4RB0A

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-apo-fur
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 40
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb0A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb0A02
4ZYHA 3COAC 1WSUA 1XSDA 4MEXF 1TNSA 5E8IA 3GUDA 1ON2A 1DPUA 2CQKA 2KRFA 2WWYA 2RKHA 3J81K 3OV8A 3R4KA 3WTWC 2H27A 2FOKA 4EJWA 4OIQF 3KZYA 1O3QA 3DPLC 1FZPB 2YX4A 1XGOA 2M5WA 2W24A 5LEKA 1IN7A 2ESHA 2EFQA 1CGPA 4B09A 3F23A 1IXCA 3B73A 1K78B 1GVJA 4YIIA 1MDMA 3IRQA 3DFGA 3JAMK 1Z6RA 1L0OC 2OQRA 1HBXG 1FYKA 2GAUA 1S8NA 1U5TC 4AVPA 4GYGA 3RIRA 2STTA 1J0RA 4MQVA 1Y0UA 4A0XA 2P6SA 3E6CC 5EEGA 1LB2A 1SFXA 3GZ6A 1C0WA 2CSOA 1XN7A 1UHWA 5CVUA 2V1UA 3NEUA 4BH9A 5J8FA 1ZLKA 1RZ4A 5CVRA 4RGSA 1SMTA 2QLZA 4MNUA 3MZYA 1R00A 4I98B 4R8HA 2UXXA 1FLIA 3Q9SA 3C18A 3REOA 2P5LC 5L3CA 4GGGA 2BEOA 4WF2A 1W4MA 3B02A 3ML6A 1UHMA 2FNAA 1T2KA 1GHCA 3I59B 5BMZA 4P9FA 4BAYA 2XIGA 2ISYA 2FQ3A 1JGSA 4HDVA 1S7AA 3TOBA 4LLLA 3GZ5A 2QM3A 4HOBA 4EV0A 1IW7F 4BQAA 3F8FA 3ZMSA 5BPDA 1JHHA 2MLGA 4WXDA 2DFIA 4RB1A 3IKTA 5AONA 3H92A 4IRGA 2GA2A 1WKMA 4HX4A 1REPC 4ENMA 5DEQA 2ZMEA 3CO6C 2L01A 3FM3A 1BIAA 5BQTA 2L02A 5D5WB 1RUOA 1U2WA 5D4RA 3V8KA 4XLNF 1KQ9A 5LEJA 4LG0B 1HSJA 1I5ZA 2FBKA 2HDCA 2K02A 4PDKA 3ROUA 1WRJA 2XAQA 2YSRA 3HSFA 3Q9VA 2NNNA 1AOYA 1QGPA 4KYWA 4AD9A 4EJUA 4LMYA 4Q47A 2ZXJA 2YR2A 4P5OA 4LLNA 2A6EF 2IP2A 4OIPF 2OD5A 3HHHA 4BHCA 4BHBA 4S05A 4ESBA 3ABTA 2BGCA 1QBJA 2UZKA 3V7RA 4O5VA 3L7WA 2A68F 3DF8A 1ZG3A 2WC2A 4LLGF 1BC7C 3CUQC 1OKRA 3WGHA 2DPUA 4EJOA 4OU0A 1STZA 4A12A 1KU3A 4B8XA 1XB4A 2M8EA 2JT1A 4Y13A 2DQLA 4HLXA 4LGWA 2XVCA 3DEUA 4KDPA 2Y75A 2D1HA 3HYIA 4CYDA 4M71A 3E5UA 3U2RA 5HLHA 2Z99A 5ILVA 1KYZA 1ZG1A 3FXUA 1YTYA 1YS6A 3ECHA 2WTEA 3HOTA 3GX4X 2NAZA 3CUQA 3QP5A 1GXPA 1NHAA 4IJAA 2D2WA 1ZARA 2RGVA 3DKWA 5IT9Z 2COMA 4IF4A 2O8XA 3L09A 3P7NA 3R6SA 3JSOA 1ODDA 3HRUA 1PUEE 1O7LA 4CDGA 5E18F 4RAYA 5LGTA 2EK5A 4ESJA 4OOIA 2V1XA 1UCRA 1QQIA 1S6LA 4NQWA 1P4XA 3CTAA 2MA3A 1IN8A 3ZMTA 4RAZA 1FSHA 4M9XA 2Q8KA 5LBQA 2A3SA 4N0BA 4AIKA 3N97A 3E5XA 1R1TA 2DW4A 3LQQA 4HAMA 1P4AA 1ONVA 3BROA 3WU1B 2XAGA 2ACJA 1IN5A 3BZ6A 4OMYA 2ESNA 3IKVA 1FC3A 3IRRA 5KK1A 3T8TA 1W7PB 2YPRA 1QNTA 3WGIA 2BYVE 1B9NA 1D8JA 1LDKB 3F22A 5A2QK 1YG2A 2FE3A 5HOOA 2OZ6A 2PG4A 3PQJA 3NQOA 4KN4X 2P6TA 2D45A 1LVAA 5K5OA 4RB0A 1MKMA 2Q0OA 4I7HA 2FA5A 3RKXA 2A69F 3LAPA 1BI2A 3V4GA 3VFZA 3FHZA 3FXRA 2H6BA 3DP7A 3M7GA 5ED4A 5DYMA 2Y0MA 5IT9K 4MQ9F 5AIQA 2O61A 5E20A 2VC0A 3GW2A 2K86A 1YIOA 1ZAOA 2OZUA 2LKPA 3SZPA 4KICA 2G7UA 5HLGA 1U3EM 4Z2YA 2FBIA 3HTSB 1Z1DA 4I01A 5DD8A 5D4SA 3BJAA 4ENNA 3FWEA 4L9NA 1OMIA 4ESFA 3EQLF 1X3UA 1U5TB 4RGRA 2HFHA 4G6QA 1SAXA 1MZBA 5H6RA 1BOAA 4KT5C 1CF7B 1RUNA 3OOPA 3I4PA 3K9TA 3F21A 1W7PA 5LHIA 5D5VB 5CLSA 5HDKA 5DCMA 1D5VA 5D6EA 3KETA 2Q2EA 2RN7A 3BPVA 1BJAA 4MGRA 1SD4A 1J7KA 4EVIA 2QBYB 1T39A 2O3FA 2L54A 4YFNF 2PFBA 2XROA 1XSXA 4HX7A 1ZN2A 1U78A 3MCZA 1TBXA 3U1DA 4OIOF 4WXCA 2B0LA 4ZH4F 3I5UA 2HTSA 3J7AO 2K27A 1OR7A 5H6QA 1O3TA 2QYOA 2DK8A 3M8EA 4LJZF 4RGXA 4XLPF 3FM5A 3TDUC 1H9TA 1TTYA 5FD6A 1LDJA 1FWZA 4A6DA 3M9AA 5D8KB 4NB5A 2AXLA 1JXSA 1XGNA 3WTXC 4A5MA 1HW1A 1YLFA 1RI7A 2VT2A 1XCBA 3WE3A 4ZYEA 1XMKA 3HRSA 2ZNYA 3PFIA 1LJ9A 3JTHA 2Z33A 2VBZA 4ZZLA 3LA7A 1FY7A 1TNTA 5DCMB 3KP4A 3QPTA 1J9IA 3EUHA 3IL2A 3L00A 5F1RA 3HIFA 3M1EA 4QLCU 1R5HA 3BJ6A 5D5XB 1J2XA 3KP2A 3JSPA 4ENKA 4HW0A 3F8MA 2QWWA 3F72A 4JQFA 3AAFA 5ILSA 4EJTA 2XUBA 1HQCA 3RKYA 2LDUA 3T1BA 4TV7A 4HQEA 1G3SA 5F64A 1R23A 1YFHA 3J80Z 3JAMZ 2V6CA 2V79A 1R58A 2VOOA 3KZZA 4KIBA 1I27A 4Q4ZF 3ELKA 2W84A 4L9JA 3SHFA 1R22A 1S3JA 4KNYA 1OYIA 3SXYA 3P9CA 1W5TA 3ABUA 6PAXA 2R7FA 3WTSC 2MBFA 5D6FA 2BV6A 1PDNC 2M45A 4JBAA 2NRAC 1T6SA 4R1HA 5J6XA 3I58A 1DP7P 1IN6A 2XV4S 2HKXA 1FYMA 1ZG5A 3WTVC 3F3XA 2FMLA 2EA2A 3KLOA 1IZ1A 5L3DA 4L5IA 1WWXA 4WXHA 5ICCA 2ADUA 3PQKA 2GQQA 3VEPA 3QU6A 5FLXZ 3O2PE 4UVCA 4MEYF 2QBYA 3JW4A 2IRFG 3V8JA 2MC3A 2ZBKA 1U6GA 2MD5A 1JHFA 1ZGJA 4IXAA 2HYFA 1EV7A 2JTVA 2Y48A 1ZYRF 5HDGA 3I71A 2LSOA 4Y15A 4MTDA 4QWQA 4UVAA 3C3WA 4IRHA 1Z7UA 1IXSB 1U5TA 3WTUC 4AIHA 3BDDA 3MZHA 2HR3A 4M72A 3E3VA 3H3ZA 1LEBA 3ZMDA 2DQRA 4L9VA 2E7XA 2DLLA 5HVQC 4CGZA 2CGPA 2XAJA 5JI6A 2A5YB 3K1NA 4L9TA 4LD5A 1YO5C 1J59A 1KQ0A 1TW3A 3EETA 3K2ZA 2C6YA 4ZZDA 3EYIA 3GWZA 4HF1A 1AWCA 3CO7C 2GXGA 1T38A 2J5OA 4G9YA 1USTA 1F5TA 3ECOA 4L0ZB 5L3GA 2XHKA 2XAHA 5JHUA 3HTUA 5TJJA 4LB6B 1FX7A 3N4MA 4G7OF 5DDGA 3TO7A 3FF5A 2CO5A 2MLKA 4WCGA 2JPCA 1FOKA 1KU7A 2W85A 5A2QZ 1QO0D 5K1YA 2DK5A 5DV5A 5CYVA 1ZRDA 1D8KA 3GFMA 5LLQA 4EM2A 3RYPA 3HRTA 1ULYA 1USSA 1K78A 1ZREA 2XKOA 4BHPA 1DPRA 4LFUA 1XD7A 1DUXC 1O57A 4GO1A 3C1DA 2YU3A 2MH2A 3CJNA 5ILUA 1MJBA 2GXBA 4PGGA 3IHUA 5HS9A 1W5SA 4H0EA 1V4RA 2CW0F 1QPMA 3LAJA 3GFLA 3KP7A 2E1CA 2EFOA 2ZO4A 3KLNA 3TKYA 4HQMA 3E6BA 4AIJA 2IT0A 4G8XA 5L3FA 5L3BA 3P9KA 2KJCA 1FP2A 5D8LB 1SMYF 4BYYA 2DAOA 2X0LA 3CUQB 3U9GA 4IHSA 2PMUA 5E1XA 2V9VA 4I0BA 1Z9CA 4A0YA 2JPBA 3KEQA 2VONA 2DT5A 4O6JA 1SD7A 3C7JA 2FSWA 3K1MA 1IXRC 3ZMZA 1TQMA 4EM1A 4G7HF 3RKWA 2G9WA 1KQ8A 5CVIA 2VBYA 3T0YA 1XMAA 1HSTA 3MWMA 3V7SA 3W6JB 1EH7A 2EFPA 2PJPA 5E17F 3R60A 4E70A 3Q5FA 2CG4A 1T0FA 2DTRA 3F8NA 4EJVA 1K6OA 4U7DA 1FBQA 3LSTA 2P7VB 3J80K 1U8RA 2G7HA 3QU3A 5FB2A 3T5XA 5LGNA 1HKSA 3QP6A 2VBXA 1G3WA 2IVMA 3HSEA 3RJPA 2QENA 4R79A 4KN7X 1XGSA 4CZZA 2HWVA 4UVBA 3E6MA 4BNCA 3R0AA 1CF7A 2OBPA 2LF7A 3NRVA 4IHTA 3WE2A 1I6XA 3S2WA 4M9ZA 2FMYA 4M6YA 2XKPA 2DO7A 3QOPA 2E7WA 1ZGAA 1YYVA 3M8FA 3GO5A 2K7LA 1E17A 2EV5A 3G3ZA 2DU9A 2VXZA 3LQRA 4RB3C 3I53A 3KFWX 4D0PA 4XSZF 4IVNA 4I02A 2QQBA 4YG2F 2L4AA 1PP8F 3DQVC 2L3DA 3HRMA 2HYGD 3BPXA 2Z3YA 1TQPA 4N9IA 2UXNA 4ZYDA 2HOEA 3GEZA 2ZNZA 2PBIA 1QZYA 4EGYA 3KP6A 1I1GA 3KEOA 1FPQA 2ZJ2A 3WU0A 3IWZA 4HBLA 1BN5A 3TDZC 3RDIA 2DBBA 3I0TA 3D0SA 4KIFA 2VE9A 1ZRCA 2H94A 2IA1A 3RYRA 4UXNA 4XRFA 4ETSA 1W7PD 2IJLA 1LQ1A 4GXOA 4DNCA 5DUIA 1K79A 5E8GA 4FT8A 1KYWA 5HLIA 3E97A 3KCCA 1G4DA 2FNPA 4FX4A 1BI0A 4FHTA 3H3UA 4UNOA 4HF2A 5HS7A 4YFKF 3L2CA 2RDPA 1O3RA 3D5LA 1LNWA 3FMQA 3GFIA 1YW9A 1T98A 5BPIA 4ON0A 4WK8F 1D3YA 3L9FA 1ZH5A 2Z9OA 3FMRA 2QZ8A 5DCFA 3R61A 4M73A 1SFUA 1J5YA 3IC7A 4GCVA 1BBYA 3I59A 4KMFA 2A6HF 3EDPA 3LWFA 3HSRA 3V8LA 2L4MA 3FMSA 2OQGA 4WX9A 1ZHFA 4RGUA 2HTJA 3O6BB 3MAJA 1B4AA 3KE2A 2NYXA 3GF2A 2XASA 1FYLA 2F5EA 1SD5A 3F8CA 1P2FA 3ZMUA 2PMHA 1V3FA 3RI4A 5BOXA 2HKOA 1P4WA 3SQNA 3WTZA 3J81Z 2A61A 3HOSA 2M1BA 2VT3A 2AS5F 3SZTA 5D5UB 2PLYA 2HZTA 1OYWA 4L18B 4LB5A 2R3SA 2RV8A 5CVJA 3HHGA 2GIVA 1Z91A 2X4HA 4K2EA 5FD5A 3CLOA 2D1VA 4XSXF 2RVCA 1TQIA 2ISZA 2W57A 2EB7A 3VOEA 2O0YA 4M74A 1UB9A 4BXUA 5LHHA 3P9IA 4LG0A 2PEXA 1VTNC 5BS6A 4G7ZF 4G6DA 2NS0A 5ERIA 1R7JA 3V7CA 3HUGA 2IPQX 4P96A 5F6FA 3F8BA 1ZRFA 4HF0A 5E1WA 4P9UA 1R1UA 3BY6A 1MJAA 4PCQA 4UV8A 2FBHA 1FBUA 3LFKA 4HDUA 4UV9A 1P92A 2OAZA 2XRNA 2LNBA 3I54A 1BC8C 1B1BA 5FFZA 2CFXA 4I0AA 3BOQA 4A2UA 2QQ9A 2HGCA 3KP5A 2ELHA 3W6KB 2WV0A 2QQAA 2VOPA 3ZMVA 5FO5A 4OMZA 3TGNA 3ERED 3SFZA 2K4JA 1B6AA 2R7DA 2EV6A 1IAWA 1MGTA 5LRSA 4CHUA 4HYEA 1PP7U 5L3EA 2KIMA 4HX8A 3QRFF 4M6XA 3RTRA 1G3YA 3G73A 2VC1A 1DDNA 3JTGA 1HXDA 5HS8A 2STWA 2E1NA 2H09A 5J8CA 2KIFA 4Q48A 3IWFA 1HKTA 3K1PA 3ZQ7A 1IRGA 2HQNA 3WG9A 1B9MA 1G3TA 2DI3A 2NNYA 2F5FA 3DXJF 1KGSA 2DPDA 2P4WA 1F4KA 2XAFA 2KJBA 1H0MA 1Z6TA 5JVTA 5FGMA 2ZFWA 1FSEA 4CO8A 4ASNA 4PGHA 4HV5A 4EM0B 5FLXK 3E6DA 1IF1A 3BP8A 2M30A 2EJRA 2KIUA 1QZZA 2J5PA 2RQPA 3VB2A 4S04A 2EV0A 3GVAA 4IPAA 2VN2A 1O7FA 1TLHB 1R1VA 1F1ZA 2ZKZA 3ZPLA 4IRIA 4I09A 2Z5UA 5ICFA 1R36A 2LF8A 4U0YA 2P8TA 5LRRA 4Q5SF 4NHJA 4U88A 4N9HA 4LK1F 3MEXA 2O03A 1HKQA 2PI0A 2BBYA 4Y17A 4U0WA 2HQRA 4KUMA 3FX3A 5DUKA 1JE8A 4RB2C 2IW5A 4EGZA 2M87A 5H20A 1XDUA 2JSCA 3K69A 3F6VA 4LK0F 4I2OA 1MD0A 3MFKA 3QAHA 1FNNA 1EH8A 2F2EA 3WODF 2W25A 1A04A 5JR3A 4A5NA 2VBWA 2H6CA 5CVVA 5IT3A 1XDSA 4ENJA 1G6NA 1LDDA 2P5VA 4GYIA 1Z05A 2K4BA 1LEAA 1P6RA 5ICEA 3ZP5A 1BIBA 1KU9A 1YS7A 3TOAA 4G94A 1KU2A 2ZCWA 3FZVA 3WTTC 3ULQB 3ZN1A 3DV8A 2JZYA 1XSVA 1F9NA 4YFXF 3CDHA 3BWGA 2RC4A 1E2XA 1IRFA 2OU2A 3KP3A 2GA1A 3RPQA 1RIOH 4ZYGA 2O6GE 1OYYA 3CUOA 1UFMA 4L0YB 3K0LA 4A6EA 1I1SA 2RNJA 2GWRA 4UHTA 4AWXB 4OIRF 5CJ9A 4KA4A 2HEOA 2IA0A 3MQ0A 4PZJA 4A0ZA 1FT9A 2IA2A 2JRTA 2GZWA 2ETHA 3TO9A 3ZN0A 2QVOA 4YIFA 1RNLA 2EWNA 3DPTA 2VE8A 3EYYA 2A07F 4XBFA 3WTYC 4HA8A 1FP1D 2EFNA 5FFXA 5HDNA 5TRDA 2F5CA 5K5RA 1S29A 1HW5A 3FXQA 1Q1HA 2PN6A 3LA2A 3RPUA 3GYHX 3E5QA 1KA8A 1R5GA 3VODA 1FBSA 3O3KA 1YW8A 5LGUA 2BE5F 4KMUX 1S7OA 2YX7A 2CWEA 2OA4A 5EEHA 2CYYA 1ZLJA 2FU4A 3TQNA 4FX0A 2ZMEB 1J75A 1B59A 2MH9A 2FRHA 2HS5A 1SD6A 3QPHA 4MTEA 1WI9A 3TO6A 1YQAA 1BI1A 1BI3A 4L5JA 3GXOA 2V1DA 1GXQA 2VODA 3LA3A 2XGXA 1OPCA 4CXFA 2TDXA 2FXAA 5JFRA 1L3LA 5DD4A 4HV6A 5ICGA 4KFCA 2EFWA 5KVRA 2P5KA 1HW2A 1MDMB 3ISPA 3GFJA 4F7ZA 5E1ZB 5LHGA 4M9SA 2P7CB 4EMSA 2FF4A 1YW7A 3BJOA 4HLYA 1O3SA 4CICA 4EQQA 1EH6A 4OINF 3WGGA 1WQ2A 1K7AA 2KKOA 2F5DA 3GLXA 1IN4A 2UWMA 4HZFA 1MJ9A 1TW2A 4WWCA 2EA4A 4DQ2A 1H9GA 1ON1A 2FEZA 1BM9A 1IUYA 2PQ8A 4O3MA 4RS8A 1XCVA 4P55A 2QUFA 3F6OA 1SFEA 1XGMA 3R0JA 3T8RA 5K5QA 4JK1X 4UUVA 4U0VA 4U7BA 5AIPA 4KIGA 3I64A 4MHGA
chains in the Genus database with same CATH superfamily
4ZYHA 1T56A 2L9VA 3COAC 1WSUA 1VQKI 1XSDA 4JI4H 3TQTA 4A93G 1JUPA 4ANJA 3MJFA 4X1EA 4RAFA 1TNSA 4MEXF 2FUG2 4HNVA 3VPRA 5IOYA 5DQGA 5E8IA 5CA1F 4RUCA 3EUHC 1XX5A 1ON2A 2XGDA 3GUDA 1DPUA 1XNQH 2CQKA 3V6KA 2KRFA 3GTMJ 3PO3J 2WWYA 4RNNA 4B48A 2RKHA 3J81K 3OYAA 1M0TA 2NS7A 4HSTA 4ECUA 3AFHA 4BGDA 2GIZA 1UMQA 3OV8A 3R4KA 3BR2A 3WTWC 2H27A 2FOKA 1S0OA 4EJWA 4OIQF 4BQQA 2VPQA 2JSPA 3KZYA 4HPQA 1LUJB 3DLLF 1O3QA 2R7SA 3BAAA 4IHWA 1HNZH 4B3TH 2VQHA 1Y39A 3BTCA 3DPLC 3I55I 3DU5A 1IJWC 5IYDJ 3JSLA 2DFEA 1FZPB 2YX4A 1XGOA 4CCKA 2M5WA 2YCHA 1MH3A 2HOAA 2W24A 5LEKA 1DV1A 1IN7A 3M07A 1W5CC 1OCCH 2ESHA 3BQ2A 3MVPA 3JSNA 2EFQA 3QODA 1W36D 4DW6A 1CGPA 2HNHA 1K83J 4CCNA 1W93A 4B09A 4IHJF 3S16J 3H0GG 3UKGA 3F23A 1IXCA 3CCMI 3GV8B 1S68A 5HODA 3HOUG 3B73A 1M1EB 4XOPA 3N42B 5JQWA 1K78B 4IEJA 4RUAA 1GVJA 4YIIA 3JRDA 4MO7A 3C2GA 1TWFJ 1MDMA 3J80W 3IRQA 3IH3A 3DFGA 5FRMA 3JAMK 1Z6RA 2HPMA 1FKAH 1L0OC 2OQRA 3MN2A 3Q8QB 4IHXA 1SEUA 1BR2A 1HBXG 5EF6A 3GZNB 1Y1VG 1GT0C 2V9WA 2Y2ZA 3ZOBA 4XIDA 3VMMA 3GTOJ 1H8AC 1FYKA 1RRJA 3KHGA 2QF7A 2K9NA 3I4MJ 2GAUA 2OPTA 2HU9A 1DGSA 1UJ8A 4CCJA 5K7ZA 2CMPA 1S8NA 4EEYA 3V6JA 1SFOA 1B04A 1U5TC 4AVPA 4GYGA 3RIRA 1XMOH 2STTA 1J0RA 4LF7H 3W2VA 4MQVA 4JI0H 1Y0UA 4A0XA 1NG6A 3M4IA 2P6SA 2FK2A 3EPZA 3HKZE 3E6CC 1FMWA 5EEGA 1LB2A 4W1UA 4XRMA 3IG0A 4UCVA 3Q0VA 2JRMA 1BJZA 4JI5H 1SFXA 3A1YA 4A3KJ 4EYIB 1EJ9A 3GZ6A 1JKQC 1C0WA 2CSOA 2W82A 1RJQA 3MR2A 1XN7A 4CYCA 5DGBA 2LTPA 4NC7A 1SYXB 3I4MG 4YP3A 1FJGH 1UHWA 2XGPA 5CVUA 3RCOA 2WAQE 2V1UA 4LF8H 3NEUA 2AGQA 4BH9A 5J8FA 1HOMA 2DA2A 5KKNB 2R8JA 3VPDA 1ZLKA 2GPSA 2XPUA 1JDEA 5DTDA 3OIOA 2NU7B 1RZ4A 5F9LA 3LMMA 4YR3A 1X1AA 5CVRA 4RGSA 1SMTA 2QLZA 4MNUA 3MZYA 2MC4A 1R00A 4I98B 1BOBA 2R8HA 2UVVA 1U9OA 4XM3A 4A3EJ 2Y0SN 4R8HA 2UXXA 2E2IJ 1FLIA 1SVLA 3Q9SA 3BCBA 5KT7A 5KFDA 4YHHH 3C18A 3REOA 2ZJQF 5L3CA 2P5LC 4RU9A 4GGGA 1Y14B 1WCMG 2BEOA 1N25A 4WF2A 1W4MA 3B02A 3QPLA 4IQ4A 3PNYA 2DA5A 3ML6A 1UHMA 1X1PA 2FNAA 1T2KA 4DR2H 2HHHH 2W6QA 1GHCA 3I59B 4GFBA 2E5LH 4CSWA 5BMZA 1Z2PX 1WI3A 1K61A 2H8RA 4P9FA 4BAYA 3ZCOA 2XIGA 2DXIA 3SE7A 3DTIA 2ISYA 2FQ3A 5C4JJ 4A3DG 1JGSA 4HDVA 3OR1C 4HEA2 5C1OA 4NQWB 1S7AA 4XKVA 4TV8F 2FD5A 3TOBA 5DLFA 4UCOA 3VYSB 2LBFB 2ZXWH 4B3XA 1BGWA 4FE4A 3UR3C 3TL4X 1X58A 3I3LA 5KG3A 4A3EG 4LLLA 3GZ5A 5J1UA 1HLVA 2Y9YA 2QM3A 3RFCA 2DDAA 4HOBA 4EV0A 2VKEA 4ZOLF 2YU9J 3KPHA 2X6OA 1IW7F 4BQAA 4TV9F 3F8FA 4BJ5C 3ZMSA 1JHHA 2MLGA 5BPDA 4ZC3A 4WXDA 4EGQA 2DFIA 2W00A 2CFOA 2LK2A 4B3AA 4RB1A 3IKTA 3FBIB 1Y8QB 5AONA 3H92A 4IRGA 2Y0SE 1Z77A 2GA2A 1WKMA 2M34A 3X2QH 4O3RA 5KFKA 2M2EA 3DTKA 2DODA 3RZOJ 5C5JA 4XLFA 4LSXA 2R7VA 4HX4A 5C4XJ 2E5ZA 1REPC 1I7LA 3CVZA 4ENMA 2R93A 1MSFC 5DEQA 4FQGA 4BQNA 5BNGA 1IGNA 2ZMEA 4PJLA 3RV4A 2X85A 3O8HA 2B63G 2WAQN 3CO6C 2L01A 3FBNB 3FM3A 3AYHB 1VQ6I 4F4WA 5DG7A 1BIAA 5BQTA 2Y30A 2L02A 5D5WB 1RUOA 4XLAA 2YW2A 1U2WA 4DL2A 5D4RA 3V8KA 2K9SA 2Y31A 2R5ZB 4O4LF 4XLNF 4ED7A 3V4SA 3CCQI 1KQ9A 3OYCA 5LEJA 4LG0B 5KFAA 5E17F 5IYBJ 1QVUA 1HSJA 5E3MA 1I5ZA 2FBKA 5E79C 2HDCA 1JUSA 2K02A 3ABLH 4PDKA 3ROUA 4YR0A 2J9GA 3OS0A 1XDNA 1V5EA 1WRJA 3LFUA 3MR5A 4KJZA 2XAQA 2YSRA 3CMYA 2P0WA 2V26A 4C30A 3QPSA 2MG4A 1IRZA 1MMSA 4UUSA 4YAJB 3HSFA 3A01A 4PFPA 3Q9VA 3JRXA 2NNNA 1BR1A 3LSMA 1AOYA 4LFCH 1UZCA 3BQZA 1MNMC 1QGPA 2BY0A 4KYWA 2DFFA 4AD9A 5KFHA 2GOXB 4EJUA 4Q8EA 3OYJA 3D5RC 4LMYA 1MMGA 3RJ0A 4Q47A 2R7RA 2ZXJA 3GTLJ 1S97A 2YR2A 4P5OA 4O2AF 4LLNA 1Z21A 2A6EF 1IBMH 2IP2A 4GC7A 4DL5A 3U21A 4OIPF 3H0DA 2OD5A 5GP9A 3HHHA 1Q1VA 2EIJH 4BHBA 4BHCA 4ESBA 3ABTA 4S05A 2BGCA 3GTPJ 2W6ZA 2QKMB 5HV6A 2P81A 1QBJA 2FLPA 2UZKA 2E5NA 1GUUA 4BQOA 3OYBA 1HA8A 3V7RA 2AU0A 3H35A 4O5VA 3L7WA 2L9SA 3K7AJ 4ECXA 2A68F 3DF8A 5E3OA 1FMVA 1ZG3A 2WC2A 4LLGF 4RAGA 2XD4A 4II3A 1BC7C 3ZXSA 3HEFA 3CUQC 5KFYA 2ME0A 2KIQA 1OKRA 3WGHA 2DPUA 4EJOA 1E3HA 3H4BA 3AG2H 3CF5F 4OU0A 3CMEI 1WHUA 1STZA 4NDLA 4IO9F 1KU3A 4A12A 4B8XA 3FMAA 1XB4A 2DTZA 2M8EA 5KFCA 2JT1A 4ED8A 5F0FA 3LL7A 5C44G 1YRNB 4Y13A 2ZM6H 3HOVJ 2DQLA 2PMZN 4LF6H 2JA6G 4HLXA 4LGWA 1UAAA 4J0MA 5CA0F 2XVCA 3DEUA 2VIXA 1VF9A 3PNVA 4KDPA 1V5GA 2Y75A 2D1HA 2PMZA 1PX2A 1SANA 3HYIA 3NWTA 3OWTA 3PUFA 4XRSA 4CYDA 1VI0A 4M71A 3Q8SB 1RYSA 3MKZA 1V54H 3E5UA 3U2RA 5HLHA 2Z99A 1BJTA 5ILVA 3LSKA 2W70A 2BW3B 2G0EA 1JX4A 1OWTA 1KYZA 4ECQA 5BR8H 1ZG1A 3FXUA 2R7TA 3GTKJ 4IL6C 3ZRGA 3OHBA 1YTYA 3QYFA 1YS6A 3ECHA 5KHDA 2WTEA 3A01B 3HOTA 1VBHA 4A3CG 1PUFA 3NAUA 3GX4X 3V42A 2W9CA 2NAZA 3TP0A 3CUQA 1OQYA 3QP5A 3CMAI 2V9PA 3S17J 3DF7A 4C9YA 2CH0A 1GXPA 5IP7J 4PFOA 1NHAA 1VQPI 2FMAA 4IJAA 2D2WA 4NUBA 1ZARA 2RGVA 1WJEA 3HKZA 3DKWA 4J00A 2YUSA 5IT9Z 2COMA 4IF4A 1IRXA 1ETXA 2O8XA 3L09A 4N4OB 4DL7A 3FXMA 3P7NA 2HZDA 3R6SA 3JSOA 1ODDA 3PO2J 3HOYG 3HRUA 1PUEE 3PR5B 1O7LA 4CDGA 5E18F 4BY1G 4B3SH 3WO1A 3S93A 4RAYA 5LGTA 2EK5A 1X2NA 2KHMA 4ESJA 5IWAH 4OOIA 2V1XA 4IQJA 4FS2A 1UCRA 1QQIA 1S6LA 2HDWA 2L9NA 4NQWA 1W1WE 4UB6C 4ZDLA 5IP9J 3OYMA 4MV9A 5DLGA 1P4XA 5JVLA 3QYEA 1C3OA 3CTAA 4FISA 2R85A 2LG4A 1WJ5A 2OC6A 2DJNA 2MD0A 2MA3A 3ORQA 1IN8A 2I10A 3ZMTA 4OWRB 5M5YJ 4FBUA 4RAZA 5E3NA 3WU2C 1VQOI 2GXAA 1FSHA 4M9XA 2Q8KA 1JT0A 4J9QA 4PDBA 3TW6A 1YJWI 2ZC2A 2JA6A 4D1QA 4IHYA 3RSNA 1VQ7I 2JA5J 3ABKH 3H9QA 5LBQA 2A3SA 4F4ZA 2M4KA 2HVQA 4N0BA 1LVKA 3BTLA 4AIKA 3N97A 1K1SA 2UUBH 1NTCA 4BDYA 2XSDC 1AU7A 2R7LA 3E5XA 1ZR2A 3FXKA 3JRBA 1R1TA 2DW4A 4ED1A 3LQQA 4HAMA 4LH6A 3FXJA 1NG7A 1P4AA 3BZCA 2FB9A 1ONVA 2FPIB 2GLTA 4JI7H 3BROA 4YBZB 3WU1B 1A35A 2XAGA 1UC9A 1ZKGA 2DDBA 5L1LA 4C2MJ 2ACJA 1IN5A 3BZ6A 2B7EA 4OMYA 4PJNA 2MW8A 2ESNA 3GLLA 1RK6A 1LFPA 2CUZA 1XS9A 1K4TA 3W2WA 3IKVA 3LWBA 1FC3A 2DPIA 3IRRA 5KK1A 2IS2A 3T8TA 4JV2A 1W7PB 5T14A 2YPRA 1YX3A 4E7JA 1QNTA 1KJIA 3WGIA 2BYVE 4JYKA 3SFIA 1B9NA 2JQ7A 1D8JA 4BY7G 4Y3OA 2CUEA 1LDKB 2KZGA 2BVMA 3PR4A 1TP4A 4XK4A 3F22A 2DJIA 2Z16A 1YG2A 5A2QK 3TIIA 4EG0A 3L2PA 4OX9H 3HPHA 3BR6A 4Y4RA 4CH7A 2LBFA 2C2RA 2FE3A 5HOOA 2OZ6A 4LFBH 2PG4A 3PQJA 3NQOA 5KFLA 4KN4X 5IYDG 2VB6A 2P6TA 4EEQA 2D45A 1FTZA 1BNCA 5KFBA 1LVAA 3PSIA 1MBKA 4GDFA 2H8WA 2NU6B 3QZ8A 3VYUB 5HLTA 5K5OA 3VWBA 4RB0A 4QIWN 1MKMA 1I94H 2Q0OA 2R93G 4ZI7F 3PZPA 4I7HA 1WSCA 4L5EA 5JVGF 2FA5A 3RKXA 2IP4A 4CC6A 3M9OB 2I87A 5M5WJ 3J7AK 5BPHA 3CJRB 1DQUA 2A69F 3LAPA 2VQLA 1BI2A 3V4GA 3SI8A 3VFZA 3WNZA 2W6MA 2PBZA 3FXRA 4B1RA 3FHZA 4UY8I 2H6BA 3DP7A 3P5JA 3M7GA 5ED4A 2UUAH 3TMOA 4LIVA 3S3OA 3PJRA 5DYMA 4IZZA 3U9TA 5KFGA 3N05A 1A9XA 5FPRA 2Y0MA 5IT9K 2YZNA 4MQ9F 2YZGA 5AIQA 2F6CA 3GIPA 3CCEI 2O61A 2KPMA 5E20A 2VC0A 3GW2A 3H20A 2F4MB 3HXLA 3ETHA 4PJ0C 2K86A 3FK6A 2AGPA 1YIOA 2DN0A 1ZAOA 2X6XA 1W36C 2E2JJ 5HNFA 2WDTA 4MA0A 2OZUA 1JKJB 3EUAA 2LKPA 1MMAA 3G1OA 1Y8RB 1Y1WJ 2RNGA 3A0BC 3SZPA 3DKYA 4KICA 4FE7A 4LOCA 2K40A 2M7AA 2G7UA 3ASOH 4AU7A 5HLGA 1PVEA 3K10A 1U3EM 4Z2YA 2FBIA 4WBNF 2VUMG 3HTSB 1Z1DA 4I01A 5DD8A 5D4SA 3L2UA 4QJFA 1S10A 1X9NA 2HI3A 2XGEA 3K4CA 3BJAA 4EGJA 1Z67A 3BR5A 4ENNA 3FWEA 4L9NA 4YELA 2C00A 4FS1A 1OMIA 1BR4A 4KT6A 4ESFA 3OYEA 5DQHA 3EQLF 4FTHA 4X6AJ 4DV7H 1X3UA 2FKLA 1U5TB 4HNTA 2E60A 4RGRA 2HFHA 4G6QA 1YHQI 1SAXA 1MZBA 4EBCA 4J9PA 4J19A 5H6RA 5LXTF 1BOAA 1AN7A 2IGNA 4KT5C 4BEHB 1CF7B 4F91B 2OCEA 2R8IA 2UUZA 1RUNA 4I6ZA 3OOPA 3I4PA 2IEKA 2JEFA 3K9TA 3ZQCA 5IP6A 1W7PA 3F21A 2AO9A 3RF2A 5LHIA 5D5VB 5EWEA 1Z3XA 3MZ8A 2XGQA 3HOUJ 1PJRA 5EZGA 1YI2I 5CLSA 2XC7A 1A6QA 5HDKA 3AKZA 5DCMA 3FIWA 5D6EA 4BBSJ 1D5VA 3FKJA 3KETA 4EFEA 3IAS2 1F43A 2Q2EA 2RN7A 3BPVA 1DGRM 1R6RA 5GAHJ 2DCEA 3ZQLA 4YB8B 3MWDA 5FKLA 1BJAA 4MGRA 5JLXA 1SD4A 4CZCA 4IWYA 1Y6IA 1IC8A 1ETKA 3KAJA 4Q45A 3RAQA 3JRCA 2FK1A 1J7KA 2LYCA 4EVIA 2QBYB 1T39A 2BHZA 2O3FA 1TL8A 2OV7A 2L54A 1EF4A 2KSWA 1R4NB 4BXXJ 1SVOA 1ZETA 4YFNF 2PFBA 2XROA 1ETQA 1XSXA 4HX7A 4B47A 3Q2OA 3OYNA 4X65H 3H9GA 1V4YA 2ASDA 3FXLA 1ZN2A 3CCUI 1U78A 3MCZA 2VASA 2M7BA 4RM2A 3HOWG 4PWQA 2YYAA 3JRFA 1TBXA 3U1DA 4OIOF 2DMPA 1SVMA 4WXCA 1OISA 1VNDA 2B0LA 4ZH4F 3I5UA 2HTSA 5LYJF 3J7AO 2K27A 1GSHA 1OR7A 3H1CA 5H6QA 1O3TA 2QYOA 2DK8A 4E4TA 3M8EA 2CV0A 4LJZF 4RGXA 4XLPF 3VYTB 3FM5A 3TDUC 1FOWA 2OCCH 3OOUA 5C1PA 1H9TA 1TTYA 5FD6A 1Z2NX 4J9LA 4DV3H 2CU7A 3CJQB 4A3IJ 1LDJA 1TWGA 4Q0YA 3DWLE 1FWZA 5B3SH 2YRWA 4A6DA 4C5BA 2VQFH 2DT6A 4F3QA 3M9AA 2CUJA 5D8KB 4NB5A 4BXXG 2AXLA 2LY9A 1JXSA 1XGNA 3WTXC 4A5MA 2KL4A 3S3NA 1XC5A 3OMYA 3G1MA 2Y0SA 1HW1A 3GTJA 3ZR8X 1YLFA 2DMQA 2CKZB 1RI7A 2JA8J 2M0MA 1XCBA 2VT2A 3CESA 4A3DJ 3D1NI 1M0WA 3GQCA 3QQAA 3WE3A 4EBDA 4ZYEA 1XMKA 3WHBA 2DOFA 3DBLB 4E7ZA 4Q8FA 2R92A 3HRSA 4FETA 1GO3E 2ZNYA 3PFIA 3RKQA 5D8DA 1LJ9A 5B66C 5J40A 3JTHA 2Y69H 2Z33A 4JI3H 2VBZA 3FKIJ 4D7MA 1TZLA 4ZZLA 4Q43A 3MR3A 3LA7A 1FY7A 1TNTA 4BDZA 1YJ9I 2R86A 5DCMB 2QSGX 4GKKH 3KP4A 2R7QA 3U9SA 2ZMEC 3OIQA 3QPTA 1J9IA 4I50F 1EHIA 1QVTA 5CAEB 5FPOA 2UXBH 4M3FA 1YITI 3EUHA 3IL2A 1CQTA 3L00A 2ZFUA 3T5JA 2HOSA 5F1RA 3HOVG 3CQZA 3RGXA 3HIFA 1DU6A 3M1EA 4QLCU 3PW5A 1VFCA 1R5HA 1DV2A 1I6UA 3BJ6A 5D5XB 4NC6A 4O3OA 1J2XA 2ME6A 4XYMB 4A3IG 2CV1A 4IAJA 4DL4A 3KP2A 3JSPA 1HF0A 1DU0A 4XX0B 3BR0A 4ENKA 4RLFA 4HW0A 3F8MA 4ZHQF 1E4GT 2JA7A 2QWWA 3F72A 4JQFA 1POGA 3PIPF 4ZDOA 2FQ4A 3AAFA 5ILSA 2IS1A 1ACIA 1OLTA 3H5AA 4I76A 2XUBA 4EJTA 5EZYF 1HQCA 3RKYA 4XMYA 3H9JA 2LDUA 3T1BA 2IMWP 4TV7A 2V4JC 1JKRC 4HQEA 3JCUC 4I55F 3BQ1A 2Q2EB 2WTFA 5C4XG 1G3SA 2V5AA 5F64A 1R23A 2YZMA 1YFHA 3J80Z 1JIHA 3PW0A 3JAMZ 2V6CA 1Y56A 1S7EA 4RDUA 1QPIA 2V79A 1R58A 4Z6YA 3OYIA 5DGAA 4JI1H 3AG4H 3KZZA 1ZELA 1I27A 4KIBA 4M3EA 2VOOA 1I3AA 5KFUA 1YJNI 3HOXJ 4Q4ZF 1VZ0A 3ELKA 2JMWA 2W84A 4L9JA 5KFTA 3HOYJ 2X9DA 2CQ7A 2R7KA 1X1DA 2LD5A 3SHFA 1DIKA 3GTKA 1JGGA 1R22A 1S3JA 4KNYA 3R5XA 2H1LA 3TP3A 1OYIA 3SXYA 3P9CA 4JX4A 5GTIC 2Q2TA 3JRGA 2DA3A 1W5TA 3ABUA 1W96A 2BQUA 3GCMA 6PAXA 2R7FA 5EDNA 4J9MA 3QFFA 3WTSC 2MBFA 5D6FA 2BV6A 1V9PA 5F08A 4ZYAA 4A69C 1PDNC 2R7NA 2M45A 4JBAA 4R8UA 2NRAC 1T6SA 1RESA 5J2TF 4R1HA 1TWCA 5J6XA 5KG4A 3I58A 1DP7P 1IN6A 2XV4S 4OAYA 1ZTRA 5IYCJ 2ECBA 4E7LA 4GLXA 3BABA 2K85A 1O4XA 3SYTA 3DEEA 2HKXA 1FYMA 2W71A 1ZG5A 4UCRA 3WTVC 3OS1A 1T3NA 3F3XA 2EIMH 2RDIA 2FMLA 3GLKA 2EA2A 2LH9A 2GBYA 2UVWA 4CCOA 1EUCB 4J9OA 3KLOA 1IZ1A 2QCOA 5L3DA 3CC7I 1TAEA 4R8UB 4L5IA 4DUYH 1WWXA 4J9NA 4WXHA 5ICCA 2TRTA 2ZJPF 3KX2A 2ADUA 3L4KA 3PQKA 4RNMA 3PW2A 3L2WA 2XB5A 2LOOA 4ECYA 2GQQA 3VEPA 3QU6A 2R84A 3K5HA 5FKOA 5FLXZ 3O2PE 4UVCA 5KX5F 4MEYF 2QBYA 5FJ8G 1RYRA 4FBTA 3JW4A 2IRFG 3V8JA 1HNWH 2MC3A 2ZBKA 3CP8A 4C3JJ 1A31A 4C2MA 2UV1A 3HGYA 1U6GA 2MD5A 1JHFA 1ZGJA 4IXAA 3ZQFA 2ZJTA 2HYFA 1EV7A 2JTVA 3AL0B 1IV6A 2Y48A 5JH7F 4I99C 1ZYRF 4RNOA 5HDGA 1KBLA 5F0HA 3I71A 2LSOA 4Y15A 3GBGA 4MTDA 1NK3P 4QWQA 3PN1A 4A3KG 3PO3G 4UVAA 3C3WA 4IRHA 1Z7UA 2W8KA 1N77A 1WH7A 1IXSB 5B1AH 1U5TA 3WTUC 1OCOH 3M1CA 2VKDA 4AIHA 3BDDA 4PJMA 3MZHA 3VSKA 2HR3A 2IBKA 2AHQA 4M72A 5EZHA 3E3VA 3H3ZA 4DL6A 3A4CA 5KAIC 3ABMH 1LEBA 5IP7G 3ZMDA 2DQRA 3R23A 4L9VA 5FRNA 3NGDA 2L5QA 4QWEA 3J7YJ 2HVSA 5EWFA 2E7XA 2DLLA 5FJ8J 1GVDA 5HVQC 4CGZA 4YEJA 2CGPA 2XAJA 3JRWA 3RAXA 5JI6A 3KTMA 2A5YB 2R0QC 3K1NA 4L9TA 3HKZN 4LD5A 1YO5C 1DGWY 1J59A 1Y1VA 2BQRA 5CKTA 4KISA 1IDZA 1KQ0A 1KEEA 1TW3A 3EETA 2VI6A 3K2ZA 3HGGA 2XB0X 2C6YA 4ZZDA 1ETYA 2DFHA 3EYIA 3K4MA 3OYFA 3GWZA 4HF1A 4C2TA 3OHAA 4Y33A 1AWCA 1FJLA 2AGOA 3CO7C 2GXGA 2VPSA 3PUBA 1ZK8A 2X1DA 3OYDA 3S14J 1SFKA 4IRDA 1I50J 1T38A 3ETJA 2J6UA 1UG0A 2IGOA 2J5OA 3K6GA 1USTA 4G9YA 1LFUP 3JZIA 2BY1A 2VJIA 3ECOA 5L3GA 1LPQA 1F5TA 3MKWB 4L0ZB 4AQYH 2KT0A 2XHKA 2XAHA 2Z1DA 2V4RA 5JHUA 3HTUA 2FPGB 1V55H 3I56I 5TJJA 2EIKH 1KC7A 2RQQA 3AG3H 2P0AA 3JREA 5FKKA 4A3MJ 4PUSA 3G8CA 4O3QA 2J6TA 4LB6B 1FX7A 3N4MA 4HQ6A 1R49A 2O5RA 4G7OF 5KFVA 2ID6A 3A02A 5DDGA 3TO7A 3FF5A 3W6VA 5GPAA 2CO5A 1F36A 2MLKA 3PM1A 4WCGA 2WY7Q 2EZKA 4AUXA 2JPCA 4YR2A 4M7EA 1FOKA 1KU7A 3LSJA 2DYSH 2W85A 4G12A 1VQ8I 4J9KA 5A2QZ 1KZHA 3KHRA 1QO0D 4MAMA 5LFAA 5K1YA 2BXZA 5GPCA 2DK5A 1ZHQA 2UVRA 4XLHA 5DV5A 5CYVA 2VKVA 3H0GA 1ZRDA 1D8KA 2DA6A 3GFMA 1ZR4A 1CQJB 3T1HH 5LLQA 1KJQA 4G3IA 4MIMA 4EM2A 3RYPA 1EYZA 2OH2A 3HRTA 1ULYA 1USSA 4E4HA 2MSYA 1K78A 2Q2UA 4JI6H 3DCFA 1ZREA 3A2KA 3E5NA 2XKOA 5EDWA 5K7HA 1S9FA 5HNHA 2XF6A 3Q1KA 4O4HF 4BE0A 4BHPA 1DPRA 3OY9A 3OR2C 2BHYA 3RBDA 3KXYT 2E71A 1OCPA 4B4CA 4LFUA 3K70D 2XPVA 1XD7A 2NXNB 4E7KA 3PVXA 1DUXC 1QRYA 4APMA 5F04A 1O57A 2A5WA 4GO1A 3KYCB 3C1DA 2KMUA 2YU3A 2MH2A 3CJNA 4BL0B 5ILUA 4ZTJA 4ME6A 1WH2A 3BA9A 2VA2A 2HDDA 1C30A 1MJBA 2DT7B 2JUGA 2XDVA 2GXBA 4PGGA 3IHUA 5HS9A 1W5SA 2VPLA 2QSHX 4H0EA 1V4RA 1UHSA 3BA8A 2CW0F 1QPMA 3LAJA 1WH5A 3GFLA 4O4IF 1X3ZB 3DBRB 4C3IJ 2O8KA 3CD6I 3KP7A 2E1CA 3CDLA 1MBHA 4XKWA 5KFOA 3Q8PB 2EFOA 2ZO4A 3KLNA 3OSPA 1YE9A 2ZDHA 1MBJA 4I4TF 3CDIA 3TKYA 1WJCA 4HQMA 3E6BA 1M6VA 4AIJA 1EA3A 2IT0A 4DV6H 4G8XA 3SEZA 3S1MJ 1T95A 2ZXHA 2WBMA 5L3FA 5L3BA 3P9KA 4DZJA 4A3JJ 2V6EA 2QYZA 1SEIA 2KJCA 1FP2A 2FJZA 5D8LB 3BZKA 1NH3A 3BQ0A 2NVYJ 2ALZA 3CCSI 1TA8A 2R5YA 5KG1A 4A3FG 2EZIA 2AQFA 2R6FA 3ZQQA 1SMYF 4BYYA 2W4SA 4DL3A 1P7IA 2WE6A 4IOAF 2DAOA 2X0LA 4DLKA 1N78A 2M0CA 1JJ6C 3CUQB 3G6XA 3FXOA 2AQEA 4QSHA 3U9GA 3UNGC 4IHSA 1RPWA 2PMUA 5E1XA 2V9VA 1WCMA 1WR2A 1MBEA 3RV3A 4I0BA 1Z9CA 4A0YA 4M3DA 2B63J 1V51A 2JPBA 1IBLH 1P7JA 2HQ5A 3KEQA 4V19K 2VONA 4ECTA 2R8KA 3J81W 2DT5A 4O6JA 2UXCH 4U7CA 2IA6A 1P9QC 1SD7A 3OIPA 2LY1A 3ZQGA 3WG7H 3C7JA 3DPUA 2FSWA 4D5CA 5KFEA 2K5CA 4DR5H 3K1MA 3OS2A 1VQLI 1BL0A 1IXRC 1I39A 1KJJA 3ZMZA 3U1KA 1OCTC 3DEWA 4ECZA 1TQMA 2H1KA 4M6VA 5FKMA 5GONF 4EM1A 4G7HF 1ERDA 3RKWA 3K2AA 2G9WA 3CQZJ 1KQ8A 5CVIA 2QKLB 3KEYA 4JX6A 2VBYA 2WAEA 3CF2A 5FROA 1XNRH 2YL2A 1WZ2A 3T0YA 1XMAA 1HSTA 3MWMA 3V7SA 3W6JB 1EH7A 2EFPA 4BXFA 4ZTFA 3R60A 4E70A 3Q5FA 2PJPA 1AUVA 3N6XA 3GV5B 3VYRB 2CG4A 4DJAA 2M4GA 1T0FA 1TWGJ 3RQ4A 1T94A 4Y52J 3BR1A 1RKTA 3K4KA 2HYJA 2DTRA 5CQEA 2M05A 3F8NA 3K3PA 4EJVA 3RUPA 1WGXA 1K6OA 2R82A 4U7DA 2OJED 4ZQIA 4IRKA 1FBQA 2R92G 3N44B 4B44A 3LSTA 4DBQA 3GTMA 2BVLA 2P7VB 2JEIA 3J80K 4LF4H 2RDJA 1IBKH 1U8RA 2G7HA 1I7NA 3KHLA 3QU3A 5FB2A 4B3MH 2MYSA 3L2VA 3T5XA 3K3VA 5LGNA 1BA5A 1O75A 2JA8G 2ZDQA 5KAFC 5GADJ 1WJDA 2K9LA 4A3LJ 4DV2H 4DR3H 1HKSA 2ZSHB 3QP6A 2MGQA 1MH4A 3C2HA 5M5XJ 2VBXA 1G3WA 2IVMA 3DBHB 2X1EA 2V59A 4LF9H 3HSEA 2E36A 5EOYA 3RJPA 4JX5A 3IN5A 2QENA 4R79A 3EPGA 2FJ1A 2XSJC 4KN7X 3H40A 1XGSA 1YX5A 4CZZA 1L2ZA 2HWVA 4QPOA 4UVBA 2IGMA 2W48A 1S0MA 2CJJA 2F5VA 1S0NA 3E6MA 2W6PA 4IR1A 2R7ZA 4BNCA 5KFQA 1EZ1A 3R0AA 1TT5B 1CF7A 2OBPA 3S1QJ 2LF7A 4JOMA 3NRVA 5LMUH 2NOJB 4AIDA 4IHTA 3G6YA 4DBRA 1D0XA 2FK3A 3WE2A 4DV0H 1I6XA 3S2WA 1WJBA 2V7FA 4M9ZA 5M3FJ 1G8XA 2FMYA 4M6YA 2XC9A 2XKPA 4F52A 2DO7A 3QOPA 5F9NA 3ASNH 2E7WA 2WY8Q 1TWHJ 3N43B 4JV0A 3MKYB 1ZGAA 1YYVA 3V4ZA 3M8FA 3GO5A 2K7LA 1E17A 2FP4B 2EV5A 3G3ZA 3H5NA 2TCTA 2KDZA 1TWHA 4LFAH 2DMUA 4F92B 5C3EG 2VR1A 2DU9A 1RKWA 2VXZA 4O3SA 3LQRA 4RB3C 3I53A 2HGSA 2VOBA 3KFWX 4D0PA 4XSZF 3BJYA 4IVNA 4I02A 4XKCA 2QQBA 4YG2F 1I6HJ 1Z0XA 5J2UF 1AA7A 2L4AA 1W0UA 3VPBA 4GKJH 1PP8F 5LMNH 4XZ3B 4U6PA 2ZB9A 4MV8A 3DQVC 4DYCA 2L3DA 3HRMA 4PJJA 1UC8A 5DM7F 1BW6A 4HG2A 2HYGD 3BPXA 4EFBA 3RTXA 2Z3YA 4MA5A 4EEFG 3H0GJ 5D1PA 1TQPA 4MFDA 3MFHA 1TT0A 4N9IA 2UXNA 1JUMA 3BTJA 4ZYDA 2HOEA 3GEZA 2A6TA 4ABZA 2ZNZA 2ID3A 2PBIA 4CYCB 5KG0A 4DZPA 1QZYA 4EGYA 3KP6A 3ESWB 5KT6A 1I1GA 3A03A 2LP0A 2QQ8A 3KEOA 1FPQA 2ZJ2A 3WU0A 3S1RJ 3IWZA 4HBLA 4ITVA 3FISA 3RB3A 1BN5A 3TDZC 4L1KA 1K83A 3RDIA 2DBBA 4YIRX 3TEDA 4CC5A 4UUSB 4A3BJ 1FEXA 5KFFA 5KT4A 4BY7J 3I0TA 3D0SA 2E34A 4KIFA 2EH3A 3CCLI 2BQ3A 2VE9A 3RQIA 1WJFA 1Z7LA 4PK4A 1ZRCA 2H94A 3UFXB 2IA1A 1V5FA 2IXSA 3FHNA 5LD2C 3N41B 3EUKL 3RYRA 1IDYA 1TWFA 3NARA 4UXNA 4XQFA 1X3WB 1RJRA 4MV3A 4ZJZA 4XRFA 2C35B 4KITB 4ETSA 1W7PD 2IJLA 1LQ1A 2YS7A 1JXLA 4D7NA 4A93J 1IO2A 3GTQJ 4JV5H 4GXOA 2DIKA 4DNCA 1K4SA 1HDPA 5DUIA 4HRIA 1PYVA 1K79A 2W9BB 5E8GA 4IOCF 4FT8A 1G2HA 2JA5G 3JRAA 2CV2A 2WAQA 4BKXA 3L2QA 3GV7B 3HM5A 5L1JA 2R87A 3HOZJ 5L9XA 1KYWA 3BR3A 4JI2H 5HLIA 3E97A 4N4NB 4A3MG 3KCCA 1G4DA 2FNPA 4LSAA 3VPCA 2VA3A 2JA7G 1PK8A 5FKNA 4FX4A 1VQ5I 1BI0A 4X0GA 4FHTA 2ZJRF 5F1JA 2VKHA 3H3UA 2DOAA 4UNOA 4HF2A 4IZOA 3HJEA 5EEAA 2WADA 4IX7A 1AUXA 4ECVA 4XLEA 4A3BG 3QYBA 5HS7A 4YFKF 5KFWA 2L7MP 3L2CA 2OTJI 1X2MA 2IGKA 4GC6A 2RDPA 1QHGA 2R7UA 1IUFA 1O3RA 3D5LA 1LNWA 5J4VA 2E2HJ 3FMQA 3GFIA 2OF7A 4QIWE 4ED3A 1B8IB 4F50A 5K2MA 3IP4B 4NC8A 1YW9A 1MNEA 4BEHA 3OYHA 5LOVF 1T98A 3B6CA 5BPIA 2VQCA 4ON0A 3H5RA 1ETOA 2NS8A 3G6VA 4WK8F 3Q3SA 2BR0A 1D3YA 3L9FA 2K9QA 1ZH5A 5KG7A 3JRIA 4E7HA 2Z9OA 2W7OA 4MV1A 3GIIA 4A3GJ 2VUGA 3FMRA 5IYZF 2PN1A 2QZ8A 5DCFA 3R61A 4HSRA 4M73A 4XNFA 1SFUA 2E2HA 1ETWA 4QWCA 1J5YA 1IOVA 3IC7A 1RR8C 2SCUB 4A2AA 4GCVA 1BBYA 3CCRI 3S2DJ 1N75A 3I59A 3HB9A 4KMFA 2V9KA 3V6HA 3DKXA 2NOGA 2VQEH 5L1KA 1WJAA 4HR7A 3BG3A 2A6HF 3IUOA 3EDPA 3LWFA 3HSRA 3V8LA 5KFXA 2JEJA 2W8LA 4JP0A 3GTLA 2L4MA 2O9LA 3GMEA 3FMSA 3KYDB 5EJCA 5DS9A 1UG2A 2JUCA 2K3FA 1QA6A 2KP6A 3CLQA 2COBA 1M7JA 5J4YA 1Y1WG 2EILH 2OQGA 4EATA 4WX9A 2EBIA 3RBEA 4B3RH 1ZHFA 2WA0A 4RGUA 4XYLB 4F4YA 2HTJA 3O6BB 1RK5A 3MAJA 2KFDA 2XGCA 5TISC 1B4AA 3KE2A 5FLVA 2NYXA 3GF2A 2XAUA 2JVGA 3SDBA 3GTQA 2VPRA 2LKSA 2XASA 3RPUD 4E7SA 2HVRA 4C2UA 3F9KA 1RR7A 3ZGKA 3L2RA 1FYLA 2UU9H 3HOWJ 2F5EA 4AM3A 4P1WA 4HYKA 2NVTJ 3FK7A 4QIWA 2LFBA 1SD5A 2BOLA 2E1MB 1P2FA 3F8CA 2NVQJ 1JDBB 4X62H 5L1IA 4ED6A 2X48A 3ZMUA 2EINH 2HXOA 4BACA 2PMHA 1V3FA 3RI4A 1KONA 2I8DA 5BOXA 2HKOA 4RM3A 2VL8A 3SEQA 3HL2A 5IY5H 1P4WA 3SQNA 3WTZA 4QWBA 5GTHC 4Y7NJ 3J81Z 4DV4H 2HOTA 5D1OB 3IH4A 2B9SA 1U0JA 1GV5A 3Q0WA 3R5HA 2XCLA 4A3JG 2A61A 1I3QJ 2YS6A 5HBRB 1YOVB 1MBFA 4UCTA 2BZTA 3HOSA 2MFZA 2OUMA 5EG0B 2M1BA 2VT3A 4A2BA 1BXRA 4BBSG 2R93J 3PSFA 2AS5F 3SZTA 4ED2A 2W7PA 1ENHA 1E0EA 5KT5A 2W9AA 3ERMA 2IBDA 5D5UB 2PLYA 4JUZA 2WAFA 2N8GA 2XCAA 2HZTA 1AKHA 2NVXJ 1ULZA 1OYWA 1B8IA 1XTAA 1XG1A 2MABA 3KZIC 4L18B 2RAEA 1K1QA 2GOMA 2DA1A 5KFIA 3UQ8A 4LB5A 5KFSA 2E1MC 2VQDA 1LE8A 1EUDB 5FLMG 2R3SA 2RV8A 5J3LA 1ZHSA 5CVJA 3HHGA 1E3OC 2UXDH 2GIVA 1D0YA 4CA0A 1U8BA 1Z91A 2X4HA 2QK4A 4K2EA 5FD5A 1VAJA 1WCMJ 2JEGA 1GSOA 3CLOA 2D1VA 4XSXF 2RVCA 1TQIA 1VQ4I 1B33N 2ISZA 2W57A 2XRLA 1ZQ3P 2EB7A 1FIAA 3S1NJ 3LSGA 2J6SA 2RGRA 3VOEA 1U9NA 2Y9ZA 2O0YA 1AKHB 4BBRJ 3BTIA 2PMZE 5KT3A 2VXDA 4M74A 4QWDA 2V4QA 1UB9A 4BXUA 5LHHA 4LITA 3P9IA 4LG0A 5J1RA 2PEXA 1VTNC 3A0HC 5BS6A 1VQMI 4G7ZF 1WPKA 5FLMJ 4V2GA 2X0SA 3TINA 5JVDF 2V1NA 4G6DA 3BT9A 2NS0A 2R7OA 3G4SI 5ERIA 5C44J 2W7NA 1R7JA 3E0JB 4IKFA 3V7CA 3HUGA 1T36A 3KALA 4RZQA 3MFIA 2E2IA 1OCZH 5IOZA 2IPQX 4A3FJ 4P96A 5F6FA 3F8BA 4AC0A 2QEXI 1ZRFA 4F93B 4HF0A 5E1WA 4P9UA 1R1UA 2KQRA 3BY6A 1MJAA 4PCQA 4UV8A 1ETVA 1GLNA 2FBHA 2LKXA 1FBUA 1S5LC 2CQXA 3LFKA 4D5FA 4HDUA 1GLVA 4A3LG 4UV9A 1B6RA 3S8PA 3E7LA 1VS0A 1P92A 2OAZA 2FLLA 2XRNA 4E6KG 2F4IA 2LNBA 4E7IA 2F4OB 4IR9A 2LY2A 3I54A 4BU2A 4XR6A 1BC8C 3GTOA 1B1BA 3CCVI 2DA4A 2Q1ZB 1VKZA 5FFZA 3R5FA 1JKOC 2CFXA 2R7ZJ 2JA2A 4I0AA 3BOQA 5A2QW 4A2UA 3CMMA 2QQ9A 2HGCA 1PUFB 4DR1H 5J47A 3KP5A 1MSEC 3Q8RB 4X66H 1H89C 2ELHA 3W6KB 2ASJA 2WV0A 1T8IA 1RETA 3RGZA 2QQAA 5KT2A 4UCUA 4DV1H 2VOPA 3ZMVA 4BJ6C 3PNTA 1MBGA 4OMZA 5FO5A 3TGNA 3ERED 3FDSA 2R7WA 3SFZA 5C3EJ 4J01A 2GLOA 2IS6A 1B6SA 2K4JA 1KJ9A 4RA2A 4EYHB 1B6AA 2R7DA 2EV6A 3HBLA 1FVIA 2R7ZG 1IAWA 3F0CA 1MGTA 3CCJI 2BY2A 5K7FA 3PW7A 1W0TA 5LRSA 2ASLA 4CHUA 3HOZG 4HYEA 1PP7U 1FTTA 5L3EA 2KIMA 4HX8A 3QRFF 1G59A 4QPQA 3QWLA 4XOTA 4M6XA 3RTRA 2OLSA 4CUGA 1G3YA 4B43A 3PFYA 3G73A 1XMQH 2VC1A 3SZGA 1DDNA 2NVXA 4QWAA 3H3VK 1I50A 3JTGA 5KFRA 5IT9W 1HXDA 1MNDA 5HS8A 2STWA 2E1NA 2H09A 4XN3A 5J8CA 3CC4I 2AXTC 2KIFA 2ECCA 4Q48A 4OAZA 3Q0UA 3KYLA 3IWFA 1IG7A 4UCSA 4X64H 3AG1H 5DG9A 1HKTA 2YRXA 2KISA 3CP2A 3K1PA 3ZQ7A 4MLOA 1IRGA 3W2AA 2JA5A 2HQNA 1TWAA 2M8GX 3WG9A 1B9MA 1G3TA 4DUZH 4UFZA 5LP6F 2DI3A 2M9HA 5B5EC 2NNYA 2F5FA 3DXJF 3GIJA 1N48A 1KGSA 1GV2A 1SC7A 3S2HJ 2HQAA 2M3AA 2DPDA 2P4WA 2FX0A 4NXNH 1F4KA 1T33A 3W3CA 2XAFA 2KJBA 1H0MA 1Z6TA 2ZXIA 2WB1E 5JVTA 5FGMA 3HZJA 1VQ9I 4BE1A 2EZHA 3K4NA 2ZFWA 3L1PA 1FSEA 1RC9A 4U87A 3M9MB 4CO8A 4ASNA 5EGOB 3M3YJ 5IPAA 4DYQA 5KG5A 2F4VH 1JTXA 1D1BA 4DGWB 4PGHA 2UUCH 4HV5A 4EM0B 5E3LA 4A3CJ 4O2BF 5IYCG 1OCRH 4DR6H 5FLXK 3E6DA 1IF1A 2R7XA 3CC2I 2X1CA 3BP8A 2M30A 1A6IA 2EJRA 2KIUA 2R5ZA 1QZZA 2J5PA 3DTEA 4WD3A 1WVRA 2RQPA 3VB2A 1HC8A 9ANTA 1CQIB 2EPFA 4S04A 5LA6F 3AL0C 2EV0A 3GVAA 3GIDA 2JA7J 2R92J 4IPAA 4AVZA 2GM4A 2L2OA 2VN2A 1O7FA 3ZQIA 3BG6A 4TQRA 4GRIA 4JV1A 5CB4F 3HG9A 1TLHB 1R1VA 3GTJJ 1F1ZA 4NXMH 2VLAA 1R5ID 3MMYB 3N40P 5J1YA 5KCMA 2ZKZA 5EYRA 3BG7A 3MD2A 1A5JA 1JI8A 2ELJA 1P8LA 3ZPLA 4IRIA 4I09A 2Z5UA 5ICFA 2L9RA 4HNUA 1HR0H 3GTPA 1R36A 2LF8A 4U0YA 1Y1WA 1LE8B 5I47A 2P8TA 1K6YA 5LRRA 4Q5SF 2R7MA 4NHJA 4U88A 5KNLA 4N9HA 4ZDPA 3N8DA 2CQQA 1EKEA 4MV6A 1J5EH 2W6OA 4PSXA 4LK1F 3CCYA 3MEXA 3S15J 2JVHA 2O03A 2DPJA 1HKQA 2PI0A 2BBYA 4A3GG 2HPIA 4Y17A 2DZDA 3G2BA 3BCAA 1OJLA 4U0WA 4F4XA 1GGOA 1AHDP 3LP8A 2HQRA 1YIJI 1ZGWA 4LF5H 3GIKA 3HUGB 4KUMA 4TQSA 3FX3A 5DUKA 1TWCJ 3EPIA 4ED0A 2L7ZA 3RZDJ 2KRHA 1JE8A 1HDDC 1H88C 4RB2C 1XMXA 2IW5A 4YAKB 4C5AA 4EGZA 2M87A 1T08B 2I5UA 5H20A 1N34H 1XDUA 2JSCA 1ORKA 2LRDA 3K69A 4XLCA 2R5YB 1A0IA 2NU9B 3H4DA 2C2EA 3F6VA 3HPGA 4LK0F 4XORA 4I2OA 4XKBA 1MD0A 3MFKA 4YQWA 3LSIA 4CCLA 3I12A 3QAHA 2ZSIB 4DIQA 5KG2A 3QZ7A 3VSLA 4ECRA 1LFBA 1IV8A 1EH8A 1FNNA 4M9UA 1RJPA 2CZGA 2F2EA 3WODF 4PSWA 1BW5A 2ELKA 3TQ1A 3SJMA 1S9HA 1UNNC 4AYBE 3OL3A 1VQNI 4MV7A 4BY1J 3GTGJ 4BWSC 4BS9A 3M4OJ 4JYAH 2W25A 3NWSA 2E19A 5H2FC 3PW4A 1N56A 3FDYA 2R8GA 1S72I 4F55A 1A04A 2CW7A 2F48A 4YRVA 2FOWA 5JR3A 3S32A 4A5NA 3GIQA 3TIGA 1QHHD 1Y0NA 2VBWA 2RREA 4XONA 2H6CA 2LREA 3ONQA 4BJTA 5CVVA 5JUMA 5IT3A 3MWEA 1XDSA 4ENJA 4M3BA 1G6NA 4IWXA 5B1BH 1LDDA 2WB1A 2P5VA 5JHFA 2JWTA 2BW3A 4GYIA 2L0KA 5C8YF 1Z05A 2K4BA 2L7FP 1LEAA 3PL8A 1P6RA 3RB6A 2WB1N 2BY3A 2CRGA 4CCMA 3JAMW 5ICEA 3ZP5A 4H4KC 1E4EB 1BIBA 1XPXA 2LMDA 5KG6A 1KU9A 1YS7A 3TOAA 4MFEA 2I80A 4G94A 1KU2A 4FASD 1J09A 2ZCWA 3JRHA 3FZVA 2IS4A 4D9JA 3LNQA 3WTTC 3ULQB 3ZN1A 2VJ4A 1YRNA 4RZRA 3DV8A 2LVSA 2FLNA 2JZYA 3BLYA 1XSVA 2PJRB 3IH2A 2E1OA 1F9NA 2KLOA 2EZLA 4YFXF 5DQIA 3E1SA 5BMVF 4NBQA 3RIZA 3CDHA 2CW8A 4XN0A 3BWGA 4ECWA 1Y1VJ 2RC4A 5EWGA 1Z3YA 3OUUA 3DLAA 1E2XA 1IRFA 2OU2A 3KP3A 2GA1A 3FKIA 1CE8A 2HXIA 4IHVA 3RPQA 2W1OA 4DV5H 1RIOH 4LIUA 1E3PA 3OUZA 1X19A 4NLGA 4ZYGA 3QOEA 5EG0A 4YY3H 2X6YA 4BUPA 2O6GE 1OYYA 3CUOA 2YS9A 1UFMA 4L0YB 3K0LA 3S3MA 2UVUA 4A6EA 5CPRB 1I1SA 4RBOA 2KZVA 2RNJA 2HJWA 5TGTA 2ICWG 4UUTA 2GWRA 5KFZA 1TWAJ 4UHTA 4AWXB 2W6NA 2A05A 3LMLA 2ZDGA 1JT6A 4OIRF 5F0CA 3LSHA 5CJ9A 4KA4A 1SAUA 2HEOA 2XCPA 2QSFX 2PX9A 2IA0A 3MQ0A 4PZJA 4V2FA 2O7OA 4EBEA 3MKLA 2QGUA 4A0ZA 4O3PA 1IOWA 2B63A 4DOZA 1FT9A 4FCYA 1CS0A 4ECSA 3G71I 2IA2A 4LH7A 2JRTA 3WO0A 2GZWA 2ETHA 3TO9A 3ZN0A 1SCUB 2DMNA 3GTGA 2GPWA 3OSFA 3BQYA 4YJ2F 2QVOA 5DM6F 5KFNA 1R4MB 3HC7A 3FKIG 4YIFA 5DG8A 2FPPB 2C28A 1GDTA 1RNLA 2EWNA 2DWCA 2RF4A 1NK2P 3OYLA 3DPTA 2VE8A 4MV4A 4DR4H 3PIOF 3EYYA 3JR9A 1E4EA 2A07F 5KFPA 4XBFA 3WTYC 4HA8A 5LL6b 1FP1D 1ZQ7A 1FOXA 1E4FT 3MR6A 2EFNA 5FFXA 5HDNA 3RB0A 2XF7A 1D1CA 5TRDA 1R71A 3G6EI 2F5CA 5IYBG 2KDOA 5K5RA 1S29A 2NVUB 3ORRA 3H3VH 5KFJA 1HW5A 2ATLA 3I9V2 3FXQA 4J9RA 2IAIA 1A36A 1Q1HA 2PN6A 2WV1A 1D1AA 3LA2A 3RPUA 3GYHX 2XPWA 2V58A 1X4PA 2DYRH 2E35A 2VUMJ 1LKXA 3E5QA 1KA8A 1R5GA 3VODA 1FBSA 1S03G 3O3KA 4S0HB 1YW8A 5LGUA 4RMNA 2BE5F 1D5YA 4KMUX 1S7OA 1T0FC 3J7ZI 2CQNA 2YX7A 4XRSG 2CWEA 3KIOA 2OA4A 5EEHA 2CYYA 2JA6J 2W9BA 5JLWA 3K5IA 1ZLJA 1SFOJ 2FU4A 3TQNA 4R7RA 2X51A 1DP3A 3D5SC 1FOYA 2ZMEB 4FX0A 1J75A 3C0FB 4LG3A 1B59A 2DMTA 2MH9A 2FRHA 3L4JA 4JI8H 1KJ8A 2HS5A 3BG5A 3OYKA 1SD6A 3QPHA 3KAKA 4MTEA 2CS3A 2DLNA 1B72A 1WI9A 4FM9A 3TO6A 1JLLB 3TBIA 4FU0A 2XF5A 2PJRA 2NU8B 3IV5A 1YQAA 1BI1A 5EGOA 2D5VA 3PO2G 1BI3A 4L5JA 1D0ZA 1UELB 2DOEA 2LC2A 1TC3C 1N36H 3GXOA 2V1DA 3OL4A 4YJ3F 1GXQA 2CQYA 2VODA 3LA3A 2XGXA 5GAEJ 1OPCA 3OYGA 4QW9A 1HNXH 4CXFA 2TDXA 4UB8C 2FXAA 4XICA 3K4JA 2L7KA 5JFRA 2NVYA 2K3PA 1I3QA 1L3LA 3T1YH 3OTOH 4XL9A 2K9MA 2C2DA 5D1OA 2W9CB 3VDXA 5DD4A 1QZEA 3J7AY 4HV6A 4Q44A 2JN6A 1X4OA 3K4BA 4BBRG 5BPFA 2C22A 5ICGA 1ITYA 4KFCA 3WHCA 2EFWA 1HCRA 1VBGA 2YU9A 5KVRA 1OFCX 1MMDA 2R4GA 4C3HJ 4AYBN 4J9SA 2P5KA 1HW2A 2JJ7A 2WYOA 3G1LA 3T5LA 5GAGJ 1MDMB 3ISPA 3KHHA 3T5HA 3GFJA 1JTYA 4BE2A 2QA4I 4AYBA 1GYFA 4F7ZA 5E1ZB 4QW8A 5LHGA 4M9SA 3CJTB 2X6WA 2I8CA 4EMSA 2P7CB 5H80A 3M8JA 2FF4A 1YW7A 3BJOA 4II2A 4HLYA 1N33H 1O3SA 4CICA 4EQQA 4QTRA 1OR7C 2LLKA 1EH6A 3HOXG 4OINF 1X1CA 2Z2SB 1GSAA 4Y8VB 3HDDA 3C2BA 4M3GA 3WGGA 1WQ2A 1K7AA 1MIJA 2KKOA 1JJ8C 3T5KA 2F5DA 2KRCA 3GLXA 3IAM2 3LSRA 2NUAB 2AQ4A 1IN4A 3H36A 2UWMA 1N32H 3GILA 2LR8A 4DR7H 4HZFA 2PVPA 1X1BA 5FLXW 2OTLI 2OWOA 1QU3A 1MJ9A 1TW2A 3GIMA 2MCTA 3I4NG 1JKPC 1Z2OX 5IP9G 4WWCA 2EA4A 4DQ2A 1H9GA 1ON1A 3TW7A 2FEZA 3K4LA 1BM9A 4TUYF 5M3MJ 1IUYA 2PQ8A 4G6TB 5KFMA 4O3MA 4RS8A 1XCVA 2VJ5A 2VQGA 3LSPA 1MMNA 3RB4A 2VUMA 3DU6A 4P55A 2QUFA 2VJJA 4NNJA 4C5CA 2EQRA 4O3NA 3ZQHA 3OSGA 3B6AA 3F6OA 3BC8A 1SFEA 1FIPA 1XGMA 2CUFA 3R0JA 3T8RA 1B72B 3SDGA 3O8GA 4K0KH 4IRCA 5CQGA 3CZ6A 3I4NJ 5K5QA 1R9TA 1WFXA 5F27A 4JK1X 3LOCA 4UUVA 1MW7A 4DYRA 4U0VA 4RLQA 1APLC 2JK3A 1R9TJ 3M9NB 4U7BA 5AIPA 4KIGA 3K70C 3BG9A 3I64A 2DA7A 2BXYA 3OSNA 4W97A 4KHPH 4MHGA
chains in the Genus database with same CATH topology
4ZYHA 3COAC 1WSUA 4JI4H 1XSDA 4MEXF 1TNSA 5E8IA 3GUDA 1ON2A 1DPUA 1XNQH 2CQKA 2KRFA 2WWYA 2RKHA 3J81K 1M0TA 3OV8A 3R4KA 3WTWC 2H27A 2FOKA 4EJWA 4OIQF 3KZYA 1O3QA 3BAAA 4B3TH 3DPLC 3JSLA 1FZPB 2YX4A 1XGOA 2M5WA 2YCHA 2W24A 5LEKA 1IN7A 2ESHA 3JSNA 2EFQA 1CGPA 4B09A 3F23A 1IXCA 1S68A 3B73A 3N42B 1K78B 1GVJA 4YIIA 1MDMA 3J80W 3IRQA 3DFGA 3JAMK 1Z6RA 1FKAH 1L0OC 2OQRA 1HBXG 1FYKA 2GAUA 1DGSA 1S8NA 1B04A 1U5TC 4AVPA 4GYGA 3RIRA 1XMOH 2STTA 1J0RA 4LF7H 4MQVA 4JI0H 1Y0UA 4A0XA 3M4IA 2P6SA 3E6CC 5EEGA 1LB2A 3IG0A 4UCVA 4JI5H 1SFXA 3GZ6A 1C0WA 2CSOA 1XN7A 1SYXB 1FJGH 1UHWA 5CVUA 2V1UA 4LF8H 3NEUA 4BH9A 5J8FA 1ZLKA 1RZ4A 5CVRA 4RGSA 1SMTA 2QLZA 4MNUA 3MZYA 1R00A 4I98B 4R8HA 2UXXA 1FLIA 3Q9SA 4YHHH 3C18A 3REOA 2P5LC 5L3CA 4GGGA 2BEOA 4WF2A 1W4MA 3B02A 3ML6A 1UHMA 2FNAA 1T2KA 4DR2H 2HHHH 1GHCA 3I59B 2E5LH 5BMZA 1Z2PX 4P9FA 4BAYA 2XIGA 2ISYA 2FQ3A 1JGSA 4HDVA 1S7AA 3TOBA 4UCOA 1BGWA 4LLLA 3GZ5A 2QM3A 4HOBA 4EV0A 1IW7F 4BQAA 3F8FA 3ZMSA 5BPDA 1JHHA 2MLGA 4WXDA 2DFIA 4RB1A 3IKTA 5AONA 3H92A 4IRGA 2GA2A 1WKMA 4LSXA 4HX4A 1REPC 3CVZA 4ENMA 5DEQA 2ZMEA 3CO6C 2L01A 3FM3A 1BIAA 5BQTA 2L02A 5D5WB 1RUOA 1U2WA 5D4RA 3V8KA 4XLNF 1KQ9A 5LEJA 4LG0B 1HSJA 1I5ZA 2FBKA 2HDCA 2K02A 4PDKA 3ROUA 1XDNA 1WRJA 2XAQA 2YSRA 3HSFA 3Q9VA 2NNNA 1AOYA 4LFCH 1QGPA 4KYWA 4AD9A 4EJUA 4LMYA 3RJ0A 4Q47A 2ZXJA 2YR2A 4P5OA 4LLNA 2A6EF 1IBMH 2IP2A 4OIPF 2OD5A 3HHHA 4BHCA 4BHBA 4S05A 4ESBA 3ABTA 2BGCA 1QBJA 2UZKA 3V7RA 4O5VA 3L7WA 2A68F 3DF8A 1ZG3A 2WC2A 4LLGF 1BC7C 3CUQC 1OKRA 3WGHA 2DPUA 4EJOA 4OU0A 1STZA 4A12A 1KU3A 4B8XA 3FMAA 1XB4A 2M8EA 2JT1A 4Y13A 2ZM6H 4LF6H 2DQLA 4HLXA 4LGWA 4J0MA 2XVCA 3DEUA 4KDPA 2Y75A 2D1HA 3HYIA 4CYDA 4M71A 3E5UA 3U2RA 5HLHA 2Z99A 1BJTA 5ILVA 1KYZA 5BR8H 1ZG1A 3FXUA 1YTYA 1YS6A 3ECHA 2WTEA 3HOTA 3GX4X 2NAZA 3CUQA 3QP5A 3DF7A 1GXPA 1NHAA 4IJAA 2D2WA 1ZARA 2RGVA 3DKWA 5IT9Z 2COMA 4IF4A 2O8XA 3L09A 3P7NA 3R6SA 3JSOA 1ODDA 3HRUA 1PUEE 4B3SH 1O7LA 4CDGA 5E18F 4RAYA 5LGTA 2EK5A 4ESJA 5IWAH 4OOIA 2V1XA 1UCRA 1QQIA 1S6LA 4NQWA 4MV9A 1P4XA 3CTAA 2MA3A 1IN8A 3ZMTA 4RAZA 1FSHA 4M9XA 2Q8KA 4PDBA 5LBQA 2A3SA 4N0BA 4AIKA 3N97A 2HVQA 2UUBH 3E5XA 1R1TA 2DW4A 3LQQA 4HAMA 4LH6A 1P4AA 1ONVA 4JI7H 3BROA 3WU1B 2XAGA 2ACJA 1IN5A 3BZ6A 4OMYA 2ESNA 3IKVA 1FC3A 3IRRA 5KK1A 3T8TA 1W7PB 2YPRA 1QNTA 3WGIA 2BYVE 1B9NA 1D8JA 1LDKB 3F22A 5A2QK 1YG2A 3L2PA 4OX9H 2FE3A 5HOOA 2OZ6A 4LFBH 2PG4A 3PQJA 3NQOA 4KN4X 4EEQA 2P6TA 2D45A 1LVAA 5K5OA 4RB0A 1MKMA 1I94H 2Q0OA 4I7HA 2FA5A 3RKXA 4CC6A 3J7AK 2A69F 3LAPA 1BI2A 3V4GA 3VFZA 3FHZA 3FXRA 2H6BA 3DP7A 3M7GA 5ED4A 2UUAH 5DYMA 5FPRA 2Y0MA 5IT9K 4MQ9F 5AIQA 2O61A 5E20A 2VC0A 3GW2A 3H20A 3HXLA 2K86A 1YIOA 1ZAOA 2WDTA 2OZUA 2LKPA 3SZPA 4KICA 2G7UA 5HLGA 1U3EM 4Z2YA 2FBIA 3HTSB 1Z1DA 4I01A 5DD8A 5D4SA 1X9NA 3BJAA 4ENNA 3FWEA 4L9NA 1OMIA 4ESFA 3EQLF 4DV7H 1X3UA 1U5TB 4RGRA 2HFHA 4G6QA 1SAXA 1MZBA 5H6RA 1BOAA 1AN7A 4KT5C 1CF7B 1RUNA 3OOPA 3I4PA 3K9TA 3RF2A 3F21A 1W7PA 5LHIA 5D5VB 5CLSA 5HDKA 5DCMA 1D5VA 5D6EA 3KETA 4EFEA 2Q2EA 2RN7A 3BPVA 1BJAA 4MGRA 1SD4A 3KAJA 1J7KA 4EVIA 2QBYB 1T39A 2O3FA 2KSWA 2L54A 4YFNF 2PFBA 2XROA 1XSXA 4HX7A 4X65H 1ZN2A 1U78A 3MCZA 1TBXA 3U1DA 4OIOF 4WXCA 2B0LA 4ZH4F 3I5UA 2HTSA 3J7AO 2K27A 1OR7A 5H6QA 1O3TA 2QYOA 2DK8A 3M8EA 4LJZF 4RGXA 4XLPF 3FM5A 3TDUC 1H9TA 1TTYA 5FD6A 1Z2NX 4DV3H 1LDJA 4Q0YA 1FWZA 4A6DA 2VQFH 3M9AA 5D8KB 4NB5A 2AXLA 1JXSA 1XGNA 3WTXC 4A5MA 1HW1A 1YLFA 1RI7A 1HNZH 2VT2A 1XCBA 1M0WA 3WE3A 4ZYEA 1XMKA 3HRSA 2ZNYA 3PFIA 1LJ9A 3JTHA 2Z33A 4JI3H 2VBZA 4ZZLA 3LA7A 1FY7A 1TNTA 5DCMB 4GKKH 3KP4A 3QPTA 1J9IA 5FPOA 2UXBH 3EUHA 3IL2A 3L00A 5F1RA 3RGXA 3HIFA 3M1EA 4QLCU 1R5HA 1I6UA 3BJ6A 5D5XB 1J2XA 4IAJA 3KP2A 3JSPA 4ENKA 4HW0A 3F8MA 1E4GT 2QWWA 3F72A 4JQFA 3AAFA 5ILSA 4EJTA 2XUBA 1HQCA 3RKYA 2LDUA 3T1BA 4TV7A 4HQEA 1G3SA 5F64A 1R23A 1YFHA 3J80Z 3JAMZ 2V6CA 2V79A 1R58A 4JI1H 2VOOA 3KZZA 4KIBA 1I27A 4Q4ZF 3ELKA 2W84A 4L9JA 3SHFA 1R22A 1S3JA 4KNYA 1OYIA 3SXYA 3P9CA 2Q2TA 1W5TA 3ABUA 6PAXA 2R7FA 3WTSC 2MBFA 5D6FA 2BV6A 1V9PA 1PDNC 2M45A 4JBAA 2NRAC 1T6SA 4R1HA 5J6XA 3I58A 1DP7P 1IN6A 2XV4S 4GLXA 3BABA 2HKXA 1FYMA 1ZG5A 4UCRA 3WTVC 3F3XA 2FMLA 2EA2A 3KLOA 1IZ1A 5L3DA 1TAEA 4L5IA 4DUYH 1WWXA 4WXHA 5ICCA 2ADUA 3L4KA 3PQKA 2GQQA 3VEPA 3QU6A 5FLXZ 3O2PE 4UVCA 4MEYF 2QBYA 3JW4A 2IRFG 3V8JA 1HNWH 2MC3A 2ZBKA 1U6GA 2MD5A 1JHFA 1ZGJA 4IXAA 2ZJTA 2HYFA 1EV7A 2JTVA 2Y48A 1ZYRF 5HDGA 3I71A 2LSOA 4Y15A 4MTDA 4QWQA 3PN1A 4UVAA 3C3WA 4IRHA 1Z7UA 1IXSB 1U5TA 3WTUC 4AIHA 3BDDA 3MZHA 2HR3A 4M72A 3E3VA 3H3ZA 1LEBA 3ZMDA 2DQRA 4L9VA 2HVSA 2E7XA 2DLLA 5HVQC 4CGZA 2CGPA 2XAJA 5JI6A 2A5YB 3K1NA 4L9TA 4LD5A 1YO5C 1J59A 1KQ0A 1TW3A 3EETA 3K2ZA 2C6YA 4ZZDA 3EYIA 3GWZA 4HF1A 1AWCA 3CO7C 2GXGA 2VPSA 1T38A 2J5OA 4G9YA 1USTA 1F5TA 3ECOA 4L0ZB 5L3GA 4AQYH 2XHKA 2XAHA 5JHUA 3HTUA 5TJJA 4LB6B 1FX7A 3N4MA 4G7OF 5DDGA 3TO7A 3FF5A 2CO5A 2MLKA 4WCGA 2JPCA 4M7EA 1FOKA 1KU7A 2W85A 5A2QZ 1QO0D 5K1YA 2DK5A 1ZHQA 5DV5A 5CYVA 1ZRDA 1D8KA 3GFMA 3T1HH 5LLQA 4EM2A 3RYPA 3HRTA 1ULYA 1USSA 1K78A 2Q2UA 4JI6H 1ZREA 2XKOA 4BHPA 1DPRA 3KXYT 4LFUA 1XD7A 1DUXC 4APMA 1O57A 4GO1A 3C1DA 2YU3A 2MH2A 3CJNA 5ILUA 1WH2A 3BA9A 1MJBA 2GXBA 4PGGA 3IHUA 5HS9A 1W5SA 4H0EA 1V4RA 3BA8A 2CW0F 1QPMA 3LAJA 3GFLA 3KP7A 2E1CA 2EFOA 2ZO4A 3KLNA 3TKYA 4HQMA 3E6BA 4AIJA 4DV6H 2IT0A 4G8XA 5L3FA 5L3BA 3P9KA 1SEIA 2KJCA 1FP2A 5D8LB 1TA8A 1SMYF 4BYYA 2WE6A 2DAOA 2X0LA 3CUQB 3U9GA 4IHSA 2PMUA 5E1XA 2V9VA 4I0BA 1Z9CA 4A0YA 1IBLH 2JPBA 3KEQA 2VONA 3J81W 2DT5A 4O6JA 2UXCH 1SD7A 4DR5H 3C7JA 2FSWA 3K1MA 1IXRC 3ZMZA 1TQMA 4EM1A 4G7HF 3RKWA 2G9WA 1KQ8A 5CVIA 2VBYA 1XNRH 3T0YA 1XMAA 1HSTA 3MWMA 3V7SA 3W6JB 1EH7A 2EFPA 2PJPA 5E17F 3R60A 4E70A 3Q5FA 3N6XA 2CG4A 1T0FA 2DTRA 3F8NA 4EJVA 1K6OA 4U7DA 1FBQA 3N44B 3LSTA 2P7VB 3J80K 4LF4H 1IBKH 1U8RA 2G7HA 3QU3A 5FB2A 4B3MH 3T5XA 3K3VA 5LGNA 1O75A 4DV2H 4DR3H 1HKSA 3QP6A 2VBXA 1G3WA 2IVMA 4LF9H 3HSEA 5EOYA 3RJPA 2QENA 4R79A 4KN7X 1XGSA 4CZZA 1L2ZA 2HWVA 4UVBA 3E6MA 4BNCA 3R0AA 1CF7A 2OBPA 2LF7A 3NRVA 5LMUH 4IHTA 3WE2A 4DV0H 1I6XA 3S2WA 4M9ZA 2FMYA 4M6YA 2XKPA 2DO7A 3QOPA 2E7WA 3N43B 1ZGAA 1YYVA 3M8FA 3GO5A 2K7LA 1E17A 2EV5A 3G3ZA 4LFAH 2DU9A 2VXZA 3LQRA