 4UCOA 3N6XA 4NXNH 2XAFA 3LA2A 2XIGA 3OV8A 4GYGA 2H6CA 3TDZC 3I54A 3LSTA 4AWXB 4F7ZA 1Z1DA 4I01A 1BC7C 3BY6A 3CUQB 2HTJA 1FYKA 4JI2H 4Z2YA 2YCHA 4GXOA 1HKSA 4IHSA 4M74A 2FNPA 1VTNC 4KICA 3R0AA 1EH7A 2EFOA 4DV4H 3FMQA 3WTYC 3QU3A 4LF5H 1HKQA 3JTGA 2VBZA 3BJ6A 3WTZA 3FXUA 5LEJA 3IL2A 2KJCA 5DEQA 4KIGA 4A12A 4JI1H 3ZMUA 3CUQA 1IRGA 3H92A 3FXRA 3KEQA 4KN7X 1YFHA 2OBPA 5CYVA 4LSAA 4U0WA 4BQAA 1FSEA 1F5TA 2F2EA 3P9CA 3KALA 2P5LC 2P8TA 3K69A 2WV0A 3BOQA 4R1HA 2UXXA 3BP8A 1N33H 1D8JA 2DQRA 4ENKA 3TQNA 2NNNA 2ZMEB 1PDNC 3GZ5A 2A3SA 3CVZA 5F6FA 3V8LA 1J2XA 2FBIA 5BR8H 4LGWA 3T1YH 4PGGA 1YG2A 4XSXF 2ADUA 4GGGA 2OZUA 1J5YA 4FHTA 3I59A 1QZYA 2QQAA 4G7HF 4O6JA 1R58A 3KETA 3DPTA 4EMSA 2UXCH 2HFHA 4N9IA 1GXPA 4A0YA 2F5DA 1NHAA 2ESNA 4LFAH 3DXJF 4RGSA 5HDNA 3MQ0A 4NXMH 2QZ8A 2WYOA 1G3YA 5ERIA 1FT9A 3HRUA 2VQFH 1UCRA 1U78A 5H20A 1JE8A 2J5PA 1FX7A 4QLCU 3C7JA 1M0WA 3ISPA 1ZAOA 1KQ9A 4DR2H 4OMZA 3KAJA 1U8RA 2RVCA 1TA8A 2OQRA 2IRFG 4HF2A 2VBWA 4IRHA 2XV4S 3R61A 1LQ1A 4RB2C 1AOYA 3N42B 1G3TA 3E6DA 2NAZA 2YX4A 4B8XA 3VODA 4CICA 1N36H 3I53A 4HX7A 2LKPA 2CQKA 3KEOA 2CW7A 4Y15A 3F3XA 1K78A 3KP7A 1GXQA 3FHZA 1Z2OX 2EV6A 5E18F 1BBYA 5FD6A 1P6RA 2HQNA 3WGIA 2A61A 2GAUA 1J59A 2CG4A 1LDDA 2EFQA 4U7BA 3F8NA 2XASA 4MV7A 2JZYA 3N4MA 4HX8A 3NQOA 5ILVA 1S7OA 4IF4A 5DD8A 4LFCH 5IT9W 3F23A 2Q2UA 2DT5A 3O3KA 5D5VB 2EA2A 2VBXA 3LFKA 4RAYA 2RKHA 1XB4A 3M7GA 4EEQA 2EV5A 2HYFA 4JYAH 2BBYA 5CVRA 1SAXA 2QWWA 2UXBH 1XMAA 4LFUA 3LAJA 2OWOA 3QOPA 4LF8H 2VQEH 4M6XA 2PN6A 2P7CB 1YLFA 1SD7A 2BGCA 1CF7A 4HAMA 3RTXA 1O3SA 1OPCA 5TRDA 1T38A 1HW5A 2GXBA 2VPSA 4ESBA 1QBJA 4OIPF 1HBXG 3KZZA 3ROUA 1JXSA 1IN6A 5K5QA 4JQFA 3TO7A 4IRIA 1FBSA 5ICCA 2FXAA 4MV9A 4B3TH 1XGOA 4PCQA 2A69F 3TKYA 2VXZA 5FPRA 1RIOH 1TBXA 2XHKA 1R22A 3FZVA 5HDKA 2HWVA 1HNWH 3QPHA 5ILSA 2CW0F 1FYLA 1R5GA 4UXNA 2VOOA 3ZMDA 3BA9A 5CLSA 2XKPA 4LF7H 1DPRA 3BABA 4XSZF 4E70A 3TOAA 4ZYHA 4OU0A 2PEXA 2XGXA 4EJUA 4UNOA 1ON2A 1Z91A 3MFKA 4ENMA 1HXDA 1XSDA 2FF4A 2HKXA 2KIMA 5BMZA 3DQVC 3LA3A 4JI6H 4JI4H 1IBLH 4UV8A 1ODDA 4A6EA 1TQMA 3C3WA 4NQWA 4HBLA 1RNLA 4LB6B 4AVPA 3KXYT 4HW0A 1W5SA 4G6QA 1XGSA 3WU1B 5D8LB 3H3UA 1EH8A 4OIQF 4PDBA 4YIFA 1B9NA 1MJAA 2UUCH 2FOKA 4RB3C 4I09A 2V1DA 2GIVA 2K27A 1QNTA 1WQ2A 1E17A 4YHHH 1CGPA 4LF9H 2P7VB 4KT5C 4OMYA 1S29A 3I64A 1BIBA 5FB2A 2QM3A 2DK8A 4ZYEA 1V9PA 4U0VA 3JAMW 3M9AA 1LJ9A 1FJGH 4WXDA 1LEAA 4G7OF 3L4JA 2IA1A 1Z6TA 3LQQA 4XLPF 5D4RA 2VOPA 3UQ8A 3ERED 1J5EH 5ICFA 5FO5A 3F8CA 2ESHA 4HQMA 3E6CC 4LK0F 2UXNA 3IG0A 3MEXA 5EOYA 4RS8A 2MH9A 4MQ9F 1XDUA 4MTDA 2ZMEA 4PDKA 4BH9A 4QWQA 4PGHA 1WKMA 2G7HA 2MH2A 3U9GA 1Z6RA 1FYMA 1E4FT 4CGZA 3FMAA 3RPUA 4ZZDA 5DCMA 1ZG1A 2Y75A 5HLGA 3BA8A 1SMTA 1OYWA