4RB0A

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-apo-fur
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 40
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb0A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb0A02
3LA2A 1ZG1A 2ZXJA 5L3FA 1SD7A 1FP2A 3I64A 2K4BA 2PI0A 4UHTA 1P4AA 4RGRA 2MH9A 2OZUA 1DDNA 4G94A 1VTNC 2EWNA 2LF7A 1KGSA 5FFXA 4H0EA 2M45A 2VT2A 1XDSA 4KN7X 1O7FA 4HDVA 1SD4A 3D0SA 4LG0B 1EH8A 1O57A 4WK8F 5CVRA 5LRSA 3T8RA 3EYYA 3SZTA 1KYWA 4I0BA 4IPAA 2XAGA 2HKOA 4NB5A 3GF2A 4IJAA 2LNBA 1W7PA 5IT9Z 4HX4A 1FC3A 3F8CA 5ICFA 4PZJA 5D5WB 1TNTA 2EB7A 2IJLA 2V9VA 3GXOA 4L9JA 1KYZA 5L3CA 3MZYA 3MAJA 4U88A 3QRFF 1YS6A 2P5LC 3PFIA 2MBFA 5FLXK 4G7OF 1R58A 4EJTA 1U8RA 3RKYA 4Z2YA 1K78A 2BBYA 3I5UA 2P7VB 4UXNA 2D45A 4CZZA 2HYFA 5CJ9A 3KP2A 3MWMA 1P6RA 4IXAA 3V7CA 1SD5A 5J6XA 2PBIA 1HKQA 3I59B 4KFCA 2Z3YA 1BI3A 3VEPA 3WE3A 3GVAA 5L3GA 4LD5A 1BIBA 4EV0A 1FBSA 3EQLF 3NQOA 4LGWA 4M6XA 5D5UB 2YR2A 3GFMA 3T1BA 3BOQA 3ABUA 4HZFA 1ZGAA 3KZZA 1A04A 4PCQA 2J5OA 3FXQA 3K1MA 1IN8A 4CYDA 5LHGA 4D0PA 1XD7A 4A12A 3RKXA 2FSWA 5BOXA 1XCVA 1ZH5A 2JRTA 2ZFWA 3F3XA 2O0YA 2VE8A 1UFMA 1UHWA 2VXZA 1SFUA 4ASNA 3VODA 3HSEA 2R7FA 4EM2A 2P6TA 3E6CC 1W4MA 1D8KA 1T0FA 4Q47A 1WWXA 4KICA 4EM1A 5F1RA 4KA4A 3DPTA 2JTVA 4MGRA 1R22A 4G7ZF 1USSA 3FF5A 3KLNA 2JPCA 2ZCWA 4WWCA 5LEJA 4HYEA 1BOAA 3E6BA 2B0LA 3LFKA 2VBYA 5DUKA 1RNLA 1KU7A 3FXRA 1XN7A 3KETA 1LJ9A 1R23A 5DDGA 2F2EA 3TO6A 1FNNA 4RB3C 1MKMA 5HDNA 1QPMA 2STTA 2OD5A 5JR3A 1J75A 3KP3A 3V8JA 1DP7P 4PGGA 3DXJF 1FP1D 3ZQ7A 4MQ9F 4UV8A 5F6FA 1KQ0A 2E7WA 2W24A 4JQFA 4OMZA 2NNYA 4ESFA 2VC0A 2Z5UA 2BYVE 2KRFA 4KMUX 1O7LA 1QBJA 3WTSC 1FY7A 2ZBKA 1YQAA 3NEUA 1OKRA 3HOTA 4HQEA 4KMFA 4BXUA 2FBIA 2UXNA 3JSOA 4AIHA 1S7OA 2A68F 4AD9A 4M72A 4LLNA 2FU4A 2EA4A 2Y48A 3GLXA 3HHHA 5DYMA 1YW9A 1G3SA 4RB0A 4KDPA 1R36A 3BPVA 5KK1A 3U1DA 5HLHA 4UUVA 3BJ6A 2IP2A 2DPUA 3B73A 1HBXG 3ML6A 1SFEA 2R7DA 1XGSA 4HAMA 1UCRA 1LVAA 2YX4A 1T39A 1QNTA 2L3DA 3E5XA 4WXDA 1PDNC 3ZMUA 3ZMZA 1Y0UA 5ICCA 5E8GA 1S6LA 3I0TA 2QQAA 4MTEA 1K79A 5D8LB 3V8LA 1YYVA 3F21A 4GXOA 1WRJA 1Z1DA 3WTZA 1BI0A 1HSJA 4OOIA 3D5LA 3FMRA 5AIQA 1TW2A 4L0ZB 3LAJA 1O3TA 2D1HA 2OU2A 2YX7A 3HOSA 3QPHA 2Y75A 2PEXA 3Q5FA 5LGTA 2ZNYA 2GIVA 2KIMA 2HWVA 2OA4A 1O3RA 4ENKA 2VONA 3J81Z 3LA7A 1MDMB 4LLLA 4I2OA 2W25A 5FGMA 1P4XA 5ERIA 2MLGA 3ZPLA 4L9NA 3TOBA 2P5VA 1K6OA 3SXYA 1MZBA 3SZPA 3N4MA 1U78A 4KIBA 4LB5A 4HA8A 1IXRC 4LB6B 4WCGA 1B4AA 1J9IA 4LFUA 1W5SA 2IA1A 1B6AA 4TV7A 4A0ZA 1TBXA 3ZMTA 4RB1A 1YW8A 2VBXA 1XDUA 3BZ6A 3GZ6A 1F1ZA 3GW2A 5K1YA 1V4RA 4Y13A 2STWA 1FYMA 3RYRA 5CVVA 5L3EA 4L9VA 4XBFA 5LGNA 3IC7A 3H92A 5FLXZ 1H0MA 2EFQA 4HX7A 1ZG3A 2LSOA 2NNNA 2CW0F 2ETHA 2RGVA 1TQPA 2GA2A 5JVTA 3RTRA 4CICA 1B1BA 2ESHA 1YIOA 1QZZA 5BQTA 5JHUA 3K1NA 2CWEA 1OPCA 3FMQA 3QPTA 3U9GA 1LQ1A 2V1DA 2V79A 2O03A 1T38A 1S8NA 3CTAA 2AS5F 3PQKA 3J80Z 1NHAA 2WTEA 4EJUA 5CYVA 2QLZA 3WTTC 1XSXA 3FM3A 1YFHA 3TQNA 3Q9VA 4G9YA 3M8EA 2FXAA 1MJ9A 3REOA 4ZYDA 4M73A 5LEKA 4BH9A 5HS9A 3EUHA 4HX8A 4RB2C 1J2XA 5LBQA 3RJPA 1I5ZA 2UWMA 1FPQA 1ON1A 1BI2A 4Q5SF 4DNCA 2QZ8A 1IXCA 1LEAA 4WXCA 1SAXA 1U5TA 1ZARA 1PP7U 2K4JA 3QP5A 3ZMVA 3V7SA 2XAQA 2YU3A 2K27A 4LMYA 1JXSA 2G9WA 1F4KA 2PMHA 4EM0B 1OMIA 3TDUC 1DUXC 4IRIA 5D8KB 3WTVC 2CFXA 3FZVA 1I27A 3GYHX 2ZJ2A 5J8CA 2V6CA 3SQNA 3JTHA 3R0JA 2EFWA 2P5KA 3HRSA 3K9TA 2VC1A 2GZWA 3IKTA 2K02A 4YIFA 2XVCA 3E5UA 1HXDA 3KEOA 1KU3A 5ILVA 4UV9A 1ONVA 3FWEA 2FOKA 1R5GA 4Y15A 1YTYA 3R0AA 1G6NA 3P9CA 5DUIA 2YPRA 2DK8A 1BI1A 2VN2A 2EV5A 3PQJA 2P6SA 4P55A 1IRFA 3T0YA 4R1HA 3M9AA 1USTA 2HDCA 3I53A 3R60A 1T6SA 2RQPA 2MA3A 1U3EM 3BP8A 1R7JA 4G7HF 2XV4S 1Z6RA 2MD5A 5AONA 3KLOA 2COMA 3ULQB 3ISPA 1XB4A 2FMYA 5D4SA 1Z7UA 2CG4A 1BBYA 2AXLA 2OQGA 1SD6A 5H6RA 2M30A 2KIUA 2CGPA 2QVOA 3K0LA 2V1UA 2Q8KA 1IUYA 2Z9OA 4UVBA 2A07F 1SFXA 3L09A 3C3WA 3C18A 3J80K 2E1NA 2HTJA 3J81K 1RZ4A 1FYKA 1C0WA 4E70A 3KFWX 1R00A 4I01A 2JZYA 2JT1A 4P5OA 3I54A 2J5PA 3BPXA 2FEZA 1FOKA 2X4HA 2ELHA 1ZRDA 1WQ2A 4A5NA 5KVRA 1IN6A 2DQLA 2WWYA 4N9HA 1ZLJA 4HBLA 5LRRA 5F64A 5JFRA 1YG2A 1LDDA 3L7WA 5DEQA 4MEXF 3P9KA 1MGTA 1ZG5A 5DD8A 2KJCA 1U5TC 1ODDA 4L5IA 4GYGA 5HDGA 4L5JA 3OV8A 5A2QK 2FQ3A 4IRGA 1G4DA 1J5YA 4XRFA 1IRGA 5ED4A 4A0YA 1IZ1A 3ABTA 5E1WA 2F5EA 4MQVA 1BM9A 1PUEE 1HW1A 2WC2A 2PLYA 2F5CA 4FT8A 1MD0A 1ULYA 3DV8A 1S29A 1EV7A 4HF1A 3TOAA 4P9FA 2QBYA 3AAFA 2VBWA 1RI7A 2Z99A 5D5VB 2A69F 3E3VA 1IXSB 5E20A 4PDKA 1O3QA 2A6EF 5BS6A 2TDXA 1R1VA 4BAYA 1IW7F 1K78B 1IF1A 1E2XA 4P9UA 4OU0A 2LDUA 3QP6A 1MJAA 2CSOA 2QQBA 3M8FA 2O61A 2EK5A 3WG9A 4B8XA 3HRTA 3LWFA 4HV6A 3MQ0A 5DCMB 4IVNA 4ZH4F 1RIOH 4FX4A 4BYYA 5D6FA 2RN7A 2QENA 2IVMA 3HIFA 3C7JA 1STZA 4M9SA 2PMUA 2HR3A 4HOBA 3O2PE 3ECHA 2JSCA 1FWZA 1WSUA 2XAHA 4RGSA 1D5VA 3WU1B 3GWZA 1XGMA 1Z9CA 5J8FA 2QQ9A 4KNYA 1D8JA 2VODA 4O3MA 3BY6A 5HOOA 1OYYA 4Y17A 3QU3A 4B09A 5CVUA 4AVPA 3R6SA 4EMSA 4HDUA 1ZGJA 4KT5C 1P4WA 4GCVA 4EGYA 1P2FA 2H94A 1F9NA 4EVIA 2L54A 4CO8A 3V7RA 4M74A 1SMYF 4U0YA 1R1UA 3BDDA 4LLGF 3H3ZA 1DPUA 3LA3A 2VOOA 4QWQA 4RGXA 3ZMSA 4NQWA 1I1SA 4NHJA 1LDKB 3RIRA 1DPRA 3DKWA 4CGZA 1Q1HA 5HLGA 1IN5A 4L0YB 1FBQA 2KKOA 4I7HA 3R4KA 3W6JB 1B59A 3DEUA 2H6BA 4EJOA 2MC3A 1T98A 4BHCA 4R8HA 3RPQA 4IF4A 4CHUA 1XMKA 5EEHA 3TGNA 2XKPA 2PJPA 1AWCA 5LGUA 4CXFA 4ON0A 4A0XA 4R79A 2RVCA 4U0VA 3K69A 2FBKA 2IA2A 5E17F 3KZYA 2ACJA 3FX3A 1W7PB 3CUQA 4KN4X 4XSXF 1LNWA 2ESNA 2OAZA 1REPC 1U5TB 1LDJA 3SHFA 2HGCA 2NRAC 3RDIA 2HYGD 3GX4X 3BROA 4I02A 1BC7C 1HSTA 2L4AA 2H09A 5E1XA 2H27A 3I4PA 3ZP5A 5ICEA 2F5DA 3IWFA 1K7AA 3ZN0A 1UB9A 2BGCA 4U0WA 4MTDA 5E1ZB 2FMLA 1JHHA 3V4GA 3DF8A 2F5FA 4A6DA 3FXUA 2XAJA 2FRHA 1FZPB 3WTXC 3ZMDA 3E97A 2EV6A 3I58A 1J59A 4A5MA 1WKMA 1ZRFA 5HLIA 3H3UA 2FNPA 3TKYA 2QWWA 1KA8A 2O3FA 3RKWA 1X3UA 2GXGA 3G3ZA 3IRQA 2WV0A 3QOPA 2HQNA 2VE9A 1SMTA 3JAMZ 1ZRCA 1TLHB 1QZYA 3KP6A 4DQ2A 4YFNF 3J7AO 3COAC 4GGGA 3KP4A 3VB2A 2M1BA 2W84A 4LK0F 3IKVA 1G3WA 3LQRA 1ZYRF 5H6QA 4AWXB 1ZN2A 2G7UA 3FMSA 2RKHA 2GAUA 3M7GA 5H20A 3U2RA 1FBUA 3WGGA 4FHTA 2CO5A 4O5VA 4HF2A 2XKOA 2NAZA 2Y0MA 5BPIA 1HW5A 2IT0A 3NRVA 1H9TA 1QO0D 5EEGA 1B9NA 3WTUC 4OINF 4I09A 3S2WA 3K2ZA 4XLNF 2XASA 3M1EA 3CDHA 3JTGA 3HTUA 1QGPA 4HQMA 2GWRA 2ZKZA 3Q9SA 3F8BA 1YLFA 3LQQA 4M9XA 1U2WA 3WGHA 4OMYA 2GA1A 1KU9A 5D5XB 4ZYHA 1P92A 5D6EA 4HLYA 2IA0A 3I71A 2E7XA 5FD6A 1KQ8A 2DFIA 2GQQA 2CQKA 3E6MA 2ZNZA 5TJJA 1BC8C 2HS5A 2XIGA 2CYYA 5AIPA 4LJZF 2M87A 1JGSA 1GXQA 3DP7A 2D2WA 2L01A 2HEOA 2YSRA 5HDKA 1CF7A 3VFZA 1TNSA 1JHFA 4CDGA 1UHMA 3WODF 4OIPF 2HTSA 3RYPA 1YO5C 1BN5A 5LLQA 1B9MA 1T2KA 1IAWA 2R3SA 2DI3A 2RV8A 4YFXF 2MH2A 2UXXA 3CJNA 1U6GA 1QQIA 2OBPA 3GEZA 1LB2A 3EETA 4ESJA 2ADUA 3I59A 1GHCA 3C1DA 4Q4ZF 4LG0A 2BV6A 2KIFA 1S7AA 3B02A 1W7PD 3GZ5A 2XROA 3F8NA 1CF7B 3JAMK 3F72A 4ENMA 3BJOA 3OOPA 4M6YA 1KU2A 2DW4A 3IHUA 2HZTA 1D3YA 1GXPA 4WXHA 3MFKA 1FLIA 4BHPA 4ZZDA 3DFGA 3F22A 3GFLA 2ISZA 2O6GE 3SFZA 2QUFA 3HRUA 2L02A 3L9FA 1F5TA 1ZHFA 2A6HF 3ZN1A 3HYIA 2Z33A 5HVQC 4L9TA 2NS0A 3LAPA 2X0LA 2K7LA 2JPBA 1FT9A 4KUMA 1V3FA 1BIAA 3WTWC 3W6KB 3HTSB 3TO9A 2W57A 1E17A 2XHKA 2EJRA 4N0BA 4OIQF 5K5RA 4N9IA 5D4RA 6PAXA 1R5HA 4XSZF 2ISYA 2Q2EA 2M8EA 2IRFG 2FA5A 2PFBA 3ELKA 4AIKA 4OIRF 4BHBA 4GYIA 4ESBA 4EGZA 3HHGA 4LK1F 1ZLKA 3KP5A 2QBYB 4U7DA 1XSVA 2HFHA 5A2QZ 2UZKA 3HSRA 3HSFA 3IRRA 4JK1X 3CUQC 1RUOA 2H6CA 3GFJA 4HLXA 4IHTA 2DBBA 1OYWA 2A5YB 1TW3A 1LEBA 4EJWA 2G7HA 3BWGA 2EV0A 4RAYA 4G6QA 4WX9A 5K5QA 5IT9K 2PG4A 4UVCA 2ZO4A 4MNUA 3WTYC 1R1TA 1FX7A 3CUOA 3VOEA 4YG2F 5IT3A 4AIJA 2BE5F 4RGUA 2XAFA 4RS8A 1ZAOA 1H9GA 2DO7A 3R61A 5K5OA 4ZYGA 3MEXA 4QLCU 4IHSA 2LKPA 3ROUA 3ERED 4OIOF 2XUBA 1TQIA 2W85A 3RI4A 4BNCA 2D1VA 2HKXA 4XLPF 1YS7A 1W5TA 2QM3A 1FSEA 4HF0A 1XGNA 1G3YA 3GUDA 2GXBA 5L3DA 2FBHA 5BPDA 3DPLC 1HKSA 3MZHA 3F6OA 2NYXA 2EFOA 2ZMEB 2XGXA 2RDPA 3CO7C 3O3KA 3QAHA 3T8TA 2C6YA 3LSTA 5FD5A 3FHZA 4ZZLA 4M9ZA 2OZ6A 2VOPA 4A6EA 2FNAA 1FYLA 5DCMA 1XMAA 1JE8A 2A3SA 1IN7A 3CLOA 4EQQA 5FFZA 2EFPA 3EDPA 2EA2A 3F6VA 2RC4A 4L18B 1WI9A 1BJAA 2P4WA 4I0AA 2L4MA 2O8XA 2HOEA 4UNOA 1EH7A 3QU6A 2IW5A 4A2UA 1O3SA 1S3JA 4M71A 3MCZA 5L3BA 1Z6TA 1MJBA 4S05A 4EJVA 4UVAA 3F8FA 5JI6A 4KYWA 4G8XA 3IL2A 2DK5A 4WF2A 2DTRA 1CGPA 1HKTA 3FM5A 4ENJA 4S04A 3F23A 2VT3A 2XRNA 4YIIA 1MDMA 1L3LA 4ZYEA 3G73A 3EYIA 2FE3A 2M5WA 5TRDA 1Z05A 4HV5A 3IWZA 5ILUA 1L0OC 2PN6A 5E8IA 2DT5A 4IRHA 5LHIA 3JW4A 1J7KA 2A61A 3O6BB 3TDZC 4ETSA 3HRMA 2DPDA 5HS8A 2OQRA 2DAOA 2DQRA 3K1PA 3P9IA 3CO6C 3BJAA 3KCCA 2IPQX 1YW7A 2RNJA 2P8TA 1I6XA 2FF4A 5E18F 4RAZA 3E6DA 2P7CB 2Q0OA 3WE2A 4FX0A 5LHHA 1IN4A 3F8MA 2PQ8A 1HW2A 2EFNA 3V8KA 4K2EA 1XGOA 5DV5A 5FB2A 4O6JA 4F7ZA 4BQAA 2DLLA 4MHGA 2E1CA 5CVJA 1RUNA 1OYIA 1FSHA 3WU0A 1Z91A 3L2CA 3TO7A 1TTYA 4KIGA 1ZREA 1TQMA 3WGIA 2LF8A 5HS7A 4GO1A 3RPUA 1I1GA 3P7NA 2QYOA 5CVIA 4P96A 3GO5A 5FO5A 2V1XA 4Q48A 5ILSA 1ON2A 3CUQB 3T5XA 1GVJA 1PP8F 4YFKF 3GFIA 4PGHA 4MEYF 4JBAA 3JSPA 4U7BA 3KE2A 5DD4A 3L00A 2K86A 4HW0A 1XSDA 1HQCA 3N97A 5ICGA 5CLSA 4KIFA 1XCBA 1AOYA 3KP7A 3DQVC 2DU9A 2KJBA 3KEQA 2ZMEA 1J0RA 5DCFA 1KQ9A 1OR7A 2VBZA 1EH6A 2BEOA 5BMZA 3E5QA 2MLKA 4G6DA 2HQRA 3HUGA 4ENNA 3ECOA 1G3TA 4I98B
chains in the Genus database with same CATH superfamily
3LA2A 3OYBA 1ZG1A 2ZXJA 5L3FA 4B3MH 1SD7A 4O4LF 3DEEA 1I7LA 1FP2A 4WD3A 4QW9A 1X4OA 2IGOA 2K4BA 3I64A 2PI0A 4RA2A 4UHTA 1P4AA 4QWBA 1Y14B 4UCUA 4PWQA 4UCVA 4RGRA 3OS2A 4U87A 2MH9A 2OZUA 3FXOA 1DDNA 2FK3A 3AG4H 1DV1A 4G94A 1VTNC 2W9CA 2IS1A 2EWNA 2KFDA 2ME6A 3J7ZI 2LF7A 1KGSA 4UY8I 5FFXA 5M5YJ 4H0EA 3EUAA 4JX4A 2M45A 2VT2A 1GLNA 1TT0A 1XDSA 4NC6A 2QEXI 2COBA 2XSDC 3RF2A 4KN7X 3S14J 2OCCH 4DR3H 1ZETA 1O7FA 1SANA 4HDVA 1W96A 2YU9A 1SD4A 1SVMA 3D0SA 2X85A 4M3GA 4RLFA 4LG0B 3S1NJ 2DFHA 1EH8A 3CJQB 1X3WB 2LP0A 3X2QH 1VQKI 3VSKA 2R92J 2B63G 1O57A 4ECQA 4ECZA 4WK8F 3RAQA 5CVRA 5LRSA 3T8RA 2R5ZA 3EYYA 4F3QA 3SZTA 1KYWA 3KYLA 1SCUB 4I0BA 4IPAA 4BE2A 2VXDA 3IG0A 2XAGA 2ECCA 2HKOA 3RB3A 4NB5A 1XS9A 3K2AA 3GF2A 4IJAA 2LNBA 1Z21A 3QQAA 1W7PA 5IT9Z 4HX4A 2EIJH 4RZRA 4J0MA 2VOBA 1FC3A 3F8CA 2GXAA 5ICFA 4PZJA 3I12A 2FPPB 1NH3A 4JX6A 5D5WB 4XN0A 1P7IA 2E1MC 2KIQA 1IO2A 2DWCA 1OCOH 2VKEA 1TNTA 2YRWA 4KITB 2YZNA 1EA3A 3M9NB 2XGCA 2EB7A 2IJLA 2V9VA 4DYQA 3RKQA 3GXOA 4L9JA 3GTOJ 1X1DA 1MMAA 5DLGA 3Q8RB 1MH3A 3OIPA 2NU8B 1KYZA 5L3CA 3MZYA 5J47A 2KP6A 3MAJA 4U88A 4XYLB 3QRFF 1YS6A 3BR2A 2P5LC 1JKQC 3PFIA 2MBFA 3FHNA 4MV8A 2V59A 4XOPA 3L2WA 5EEAA 5FLXK 4JI5H 1PX2A 2CZGA 3PNTA 2W6NA 4EYIB 4G7OF 1R58A 4EJTA 5IYDJ 4DV1H 1U8RA 1A36A 3H4BA 2YW2A 3RKYA 3SYTA 3CMAI 5IT9W 4Z2YA 3DEWA 1K78A 2BBYA 1VBHA 5CAEB 5B1BH 2X0SA 3U9TA 4BACA 3I5UA 3L4JA 1UZCA 3GTJA 2NVXJ 1W1WE 4JV5H 4XOTA 4BBRJ 3OTOH 2P7VB 4C2MA 4UXNA 5FKLA 2R7XA 2D45A 2VQCA 4CZZA 1WJCA 3G1OA 4R8UB 2R5YA 3GILA 1V54H 2HYFA 1QA6A 2VUMJ 4YR3A 5CJ9A 1YOVB 1YJ9I 3KP2A 3MWMA 1P6RA 4IXAA 3V7CA 3QYBA 2YL2A 1X58A 1N32H 2SCUB 1OCPA 1SD5A 1X2MA 2MW8A 4NBQA 5J6XA 3RJ0A 4RDUA 1ETYA 2PBIA 1OCZH 3GIKA 1HKQA 3I59B 4KFCA 2Z3YA 5C4XJ 3PW5A 1BI3A 3H5NA 3KXYT 3GIMA 3DLAA 5I47A 2C2RA 3VEPA 2JA8J 3WE3A 3BR0A 4XORA 2P0AA 2QYZA 3GVAA 2WY8Q 5CB4F 5KFPA 2DMUA 4ED1A 5L3GA 4LD5A 1BIBA 4EV0A 1MNMC 5C3EG 3N05A 5KFHA 5DM7F 1FBSA 2R7LA 3RIZA 2UVWA 3PL8A 1DGSA 3CC4I 2W9BA 3EQLF 3NQOA 4LGWA 4M6XA 5D5UB 2YR2A 3CMYA 3BQ2A 3GFMA 2XCPA 2YZGA 1JKPC 4BBRG 4XKBA 3T1BA 4CYCA 1VQMI 4DV3H 3BOQA 3ABUA 4HZFA 4RZQA 1H88C 1ZGAA 3KZZA 1A04A 3RB4A 4OAYA 2BXYA 4PCQA 5LP6F 2J5OA 4ZOLF 5F0HA 4R8UA 2FP4B 2DT6A 3FXQA 1R6RA 3K1MA 1HC8A 2O7OA 1IN8A 3FK7A 4CYDA 5LHGA 1TWHJ 4D0PA 2V7FA 2Y69H 4A3KJ 3RB0A 1XD7A 2JA5G 4A12A 3RKXA 2FSWA 5KFEA 2DJIA 2M8GX 5BOXA 1W5CC 1XCVA 1CQJB 1N48A 1GLVA 1BR1A 1ZH5A 2JRTA 2ZFWA 2UVRA 4Q44A 3F3XA 2W6PA 4M7EA 3QZ7A 2VXZA 2O0YA 1UFMA 1UHWA 2VE8A 1R4NB 3DCFA 3K7AJ 1SFUA 2F6CA 4ASNA 3I3LA 4X1EA 3VODA 4F93B 3J80W 4F4ZA 1POGA 5LMNH 3HSEA 2V9WA 2XSJC 2R7FA 1QZEA 4EM2A 2KRCA 2P6TA 2E5ZA 3E6CC 1W4MA 5KFZA 1D8KA 1T0FA 3WNZA 3R23A 4Q47A 1WWXA 2DA3A 4KICA 4EM1A 5F1RA 5HLTA 4KA4A 1JT0A 2A5WA 2PMZN 3DPTA 2JTVA 4MGRA 4A3DJ 1R22A 2IEKA 2WB1A 4G7ZF 2BW3A 2BQ3A 4NXMH 1VBGA 1USSA 3FF5A 3U1KA 2F5VA 4CYCB 4OAZA 1FOXA 3HB9A 1MBHA 3H5RA 3AFHA 1P8LA 3KLNA 1AA7A 2JPCA 4IZZA 1Z2NX 2BY1A 3BLYA 3GTLA 4NLGA 2ZCWA 2W7NA 4WWCA 3H4DA 5LEJA 5KAIC 4HYEA 2DA6A 1Z77A 4BEHA 1BOAA 3PO2G 3E6BA 4E7JA 4GLXA 2B0LA 3K4CA 4YP3A 2X1CA 3LFKA 1K83A 2VBYA 3NGDA 1FTTA 5DUKA 1AKHB 1RNLA 1T0FC 2EBIA 3BQYA 3TL4X 4BY7J 1KU7A 3FXRA 2RF4A 3WO0A 5BPFA 3GTMA 1XN7A 1WVRA 5IYCG 3KETA 3H3VH 3JZIA 1LJ9A 1R23A 5DDGA 5LA6F 2XC9A 2M34A 4B4CA 2F2EA 4JV1A 3TO6A 5LFAA 1FNNA 2UVVA 4K0KH 5DM6F 2JEJA 4RB3C 1MKMA 5HDNA 1QPMA 3GMEA 5FRNA 3LSHA 2STTA 3VWBA 4HR7A 1VS0A 4IHXA 3RV3A 1KJ9A 2OD5A 5J40A 5JR3A 1J75A 3KP3A 3V8JA 2MSYA 3L2VA 1DP7P 4QPQA 2KPMA 4PGGA 2OTJI 3DBHB 1AUXA 2W6QA 2QKLB 4GFBA 3GIIA 2B63J 2R92G 3DXJF 4GRIA 2CUFA 1I3QA 1FP1D 3M8JA 1E0EA 3BZCA 3ZQ7A 4MQ9F 4YHHH 4UV8A 5F6FA 2GLTA 1JJ8C 2W8LA 1TWCA 2VL8A 3GBGA 4Y7NJ 2L2OA 4QWAA 3GTKA 1HDDC 1KQ0A 2KZVA 1W93A 2E7WA 3OYMA 2W24A 4JQFA 4XLEA 5C8YF 4OMZA 2NNYA 4ESFA 2VC0A 2Z5UA 1PYVA 3OYCA 2N8GA 3LFUA 2BYVE 4EBCA 5IOZA 1JJ6C 2KRFA 4KMUX 3G4SI 2QSFX 2DOFA 3M07A 2FK2A 3LSGA 2V5AA 2DPJA 3CMEI 1S0MA 3VPRA 5KFAA 1JKOC 2LY9A 1O7LA 2KT0A 1QBJA 2EZHA 2IGNA 5KFLA 4PSWA 4ECXA 3WTSC 3ZQQA 3W6VA 4J9RA 1FY7A 4TV8F 3QFFA 2ZBKA 1YQAA 3RSNA 2KISA 3NEUA 2P0WA 3PFYA 5C4JJ 2AGPA 5KG3A 2AO9A 2RAEA 2OH2A 1OKRA 3HOTA 4HQEA 4C5BA 4C2TA 1J5EH 2B7EA 5E3MA 4KMFA 4BXUA 2FBIA 5EWFA 3PW7A 4HYKA 4AYBN 1K1QA 1JUMA 2UXNA 3JSOA 3E0JB 4AIHA 2VQDA 4C2UA 2W6MA 3HGYA 4YBZB 3HXLA 1S7OA 2A68F 1G2HA 5A2QW 2HXOA 4J9KA 4AD9A 4M72A 4LLNA 2FU4A 2EA4A 2LR8A 2PMZA 2CH0A 5KKNB 2W8KA 4A3EJ 2Y48A 2WAFA 5GONF 3K6GA 1WH7A 3GLXA 3BG7A 3HHHA 3BA8A 5DS9A 2DN0A 2WDTA 2EIKH 5DYMA 5KT5A 2ZB9A 2NVTJ 4J9PA 2UUBH 2Y31A 1YW9A 1G3SA 4RB0A 1E4FT 2R7OA 4KDPA 4BU2A 1R36A 3BPVA 2E35A 4D7MA 1GO3E 5KK1A 3U1DA 1WCMJ 5HLHA 3CQZA 4UUVA 4B43A 4DIQA 3BJ6A 2IP2A 1ITYA 1U0JA 4CSWA 5D1OB 5CPRB 2RREA 1UC8A 5J1UA 2DZDA 2DPUA 4IOCF 1LFPA 2JA7G 3B73A 1HBXG 2HDDA 1ZELA 3ML6A 1SFEA 2R7DA 1XGSA 4HAMA 1VAJA 1UCRA 3F0CA 1LVAA 2YX4A 1JDBB 2W1OA 5GAHJ 1T39A 2ELKA 1QNTA 2FJZA 5BPHA 1D5YA 2L3DA 2CQXA 1ETXA 3E5XA 5FPOA 4WXDA 4YJ3F 4IL6C 5IP9G 2AU0A 5B1AH 1PDNC 5DG9A 5KT4A 3L2RA 3A02A 3Q0VA 3ZMUA 3CP2A 2R6FA 3ASOH 1SFOA 3ZMZA 2B9SA 1G8XA 4BL0B 2EPFA 1Y0UA 5EDWA 5ICCA 2LKXA 1JTYA 5E8GA 3PIOF 2FB9A 1S6LA 3I0TA 4CH7A 2CQYA 2QQAA 4C2MJ 3LSKA 3Q0WA 4MTEA 4A3GJ 1K79A 4XLFA 2VA3A 1OLTA 4MA0A 2FX0A 5D8LB 2NU9B 3V8LA 1YYVA 4ECTA 3F21A 4AYBE 3PZPA 4RAGA 4GXOA 1WRJA 5GTIC 1HNZH 4UB6C 2PJRA 5KFVA 1Z1DA 3WTZA 4FS2A 5FPRA 1BI0A 2W70A 4LIVA 2EZKA 1B8IB 1FIAA 1HSJA 1CQIB 5J1RA 1WJ5A 5GAGJ 4X65H 4OOIA 3D5LA 2W82A 3I4MG 2WB1E 5K2MA 3L1PA 3FMRA 5AIQA 2UUAH 1TW2A 1N25A 4L0ZB 2LG4A 1WCMA 5JQWA 4V2FA 3CESA 3PUBA 3LAJA 1O3TA 3ORQA 3BR5A 4F92B 2D1HA 2OU2A 2YX7A 1APLC 3HOSA 2KQRA 4O3RA 3CJRB 3QPHA 1K61A 5EZYF 2Y75A 3ZXSA 2PEXA 3BT9A 3Q5FA 3KHHA 1K83J 2RDIA 2DMTA 4XYMB 4XL9A 5LGTA 3A01A 1KJQA 2ZNYA 3HOVG 2EIMH 2GIVA 1YRNB 1JX4A 2KIMA 3M3YJ 3EUHC 3G8CA 2HWVA 2OA4A 1O3RA 4ENKA 1VQ5I 2VONA 3K10A 3J81Z 3LA7A 2NVQJ 1MDMB 1Z2PX 4LLLA 1RC9A 5H2FC 4I2OA 2W25A 5FGMA 3OYAA 1VI0A 5EGOA 1B04A 4B3RH 1P4XA 5ERIA 2MLGA 4IQJA 3ZPLA 4L9NA 1ZK8A 3TOBA 4LFBH 2M7AA 2P5VA 4RAFA 3OR2C 1K6OA 3ABKH 1FJLA 3QZ8A 2DMNA 2DDBA 2XAUA 3SXYA 1MZBA 4XK4A 3SZPA 1J09A 3N4MA 5GP9A 1U78A 2MD0A 3OSFA 4KIBA 2HI3A 3NWTA 4FASD 3BC8A 2R93G 2RGRA 2BY3A 1WZ2A 3BTJA 1UAAA 4LB5A 4UCRA 2E36A 1IRZA 3PIPF 1AN7A 4HA8A 1IXRC 3SE7A 3PW2A 3FBNB 4LB6B 1B4AA 4WCGA 4IHJF 1J9IA 1ZTRA 1W5SA 4LFUA 2IA1A 3RCOA 2W6OA 1M0TA 3W2VA 2XB5A 4RNOA 4X0GA 1FTZA 3UQ8A 3MFHA 4MAMA 1IUFA 1B6AA 4TV7A 4A0ZA 3A01B 2IBKA 3BJYA 1TBXA 4Y33A 5DGAA 1I6HJ 4PUSA 1ZR2A 1YRNA 3ZMTA 1EUDB 1S0OA 2FLPA 4RB1A 1YITI 1YW8A 1TWHA 2VBXA 2QSHX 3E5NA 1XDUA 3BZ6A 3AYHB 3DTEA 3GZ6A 1F1ZA 3Q8QB 3GW2A 3EPGA 5K1YA 3TIIA 1V4RA 2L9RA 5KG2A 4Q8FA 4Y13A 2PN1A 2R84A 2ZC2A 2STWA 3OMYA 2E2HA 1FYMA 4O3QA 3QWLA 3RYRA 4X62H 5CVVA 1A5JA 4ED0A 5L3EA 4L9VA 4XBFA 3IP4B 5LGNA 2PMZE 3IC7A 3H92A 3JCUC 2UXDH 5FLXZ 1IC8A 1X2NA 1H0MA 2EFQA 1WPKA 4HX7A 1ZG3A 2E2HJ 3AG1H 3RZOJ 4QWDA 1KJIA 3JRHA 2LSOA 2NNNA 1PUFB 4ECSA 4IKFA 2CRGA 4IRDA 2CW0F 2BQUA 5GTHC 3T1HH 2ETHA 4MA5A 3KEYA 1DGWY 2RGVA 1TQPA 4HNUA 4E7KA 2GA2A 4FISA 1HLVA 4XQFA 5JVTA 3RTRA 4E7ZA 4CICA 3UNGC 4ZHQF 1B1BA 2ESHA 2UVUA 1YIOA 1QZZA 4D1QA 5BQTA 5JHUA 2W6ZA 2JUGA 3K1NA 2CWEA 1ACIA 1OPCA 4O3PA 3FMQA 3QPTA 2HHHH 3U9GA 1LQ1A 2V1DA 3L2UA 3KTMA 1EUCB 2V79A 2O03A 1T38A 1S8NA 3CTAA 2AS5F 3PQKA 2BY2A 3OSPA 1MMGA 3J80Z 1E4EB 5B5EC 1NHAA 3TMOA 3Q8SB 2WTEA 4RBOA 4EJUA 5CYVA 4B3SH 1XTAA 2QLZA 2HGSA 1XX5A 3WTTC 1XSXA 2JVHA 3FM3A 3RAXA 1YFHA 4Q8EA 3TQNA 1FMWA 3Q9VA 1B72A 2O9LA 4G9YA 3M8EA 2WAQE 2YS7A 2FXAA 3QPSA 1D1CA 4A69C 1K4TA 4B3XA 1ZHQA 1MJ9A 3V4ZA 4LIUA 3REOA 4ZYDA 1TT5B 2L7KA 1QVTA 2BVMA 3LSMA 4M73A 5LEKA 4BH9A 5HS9A 3EUHA 3K5IA 4RUCA 5JLWA 3A0BC 3H9QA 4ZYAA 3RZDJ 2AGQA 1FOWA 3O8HA 3JRWA 4HX8A 1YE9A 4RB2C 1QU3A 1J2XA 5LBQA 3RJPA 3VPDA 4F4XA 5KFMA 3CVZA 1I5ZA 1YI2I 1FPQA 2UWMA 3FBIB 1ON1A 1BNCA 1A6IA 1BI2A 4Q5SF 1LUJB 2QZ8A 3HKZA 4DNCA 1FVIA 4YAJB 1IXCA 5KFSA 1LEAA 2DYSH 3GZNB 5DG8A 2JA8G 4II3A 3BG3A 2IXSA 4KHPH 4O3NA 5D8DA 4WXCA 1LE8A 2RDJA 1SAXA 2H8RA 1U5TA 2L7ZA 5C3EJ 2G0EA 2K9MA 3MKYB 2JA5A 2R8JA 1QHHD 4A3LJ 4PDBA 1ZARA 3H0GA 1PP7U 4C30A 2GPWA 2K4JA 3QP5A 2WADA 1WH2A 3ZMVA 2LBFB 3V7SA 2XAQA 4V2GA 2YU3A 2MCTA 3DTIA 1T94A 2K27A 4LMYA 4ZQIA 1FKAH 1JXSA 2G9WA 1F4KA 2DMPA 3MMYB 1SVOA 1DU0A 4A3EG 4ECVA 2VPQA 2PMHA 3T1YH 2DDAA 4EM0B 1OMIA 2FJ1A 2JN6A 3PW4A 1MBJA 3TDUC 1DUXC 4IRIA 1X1BA 4YRVA 5D8KB 4HEA2 3FMAA 3WTVC 2CFXA 3FZVA 1I27A 3GYHX 2ZJ2A 4HQ6A 2YRXA 5LXTF 1M0WA 2I10A 5J8CA 2V6CA 3SQNA 3JTHA 5T14A 4LF4H 3R0JA 2X6XA 3UR3C 3K70D 3ZQCA 2WTFA 2EFWA 5F04A 1V5FA 3TP3A 5KFXA 2P5KA 5CA0F 3HRSA 3K9TA 4ZC3A 1BW6A 2VC1A 5KNLA 2WBMA 2HPMA 2R7KA 2GZWA 3IKTA 1VQ7I 2VJJA 4CC6A 3UFXB 4DUYH 3S17J 3GLKA 2K02A 4OX9H 2V4RA 1W0UA 4YIFA 1JT6A 2CQQA 2XVCA 5F9NA 3E5UA 1HXDA 4PJNA 3KEOA 1XC5A 4LF6H 1RKTA 1KU3A 5ILVA 4UV9A 2CW8A 1ONVA 3FWEA 3S8PA 2FOKA 4PK4A 1R5GA 3Q2OA 4Y15A 2R82A 1YTYA 1BXRA 3O8GA 1M7JA 3SEZA 3R0AA 1M1EB 1G6NA 3P9CA 2QQ8A 5DUIA 2YPRA 5FLMJ 2X9DA 4QWCA 2EZLA 2DK8A 1BI1A 2VN2A 3SZGA 1AHDP 2EV5A 3HDDA 3PQJA 2JWTA 4UCSA 2P6SA 3U9SA 4ABZA 4P55A 1WR2A 1IRFA 3T0YA 2YS9A 3OUUA 4R1HA 1Y1WJ 1IBKH 4JI0H 3H36A 3QPLA 4XKWA 4XR6A 4ME6A 4CUGA 3M9AA 1USTA 2HDCA 3I53A 3R60A 3KAJA 1Q1VA 3GV7B 4A3DG 2RQQA 3NARA 4I76A 4BXXJ 1T6SA 4DJAA 1KEEA 2LH9A 2RQPA 3A03A 2MA3A 4P1WA 1U3EM 3M4OJ 3IUOA 5FROA 3BP8A 2VI6A 1SEIA 4DL6A 5KG5A 5EDNA 5EF6A 4N4NB 1R7JA 4G7HF 1ETVA 2XV4S 2OF7A 3RQIA 1Z6RA 2MD5A 5M3FJ 2R93A 3UKGA 5AONA 3TQ1A 3CCYA 1OISA 4DL5A 3MWDA 2F4OB 3BG5A 1XPXA 3KLOA 2COMA 3ULQB 1C3OA 5C1OA 3HOXJ 1X9NA 4G12A 4BQOA 3HEFA 5LYJF 3ISPA 4AYBA 1XB4A 2FMYA 3L2PA 5D4SA 4JV2A 3DLLF 1DU6A 1Z7UA 3RB6A 2CUZA 3H20A 4X64H 2CG4A 1BBYA 1X4PA 2AXLA 2OQGA 4XRSG 4Q0YA 1SD6A 2A05A 5H6RA 3CCUI 4Y8VB 4EG0A 2M30A 5L1LA 2ID3A 2K9QA 2R7RA 2BHYA 3ZQHA 3C2BA 4HPQA 2KIUA 3LNQA 4G3IA 5E3LA 2CGPA 2JMWA 1H8AC 1RR7A 2W7OA 3OYIA 2QVOA 3OOUA 3K0LA 5IY5H 3BAAA 2V1UA 3FXMA 2Q8KA 5IYZF 1IUYA 2ZDGA 1N34H 2Z9OA 4UVBA 2A07F 2NS7A 3FKIJ 1SFXA 3TW7A 2R5ZB 4IWXA 3HM5A 2W71A 3BTCA 1T33A 1TZLA 3VYTB 3LMLA 2C28A 3L09A 3VDXA 3C3WA 3C18A 3OHAA 3J80K 4DL3A 2E1NA 3CCEI 1HF0A 2HTJA 4BXFA 3J81K 1RZ4A 2AHQA 1SVLA 4B47A 4E70A 3KFWX 1FYKA 1C0WA 1R00A 4I01A 5H80A 2X6OA 2XGEA 4J01A 1D0XA 2JZYA 2JT1A 5DG7A 4P5OA 3I54A 4DW6A 4UFZA 2J5PA 3BPXA 1IG7A 1B6SA 1I3QJ 3S1QJ 4U6PA 2JA7A 1N56A 3BG6A 4ED6A 3J7AY 2FEZA 4JP0A 2MG4A 4PFOA 2LMDA 2K9LA 1FOKA 2X4HA 4ZDPA 2CS3A 4EATA 4C3IJ 3SJMA 1LKXA 2VB6A 2ELHA 4PJJA 1ZRDA 1FOYA 2FPGB 5BMVF 1EHIA 5F08A 2PBZA 3DF7A 3M4IA 1WQ2A 2NVYJ 3KZIC 4A5NA 3N42B 5D1PA 5JVDF 5KVRA 1IN6A 1EF4A 3G6EI 2YCHA 3K4BA 4BBSG 2DQLA 2DA1A 2WWYA 4N9HA 1ZLJA 2CUJA 2OUMA 4HBLA 5LRRA 1X1PA 5F64A 4IAJA 4JI2H 5JFRA 2FLNA 3R5XA 1YG2A 2ZDHA 1LDDA 4N4OB 3L7WA 4DL7A 1T8IA 3I4NJ 5DEQA 4MEXF 1HDPA 2KMUA 4DR7H 3P9KA 2I87A 1MGTA 1ZG5A 2XCLA 5DD8A 2KJCA 4A3CG 5KT7A 1CE8A 5L9XA 1U5TC 3LSJA 1ODDA 3DKYA 4L5IA 3W3CA 1BGWA 2DLNA 2F4MB 1ETWA 2K3PA 4GYGA 5KCMA 5HDGA 1ZR4A 3GIDA 4L5JA 2UUCH 3CDIA 3OV8A 2HZDA 5A2QK 2R7MA 4MFDA 4NQWB 2FQ3A 4IRGA 1MBEA 3PO3J 5KT3A 2XGQA 2KSWA 4LG3A 1G4DA 1J5YA 4RUAA 2E1OA 4BEHB 2UU9H 4XRFA 3N40P 1Y6IA 1O4XA 2HPIA 1OJLA 2DXIA 1IRGA 1V5EA 3AL0C 1MSFC 4CA0A 4DL2A 2Q2TA 5ED4A 4A0YA 3GTQA 1PVEA 3JRIA 1IZ1A 4A2BA 1UELB 3W2WA 4UUSB 3ABTA 2E71A 4QSHA 5E1WA 4I55F 2F5EA 4MQVA 1BM9A 1PUEE 4YJ2F 5F0FA 4BGDA 1HW1A 2WC2A 1XNRH 2PLYA 1CQTA 1ZHSA 2F5CA 4FT8A 4E7SA 1MD0A 3F9KA 1ULYA 3BZKA 3DV8A 1S29A 2KRHA 3I55I 4B3TH 2DJNA 3MR3A 2C2DA 1OCCH 4YAKB 4Y3OA 3CQZJ 1EV7A 2XPVA 2DMQA 4HF1A 4A3BJ 3V42A 3T5JA 3TOAA 3N43B 3PSFA 3RGXA 4P9FA 1VFCA 2QBYA 1OCTC 5EJCA 4HNTA 5J2TF 3AAFA 2VBWA 3TW6A 4XMYA 1MMNA 3ESWB 3H9GA 4NUBA 1RI7A 2Z99A 3DU6A 5D5VB 2JA6J 4BJTA 2H1LA 2A69F 3AKZA 2QSGX 3QOEA 3E3VA 2R7WA 3V6KA 4BWSC 1Y1VG 2JJ7A 2VPSA 4KISA 4WBNF 3JREA 5FKMA 2MYSA 3KHGA 3SI8A 4IOAF 2EINH 3HOVJ 3CC2I 3KPHA 5CA1F 2V4QA 2E60A 5FLXW 4ZDLA 1IXSB 5E20A 4BDZA 3IV5A 4PDKA 1H89C 1O3QA 2A6EF 5BS6A 3BR3A 2TDXA 4DV0H 1OCRH 4A3LG 1R1VA 4BAYA 2M2EA 1OFCX 5EYRA 2CV1A 4O2AF 1IW7F 1K78B 1IF1A 3M9OB 3H1CA 5IP6A 1E2XA 2M3AA 3IH3A 4ZTFA 1D1AA 5M5WJ 2WE6A 3G6XA 4P9UA 4OU0A 5B3SH 2XDVA 2BW3B 3OR1C 2LDUA 2K5CA 3QP6A 1WH5A 4C5AA 1XDNA 1MJAA 2CSOA 2QQBA 3M8FA 3ASNH 2NUAB 2EZIA 1Y1VA 2O61A 3ZQLA 2EK5A 5KT6A 4B44A 1LPQA 2HJWA 1V9PA 1F43A 2B63A 2ALZA 2CV2A 1MBGA 2CQNA 3WG9A 3HRTA 4B8XA 3LWFA 1M6VA 4HV6A 1UJ8A 3BABA 1ZKGA 4DR4H 2VUMA 3LMMA 2QGUA 1IJWC 4GKKH 2F4VH 3MQ0A 1Z2OX 3T5KA 5DCMB 1S97A 1F36A 2DA5A 4IVNA 4ZH4F 1RIOH 4FX4A 2R7SA 3DPUA 3PNVA 2LRDA 4BYYA 3KYDB 4HG2A 2R93J 1AUVA 3IAM2 2E1MB 3GLLA 1SEUA 5D6FA 2RN7A 3VSLA 5HNFA 5FLMG 3GTOA 4CCNA 2QENA 2ZSHB 5KFFA 2R8KA 2IVMA 3HIFA 2L7FP 1JUSA 3C7JA 2VIXA 2E2IJ 1STZA 4HSRA 4M9SA 4NDLA 1CS0A 2PMUA 2HVSA 1ETOA 2HR3A 2BZTA 1G59A 1ZQ3P 4HOBA 3JRFA 3GTMJ 3EPZA 3O2PE 4J00A 3ECHA 2JSCA 1RKWA 4L1KA 2LREA 1Z7LA 1FWZA 3LL7A 2OTLI 1WSUA 2RNGA 3ZCOA 4NXNH 2X6WA 2XAHA 4RGSA 2E5LH 1T95A 2X6YA 2DFFA 2QA4I 1QPIA 1D5VA 1VQ6I 5IYBJ 3WU1B 3I9V2 4A3KG 3CCJI 3GWZA 2UXCH 2TRTA 1TA8A 2R92A 3MJFA 5KFRA 1XGMA 1Z9CA 2IP4A 4F4YA 1TAEA 1RYRA 4DR6H 5J8FA 4Z6YA 4D9JA 4Q45A 5GPAA 3RFCA 2QQ9A 1TWAA 4XLAA 4KNYA 4XN3A 4JI1H 3OIQA 1RETA 2ID6A 4GDFA 2VODA 1D8JA 3K3PA 4J9OA 5E79C 1YHQI 3GTKJ 3HOXG 4O3MA 2KLOA 4AC0A 2O8KA 3BY6A 5KFKA 2OC6A 5HOOA 1OYYA 4Y17A 3QU3A 1T08B 4B09A 2JA6G 1R4MB 5CVUA 4AVPA 2V4JC 2R7ZJ 2X1EA 4AQYH 1DV2A 3AG3H 5IOYA 4A3GG 3R6SA 3P5JA 4JX5A 3BQ0A 4ED7A 4A3IJ 1RK6A 3K5HA 3T5HA 4IQ4A 2V9KA 3CMMA 4FE7A 4EMSA 3S15J 1EKEA 3G71I 4HDUA 1ZGJA 1GGOA 1X19A 4KT5C 4TUYF 1P4WA 4GCVA 4LF7H 4EGYA 1BJZA 1P2FA 4XKCA 2H94A 2XC7A 1F9NA 4EVIA 1YJNI 2L54A 1SC7A 4CO8A 4JYAH 1DGRM 4O3OA 3V7RA 3QYEA 4M74A 1SMYF 4DR5H 4BE0A 5KX5F 4O4HF 3FISA 1WGXA 3N8DA 5TGTA 2IAIA 4U0YA 4BE1A 4ZDOA 1RESA 2ASLA 1R1UA 3M1CA 3BDDA 4YELA 1NK3P 1GSAA 2R85A 4JI4H 4LLGF 3Q8PB 2FOWA 3H3ZA 1AKHA 1DPUA 1JLLB 1KBLA 3LA3A 1N77A 2VOOA 4V19K 4QWQA 1S68A 4RGXA 3ZMSA 3M9MB 1RJPA 1B33N 4NQWA 2VUGA 4YQWA 2R7VA 3PUFA 3VMMA 1I1SA 1TP4A 4NHJA 3I4MJ 1LDKB 2LVSA 3RIRA 5JVGF 3S16J 1DPRA 1HNXH 2M4KA 3DKWA 4CGZA 1Q1HA 5HLGA 1IN5A 4L0YB 2VJ4A 5KFNA 4ED3A 1FBQA 2KKOA 2R7UA 1S7EA 3CJTB 3FDYA 4I7HA 2HVQA 3S3MA 4DLKA 1X3ZB 3GTLJ 4IZOA 3S1MJ 4QJFA 2R8HA 3R4KA 5EGOB 3W6JB 3OYLA 1D0YA 1HNWH 1WJAA 1B59A 3DEUA 2H6BA 1MNEA 2XRLA 4EJOA 4EEQA 1RK5A 3G6VA 2MC3A 4BY1G 2YU9J 1T98A 4BHCA 4R8HA 3FKIA 3RPQA 4IF4A 4E7LA 3CCQI 4CHUA 4DV6H 3ZGKA 2PX9A 1XMKA 5EEHA 3HUGB 3ZQFA 4J19A 3TGNA 2JRMA 1WJFA 2FQ4A 2XKPA 3G6YA 2Q1ZB 3HOWG 3DBLB 2PJPA 4NNJA 1AWCA 5LGUA 4CXFA 4W1UA 3WG7H 1GYFA 4ON0A 3S2HJ 4A0XA 1NG6A 4DV4H 4R79A 2RVCA 2GBYA 4U0VA 3K69A 2FBKA 2L9NA 5JVLA 2IA2A 3QYFA 3KZYA 4CCJA 5E17F 2ACJA 2ATLA 3FX3A 4YEJA 4F55A 3HL2A 1W7PB 3H5AA 1KC7A 3CUQA 4KN4X 4XSXF 1LNWA 4IRCA 4IX7A 2ESNA 2OAZA 1BR4A 1T36A 4IR1A 1REPC 2QF7A 2W00A 3OS1A 1U5TB 3EPIA 1LDJA 3SHFA 3KIOA 4ZTJA 3HG9A 1OQYA 2HGCA 4DUZH 3G1MA 2NRAC 5LD2C 1X1AA 3RDIA 4GC6A 2HYGD 4QIWN 4F52A 5KHDA 3GX4X 1BL0A 5J4YA 3BROA 3SDGA 4I02A 3D1NI 4A3JG 2JA6A 2CV0A 1BC7C 3CCVI 4QW8A 4J9SA 1HSTA 2L4AA 2H09A 2BR0A 1GVDA 5E1XA 3SDBA 1IOVA 2H27A 3I4PA 4DL4A 2R86A 4APMA 3ZP5A 2VPLA 2IS2A 5ICEA 1Y56A 2F5DA 3IWFA 4RNMA 3BCBA 3AG2H 4XRSA 1K7AA 3ZN0A 1B6RA 1UB9A 4Q43A 1IV6A 4A3BG 2BGCA 4U0WA 4MTDA 5E1ZB 5L1JA 1VNDA 2ME0A 1NK2P 3JRGA 4PSXA 3JRBA 1A35A 2L9VA 3PJRA 2FMLA 1JHHA 3V4GA 2BQRA 3DF8A 3HKZN 2WAQA 4ED8A 1MBFA 2F5FA 4W97A 3CCLI 4FTHA 1Y0NA 3HGGA 3ABLH 4E7HA 2WV1A 4A6DA 3FXUA 2OWOA 2XAJA 2FRHA 2HDWA 2XPUA 1FZPB 3WTXC 3PW0A 3ZMDA 3E97A 2EV6A 4D7NA 3I58A 1J59A 4A5MA 1WKMA 1ZRFA 5HLIA 2DFEA 3H3UA 2HOTA 2FNPA 4JYKA 5KFBA 3TKYA 2QWWA 1KA8A 2V6EA 3TEDA 4RMNA 2MC4A 2O3FA 3PN1A 2JK3A 3RKWA 2W9CB 2BVLA 1S0NA 4BJ6C 1X3UA 2GXGA 3G3ZA 1LE8B 1JKJB 3IRQA 3L2QA 2ZXIA 3FKJA 4CCOA 2WV0A 3OYHA 3QOPA 2HQNA 5DQGA 2J6UA 4EGJA 4XRMA 1MW7A 2VE9A 2Y0SA 3BG9A 2PVPA 1SMTA 2NU6B 3CC7I 1RRJA 1MSEC 3JAMZ 1ZRCA 2J6TA 1TC3C 1IGNA 1VQ4I 1TLHB 1ETQA 1QZYA 3KP6A 4DZPA 5M3MJ 1HOMA 4DQ2A 4M3FA 2IS4A 4YFNF 4MO7A 4O2BF 2LYCA 5IWAH 5KFIA 3J7AO 1V5GA 4C3JJ 5C1PA 1UG0A 1XG1A 4GGGA 3KP4A 3VB2A 3COAC 3ETHA 2FMAA 1X1CA 5JHFA 2NVYA 2M1BA 4XLCA 2FUG2 1VQNI 4QTRA 2W84A 3MZ8A 3N41B 4LK0F 2EQRA 4JOMA 2MFZA 3IKVA 4Y52J 3GTGA 1G3WA 3LQRA 1MMDA 5FKNA 1R5ID 1ZYRF 2UXBH 2VQGA 2K3FA 5H6QA 1JDEA 4AWXB 1RJQA 5KG6A 1ZN2A 4LFAH 1JTXA 2XF6A 2M0CA 3VPBA 3IH4A 2VJIA 2G7UA 3OYEA 4FS1A 3FMSA 3DKXA 2RKHA 2GAUA 1MH4A 4A3FG 3M7GA 5L1IA 5H20A 1YIJI 1ETKA 4BUPA 4J9MA 3U2RA 1FBUA 4D5FA 3CD6I 3WGGA 2HXIA 5IYDG 4IHYA 4FHTA 2CO5A 1JXLA 3GIPA 3E1SA 4MV1A 1TWFA 4O5VA 4HF2A 2XKOA 2NAZA 2Y0MA 3QODA 1LFBA 3DBRB 4B3AA 2KL4A 4L5EA 5BPIA 3WO1A 5KFJA 4DZJA 1HW5A 4UCOA 2IT0A 1W0TA 3NRVA 3S1RJ 1H9TA 1V55H 5LL6b 3A1YA 5J2UF 4RNNA 1QO0D 5EEGA 4A93J 1DP3A 1B9NA 1OR7C 4JI3H 3WTUC 3H9JA 4FQGA 2CUEA 1U9OA 2GIZA 2Z2SB 4OINF 4MV6A 3PVXA 4I09A 3S3NA 3S2WA 4UUTA 3K2ZA 3D5RC 4XNFA 4XLNF 1I7NA 2XASA 3M1EA 1MBKA 3CDHA 5KG4A 3JTGA 1L2ZA 2F4IA 1QGPA 3HTUA 4HQMA 2GWRA 2ZKZA 3Q9SA 2Y30A 1YLFA 3F8BA 3LQQA 2R7ZG 4M9XA 1U2WA 3LOCA 3BTLA 3WGHA 4OMYA 4KJZA 2GA1A 4ZJZA 4J9QA 2I5UA 2XD4A 4QPOA 1KU9A 2WA0A 3MFIA 4CCLA 2R4GA 4II2A 5B66C 2P81A 1FMVA 5KG0A 4A2AA 5D5XB 2Y2ZA 2I8CA 4DV2H 4J9LA 4ZYHA 4E4HA 1P92A 2I80A 4EFBA 5D6EA 4HLYA 2IA0A 3ONQA 2ZDQA 3I71A 5KFQA 2CJJA 2E7XA 5FD6A 3CCRI 2L9SA 1Y39A 1WSCA 1KQ8A 4EFEA 2DFIA 2ZXWH 3NWSA 2GQQA 4FM9A 4BQNA 2CQKA 3E6MA 2FD5A 2ZNZA 3H40A 5TJJA 3JRAA 5KFTA 1IBLH 5IYCJ 3OL3A 4DOZA 1BC8C 2HS5A 2AQ4A 4AVZA 4XX0B 1E4EA 3W2AA 2XIGA 2CYYA 1GUUA 1GV5A 4NC7A 5AIPA 4MIMA 4LJZF 2M87A 1JGSA 3K3VA 1Y1WA 4M3BA 1GXQA 3PM1A 3DP7A 3C2GA 4HSTA 2D2WA 2L01A 2HEOA 4FBUA 3KYCB 4DYCA 2YSRA 2QK4A 3GTPJ 3MWEA 5FJ8G 5HDKA 1MMSA 4G6TB 1CF7A 2XCAA 4EEYA 3VFZA 4DBRA 1S10A 1UHSA 4U7CA 1TNSA 1JHFA 4CDGA 2X1DA 4BS9A 4XM3A 5HNHA 4DV7H 1UHMA 3WODF 4OIPF 3BCAA 1WJEA 2VKHA 1BA5A 2HTSA 1KZHA 3RYPA 1GT0C 3ETJA 1YO5C 1BN5A 5LLQA 3K70C 1A0IA 1ORKA 2KZGA 5C4XG 1B9MA 5CQEA 1D1BA 1T2KA 1IAWA 2R3SA 2VASA 3ZQGA 4CZCA 2JQ7A 3MKLA 2VUMG 2DI3A 3H0DA 4MV7A 2RV8A 4YFXF 3TQTA 2M9HA 2MH2A 3R5HA 2CFOA 2UXXA 2L5QA 4RM2A 3CJNA 4X66H 1TWFJ 3L4KA 2NU7B 1T56A 1R49A 4RM3A 5EOYA 2R7TA 1TWAJ 1U6GA 2IA6A 1QQIA 2OBPA 4BQQA 4LSAA 1N36H 3GEZA 3KAKA 4UUSA 1LB2A 3EETA 4ESJA 2ADUA 5LOVF 3I59A 1GSHA 2ICWG 2UV1A 2HYJA 5KT2A 1GHCA 4QWEA 3HOWJ 4I50F 3S3OA 4MV3A 3C1DA 1K1SA 4JUZA 3JAMW 1BOBA 1U9NA 4Q4ZF 4LG0A 2BV6A 1FJGH 2VKVA 2KIFA 1S7AA 1E3HA 5HV6A 4RLQA 4XLHA 2QCOA 3B02A 1W7PD 3OIOA 1IRXA 3HZJA 3GZ5A 1BR2A 3OYNA 2L0KA 2XROA 3F8NA 1CF7B 3GV8B 1WCMG 3JAMK 5GPCA 2HQ5A 4NC8A 1YX3A 3F72A 3N6XA 2X48A 4ENMA 3TBIA 4AIDA 3BA9A 4A93G 3K4KA 1RPWA 3BJOA 1KU2A 3OOPA 2ZFUA 2DW4A 4M6YA 3OS0A 2MGQA 1I94H 4LSXA 3IHUA 2V9PA 5BR8H 4A3MG 2D5VA 4JV0A 2HZTA 1VQLI 4LF8H 1D3YA 1GXPA 2DOEA 4WXHA 3MFKA 4M9UA 5E3NA 1FLIA 1WJDA 1S03G 4BHPA 3A0HC 4ZZDA 4QIWA 1TWGA 3DFGA 3ERMA 3F22A 2KDZA 4R7RA 3GFLA 2ISZA 4FU0A 3LSIA 1Z3XA 2O6GE 2W9BB 5GAEJ 3SFZA 1Z3YA 2Q2EB 2QUFA 2X51A 3HRUA 5F27A 5J3LA 2IS6A 2L02A 2FKLA 3NAUA 4KT6A 3FXJA 3L9FA 4GC7A 1P9QC 1F5TA 1ZHFA 2A6HF 3OYJA 4QIWE 4AM3A 3ZN1A 1S9FA 2J6SA 3HYIA 4IRKA 4F4WA 4C9YA 4C3HJ 2Z33A 5HVQC 1P7JA 4L9TA 2NS0A 3LAPA 2X0LA 4XICA 4MV4A 4TV9F 2K7LA 2A6TA 2LY1A 2EH3A 2JPBA 1FT9A 4KUMA 2LKSA 4RU9A 1V3FA 2LOOA 2JVGA 1BIAA 5DGBA 3WTWC 5IYBG 5L1KA 2W7PA 3W6KB 1VF9A 1E3PA 2GM4A 3V6JA 4Y4RA 2I8DA 3HTSB 4E6KG 2C00A 3TO9A 2W57A 2VPRA 4XONA 2JA2A 3Q1KA 1E17A 2DA4A 4UB8C 5KFYA 2XHKA 4YB8B 5FRMA 2YYAA 4I99C 2EJRA 5EG0A 4N0BA 5F9LA 3OYKA 5K5RA 4OIQF 2ZXHA 3MKZA 4BY7G 5JH7F 4N9IA 5D4RA 2W48A 3D5SC 6PAXA 2XF7A 1R5HA 1WHUA 2ZJPF 2LD5A 5KFGA 2BOLA 2XPWA 3OSNA 3SFIA 4XSZF 2ISYA 4EYHB 1VQPI 3U21A 2Q2EA 4PJLA 2M8EA 2IRFG 2FA5A 4I4TF 4IHWA 1N33H 4YR2A 2PFBA 4IEJA 1K6YA 3H35A 1T3NA 3RGZA 3ELKA 4AIKA 1I39A 4OIRF 3OUZA 4BHBA 3H0GG 4GYIA 1TL8A 4ESBA 3LWBA 4EGZA 3HHGA 4LK1F 3SEQA 5FKOA 3KP5A 2ZJRF 1ZLKA 4U7DA 2QBYB 4EEFG 1Y8RB 1XSVA 2HFHA 2ZJQF 3DU5A 3CF5F 5KFOA 3VYSB 4IO9F 4E4TA 5A2QZ 3C2HA 3GCMA 3PSIA 3LSPA 2UZKA 3HSRA 5IP7J 3HSFA 3IRRA 4JK1X 2VQEH 3CUQC 2H1KA 1IDYA 2LC2A 1RUOA 2H6CA 3GFJA 3JRCA 4HLXA 3HKZE 1LVKA 1I50J 4XIDA 2DA2A 4IHVA 4IHTA 1ZGWA 3HOZG 3RQ4A 2DBBA 2R87A 1OYWA 2A5YB 3HJEA 3WHCA 1TW3A 3FIWA 2IMWP 1HCRA 1LEBA 4EJWA 1BJTA 2H8WA 3JR9A 3ZOBA 1YJWI 2G7HA 3BWGA 2EV0A 4RAYA 4G6QA 4WX9A 5K5QA 5IT9K 5C44G 1DQUA 3OSGA 3PO3G 2GLOA 2PG4A 5EG0B 3OHBA 3IN5A 4UVCA 5F1JA 4EBEA 3MVPA 5IP9J 1UNNC 2CU7A 1Z0XA 2ZO4A 3GTQJ 4O3SA 4MNUA 4DR1H 2Y0SE 3BR1A 3WTYC 2DODA 2ELJA 4BJ5C 1R1TA 1PJRA 2C35B 4TQRA 2AQEA 1FX7A 1QVUA 2E34A 3CUOA 3VOEA 5E3OA 2VR1A 3PR4A 1UMQA 4ECRA 4A3FJ 4YG2F 2V26A 1HR0H 2LFBA 4B48A 4LF9H 1GV2A 5IT3A 4AIJA 2BE5F 4RGUA 2J9GA 3Q0UA 3TIGA 1QRYA 2XAFA 4O4IF 4ECWA 4RS8A 1KJ8A 2CW7A 2E5NA 2AXTC 2PJRB 3V6HA 1ZAOA 2Y0SN 1VQ9I 3S32A 1H9GA 1IDZA 4ZI7F 2C2EA 2ECBA 2DO7A 4EGQA 1VQOI 3R61A 5K5OA 1VQ8I 3ABMH 3HOZJ 3GQCA 2WYOA 1NG7A 1RR8C 4ZYGA 2OLSA 3MEXA 4BXXG 4QLCU 3A4CA 4IHSA 1IV8A 3RBDA 9ANTA 2O5RA 2LKPA 1N78A 2QKMB 1VZ0A 3ROUA 3ERED 1EYZA 1OWTA 3E7LA 4OIOF 3OYGA 2DT7B 2XUBA 1TQIA 3S93A 5D1OA 5J1YA 2W85A 1ULZA 4DGWB 3RI4A 3ZR8X 2ASDA 4BNCA 2FLLA 2KDOA 1V51A 2D1VA 2HKXA 4XLPF 2M05A 1YS7A 2EILH 2LTPA 2DPIA 3R5FA 2JSPA 5KFCA 1W5TA 4BKXA 2QM3A 2OPTA 1FSEA 4HF0A 2YUSA 3AL0B 1XGNA 2V1NA 1ERDA 2HNHA 4TQSA 3CP8A 1G3YA 3GUDA 2GXBA 1D0ZA 1S5LC 3CLQA 5L3DA 2FBHA 5BPDA 2CQ7A 2UUZA 2WY7Q 1HKSA 3DPLC 4CCMA 5HBRB 2OCEA 4DYRA 4XZ3B 2K9SA 1ENHA 4CCKA 3MZHA 3F6OA 2NYXA 2WB1N 2EFOA 1R9TJ 3LP8A 2ZMEB 2XGXA 2RDPA 2GPSA 3J7AK 3CCMI 3CO7C 4IWYA 5CKTA 5TISC 3O3KA 4DBQA 2XGPA 2ASJA 4JI8H 4F91B 3QAHA 3T8TA 3LSTA 5FD5A 3FHZA 2C6YA 5EZGA 4ZZLA 4M9ZA 1SFOJ 1K4SA 2OZ6A 3RPUD 3CCSI 1FEXA 1PK8A 1BW5A 4E7IA 1A6QA 1JIHA 2Y9ZA 3HOUJ 2VOPA 4A6EA 1UG2A 2WAEA 3K4JA 5GADJ 2FNAA 1JKRC 5IP7G 3VYUB 1JI8A 5KAFC 1FYLA 5DCMA 2YZMA 1XMAA 4A3MJ 4PFPA 3RUPA 1JGGA 1JE8A 2A3SA 2NVUB 1UC9A 2Q2UA 1IN7A 1TWCJ 3CLOA 4EQQA 2ZSIB 5FFZA 5K7HA 4ITVA 2EFPA 3G1LA 3S2DJ 3B6AA 3EDPA 2EA2A 3F6VA 3Q3SA 1RYSA 4A3IG 2Z1DA 2K40A 2RC4A 4L18B 1WI9A 1B72B 1DIKA 1BJAA 2E2IA 2P4WA 4I0AA 3JRXA 1SAUA 2L4MA 2O8XA 4EBDA 1ZQ7A 2DIKA 3VYRB 2HOEA 4UNOA 4FE4A 2HOSA 4JI6H 1EH7A 3QU6A 4AU7A 2ZJTA 3OWTA 1QHGA 5DQHA 2IW5A 4ED2A 2LBFA 2L7MP 2W4SA 4A2UA 1GSOA 1O3SA 1SFKA 5JUMA 3I56I 4S0HB 1S3JA 4GKJH 4M71A 3MCZA 5L3BA 2VQFH 1Z6TA 1MJBA 4LITA 3PNYA 4S05A 5KG7A 5FLVA 2W9AA 4XKVA 2DTZA 1LFUP 4F50A 2FPIB 4EJVA 4UVAA 4BDYA 3TP0A 3G2BA 1PUFA 5K7FA 3F8FA 1C30A 2R7NA 5JI6A 2VLAA 4KYWA 1O75A 4G8XA 3MR2A 3IL2A 3T5LA 4HNVA 1Y1VJ 2K85A 1W36C 3CDLA 1Y8QB 2DK5A 4WF2A 2DTRA 1CGPA 3N44B 4CC5A 2R7ZA 1HKTA 3FM5A 4UCTA 3MR5A 3BQ1A 3OYFA 4JI7H 4ENJA 4S04A 3VPCA 2VJ5A 2BY0A 3F23A 4BY1J 2VT3A 2XRNA 3HC7A 4YIIA 1MDMA 1L3LA 4ZYEA 2CMPA 3G73A 2R8IA 4IR9A 5JLXA 3EYIA 2GOXB 3KX2A 3H3VK 2F48A 2FE3A 2M5WA 1XMXA 3BTIA 5K7ZA 5TRDA 1VKZA 1Z05A 4HV5A 2LY2A 2NXNB 3IWZA 5ILUA 1L0OC 3HPHA 4M3DA 3FXKA 1E4GT 2PN6A 2DYRH 1R9TA 1N75A 2DT5A 2JUCA 4PJ0C 5E8IA 4IRHA 5LHIA 3K4NA 3JW4A 2R8GA 1SYXB 1J7KA 2E2JJ 2A61A 3BQZA 2DOAA 3GIQA 2JEGA 2HQAA 2NVXA 3O6BB 5KFWA 3HOYG 3TDZC 3B6CA 5KFUA 2VQLA 4LFCH 4ETSA 3FDSA 3HRMA 1B8IA 4PJMA 1I50A 2M7BA 2DPDA 5HS8A 1I3AA 2DAOA 2DQRA 2OQRA 3K1PA 4YY3H 3P9IA 3CO6C 3BJAA 2R5YB 3GTPA 5EZHA 2NOGA 2IBDA 3ZRGA 3KCCA 4I6ZA 5KG1A 2JA5J 1Y1WG 5KFDA 2NOJB 2LLKA 2VA2A 1HA8A 2IPQX 1YW7A 2RNJA 5HODA 5C44J 1U8BA 3J81W 2P8TA 1I6XA 5DTDA 2FF4A 5E18F 3A2KA 1IBMH 2NS8A 3JSLA 4RAZA 3MKWB 3E6DA 2R0QC 4FCYA 1E3OC 5F0CA 2P7CB 2Q0OA 2JA7J 3C0FB 3WE2A 4FBTA 4FX0A 2AGOA 5LHHA 1IN4A 2OV7A 3F8MA 3RTXA 2LK2A 3EUKL 2XGDA 1I6UA 4FETA 2BHZA 2PQ8A 3WU2C 2EFNA 1HW2A 2R7QA 3H0GJ 3V8KA 4K2EA 4HRIA 3KALA 3FXLA 1XGOA 3DWLE 1FIPA 5DV5A 2FK1A 5FB2A 4O6JA 4F7ZA 4BQAA 4DR2H 2DLLA 3LSRA 4ECYA 3MD2A 2CKZB 4MHGA 1R71A 2E1CA 5CVJA 2AQFA 1RUNA 3TINA 4ECUA 2JEIA 1OYIA 4AUXA 5J4VA 4BBSJ 1FSHA 3HPGA 5FJ8J 2V58A 1KJJA 3WU0A 1WFXA 1Z91A 3L2CA 3WHBA 1A31A 4LH6A 4MLOA 3TO7A 3KHLA 1TTYA 2JEFA 1WI3A 2GOMA 1JUPA 2M0MA 4KIGA 4B1RA 5M5XJ 3HBLA 3HOYJ 1ZREA 3OL4A 3PR5B 5EWGA 3FKIG 1EJ9A 1V4YA 3V4SA 1TQMA 3WGIA 2VKDA 2LF8A 5HS7A 4A3CJ 4YIRX 2XF5A 3BR6A 2YS6A 5BNGA 4GO1A 4DV5H 1S9HA 1I1GA 3CZ6A 3RPUA 3P7NA 5EWEA 3PO2J 3DTKA 4ANJA 2ZMEC 2QYOA 2WAQN 5CVIA 1W36D 4P96A 3GO5A 5DQIA 2KHMA 2V1XA 5FO5A 3OYDA 2E19A 5DLFA 1NTCA 3FK6A 4Q48A 1MIJA 1RJRA 2DCEA 5ILSA 4MV9A 1ON2A 3CUQB 3T5XA 1GVJA 1PP8F 3J7YJ 4YFKF 3MR6A 1XMQH 2Y9YA 3GTJJ 3GFIA 4PGHA 4LH7A 4MEYF 4JBAA 3JSPA 1S72I 2ZM6H 4U7BA 3IH2A 3KE2A 4OWRB 1AU7A 3CF2A 3GV5B 5DD4A 3L00A 4LF5H 4H4KC 2HOAA 2C22A 2K86A 3JRDA 1WJBA 2IGMA 4HW0A 1TWGJ 3K4MA 5FKKA 1XSDA 1GDTA 1A9XA 1HQCA 3N97A 3ZQIA 4LOCA 5ICGA 5CQGA 5CLSA 4X6AJ 4KIFA 4M3EA 1XCBA 1EZ1A 3KHRA 1XMOH 1AOYA 2VQHA 3KP7A 1MNDA 2HU9A 4M6VA 4A3JJ 3DQVC 2DU9A 2KJBA 3RV4A 4YR0A 3RBEA 3IAS2 1YX5A 3K4LA 3KEQA 4D5CA 1KONA 2ZMEA 1J0RA 1XNQH 2TCTA 2K9NA 5DCFA 2OJED 1KQ9A 2Z16A 1OR7A 3ORRA 2VBZA 1EH6A 3GIJA 2BEOA 2XB0X 1IOWA 4J9NA 5BMZA 3E5QA 2DA7A 4MFEA 2MLKA 1Z67A 2M4GA 5IPAA 3GTGJ 5C5JA 3MN2A 2HVRA 4G6DA 4C5CA 2HQRA 5LMUH 3HUGA 2BXZA 4ENNA 3ECOA 3OY9A 3JSNA 3HOUG 1G3TA 4I98B 2MABA 3I4NG 2IGKA
chains in the Genus database with same CATH topology
3LA2A 1ZG1A 2ZXJA 5L3FA 4B3MH 1SD7A 1FP2A 3I64A 2K4BA 2PI0A 4UHTA 1P4AA 4UCUA 4UCVA 4RGRA 2MH9A 2OZUA 1DDNA 4G94A 1VTNC 2EWNA 2LF7A 1KGSA 5FFXA 4H0EA 2M45A 2VT2A 1XDSA 3RF2A 4KN7X 4DR3H 1O7FA 4HDVA 1SD4A 3D0SA 4LG0B 1EH8A 1O57A 4WK8F 5CVRA 5LRSA 3T8RA 3EYYA 3SZTA 1KYWA 4I0BA 4IPAA 3IG0A 2XAGA 2HKOA 4NB5A 3GF2A 4IJAA 2LNBA 1W7PA 5IT9Z 4HX4A 4J0MA 2VOBA 1FC3A 3F8CA 5ICFA 4PZJA 5D5WB 1TNTA 2EB7A 2IJLA 2V9VA 3GXOA 4L9JA 1KYZA 5L3CA 3MZYA 3MAJA 4U88A 3QRFF 1YS6A 2P5LC 3PFIA 2MBFA 5FLXK 4JI5H 4G7OF 1R58A 4EJTA 4DV1H 1U8RA 3RKYA 5IT9W 4Z2YA 1K78A 2BBYA 3I5UA 3L4JA 4JV5H 3OTOH 2P7VB 4UXNA 2D45A 4CZZA 2HYFA 5CJ9A 3KP2A 3MWMA 1P6RA 4IXAA 3V7CA 1N32H 1SD5A 5J6XA 3RJ0A 2PBIA 1HKQA 3I59B 4KFCA 2Z3YA 1BI3A 3KXYT 3VEPA 3WE3A 3GVAA 5L3GA 4LD5A 1BIBA 4EV0A 1FBSA 3RIZA 1DGSA 3EQLF 3NQOA 4LGWA 4M6XA 5D5UB 2YR2A 3GFMA 3T1BA 4DV3H 3BOQA 3ABUA 4HZFA 4RZQA 1ZGAA 3KZZA 1A04A 4PCQA 2J5OA 3FXQA 3K1MA 1IN8A 4CYDA 5LHGA 4D0PA 1XD7A 4A12A 3RKXA 2FSWA 5BOXA 1XCVA 1ZH5A 2JRTA 2ZFWA 3F3XA 4M7EA 2O0YA 2VE8A 1UFMA 1UHWA 2VXZA 1SFUA 4ASNA 3VODA 3J80W 5LMNH 3HSEA 2R7FA 4EM2A 2P6TA 3E6CC 1W4MA 1D8KA 1T0FA 4Q47A 1WWXA 4KICA 4EM1A 5F1RA 4KA4A 3DPTA 2JTVA 4MGRA 1R22A 4G7ZF 4NXMH 1USSA 3FF5A 1P8LA 3KLNA 1Z2NX 2JPCA 2ZCWA 4WWCA 5LEJA 4HYEA 1BOAA 3E6BA 4GLXA 2B0LA 3LFKA 2VBYA 5DUKA 1RNLA 1KU7A 3FXRA 1XN7A 3KETA 1LJ9A 1R23A 5DDGA 2F2EA 3TO6A 1FNNA 4K0KH 4RB3C 1MKMA 5HDNA 1QPMA 2STTA 1VS0A 2OD5A 5JR3A 1J75A 3KP3A 3V8JA 1DP7P 4PGGA 3DXJF 4YHHH 1FP1D 3ZQ7A 4MQ9F 4UV8A 5F6FA 1KQ0A 2E7WA 2W24A 4JQFA 4OMZA 2NNYA 4ESFA 2VC0A 2Z5UA 2BYVE 2KRFA 4KMUX 1O7LA 1QBJA 3WTSC 1FY7A 2ZBKA 1YQAA 3NEUA 1OKRA 3HOTA 4HQEA 1J5EH 4KMFA 4BXUA 2FBIA 2UXNA 3JSOA 4AIHA 3HXLA 1S7OA 2A68F 5A2QW 4AD9A 4M72A 4LLNA 2FU4A 2EA4A 2Y48A 3GLXA 3HHHA 3BA8A 2WDTA 5DYMA 2UUBH 1YW9A 1G3SA 4RB0A 1E4FT 4KDPA 1R36A 3BPVA 5KK1A 3U1DA 5HLHA 4UUVA 3BJ6A 2IP2A 5D1OB 2DPUA 3B73A 1HBXG 3ML6A 1SFEA 2R7DA 1XGSA 4HAMA 1UCRA 1LVAA 2YX4A 1T39A 1QNTA 2L3DA 3E5XA 5FPOA 4WXDA 1PDNC 3ZMUA 3ZMZA 1Y0UA 5ICCA 5E8GA 1S6LA 3I0TA 2QQAA 4MTEA 1K79A 5D8LB 3V8LA 1YYVA 3F21A 4GXOA 1WRJA 1HNZH 1Z1DA 3WTZA 5FPRA 1BI0A 1HSJA 4X65H 4OOIA 3D5LA 3FMRA 5AIQA 2UUAH 1TW2A 4L0ZB 3LAJA 1O3TA 2D1HA 2OU2A 2YX7A 3HOSA 3QPHA 2Y75A 2PEXA 3Q5FA 5LGTA 2ZNYA 2GIVA 2KIMA 2HWVA 2OA4A 1O3RA 4ENKA 2VONA 3J81Z 3LA7A 1MDMB 1Z2PX 4LLLA 4I2OA 2W25A 5FGMA 1B04A 4B3RH 1P4XA 5ERIA 2MLGA 3ZPLA 4L9NA 3TOBA 4LFBH 2P5VA 1K6OA 3SXYA 1MZBA 3SZPA 3N4MA 1U78A 4KIBA 2RGRA 4LB5A 4UCRA 1AN7A 4HA8A 1IXRC 4LB6B 4WCGA 1B4AA 1J9IA 4LFUA 1W5SA 2IA1A 1M0TA 3UQ8A 1B6AA 4TV7A 4A0ZA 1TBXA 3ZMTA 4RB1A 1YW8A 2VBXA 1XDUA 3BZ6A 3GZ6A 1F1ZA 3GW2A 5K1YA 1V4RA 4Y13A 2STWA 1FYMA 3RYRA 4X62H 5CVVA 5L3EA 4L9VA 4XBFA 5LGNA 3IC7A 3H92A 2UXDH 5FLXZ 1H0MA 2EFQA 4HX7A 1ZG3A 2LSOA 2NNNA 2CW0F 3T1HH 2ETHA 2RGVA 1TQPA 2GA2A 5JVTA 3RTRA 4CICA 1B1BA 2ESHA 1YIOA 1QZZA 5BQTA 5JHUA 3K1NA 2CWEA 2HHHH 1OPCA 3FMQA 3QPTA 3U9GA 1LQ1A 2V1DA 2V79A 2O03A 1T38A 1S8NA 3CTAA 2AS5F 3PQKA 3J80Z 1NHAA 2WTEA 4EJUA 5CYVA 4B3SH 2QLZA 2HGSA 3WTTC 1XSXA 3FM3A 1YFHA 3TQNA 3Q9VA 4G9YA 3M8EA 2FXAA 1ZHQA 1MJ9A 3REOA 4ZYDA 4M73A 5LEKA 4BH9A 5HS9A 3EUHA 4HX8A 4RB2C 1J2XA 5LBQA 3RJPA 3CVZA 1I5ZA 2UWMA 1FPQA 1ON1A 1BI2A 4Q5SF 4DNCA 2QZ8A 1FVIA 1IXCA 1LEAA 4KHPH 4WXCA 1SAXA 1U5TA 4PDBA 1ZARA 1PP7U 2K4JA 3QP5A 1WH2A 3ZMVA 3V7SA 2XAQA 2MCTA 2YU3A 2K27A 4LMYA 1FKAH 1JXSA 2G9WA 1F4KA 2PMHA 3T1YH 4EM0B 1OMIA 3TDUC 1DUXC 4IRIA 5D8KB 3FMAA 3WTVC 2CFXA 3FZVA 1I27A 3GYHX 2ZJ2A 1M0WA 5J8CA 2V6CA 3SQNA 3JTHA 4LF4H 3R0JA 2EFWA 2P5KA 3HRSA 3K9TA 2VC1A 2GZWA 3IKTA 4CC6A 4DUYH 2K02A 4OX9H 4YIFA 2XVCA 3E5UA 1HXDA 3KEOA 4LF6H 1KU3A 5ILVA 4UV9A 2CW8A 1ONVA 3FWEA 2FOKA 1R5GA 4Y15A 1YTYA 3R0AA 1G6NA 3P9CA 5DUIA 2YPRA 2DK8A 1BI1A 2VN2A 2EV5A 3PQJA 4UCSA 2P6SA 4P55A 1IRFA 3T0YA 4JI0H 4R1HA 1IBKH 3M9AA 1USTA 2HDCA 3I53A 3R60A 3KAJA 1T6SA 2RQPA 2MA3A 1U3EM 3BP8A 1SEIA 1R7JA 4G7HF 2XV4S 1Z6RA 2MD5A 5AONA 3KLOA 2COMA 3ULQB 1X9NA 3ISPA 1XB4A 2FMYA 3L2PA 5D4SA 1Z7UA 3H20A 4X64H 2CG4A 1BBYA 2AXLA 2OQGA 4Q0YA 1SD6A 5H6RA 2M30A 2KIUA 2CGPA 2QVOA 3K0LA 3BAAA 2V1UA 2Q8KA 1IUYA 1N34H 2Z9OA 4UVBA 2A07F 1SFXA 3LMLA 3L09A 3C3WA 3C18A 3J80K 2E1NA 2HTJA 3J81K 1RZ4A 1FYKA 1C0WA 4E70A 3KFWX 1R00A 4I01A 2JZYA 2JT1A 4P5OA 3I54A 4UFZA 2J5PA 3BPXA 2FEZA 1FOKA 2X4HA 2ELHA 1ZRDA 3DF7A 3M4IA 1WQ2A 4A5NA 3N42B 5D1PA 5KVRA 1IN6A 2YCHA 2DQLA 2WWYA 4N9HA 1ZLJA 4HBLA 5LRRA 4IAJA 5F64A 4JI2H 5JFRA 1YG2A 1LDDA 3L7WA 5DEQA 4MEXF 4DR7H 3P9KA 1MGTA 1ZG5A 5DD8A 2KJCA 1U5TC 1ODDA 4L5IA 1BGWA 4GYGA 5HDGA 4L5JA 2UUCH 3OV8A 5A2QK 2FQ3A 4IRGA 2KSWA 1G4DA 1J5YA 2UU9H 4XRFA 3N40P 1IRGA 2Q2TA 5ED4A 4A0YA 1IZ1A 4A2BA 3ABTA 5E1WA 2F5EA 4MQVA 1BM9A 1PUEE 1HW1A 2WC2A 1XNRH 2PLYA 1ZHSA 2F5CA 4FT8A 1MD0A 1ULYA 3DV8A 1S29A 4B3TH 1EV7A 4HF1A 3TOAA 3N43B 3RGXA 4P9FA 2QBYA 3AAFA 2VBWA 1RI7A 2Z99A 5D5VB 2A69F 3E3VA 4BWSC 2VPSA 5FLXW 1IXSB 5E20A 4PDKA 1O3QA 2A6EF 5BS6A 2TDXA 4DV0H 1R1VA 4BAYA 1IW7F 1K78B 1IF1A 1E2XA 2WE6A 4P9UA 4OU0A 2LDUA 3QP6A 1XDNA 1MJAA 2CSOA 2QQBA 3M8FA 2O61A 2EK5A 1V9PA 3WG9A 4B8XA 3HRTA 3LWFA 4HV6A 3BABA 4DR4H 4GKKH 2F4VH 3MQ0A 1Z2OX 5DCMB 4IVNA 4ZH4F 1RIOH 4FX4A 4BYYA 5D6FA 2RN7A 2QENA 2IVMA 3HIFA 3C7JA 1STZA 4M9SA 2PMUA 2HVSA 2HR3A 4HOBA 3O2PE 3ECHA 2JSCA 1FWZA 1WSUA 4NXNH 2XAHA 4RGSA 2E5LH 1D5VA 3WU1B 3GWZA 2UXCH 1TA8A 1XGMA 1Z9CA 1TAEA 4DR6H 5J8FA 2QQ9A 4KNYA 4JI1H 1D8JA 2VODA 4O3MA 3BY6A 5HOOA 1OYYA 4Y17A 3QU3A 4B09A 5CVUA 4AVPA 4AQYH 3R6SA 4EMSA 4HDUA 1ZGJA 4KT5C 1P4WA 4GCVA 4LF7H 4EGYA 1P2FA 2H94A 1F9NA 4EVIA 2L54A 4CO8A 4JYAH 3V7RA 4M74A 1SMYF 4DR5H 4U0YA 1R1UA 3BDDA 4JI4H 4LLGF 3H3ZA 1DPUA 3LA3A 2VOOA 4QWQA 1S68A 4RGXA 3ZMSA 4NQWA 2VUGA 1I1SA 4NHJA 1LDKB 3RIRA 1DPRA 1HNXH 3DKWA 4CGZA 1Q1HA 5HLGA 1IN5A 4L0YB 1FBQA 2KKOA 4I7HA 2HVQA 3R4KA 3W6JB 1HNWH 1B59A 3DEUA 2H6BA 4EJOA 4EEQA 2MC3A 1T98A 4BHCA 4R8HA 3RPQA 4IF4A 4CHUA 1XMKA 5EEHA 3TGNA 2XKPA 2PJPA 1AWCA 5LGUA 4CXFA 1GYFA 4ON0A 4A0XA 4DV4H 4R79A 2RVCA 4U0VA 3K69A 2FBKA 2IA2A 5E17F 3KZYA 2ACJA 3FX3A 1W7PB 3CUQA 4KN4X 4XSXF 1LNWA 2ESNA 2OAZA 1REPC 1U5TB 1LDJA 3SHFA 2HGCA 4DUZH 2NRAC 3RDIA 2HYGD 3GX4X 3BROA 4I02A 1BC7C 1HSTA 2L4AA