4RB1A

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-e. coli fur box
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
VSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb1A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb1A02
2LNBA 4IF4A 3HRMA 3PFIA 1J5YA 5BOXA 3REOA 4P96A 2GXGA 4M74A 1LJ9A 3WTUC 5J8FA 3HRTA 3GLXA 2A3SA 1OYWA 1MGTA 2QQAA 2O3FA 3I53A 5D8KB 5BPIA 3HTSB 3BZ6A 3MFKA 1Y0UA 2DAOA 4HA8A 3RYPA 2V9VA 2GA2A 2OZ6A 3NEUA 4A5NA 2G7UA 5BQTA 3R0JA 1P4XA 3F8CA 1FY7A 1RUNA 1EH6A 1U5TB 1HSTA 4ZYGA 4UNOA 2Q2EA 5DUKA 2H27A 2F5FA 1J0RA 3LFKA 4D0PA 4G6QA 2W57A 1K78B 3E97A 3GEZA 1Z91A 3HSFA 2LF8A 4ENJA 2H6BA 3RPQA 2ISYA 1T2KA 2PG4A 1SD6A 2NRAC 4LLGF 1TNSA 4KMUX 2EB7A 3KCCA 2QBYA 3WTZA 1KQ8A 4BHBA 3D0SA 2ZJ2A 2FNPA 4OU0A 1KQ0A 4L5JA 2VOPA 3EETA 4N0BA 4AWXB 3H92A 2P7CB 1YIOA 1KU3A 3I64A 1D8KA 1OYIA 3HRUA 2R7FA 2HTSA 3E6MA 3M8EA 4M73A 2JZYA 4A2UA 5L3EA 4I09A 3LA3A 2KJCA 5FO5A 1R7JA 3ULQB 1ODDA 3CTAA 3LA7A 3RJPA 4BH9A 3V7RA 2HFHA 3K1PA 3FHZA 2E1NA 5DYMA 2EJRA 5LHIA 4PCQA 3J81Z 4TV7A 3MWMA 4CDGA 1LQ1A 5JVTA 1DPRA 2DW4A 5FB2A 1Q1HA 3KFWX 3WE2A 1S3JA 2UXXA 1S6LA 4EJWA 3HTUA 4CZZA 5CVUA 5J6XA 2JTVA 2JPCA 1W5TA 2MBFA 1R1VA 1TQPA 4OOIA 1X3UA 2EV5A 3NQOA 4P5OA 3L7WA 3HRSA 4O3MA 4OMYA 4MHGA 3WTTC 4U0YA 2GXBA 4EJTA 3DKWA 3MQ0A 2ACJA 1LEAA 1RZ4A 4EVIA 1S7AA 1LB2A 3RIRA 1TBXA 2F5DA 1U5TC 2P8TA 2V1DA 5DD4A 3RYRA 2OU2A 1O3RA 2RNJA 3QU6A 2R3SA 3HHHA 3V7SA 4LK0F 2M1BA 3HSEA 4G8XA 1YS7A 2XASA 2RQPA 3C7JA 2FBIA 4L9NA 3ZMVA 2L4MA 1BI3A 1RI7A 2W25A 1B6AA 4ENMA 5D6FA 4YIIA 4A0XA 1HSJA 3ERED 1G3TA 1OR7A 2BEOA 1HW1A 2DBBA 2Y48A 1B1BA 4ENKA 5F6FA 2A69F 2ESNA 1K79A 2MH9A 3TO6A 1KGSA 5ILSA 3G3ZA 2H6CA 1QBJA 4UVBA 3BPVA 3BROA 4M71A 1SD4A 3FMQA 4MQVA 1REPC 2Y0MA 1XSXA 1YG2A 3IRQA 2RDPA 4F7ZA 1J7KA 2BV6A 4ESFA 5ICEA 2DQRA 5ICCA 2TDXA 5DV5A 4BYYA 1IF1A 1SMYF 5HLHA 4H0EA 1BC7C 4OINF 5LRRA 3IKVA 2A07F 4WX9A 5D6EA 1FYLA 1PUEE 2XAQA 4GO1A 2EFPA 1S29A 1SFXA 3CO6C 1Z6RA 4HBLA 1Z1DA 3SZTA 3COAC 2XAJA 4FHTA 3L2CA 2VT2A 2P6SA 3K1NA 5H6QA 4KN7X 1FP2A 3ZMTA 1J59A 3GZ5A 3ABTA 1YYVA 5H20A 2GIVA 4HQEA 4U7DA 5CLSA 1B59A 5F1RA 3F8BA 5L3DA 3IWZA 3KP4A 3V8LA 1W5SA 1WI9A 2P6TA 4HV5A 1IN8A 3V8JA 3E5XA 1KQ9A 2FMYA 4HZFA 1OYYA 3ZN1A 1I1SA 3FF5A 2G7HA 3H3UA 1ZLKA 3F3XA 3FMSA 3ZMZA 2DPUA 2FOKA 1LVAA 2RVCA 4L5IA 4A6DA 2O8XA 1K7AA 5FGMA 5DEQA 1T39A 4RGXA 2O6GE 4KN4X 4L9JA 1XGMA 2ZBKA 1IN5A 3ECOA 1CF7B 3ROUA 3TDUC 5ED4A 1F9NA 3KLOA 1BC8C 5LBQA 1IRGA 3T1BA 2AXLA 5KVRA 2OBPA 3P9CA 2VE9A 5DDGA 1ZREA 2X4HA 2V6CA 1QNTA 1K6OA 1IN4A 3DP7A 3HOTA 1R58A 2ZMEB 3IWFA 2RN7A 3HYIA 1FWZA 3J7AO 4R8HA 3F6OA 2IPQX 4U0VA 2CG4A 2HZTA 2D2WA 2LSOA 2E7XA 3JW4A 3QP5A 5LLQA 2MLGA 4MEYF 3GUDA 3GYHX 4OIRF 2HKXA 1BIBA 5ILVA 3P7NA 2EK5A 2L02A 5K5RA 4BQAA 2YR2A 2CO5A 2Q0OA 1EV7A 4LG0A 2PMHA 4CO8A 1MJ9A 4ZZDA 4JBAA 5D5XB 3EQLF 2JT1A 1MZBA 1D8JA 3JSOA 2FU4A 4EJUA 5F64A 2O61A 3GFMA 1JHHA 2M87A 2A61A 4Y15A 5D5UB 4EM1A 5D5VB 5JI6A 4XRFA 3ECHA 5HLGA 5IT9Z 5DUIA 1USTA 5AONA 1XSDA 2X0LA 1DP7P 3IRRA 3FMRA 3MEXA 2OA4A 5LHGA 5IT3A 5LHHA 2D1HA 3L9FA 3E6DA 4PZJA 5LRSA 3GXOA 5CJ9A 2K27A 1XDSA 4CYDA 1S7OA 1ZH5A 1A04A 2HQNA 4EJVA 1AWCA 2HEOA 4EGZA 1SFEA 2CSOA 3SFZA 2ZNYA 2CQKA 3BP8A 4FT8A 4L18B 3M7GA 3FX3A 2WC2A 5H6RA 1MJAA 5HVQC 4NHJA 2NNNA 1P6RA 5E18F 5L3BA 2IP2A 2PMUA 4KUMA 3RI4A 1OPCA 2PFBA 3ISPA 3WU1B 2O0YA 1O57A 2Z99A 3DPLC 5CVRA 4WCGA 2IA2A 5CVVA 3HIFA 2CFXA 3K69A 4M72A 1FBQA 1XMAA 4GYGA 4ENNA 2P7VB 1XGOA 3R60A 5BPDA 4CICA 1ZHFA 5ILUA 3F8FA 2AS5F 4IRHA 4P9FA 4U0WA 1BI0A 4KIGA 2CWEA 2COMA 1OKRA 3CO7C 3FXRA 1O3TA 3ML6A 1BN5A 4MGRA 4XSZF 1YO5C 3BPXA 5ICFA 1T38A 1YW9A 2STWA 2VBWA 3SXYA 3D5LA 1GVJA 1JXSA 1GXPA 3CLOA 3ZP5A 1FPQA 2VE8A 2ETHA 3WG9A 2RV8A 2QZ8A 1YQAA 3U2RA 1ONVA 1R23A 4EMSA 3ZMDA 2ZKZA 4ZYHA 1I6XA 5FD6A 4RAZA 1XGSA 5HDKA 3WTXC 4UV8A 2M5WA 1O7FA 5JR3A 2KIMA 2VT3A 4OIPF 3QPHA 1H0MA 1T98A 1W7PD 1LDJA 2D45A 4A0ZA 1D3YA 4I7HA 3R0AA 1F1ZA 4BXUA 3HUGA 3KP5A 3T8RA 4CHUA 1EH7A 5HDGA 4MEXF 4IHTA 1FOKA 3EDPA 1TW2A 4YIFA 3BJAA 3GFIA 4LB5A 1ZG3A 1G4DA 4BHCA 1USSA 4EV0A 4HF2A 4A5MA 5E1ZB 2L4AA 2MC3A 5FLXK 3QAHA 3JSPA 3GO5A 3I71A 2XROA 4YG2F 2DU9A 3WE3A 3L00A 3V8KA 4U7BA 5K5QA 2GA1A 1STZA 1R1UA 5A2QK 2HTJA 1B9MA 3I5UA 3KETA 2D1VA 1G3WA 3GW2A 2M8EA 2KRFA 5KK1A 3N97A 1G6NA 2F5EA 4Q47A 1P4WA 1ULYA 3K9TA 1O3SA 1IN7A 3TQNA 4RGUA 2Z3YA 3DFGA 1S8NA 5LEKA 1YW7A 5LGUA 5ICGA 1LDDA 4ESJA 2K02A 2DQLA 1ZARA 1FYKA 3DXJF 2FEZA 3F72A 3WODF 1W4MA 2XIGA 1SFUA 1FSEA 2XV4S 2IRFG 1FBUA 5EEHA 3Q9SA 1IAWA 4IHSA 2V1UA 4DQ2A 3M1EA 4ZYEA 4A0YA 1B4AA 1ZGJA 2FA5A 1QO0D 4P55A 1VTNC 5JFRA 3TO9A 1XB4A 2PN6A 2L01A 1TLHB 3CJNA 1L3LA 4Y17A 2VC1A 2ISZA 4QWQA 1ON1A 3EUHA 4K2EA 3G73A 3W6KB 2A68F 5J8CA 2EA4A 2DLLA 3MZHA 2VC0A 4LB6B 1KU2A 1PDNC 2CYYA 3FZVA 4HOBA 3SHFA 1I5ZA 4LK1F 4YFKF 2ZCWA 1FYMA 2XAGA 4P9UA 3ELKA 4WWCA 3TOBA 1FX7A 3MCZA 3MAJA 3M9AA 5E20A 1KU9A 1WRJA 4IRGA 3FM5A 4AIJA 2P5VA 4Z2YA 1DPUA 4NB5A 4XLNF 4ZYDA 3RPUA 3T0YA 2EFQA 4JK1X 1E17A 2EV6A 4UV9A 2ZXJA 3PQKA 4G7OF 4RB2C 4KA4A 5BS6A 5L3GA 1XDUA 3LWFA 1I27A 1HKQA 4HX7A 1XMKA 2W84A 1HQCA 1LEBA 1XN7A 5HS9A 3O2PE 1ZRFA 1WWXA 4G9YA 2FSWA 2QQBA 1HXDA 4XSXF 1KA8A 2IA1A 1NHAA 4BNCA 2VN2A 3T5XA 5E17F 2M45A 5E1WA 2MD5A 4I98B 4LJZF 1FBSA 1T0FA 3GFJA 4OIOF 3K2ZA 5FLXZ 4L0ZB 2DPDA 3J80Z 2DFIA 3TGNA 5TRDA 3F8NA 1U5TA 4IRIA 4LD5A 2HR3A 2OD5A 3HSRA 2NS0A 4BHPA 2VXZA 3IHUA 4Q4ZF 2STTA 4UUVA 3C18A 3LQRA 1K78A 2HWVA 3JAMZ 2P4WA 3BOQA 3I59B 3MZYA 1CGPA 4IPAA 4UVAA 5K5OA 2M30A 2L54A 2KJBA 5DCMB 4HF1A 4HYEA 4KIFA 3BDDA 2LKPA 1XCVA 1QGPA 4JQFA 2ZO4A 2NYXA 4HLYA 1G3YA 1BBYA 1Z6TA 5CYVA 2R7DA 2F2EA 3H3ZA 3O3KA 4HW0A 2YPRA 2WV0A 2FBKA 1C0WA 2XVCA 2DO7A 4RGRA 2QM3A 4N9IA 1IXRC 3P9KA 3FXQA 3QPTA 4HDVA 3K1MA 1ZGAA 1YFHA 1O3QA 1KU7A 1D5VA 3DF8A 4G7HF 2QYOA 2VOOA 4B09A 2J5OA 3R4KA 4HF0A 3ZMSA 4U88A 1IXCA 3DPTA 1TQIA 3O6BB 3KP2A 3QOPA 4RS8A 1GXQA 2WWYA 3VB2A 1BJAA 1RUOA 2ZNZA 4IJAA 3CUOA 4L9TA 3BJ6A 3F23A 2ZFWA 1U6GA 3P9IA 3CUQC 4FX4A 2A6HF 2A5YB 2XAHA 3JAMK 2FF4A 2K86A 4KFCA 1R00A 4HAMA 2LDUA 2ADUA 4ETSA 1BI2A 5CVJA 3N4MA 1KYWA 5E8GA 1WQ2A 3WTWC 3WGHA 1V4RA 4PGGA 2E1CA 3TDZC 2OZUA 2YU3A 1J75A 2HQRA 3RDIA 1IZ1A 1UCRA 4IVNA 3BY6A 2QENA 2K7LA 3B73A 3K0LA 1SD5A 4I0BA 1P2FA 1TTYA 3KP6A 1WSUA 1LNWA 4S04A 1L0OC 2DI3A 1P4AA 3IL2A 1EH8A 4HDUA 2CGPA 2HYGD 4XLPF 5FD5A 3KLNA 2P5LC 2VODA 4I2OA 3F22A 1PP7U 4UVCA 1U8RA 2GZWA 4RB3C 2IA0A 4KMFA 4A12A 2VBZA 2HYFA 5HLIA 4WXCA 4Y13A 2OAZA 3KZYA 1T6SA 1Z9CA 1MKMA 1ZAOA 3LQQA 2EFOA 1BM9A 4RB1A 3WTYC 2QLZA 3I54A 4MNUA 2CW0F 3W6JB 1IN6A 2L3DA 5EEGA 5DCFA 1QZYA 3OOPA 4AIKA 5TJJA 1MDMB 4L9VA 5E1XA 2FXAA 1V3FA 2ZMEA 2MH2A 1P92A 1FC3A 4LMYA 3KEQA 5AIPA 4HX8A 2XUBA 4XBFA 5JHUA 4R79A 3J80K 1SD7A 1ON2A 4ZH4F 2O03A 3U9GA 3U1DA 1SAXA 4ASNA 1E2XA 1FZPB 3ZMUA 2XAFA 5HDNA 4A6EA 2PLYA 4R1HA 4I01A 4M6YA 4WXHA 2HDCA 1WKMA 1H9TA 3GFLA 3C1DA 2Z9OA 2YX7A 3E6BA 1U78A 1HBXG 2VONA 1QZZA 1B9NA 4ESBA 1BI1A 4M6XA 2H09A 2PJPA 1JGSA 1Z7UA 4ON0A 2Z5UA 3E5QA 1IUYA 3ABUA 1HKSA 3E3VA 5L3FA 4EQQA 1UFMA 1FT9A 4QLCU 1UB9A 5FFZA 2LF7A 5LEJA 4PGHA 3RKWA 5FFXA 1R1TA 1FNNA 1FP1D 2OQGA 3R61A 1IRFA 2EA2A 2YX4A 4LGWA 2HS5A 2W85A 2RC4A 3RKXA 4CGZA 4I02A 4M9ZA 4RAYA 2IT0A 3T8TA 3GWZA 2PEXA 3KE2A 4CXFA 1YTYA 4KYWA 1IW7F 2FE3A 3HOSA 5LGNA 3SZPA 3GVAA 1CF7A 3GZ6A 3RKYA 4M9SA 2B0LA 3TO7A 1MJBA 4WXDA 4PDKA 5DCMA 2PBIA 3KZZA 3LSTA 1BIAA 2KKOA 1ZLJA 3M8FA 5BMZA 1HKTA 4BAYA 2DT5A 1YLFA 2VBYA 2K4JA 2BGCA 2K4BA 3DV8A 4LLLA 2GAUA 3FM3A 3EYIA 1QPMA 1R5GA 3L09A 4LG0B 3I58A 2QVOA 2FNAA 4GGGA 4ZZLA 3WU0A 2JSCA 4RGSA 6PAXA 4HV6A 1R5HA 1BOAA 1KYZA 2W24A 4OIQF 1O7LA 3CDHA 2V79A 2A6EF 2EFNA 1HW5A 1OMIA 2UWMA 2JRTA 2EWNA 3F8MA 3RTRA 3Q9VA 3ZPLA 1J9IA 3V7CA 3I59A 5DD8A 3IC7A 2FRHA 1GHCA 4RB0A 3I0TA 1AOYA 4Q48A 1RIOH 4YFNF 1G3SA 4WK8F 5LGTA 1J2XA 4WF2A 2PI0A 4E70A 5E8IA 5A2QZ 3B02A 3E5UA 4GXOA 2ESHA 2RKHA 3WTSC 2V1XA 3KEOA 3LAJA 3S2WA 2UXNA 3QP6A 3QRFF 5HOOA 4O6JA 3ZQ7A 3LA2A 5D5WB 1F4KA 3VEPA 3TOAA 1ZG5A 3DQVC 4AVPA 4UXNA 3ZN0A 1ZN2A 2VBXA 2YSRA 3WTVC 3LAPA 2Z33A 5AIQA 4Q5SF 4KDPA 4IXAA 3Q5FA 4EJOA 4L0YB 3QU3A 4HQMA 2KIUA 5D4RA 3I4PA 1YS6A 1DUXC 2QWWA 1ZYRF 2XHKA 3SQNA 2JPBA 3VODA 3C3WA 4M9XA 3CUQB 1XGNA 2XRNA 1TQMA 3JTHA 2QUFA 1XD7A 2MLKA 3PQJA 1JHFA 1R36A 2OQRA 2C6YA 3HHGA 3NRVA 5HS8A 4MQ9F 4YFXF 3FXUA 2MA3A 1FSHA 1ZRDA 2Y75A 3E6CC 2XKOA 2PQ8A 3FWEA 4NQWA 3F21A 2H94A 2KIFA 2J5PA 4KT5C 4I0AA 1W7PA 4HX4A 4N9HA 2GQQA 3OV8A 3VOEA 3IKTA 1XSVA 4FX0A 2F5CA 2FBHA 1Z05A 3AAFA 3BWGA 5IT9K 4LFUA 1UHWA 2IJLA 4GYIA 4EGYA 3WGIA 3J81K 4EM0B 2FQ3A 2IVMA 1UHMA 3KP7A 3JTGA 4GCVA 1JE8A 2Q8KA 2IW5A 2NNYA 1I1GA 5HS7A 5D4SA 2ELHA 2BBYA 4KNYA 1U3EM 1HW2A 3KP3A 4O5VA 4EM2A 3BJOA 3CUQA 4AD9A 2BE5F 2HOEA 1RNLA 3DEUA 1MD0A 4AIHA 4LLNA 1R22A 2RGVA 4KIBA 1W7PB 2HGCA 2WTEA 4G94A 4OMZA 1FLIA 4G7ZF 4DNCA 1ZG1A 4HLXA 2FMLA 2DK5A 4G6DA 1H9GA 1TW3A 1YW8A 2DK8A 2P5KA 3TKYA 1MDMA 4S05A 2HKOA 2EV0A 2DTRA 4MTDA 5K1YA 1IXSB 1ZRCA 1TNTA 4MTEA 2E7WA 2NAZA 2UZKA 1F5TA 5CVIA 2QBYB 5ERIA 3EYYA 3F6VA 2GWRA 3GF2A 4KICA 4UHTA 5L3CA 1XCBA 5D8LB 1U2WA 2XKPA 1SMTA 3V4GA 3VFZA 1LDKB 1DDNA 3R6SA 3WGGA 3GX4X 1QQIA 2EFWA 2QQ9A 1PP8F 2XGXA 2BYVE 4B8XA 2G9WA
chains in the Genus database with same CATH superfamily
2LNBA 4IF4A 3HRMA 2PX9A 3PFIA 1B33N 1J5YA 5BOXA 4K0KH 2DYSH 4ZOLF 2OV7A 3REOA 2NVUB 4P96A 2GXGA 2X0SA 3NAUA 4M74A 1LJ9A 1LVKA 2IXSA 3WTUC 3A01B 1RRJA 3W6VA 1KJJA 4A93J 4GC6A 5J8FA 2VR1A 2BY2A 1V9PA 3HRTA 1BXRA 3GLXA 2A3SA 1RESA 4QPOA 3GTPA 4JV0A 1OYWA 1S10A 3N40P 1MGTA 2QQAA 2O3FA 3I53A 3EUAA 5D8KB 5BPIA 3PW4A 5K7HA 3HTSB 2LOOA 1ZKGA 4RLFA 3FIWA 4EATA 2N8GA 3BZ6A 3DU6A 3MFKA 1Y0UA 2CMPA 1RPWA 1K1SA 3U9TA 4CYCA 2XCPA 2R7XA 2DAOA 4HA8A 3RYPA 2V9VA 5KAIC 2GA2A 2ZJQF 2OZ6A 4ANJA 4QJFA 4B44A 3NEUA 4A5NA 4U6PA 4IO9F 3H4DA 2EIMH 2BW3A 2G7UA 5BQTA 5K2MA 2M0MA 1OFCX 3R0JA 1VFCA 2IGMA 1P4XA 2ZB9A 3H5AA 1Y39A 4QIWE 4XN3A 3H35A 4FS1A 3MFIA 3F8CA 1FY7A 2M4GA 1ZELA 4IZZA 1GT0C 1NK2P 1RUNA 4Y52J 4C3HJ 2EINH 1EH6A 4DBQA 1U5TB 3L2RA 2DZDA 1HSTA 4ZYGA 4UNOA 2Q2EA 5DUKA 2QYZA 1H8AC 1Y1VG 3G6EI 3OSFA 2H27A 2X9DA 5IYDG 1QZEA 5E3OA 3T1YH 2F5FA 2FD5A 4XORA 2PMZE 4BE2A 3GQCA 1J0RA 3K4JA 3LFKA 4D0PA 4G6QA 5GAEJ 4QIWN 2HOTA 2W57A 1ETKA 1X9NA 1K78B 3E97A 4CCNA 3GEZA 1TWAA 2L9RA 3TEDA 1Z91A 3HSFA 1GLVA 2LF8A 4X62H 4J9LA 4ENJA 1EUDB 3LSIA 2H6BA 3RPQA 2ISYA 1HNXH 1T2KA 2PG4A 1SD6A 2NRAC 2VB6A 2XSJC 1VKZA 2JK3A 3N44B 3TMOA 1Z3YA 3N42B 4IHVA 1TL8A 1YRNB 1VBHA 2YS9A 1WR2A 3VYUB 4LLGF 3QYEA 1TNSA 4M3FA 1M1EB 4UB8C 2L9NA 4KMUX 3K5IA 2DPJA 2EB7A 1XDNA 4J00A 1ZGWA 4A3BJ 3KCCA 2QBYA 5IYZF 4DGWB 2TCTA 3TQ1A 2IS1A 3WTZA 1KQ8A 2QGUA 4BHBA 4LF8H 3D0SA 1DV2A 2ZJ2A 2FNPA 4OU0A 3PIPF 4CC5A 2R6FA 1B72A 1KQ0A 2ME0A 4J9RA 4L5JA 2JEIA 5KFIA 1QVUA 3EETA 2VOPA 4N0BA 1I6UA 2XGPA 2UV1A 2R7RA 2VPLA 1D0YA 1HDPA 3H92A 4AWXB 3RQ4A 2P7CB 4RZQA 1YIOA 3I9V2 1KU3A 3I64A 1D8KA 3V4SA 4DR4H 5C3EG 1OYIA 3HRUA 2VA3A 5KFYA 5B5EC 2R7FA 4DUZH 2HTSA 2JMWA 1GV5A 3E6MA 4BY7J 1N48A 3OR2C 4C2UA 3M8EA 5FKLA 2F4OB 4M73A 1VQNI 3QZ7A 3FXJA 3GIKA 2JZYA 1BOBA 4A2UA 2KQRA 4I09A 3LA3A 5L3EA 4PUSA 3L2QA 2KJCA 5FO5A 1GSAA 3FKIA 1R7JA 5FKNA 3ULQB 3OSNA 3TBIA 1JKJB 1ODDA 2EBIA 1N32H 3I4NG 2NS8A 3FMAA 3CTAA 2ZC2A 3S2DJ 4HG2A 4MA5A 3LA7A 5GONF 4DR5H 1HA8A 3RJPA 4DL7A 4NXMH 4BH9A 1G59A 2LK2A 3V7RA 1VI0A 2HFHA 1TC3C 1ZR2A 3K1PA 1ACIA 3DEWA 4DR1H 2VQCA 2BQ3A 1HCRA 2WB1A 3FHZA 5I47A 5KFHA 2E1NA 5DYMA 2EJRA 5LHIA 4PCQA 3J81Z 4TV7A 3MWMA 1N25A 5TGTA 4XRSG 4KISA 4AVZA 5KHDA 3AKZA 5KFCA 4NXNH 4BL0B 4CDGA 1LQ1A 5JVTA 5FKOA 1DPRA 2K9MA 1B8IB 2K40A 2DW4A 1GV2A 4D9JA 1MBEA 3RFCA 1WJDA 3U21A 2RNGA 3OL3A 1Q1HA 3E7LA 5FB2A 2EIJH 3KFWX 3BCAA 3H0GJ 1TWFJ 3WE2A 2X85A 1S3JA 2UXXA 3JRFA 4DV1H 1S6LA 2H1KA 3VYTB 3W3CA 1FIAA 1MMNA 4ZDLA 4BQOA 2V26A 2JJ7A 4EJWA 5LD2C 4YJ2F 2WAQN 1NG7A 3QWLA 5IPAA 3KZIC 4QW8A 3HTUA 4F4WA 4CZZA 2DWCA 3G1MA 4JI0H 4AQYH 5CVUA 2JUGA 3BR6A 1MBJA 5J6XA 2OTJI 1Z67A 1E0EA 2JTVA 3GIQA 2JPCA 1W5TA 2K85A 4P1WA 2HPMA 2MBFA 1R1VA 1T33A 1TQPA 2XD4A 3FXMA 4OOIA 2V4QA 1X3UA 1TAEA 1RYSA 1N56A 3CLQA 5L1IA 1EHIA 2W9AA 2QA4I 2EV5A 4O2AF 2M2EA 3NQOA 3J80W 2Q1ZB 3BZCA 4P5OA 3L7WA 2DOFA 3UKGA 3HRSA 4O3MA 5JUMA 4OMYA 3ORQA 2M3AA 3ZQGA 3ETHA 3AYHB 2UUAH 2CQXA 4QWDA 4MHGA 4XICA 3WTTC 1J09A 3G1OA 1X3ZB 2V4JC 4U0YA 2GXBA 4EJTA 1VZ0A 1MBHA 2ID3A 2M7AA 3DKWA 3HM5A 4EYHB 3MQ0A 2XF6A 1LEAA 4BDYA 2ACJA 2DFHA 1RZ4A 2JA5J 3L2UA 4UCOA 1R4NB 4AU7A 2HU9A 3EPZA 2IS6A 4EVIA 5CA0F 4DR7H 2YU9J 1S7AA 1BL0A 1LB2A 3RIRA 5FPOA 1TBXA 2F5DA 3CESA 3HC7A 2I8CA 3RBDA 2KP6A 5DLFA 1VQMI 4C3JJ 1U5TC 2JVGA 1C30A 2E36A 2P8TA 2V1DA 2R4GA 5DD4A 1V5EA 1B6SA 3KX2A 3VYRB 1SEUA 5B1BH 4CCOA 2WAQA 3RYRA 4EEFG 2OU2A 4UUSB 2R87A 5JVLA 4IZOA 1O3RA 2RNJA 1GSOA 4HPQA 3LOCA 4MV7A 4YB8B 2CUJA 3QU6A 4S0HB 3M8JA 2R3SA 2YZGA 2VUMG 3HHHA 3V7SA 1RKTA 3OR1C 2VUMA 2MSYA 4LK0F 3PJRA 4IWYA 2M1BA 3MVPA 4LFBH 4DZJA 4WBNF 3HSEA 2R93G 4G8XA 1YS7A 2XPWA 4A3MG 2XASA 2RQPA 3C7JA 4XLCA 2FBIA 4L9NA 2VJ5A 2KPMA 4BBRJ 5KFNA 3ZMVA 2IGKA 2W8LA 2L4MA 1BI3A 1RI7A 2W25A 3UFXB 1B6AA 2RAEA 4ENMA 1X4OA 4BXFA 5FLMG 4ZQIA 5D6FA 4YIIA 4UCUA 3OYCA 3HL2A 4XRMA 4MV6A 5KFZA 4E7KA 2C2EA 2I5UA 1ZHSA 4A0XA 1BR4A 1HSJA 3ERED 4G6TB 2RDJA 2YUSA 3V42A 1Y14B 3S1MJ 1Z2PX 1G3TA 1SVMA 1OR7A 1MNMC 3I55I 2VI6A 2BEOA 1HW1A 2DBBA 2Y48A 2V9WA 2VA2A 1BW6A 1B1BA 4ENKA 4CSWA 5F6FA 4ED3A 2R85A 2A69F 3BTJA 1R4MB 4CCLA 2ESNA 1K79A 4UCSA 2MH9A 4MV4A 3TO6A 5H80A 1KGSA 4HQ6A 3PO2J 3C0FB 2GXAA 4C9YA 2DDAA 3LSKA 1LKXA 3ZQHA 5M5WJ 3BG5A 5ILSA 3G3ZA 2FP4B 4PK4A 2H6CA 4MA0A 1QBJA 1P8LA 2DYRH 4B3AA 4A3EJ 3GILA 1SVOA 1TWHJ 3ZQQA 3HKZA 5EG0B 4UVBA 2KDOA 3FXLA 3BPVA 3OYAA 3BROA 4M71A 3DBLB 5IP9J 1M0TA 1SD4A 3FMQA 4MQVA 3A0BC 1REPC 1EUCB 4PJMA 2Y0MA 3FBIB 3HPHA 1PUFB 3CJQB 4PFPA 1XSXA 4HSRA 1YG2A 1UC8A 3QZ8A 2HOAA 4FE7A 4DYCA 3IRQA 2QKLB 2RDPA 4F7ZA 3WO1A 5GAGJ 3V4ZA 3Q0VA 1E3OC 1J7KA 3MMYB 2O9LA 4KJZA 2BV6A 4ESFA 5ICEA 2DQRA 3M4OJ 1AKHA 2OTLI 2R7NA 5ICCA 2J6SA 2L7KA 2TDXA 5DV5A 4BYYA 3Q0WA 1X2MA 2KRHA 1IF1A 4M3BA 1DIKA 4L1KA 1SMYF 3Q0UA 5HLHA 3JRDA 3A2KA 4H0EA 3BCBA 2WAFA 4MV3A 1BC7C 4OINF 1QRYA 5LRRA 2K5CA 3ESWB 3IKVA 3CC2I 3BZKA 2A07F 4WX9A 5D6EA 1FYLA 1PUEE 2ICWG 5A2QW 3HOXJ 2XAQA 3HKZE 2QKMB 5KT6A 5L1LA 4GO1A 2EFPA 5J3LA 1S29A 2E1OA 1SFXA 5JHFA 4CCMA 3G1LA 2L2OA 3CO6C 2HOSA 2LMDA 1Z6RA 3BQ2A 4HBLA 1Z1DA 3CC7I 3SZTA 1MMDA 3COAC 4ED8A 1JT0A 3K5HA 1JUPA 2XAJA 4FHTA 2VL8A 3W2AA 3DTIA 3PVXA 3O8GA 3L2CA 4LH6A 3CQZJ 2OCEA 2VT2A 1ETXA 2XCLA 4DV2H 3CCYA 2P6SA 4A3LJ 3K1NA 2DXIA 5H6QA 4A3MJ 4B3TH 4KN7X 5D1PA 1FP2A 3ZMTA 1J59A 3GZ5A 3BABA 3C2BA 1R9TA 2CW8A 3QQAA 3ABTA 1YYVA 5H20A 2GIVA 1IRZA 4YAKB 4HQEA 2DFEA 5B1AH 4U7DA 2FX0A 5CLSA 1W0UA 1WGXA 1B59A 1BR2A 5F1RA 3H0GG 2EH3A 3F8BA 3I4MJ 5L3DA 3IWZA 4ITVA 1JDEA 1ORKA 1U9NA 1FTZA 3KP4A 3NGDA 2WTFA 4YR2A 2LY9A 3V8LA 1VQPI 4BBSJ 5EF6A 1ETVA 4E7IA 2JEJA 1W5SA 1WI9A 2P6TA 4HV5A 3M9MB 1IN8A 2HZDA 3R5HA 3V8JA 3E5XA 1I50A 1KQ9A 2FMYA 4HZFA 1IUFA 3GV5B 2H8WA 3FKJA 4O4HF 1OYYA 2O5RA 2WY7Q 5DLGA 3ZN1A 5IYBG 3HKZN 2HVRA 1I1SA 3FF5A 2G7HA 5KFRA 1M6VA 3H3UA 5KT2A 3OUZA 5E3NA 1ZLKA 3BTCA 3RUPA 3F3XA 4YR0A 3TL4X 2HXIA 1FOXA 1Z2OX 5LXTF 3CP8A 3FMSA 5FLVA 3R5XA 3J7ZI 4BKXA 3CCEI 4A3KJ 2M9HA 3OYJA 3ZMZA 2DPUA 1RC9A 2FOKA 2KFDA 1LVAA 2RVCA 4L5IA 1TWGA 3TIIA 4A3IG 4A6DA 1S0OA 2O8XA 2XDVA 1K7AA 5FGMA 1IJWC 5DEQA 3HOZG 3BTLA 4KHPH 1T39A 2XPVA 2E5ZA 3D5RC 4RGXA 5C3EJ 2DMPA 2O6GE 4KN4X 4MV9A 5EWGA 2IAIA 2KT0A 3J81W 2KSWA 4L9JA 1XGMA 2ZBKA 1OR7C 1IN5A 4II3A 5KG7A 4TQRA 3ECOA 1TWAJ 4FM9A 3SEZA 1CF7B 4DR2H 4JX5A 3ROUA 1X3WB 3TDUC 5ED4A 1F9NA 3KLOA 5CPRB 5LBQA 1BC8C 2M34A 4I76A 3HOZJ 1IRGA 1EZ1A 3RGXA 2KRCA 3T1BA 2AXLA 5KVRA 5DGAA 2OBPA 2KISA 3P9CA 4F93B 1RR8C 5IP6A 1T56A 4B4CA 5DDGA 2CFOA 3DKYA 2VE9A 2QSHX 1ZREA 2FK3A 2X4HA 1GGOA 2V6CA 1UNNC 5L9XA 5C1OA 1QNTA 2F4IA 1V51A 1K6OA 4DV0H 1IN4A 1OCZH 3DP7A 5J1YA 3HOTA 3RV3A 1R58A 1JKQC 2ZMEB 3IWFA 4F91B 2RN7A 4DL3A 2W9BA 3HYIA 3SJMA 1FWZA 2LKXA 3J7AO 2BQUA 3M1CA 4R8HA 3F6OA 2IPQX 1Z21A 5J4VA 4U0VA 2CG4A 2HZTA 3CZ6A 2YRWA 4LF7H 3GIJA 2ZJRF 5DQHA 1U0JA 2D2WA 2LSOA 2LREA 2XC7A 4XKVA 3DCFA 3G6VA 3AG3H 3PFYA 4DBRA 3V6HA 2E7XA 3JW4A 4N4OB 4B47A 3QP5A 1E3HA 3T5JA 4F92B 5LLQA 4EGQA 2JVHA 3GTKA 2MLGA 1BJTA 2W6ZA 1X1PA 3O8HA 4JUZA 2BY1A 2DMNA 4MEYF 2CV2A 4ECRA 3CC4I 3V6JA 4F55A 4XLFA 1FTTA 3GUDA 3PO3J 3B6CA 1AHDP 2DMQA 3GYHX 1XX5A 5IYDJ 2W82A 5EZHA 4OIRF 3VWBA 2HKXA 1BIBA 1KONA 2DMUA 2B7EA 5ILVA 1E3PA 3P7NA 2H8RA 2EK5A 1YITI 2L02A 5K5RA 1PUFA 3NWTA 4BQAA 2YR2A 3OS0A 1ENHA 2CO5A 2Q0OA 4YR3A 1EV7A 1Z7LA 4CZCA 4LG0A 2PMHA 4CO8A 3PM1A 4C5BA 1Y8QB 5B3SH 3G71I 2R7KA 2WE6A 1MJ9A 4ZZDA 4JBAA 5D5XB 4DZPA 5EOYA 3KALA 5E3LA 4IHWA 2VKDA 3EQLF 3TW7A 2JT1A 2VQHA 3C2HA 1MZBA 1D8JA 2ASDA 3JSOA 5F27A 2FU4A 3F9KA 3VPDA 3VPCA 2BZTA 4TUYF 4EJUA 1T94A 3MWEA 4O4IF 5F64A 1A35A 2O61A 2V58A 3GFMA 2DDBA 1JHHA 2E60A 3SI8A 2M87A 2J6TA 2A61A 4Y15A 5DM7F 3CMYA 5D5UB 1DGSA 4JV5H 4Q45A 3HXLA 4EM1A 5D1OA 4A3DJ 5D5VB 3KHRA 5JI6A 5KG4A 4XRFA 2XRLA 2ECBA 1P7IA 3ECHA 2P81A 3IP4B 5HLGA 1FJLA 4ECSA 1SFOA 2WADA 1I50J 5IT9Z 4HNVA 5DUIA 2DLNA 1WCMA 1USTA 4TV9F 4NUBA 5F0CA 5AONA 5IP7G 1XSDA 1NK3P 1HDDC 2DPIA 2W71A 2X0LA 1DP7P 2NVYJ 3IRRA 3FMRA 1CQJB 3MEXA 4JI8H 3N43B 5KFJA 1I3QJ 1Y56A 4IHYA 1RK6A 5KT4A 4JV1A 2E2HJ 2NVQJ 2OA4A 5HBRB 1RYRA 5LHGA 1S0NA 5IT3A 1XTAA 3OYHA 5LHHA 2D1HA 1I7NA 2R7ZG 2AGQA 3L9FA 3L2VA 2HVSA 4GFBA 5KFQA 3E6DA 5BMVF 1F43A 4JI5H 4GLXA 4PZJA 3ZQLA 2Y9YA 1JUMA 5LRSA 2AO9A 2XSDC 2CRGA 5J1RA 3GXOA 5CJ9A 4IOAF 2K27A 2R86A 1XDSA 1LE8A 4CYDA 5EWFA 5LOVF 1T08B 1S7OA 3IAM2 3UR3C 1ZH5A 1A04A 2OF7A 4BUPA 5H2FC 2HQNA 5EDWA 4EJVA 1AWCA 2HEOA 2C22A 1IO2A 3MKWB 5EYRA 2VPSA 4O3PA 4EGZA 1SFEA 3HZJA 3IH4A 2CSOA 4AYBE 3SFZA 4FISA 5FJ8J 1EA3A 2ZNYA 3SDGA 2R8JA 1O75A 4IOCF 3PW7A 3GLKA 3GTOA 3GBGA 2CQKA 3BP8A 1OQYA 4FT8A 3M9OB 4DV3H 4PFOA 4L18B 3OYGA 1R71A 2VJ4A 3FX3A 2WC2A 1V5FA 3M7GA 1H88C 2B63G 5H6RA 1MJAA 1YX5A 4DW6A 5HVQC 2NNNA 4NHJA 3SE7A 4RZRA 4YJ3F 3LSJA 4C3IJ 2HJWA 1P6RA 1MIJA 5E18F 2CW7A 5LFAA 3BAAA 5L3BA 5EGOB 2IP2A 2PMUA 4KUMA 3RI4A 1MMGA 1OPCA 2PFBA 4BQNA 4QIWA 3SYTA 4MLOA 1T3NA 1CQTA 3ISPA 3WU1B 1SFOJ 2Q2UA 3GTJJ 4J9QA 3L4JA 4XZ3B 3JSNA 2O0YA 1O57A 2Z99A 4A3JG 4AIDA 4ECQA 2E2IJ 4A3CG 2CUFA 3DPLC 3OWTA 5CVRA 5E3MA 4WCGA 4J19A 4DJAA 4BE1A 2DIKA 5IYBJ 4EBCA 2IA2A 1XMOH 2Z2SB 5CVVA 2R7QA 5T14A 4A3IJ 3BA8A 2X48A 3HIFA 1YJWI 3DPUA 4ECZA 4Q8EA 3AG2H 2UXBH 1WH2A 4JOMA 2CFXA 1WJ5A 1POGA 3K69A 4Y33A 4ZYAA 2OWOA 4M72A 1FBQA 1XMAA 4GYGA 3GTKJ 4ENNA 2P7VB 5F0HA 1XGOA 4FE4A 2XB0X 3R60A 3FKIG 5BPDA 4CICA 1TP4A 1ZHFA 3DEEA 5ILUA 4ZJZA 3F8FA 2MFZA 2AS5F 1N75A 4IRHA 4P9FA 4U0WA 1JJ8C 4II2A 3H40A 2XAUA 2R8KA 3TP3A 2ELJA 5DM6F 3RKQA 1BI0A 4KIGA 2CWEA 2WBMA 4M6VA 4A3FJ 4ECTA 2COMA 1A6IA 1OKRA 3HOYJ 2VQEH 3MN2A 2G0EA 2FPPB 5EJCA 2Q2EB 3CO7C 2FOWA 2KZVA 4LIVA 3K70D 2K3PA 3FXRA 1O3TA 3ML6A 3PL8A 1E4GT 2NU7B 2UXDH 1BN5A 4IL6C 3JREA 2ZDGA 3TIGA 3HB9A 4X64H 3V6KA 3JRHA 2MD0A 4MV1A 4MGRA 4XSZF 2FK2A 4RAGA 1YO5C 2YL2A 4L5EA 3BPXA 5ICFA 1T38A 2HVQA 1YW9A 2STWA 2VBWA 4XYLB 1ERDA 3SXYA 3BLYA 3D5LA 4O3OA 3H4BA 1DQUA 4MFEA 3S15J 3Q2OA 1GVJA 1Z0XA 2H1LA 1GXPA 4LOCA 1Y0NA 3CLOA 3ZP5A 1JXSA 1FPQA 3SFIA 1HNWH 2VE8A 3GTLA 2ETHA 3L4KA 3PNTA 1WHUA 3HOVJ 1B72B 5KX5F 3WG9A 4OX9H 2RV8A 1KBLA 2A5WA 1N34H 2QZ8A 3BQYA 2HNHA 2X6XA 1YQAA 3U2RA 4QWEA 4IRKA 1KJIA 3BT9A 3MR6A 1ONVA 5KFTA 1JKPC 4CCKA 1R23A 2EZHA 4LFAH 4EMSA 3S1QJ 3CF2A 2EZIA 3ZMDA 2DOEA 2ZFUA 2ZKZA 4ZYHA 1Q1VA 1I6XA 3G6XA 5FD6A 4RAZA 1XGSA 3HBLA 5GTHC 2CUZA 4X0GA 5IWAH 2MG4A 5HDKA 4IQJA 2E1MC 1RJPA 4CA0A 4QW9A 3WTXC 3GTQJ 4UV8A 2XF5A 3H0GA 4IKFA 2M5WA 1D5YA 4E7SA 1UAAA 1K61A 1O7FA 5E79C 2UUBH 1NTCA 2X1DA 1XPXA 1Y1VA 5JR3A 2KL4A 1I3QA 2KIMA 2VT3A 2ECCA 5C1PA 2PMZN 2WA0A 1VQKI 4OIPF 3GTJA 3QPHA 3GTQA 5LMNH 3I56I 2P0WA 1H0MA 3DF7A 1T98A 4DLKA 1W7PD 2K3FA 3T1HH 1LDJA 2D45A 4A0ZA 5KFUA 3PW2A 1D3YA 1YOVB 4I7HA 4NC6A 2K9QA 3R0AA 1F1ZA 4BXUA 1KZHA 3HUGA 4JP0A 2J6UA 3KP5A 1KJ9A 1SAUA 1VQ9I 4UUTA 3T8RA 5F08A 4CHUA 3WNZA 3JRBA 4IQ4A 2F5VA 2VUMJ 5TISC 4GRIA 2JA8G 2DFFA 1IG7A 1EH7A 5J2TF 4BJTA 3GIIA 5HDGA 3CVZA 4RU9A 4MEXF 4R7RA 1OISA 3LMMA 3GTGJ 4IHTA 2UVVA 3CDIA 3QODA 2L7FP 1FOKA 3EDPA 3FKIJ 1TW2A 2W6PA 4EYIB 3A1YA 2GPSA 2WAQE 4YIFA 3BJAA 3RV4A 3GFIA 3HDDA 4LB5A 1ZG3A 4BHCA 3B6AA 1G4DA 1USSA 4EV0A 4HF2A 4C5CA 3MFHA 4A5MA 4JI7H 1GSHA 4ZDPA 5E1ZB 1N77A 1ETOA 2AU0A 1MMSA 1SEIA 4AUXA 2EPFA 2L4AA 1WH5A 2NUAB 1FIPA 1BNCA 2D5VA 2MC3A 5FLXK 1M7JA 4A93G 3QAHA 1Y8RB 3JSPA 4PDBA 3FHNA 2R7ZJ 1YE9A 2W7NA 2ZJTA 4YHHH 3GO5A 1OCPA 3GTOJ 3I71A 1VQ4I 2ASJA 2XROA 3KPHA 1S5LC 3QFFA 4XKBA 2CV0A 4YG2F 4V2FA 3PSIA 5F0FA 3Q3SA 2DU9A 3RB0A 1RETA 3WE3A 5KFWA 3L00A 3I3LA 1SYXB 3VPBA 3V8KA 4U7BA 1DP3A 1JXLA 1RJRA 5K5QA 2GA1A 4N4NB 2W1OA 2R7WA 3D1NI 1FOWA 4BDZA 1STZA 1TZLA 3EPIA 2RGRA 3GTMA 3HGGA 1R1UA 2NU6B 5A2QK 3A01A 3CP2A 4FU0A 4A2BA 2LFBA 2HTJA 3I12A 1B9MA 3I5UA 3VSLA 3MKZA 4RBOA 2W70A 1UZCA 3KETA 3N41B 4BXXG 1IOWA 2D1VA 1G3WA 4Y7NJ 3GW2A 1P7JA 5EGOA 4W97A 2M8EA 2KRFA 5KK1A 2QSFX 3N97A 2L7ZA 1EJ9A 4E4HA 1K6YA 3BQ0A 4J9SA 4PWQA 4WD3A 4ED2A 1G6NA 2F5EA 3OUUA 1VQOI 1RR7A 4JI2H 2O7OA 4Q47A 1P4WA 1ULYA 4DR3H 5JQWA 3K9TA 1O3SA 1IN7A 3TQNA 1X2NA 4RGUA 2Z3YA 2CU7A 2C00A 2DCEA 5B66C 3LWBA 2AQEA 2W4SA 4J9OA 5KFKA 1I94H 3DFGA 4RMNA 1S8NA 1Y1WG 2Y30A 2OC6A 3S93A 1FEXA 5LEKA 1YW7A 5LGUA 5ICGA 1Y1WA 1LDDA 1GYFA 2CV1A 2ZDHA 1VQ8I 4ESJA 1K83J 2K02A 1S7EA 2DQLA 3A0HC 3EUHC 1T8IA 4JV2A 1ZARA 1FYKA 3DXJF 4GDFA 2WB1E 3CCSI 2FEZA 4ZI7F 2BOLA 4YRVA 3F72A 3A03A 3WODF 1W4MA 2JA5A 3OHBA 2WAEA 3M07A 2XIGA 5KFGA 1TA8A 1SFUA 1FSEA 3LFUA 2JA7A 3LSRA 2XV4S 2IRFG 1FBUA 2LD5A 2YCHA 5EEHA 5LA6F 3TW6A 5KFEA 3Q9SA 2E2IA 1JI8A 1IAWA 4IHSA 2V1UA 4DQ2A 3M1EA 4ZYEA 3S14J 3Q8SB 3PSFA 4A0YA 2GOXB 1L2ZA 1B4AA 1ZGJA 2FA5A 2UXCH 1QO0D 4P55A 4I6ZA 1YJ9I 1VTNC 5JFRA 4F4XA 1MSFC 2UVUA 2BHYA 1IRXA 4XNFA 3TO9A 2M8GX 1XB4A 2PN6A 4OWRB 2L01A 2LG4A 2GM4A 3BG7A 1TLHB 3CJNA 3H9JA 4IEJA 1L3LA 2KLOA 4Y17A 4R8UB 2VC1A 2ISZA 1WPKA 4B3XA 3HOYG 1P9QC 4QWQA 4XOTA 3HPGA 2ZJPF 3ZR8X 1ON1A 3H3VK 4E7HA 3N05A 3PZPA 3PUFA 2VOBA 3EUHA 4K2EA 3G73A 3RPUD 3W6KB 2IA6A 2A68F 2AXTC 5J8CA 2EA4A 4JYKA 2JEGA 4MAMA 2DLLA 5F9NA 3MZHA 5EG0A 2VC0A 5J40A 2K9NA 4LB6B 1KU2A 3LSPA 2QSGX 2B63A 4XIDA 3OS2A 1AUVA 3M4IA 2XGEA 1PDNC 2CYYA 3FZVA 4HOBA 3SHFA 1V4YA 5CQEA 5F04A 4FASD 4AM3A 1I5ZA 2YZMA 2L0KA 1MBKA 1M0WA 4LK1F 4YFKF 2ZCWA 3T5KA 1FYMA 2R7VA 4V19K 4E7JA 2XAGA 1YX3A 4P9UA 5IOYA 3ELKA 4WWCA 3K4NA 3TOBA 3MWDA 4RDUA 1FX7A 1JIHA 3MCZA 2X6WA 3MZ8A 3A02A 3MAJA 1AUXA 3M9AA 4JX4A 3TQTA 5E20A 2YS6A 1KU9A 1WRJA 2PMZA 4IRGA 1DU6A 3GMEA 3Q1KA 1IV6A 1WCMJ 2AHQA 3FM5A 4AIJA 2P5VA 4PJLA 4Z2YA 1DPUA 4NB5A 4XLNF 4ZYDA 4F4YA 3RPUA 3T0YA 2EFQA 1BA5A 1EYZA 4JK1X 4LG3A 2XB5A 2PJRA 1W5CC 2FLLA 3CMMA 1E17A 1B04A 4XRSA 2EV6A 4UV9A 2ZXJA 4XONA 3PQKA 2HDDA 1NG6A 2WDTA 2IS4A 4G7OF 2V9KA 3PR4A 1DV1A 4RB2C 3HOWJ 2KZGA 4KA4A 5BS6A 4D7MA 5L3GA 1HC8A 1XDUA 3LWFA 1I27A 1E4FT 4CH7A 4AYBN 5JLXA 1HKQA 2W6QA 4C2MJ 2IGOA 4HX7A 1GDTA 1WZ2A 1XMKA 4FTHA 2W84A 1HQCA 1LEBA 1XN7A 1JUSA 5HS9A 3JRXA 3O2PE 1ZRFA 1MNDA 3ZQCA 2DJNA 5IT9W 1WWXA 4G9YA 1A9XA 3HOVG 2FSWA 2QQBA 2JQ7A 1HXDA 1Z3XA 4XSXF 1CS0A 5FRMA 3JRWA 3HG9A 3JSLA 4RM2A 4FBTA 3LSGA 1A36A 1KA8A 2BHZA 2OUMA 2RF4A 2IA1A 1G8XA 1KJQA 3OTOH 1NHAA 1DGRM 4BNCA 2VN2A 4ECUA 3T5XA 5E17F 4ED7A 1AA7A 2M45A 5GP9A 5E1WA 2MD5A 1N33H 2SCUB 3KXYT 1UMQA 2FQ4A 2ELKA 4I98B 3BR0A 4LJZF 3OYNA 1FBSA 4XMYA 1T0FA 3HUGB 3RZOJ 3GFJA 2W6OA 1R9TJ 4OIOF 2VXDA 3K4LA 4B48A 2NXNB 3ABLH 4PJ0C 2COBA 2XGCA 3H20A 4MO7A 5KFBA 3K2ZA 4GC7A 5L1JA 2NVXJ 5FLXZ 4XLEA 3FBNB 4L0ZB 3BJYA 1D0XA 1VBGA 2DPDA 2VQGA 3J80Z 2DFIA 3TGNA 2R93A 2ZXWH 3K4CA 4NQWB 5TRDA 3F8NA 3ERMA 5HODA 1MBFA 4FETA 1U5TA 2WB1N 3PIOF 2IBKA 3DU5A 4IRIA 4MV8A 5KG0A 4LD5A 3BG3A 3K7AJ 5EEAA 3AFHA 4LF6H 1WH7A 2HR3A 2OD5A 3HSRA 3GLLA 2NS0A 1BJZA 4G3IA 4BHPA 3H3VH 2VKEA 2VXZA 3IHUA 4Q4ZF 2STTA 1BW5A 3CF5F 3L2WA 3C18A 1D0ZA 4UUVA 4A3EG 3LQRA 1K78A 2ALZA 2HWVA 1VNDA 3FDSA 2HPIA 2RQQA 3JAMZ 2P4WA 5D1OB 1S03G 3BOQA 3I59B 3MZYA 3JRCA 4IPAA 1CGPA 4BBSG 4UVAA 3WU2C 5K5OA 2M30A 5FKKA 2L54A 2TRTA 2IMWP 2KJBA 5DCMB 4HF1A 3DTEA 4EGJA 5KNLA 1A6QA 3RQIA 4NC7A 3L1PA 1SCUB 5EWEA 4YP3A 2C28A 2Q2TA 4HYEA 1W1WE 1OCTC 1UG2A 3OIOA 3AL0C 2ZXIA 2EQRA 2R8HA 3BR3A 5KFVA 4KIFA 3MR5A 3BDDA 2LKPA 4RNOA 2DMTA 4ECVA 2JEFA 5CAEB 1XMQH 3H9QA 1XCVA 3OIPA 3PN1A 3JAMW 4DL6A 1QGPA 4JQFA 2ZO4A 3RCOA 2NYXA 3GV8B 2L9SA 4J9NA 4HLYA 4EFEA 3HOXG 1G3YA 1K83A 1SANA 2E5LH 4QWBA 5KT7A 3RIZA 2ATLA 3S3MA 1FVIA 1BBYA 1Z6TA 4TQSA 5JVGF 5CYVA 2YZNA 3GIPA 3ZGKA 3SZGA 2R7DA 4BE0A 1WSCA 5M5XJ 2CS3A 2F2EA 2W6MA 2RREA 2NOJB 4D5FA 3H5NA 3CCQI 4AYBA 5HLTA 3K4MA 3H3ZA 3O3KA 1YJNI 4C2TA 1XNQH 2L7MP 2YPRA 4HW0A 2WV0A 2FBKA 2I80A 1FMWA 1C0WA 4R8UA 5C4JJ 2XVCA 2DT6A 5J4YA 2E2JJ 3ORRA 2DO7A 4RGRA 2R5ZB 2QM3A 1VQ7I 1QHHD 1NH3A 4N9IA 4BY1G 1IXRC 2DA2A 3P9KA 5KT5A 4DL2A 2VLAA 3FXQA 4U7CA 3QPTA 4X66H 4HDVA 1IOVA 3K1MA 4E7LA 1V55H 3I4MG 1ZGAA 1XNRH 1YFHA 1O3QA 1KU7A 5DQIA 1D5VA 1X1CA 3DF8A 2R5YB 4BXXJ 1QA6A 4G7HF 1U9OA 1ZK8A 4X1EA 2QYOA 2R82A 2VOOA 4B09A 4LF4H 2J5OA 3R4KA 4HF0A 3ZMSA 4ECXA 2R7ZA 4U88A 1IXCA 4Q43A 3CJRB 3KAKA 3DPTA 1TQIA 2LP0A 2ZSIB 3O6BB 2BW3B 3MR2A 3BG6A 1XS9A 4IRDA 3KP2A 3QOPA 4PSXA 5FRNA 2M05A 1ZR4A 1OCCH 4YEJA 3DBHB 5DG7A 1CQIB 4RS8A 4FBUA 4XX0B 4I4TF 1GXQA 2WWYA 5GAHJ 3VB2A 1BJAA 3RTXA 3IG0A 4IRCA 3S1NJ 1RUOA 5C4XJ 2ZNZA 2XCAA 4IJAA 3H0DA 3F0CA 3CUOA 4X6AJ 2CQQA 4C2MA 4L9TA 5DG9A 9ANTA 4BQQA 2FJZA 4LF5H 3BJ6A 4DV6H 1BR1A 3BR1A 4RLQA 4BGDA 3F23A 3CMAI 2F4MB 2ZFWA 3JR9A 1U6GA 3OIQA 3P9IA 1S72I 3CUQC 2FPGB 4QWAA 4RUCA 1JTYA 3W2VA 1XC5A 2W9CB 5KKNB 2V6EA 4LIUA 4FX4A 1OLTA 1UG0A 1X19A 4A3CJ 4HR7A 5JLWA 3ZQFA 2A6HF 3PW0A 2A5YB 2V5AA 2XAHA 4NBQA 2R8IA 3JAMK 1WJCA 1MSEC 2CQYA 4F52A 4O2BF 2FF4A 2K86A 4KFCA 5K7ZA 5FLMJ 2C35B 4KT6A 2JA5G 1R00A 1ITYA 4HAMA 2DT7B 2LDUA 4EG0A 4Q8FA 2ADUA 4A3GJ 4ETSA 1BI2A 2A6TA 5CVJA 3N4MA 1KYWA 3JRGA 5E8GA 1VS0A 3ZCOA 4O3NA 3FISA 2V7FA 2VJIA 4HNUA 3VSKA 4BACA 1WQ2A 3WTWC 3WGHA 4LF9H 4UFZA 1V4RA 1V5GA 1K1QA 4PGGA 3MD2A 2GLOA 2E1CA 4BEHA 3P5JA 1E4EA 3GZNB 3TDZC 2OZUA 2YU3A 4XYMB 1J75A 2HQRA 3RDIA 1IZ1A 1UCRA 4A2AA 4BJ5C 2FB9A 5DGBA 4DR6H 2UU9H 2LVSA 4LH7A 5KFSA 2X1CA 2LLKA 4A3JJ 1JKOC 1QHGA 4EEYA 3GIDA 5KG2A 1GVDA 3EPGA 2V1NA 2VPRA 1Z77A 2JRMA 2XPUA 4IVNA 1K4TA 3BY6A 4HRIA 2QENA 3K70C 2F6CA 5BPFA 2K7LA 3B73A 1LE8B 1YIJI 2E5NA 3AG1H 3K0LA 2X51A 1ZTRA 3PW5A 1SD5A 4I0BA 1P2FA 1V54H 3S3NA 2R92A 1TTYA 4XKWA 4J01A 3KP6A 1WSUA 1LNWA 1MNEA 4S04A 2BVLA 2PJRB 2CQNA 1L0OC 2DI3A 1A31A 1P4AA 3IL2A 2UVWA 1EH8A 4IR1A 4HDUA 2CGPA 5KT3A 4DL5A 2LY2A 2HYGD 5FLXW 3UQ8A 4XLPF 4A3BG 5FD5A 3KLNA 1JLLB 3RF2A 3GV7B 2P5LC 2VODA 3H36A 4BS9A 4I2OA 4IHJF 2JA7G 3F22A 2R93J 1PP7U 4UVCA 1U8RA 1RK5A 2GZWA 1S97A 4RB3C 2LH9A 2IA0A 1MH4A 4KMFA 4A12A 2M0CA 2VBZA 3S2HJ 4Q0YA 1OJLA 2HYFA 2V59A 5HLIA 1UHSA 1FOYA 4WXCA 3OYEA 2ASLA 3CCUI 3SDBA 5DG8A 1JT6A 4Y3OA 4Y13A 3BG9A 1WVRA 5KFPA 2UVRA 2B63J 3KHHA 2NU9B 2OAZA 1X4PA 3KZYA 3J7YJ 1WI3A 1T6SA 1Z9CA 4W1UA 1MKMA 2LBFA 3CCLI 4QTRA 5KG1A 1ZAOA 4XQFA 1I7LA 4I99C 4IHXA 4ZDOA 5GPAA 1W36D 4F4ZA 5KFLA 4XOPA 4E7ZA 1RKWA 3LQQA 3OYBA 2EFOA 3H5RA 5LP6F 1MW7A 4RAFA 1ZQ3P 3DLLF 1HNZH 1BM9A 2YYAA 3CQZA 4RB1A 3WTYC 2FLNA 4XK4A 2QLZA 4QSHA 2R7UA 3MJFA 3WHBA 4QPQA 3I54A 4MNUA 3NARA 2CW0F 3CCVI 4ZTJA 2OJED 3W6JB 4FS2A 3DWLE 1IN6A 2EILH 2L3DA 4V2GA 4LFCH 3PUBA 1OCOH 3KIOA 5EEGA 2OCCH 3ONQA 3DLAA 5DCFA 1CE8A 1TT0A 4YAJB 4ED0A 3CDLA 1LFBA 1QZYA 2KHMA 3CCRI 3OOPA 4HYKA 2Y0SA 3U9SA 4AIKA 2KMUA 5TJJA 1MDMB 1HLVA 4L9VA 5E1XA 2ME6A 2DA3A 2FXAA 3ABKH 3PO3G 2XGDA 3U1KA 1JJ6C 5HV6A 1WCMG 4JI3H 5BPHA 3ASNH 1V3FA 2ZMEA 1PVEA 3KYLA 2MH2A 3GTMJ 1P92A 2DJIA 2LKSA 5JH7F 3EUKL 2DA5A 2YRXA 1OWTA 1FC3A 2AQ4A 5CA1F 4LMYA 1U8BA 2JA6J 3KEQA 4XR6A 5AIPA 3HOUJ 1J5EH 4HX8A 2XUBA 5BR8H 4XBFA 2R92J 5JHUA 3OYMA 3OYIA 1HOMA 3RAQA 1W36C 4AC0A 4R79A 3J80K 3QPLA 3OYLA 1SD7A 2IP4A 5C4XG 3K3VA 3DBRB 1ON2A 4ZH4F 2O03A 2R0QC 4U87A 5KG3A 3LL7A 3U9GA 3U1DA 1SAXA 3G6YA 3CJTB 4ASNA 3ZQIA 2R8GA 2F48A 1KJ8A 1E2XA 3GTLJ 3KAJA 1FZPB 1T0FC 3ZMUA 1TT5B 1X1AA 2E34A 2QQ8A 2XAFA 5HDNA 1I3AA 4TV8F 1I39A 2LY1A 2E35A 4JI1H 4A6EA 5J47A 2MC4A 4CCJA 2YU9A 1VQ5I 2HXOA 2X1EA 2PLYA 1MBGA 4R1HA 2I10A 4I55F 4I01A 4M6YA 3K4KA 3Q8RB 4WXHA 1Y1WJ 2E1MB 1GUUA 3GCMA 2W7OA 4DIQA 3OYFA 1KC7A 2HDCA 3C2GA 1WKMA 3N6XA 4YY3H 3CMEI 1H9TA 4YELA 2C2RA 3GFLA 3C1DA 2Z9OA 2VQLA 2YX7A 2EIKH 3E6BA 3S3OA 1YI2I 4PJJA 1U78A 1JGGA 1HBXG 2W7PA 2VONA 4HNTA 5DS9A 1ETQA 1QZZA 1B9NA 4PJNA 2WY8Q 4ESBA 4CC6A 1BI1A 4M6XA 2H09A 2PJPA 2P0AA 1JGSA 2M4KA 1VQLI 5M5YJ 1Z7UA 4ON0A 3KTMA 2Z5UA 2LC2A 3E5QA 2JA8J 2PBZA 1IUYA 2KDZA 3J7AY 5LYJF 4ED1A 3ABUA 3K2AA 1Y6IA 1LFUP 4DOZA 1Z2NX 1HKSA 1A5JA 3NWSA 3FK6A 4O3QA 2EZKA 3E3VA 5L3FA 4ECYA 3J7AK 4DUYH 5K7FA 1WJAA 4UB6C 4EQQA 2NU8B 1IBKH 1UFMA 1FT9A 2LRDA 4QLCU 1UB9A 1Y1VJ 3E0JB 4A3DG 4B3SH 5FFZA 2LF7A 3IV5A 3IH2A 1AU7A 1W0TA 2CKZB 5LEJA 1TWCA 4A69C 4PGHA 3RKWA 4APMA 3TINA 2O8KA 3HGYA 3MKLA 1GO3E 3D5SC 3CCMI 3WHCA 5FFXA 2VPQA 2DTZA 1R1TA 2MABA 2W00A 3R23A 2XGQA 1FNNA 1OCRH 4CYCB 1FP1D 2OQGA 3R61A 5EZYF 3T5HA 1IRFA 5HNFA 2EA2A 3HOWG 2YX4A 4DYRA 4LGWA 4E6KG 2FPIB 4J9PA 2HS5A 2W85A 2RC4A 3RKXA 1SC7A 4CGZA 4XM3A 4I02A 1S0MA 4HEA2 3OYDA 3N8DA 4M9ZA 2W9CA 2VKHA 4RAYA 2IT0A 2JSPA 3T8TA 1S9HA 3GWZA 4G12A 2PEXA 3KE2A 1PX2A 2DODA 4CXFA 3G8CA 1JKRC 4LSAA 2R7LA 1YTYA 4KYWA 1IW7F 3LMLA 5KFDA 1HR0H 2W6NA 2VQFH 2FE3A 3HOSA 1X1DA 3ZOBA 4KITB 5LGNA 4PSWA 2QF7A 3GVAA 3SZPA 1CF7A 1ZHQA 4B3RH 2J9GA 1XMXA 1YRNA 2XC9A 4ZTFA 3GZ6A 1O4XA 3JCUC 3RKYA 4M9SA 2B0LA 5CKTA 3TO7A 5HNHA 1N36H 5LMUH 1MJBA 4YQWA 1D1CA 3OOUA 2X6YA 2E19A 2HHHH 2YW2A 4RUAA 4J9KA 4WXDA 2K9LA 2GBYA 4PDKA 3FK7A 4F50A 1R5ID 5DCMA 5BNGA 1IDZA 2PBIA 3KZZA 1PJRA 2IGNA 2L9VA 2MYSA 2LTPA 3TP0A 1IV8A 5GPCA 5C44G 3LSTA 2PVPA 4A3FG 1BIAA 2VQDA 1WFXA 2KKOA 1PYVA 3OL4A 1ZLJA 2DA6A 3M8FA 3PNYA 5BMZA 4M3GA 1B8IA 1FMVA 2HQ5A 3QYFA 1MH3A 1HKTA 4BAYA 5KG6A 1ULZA 4UCVA 2DT5A 1F36A 1LFPA 4B1RA 4D7NA 4YBZB 1YLFA 2VBYA 2K4JA 4MIMA 2BGCA 2JUCA 3VYSB 2QEXI 2JA2A 2K4BA 3DV8A 4OAYA 2OH2A 3WG7H 2HI3A 4LLLA 2GAUA 3BTIA 3FM3A 3EYIA 1QPMA 5CB4F 1R5GA 3L09A 4D5CA 4LG0B 2CZGA 3I58A 5JVDF 2QVOA 2HYJA 5KCMA 2FNAA 2ZM6H 4A3GG 1EF4A 4GGGA 4ZZLA 3WU0A 2DA7A 2JSCA 4NNJA 4RGSA 4HV6A 6PAXA 2Y0SE 1R5HA 1W96A 2CUEA 2IEKA 3ABMH 4IWXA 3RB4A 1DU0A 1BOAA 1KYZA 2W24A 3H9GA 4OIQF 3K3PA 1O7LA 3OSPA 2PN1A 3CDHA 2HDWA 4ECWA 1VQ6I 4RNMA 2BQRA 5J2UF 2V79A 5KFFA 3HEFA 2A6EF 3LNQA 1SFKA 2V9PA 2R92G 2EFNA 1HW5A 1OMIA 2UWMA 1GLNA 1TWGJ 3ASOH 2JRTA 2EWNA 1UELB 1SVLA 2VASA 3F8MA 3RTRA 5FROA 2W9BB 3Q9VA 3ZPLA 2GLTA 3JRAA 1J9IA 3HJEA 3V7CA 3PO2G 2MCTA 2DOAA 3I59A 1VAJA 5DD8A 3IC7A 5C5JA 2DA4A 1LPQA 2NVTJ 1FKAH 1UJ8A 3AL0B 1BGWA 2FRHA 2FLPA 1GHCA 2AGOA 4RB0A 3I0TA 1AOYA 4Q48A 1RIOH 2BY3A 4YFNF 2XF7A 1G2HA 1G3SA 2VUGA 4WK8F 5LGTA 5FPRA 3BR2A 1J2XA 1N78A 4WF2A 2PI0A 4E70A 2GIZA 4UUSA 5E8IA 3S16J 5A2QZ 3B02A 3W2WA 3K4BA 5CQGA 3E5UA 2R7SA 4GXOA 4RA2A 3KEYA 4ED6A 5M3MJ 3LP8A 2ESHA 3IAS2 1APLC 2RKHA 3WTSC 2V1XA 3RZDJ 3M9NB 3RB3A 2EZLA 3KEOA 4O3RA 3HOUG 3LAJA 4D1QA 3ETJA 4NLGA 1H89C 3S2WA 3QPSA 2R7OA 3IH3A 2UXNA 3QP6A 3QRFF 2FUG2 5LL6b 2Z1DA 5HOOA 3GTPJ 3E1SA 4NDLA 4BY1J 4O6JA 3ZQ7A 3OHAA 3BQZA 4DYQA 2GOMA 2Y31A 4GKJH 3LA2A 5D5WB 3MKYB 3VEPA 1F4KA 3TOAA 1ZG5A 3LSMA 1WJEA 3CCJI 3DQVC 1IBMH 4AVPA 2ID6A 4UXNA 2A05A 3ZN0A 1ZN2A 3Q8PB 2VBXA 2VIXA 4UY8I 3BQ1A 2YSRA 1VF9A 2NS7A 3WTVC 4H4KC 2OPTA 2FMAA 4RNNA 4QWCA 3LAPA 2Z33A 5AIQA 1ETWA 4KDPA 4IXAA 4Q5SF 2Y0SN 3Q5FA 4EJOA 4X65H 4L0YB 3QYBA 1LUJB 3QU3A 4HQMA 3ZXSA 2KIUA 3VDXA 5D4RA 3I4PA 1YS6A 1S68A 1IGNA 2GPWA 1DUXC 4A3KG 5F9LA 2QWWA 1ZYRF 2XHKA 3SQNA 2JPBA 3VODA 4XN0A 5KG5A 4EFBA 2I8DA 2R7TA 3E5NA 4A3LG 3C3WA 3IUOA 4M9XA 3CUQB 2E71A 4LITA 1XGNA 3VMMA 2XRNA 4JI6H 1C3OA 5D8DA 2UUZA 5IY5H 3FDYA 1TQMA 2R5YA 5IYCG 3JTHA 4JI4H 2AGPA 2QUFA 1XD7A 5M3FJ 2MLKA 3KYDB 2IS2A 3PQJA 2DA1A 3OY9A 2UUCH 1YHQI 4UCRA 4BEHB 2CQ7A 1JHFA 1R36A 2OQRA 3A4CA 4J0MA 2R7MA 2C6YA 1K4SA 4HSTA 4DV5H 2NVYA 3HHGA 3JRIA 3NRVA 3S8PA 5HS8A 4MQ9F 4YFXF 5IP9G 4M3DA 5C8YF 3FXUA 5KAFC 2MA3A 3RSNA 4F3QA 1FSHA 1TWHA 4GKKH 4O3SA 1ZRDA 3H1CA 4JYAH 1KEEA 2JA7J 1PK8A 2Y75A 3E6CC 1QPIA 2XKOA 1I6HJ 2PQ8A 3RAXA 4DV4H 3FWEA 4XLHA 4NQWA 3X2QH 3F21A 2H94A 2KIFA 2J5PA 4KT5C 3DTKA 4I0AA 4IX7A 4Q44A 3L2PA 1W7PA 4HX4A 4EBEA 4N9HA 2GQQA 5GADJ 3OV8A 4DV7H 1UC9A 3VOEA 2HQAA 5FKMA 2RDIA 3IKTA 1WJBA 1XSVA 3M3YJ 4FX0A 2F5CA 3BR5A 2HGSA 2CH0A 2FBHA 3JZIA 4M7EA 1Z05A 1QVTA 3OMYA 3RJ0A 1S9FA 2E2HA 1IDYA 4BBRG 5C44J 3AAFA 2NVXA 3BWGA 5IT9K 3BA9A 1T95A 4LFUA 3KYCB 3FXOA 2BR0A 1UHWA 2IJLA 2BXZA 4GYIA 4Z6YA 2Z16A 5F1JA 4EGYA 2QK4A 4BWSC 4ZHQF 1D1BA 3WGIA 3J81K 1AN7A 4B3MH 4EM0B 3WO0A 4NC8A 1JTXA 2FJ1A 4M9UA 4FQGA 2FQ3A 1X58A 1X1BA 2CJJA 1UHMA 2BXYA 2IVMA 3KP7A 1TWCJ 3JTGA 2Y9ZA 4GCVA 5J1UA 1JE8A 2Q8KA 5DTDA 2JWTA 2IW5A 5EDNA 5IYCJ 2NNYA 4JX6A 4C30A 1I1GA 2LYCA 1ZETA 5HS7A 2LBFB 4IR9A 4Y4RA 4LSXA 5D4SA 3OYKA 3OSGA 2ELHA 3QOEA 3S1RJ 2BBYA 1ZQ7A 4KNYA 1U3EM 2WV1A 1HW2A 1B6RA 1WJFA 2VJJA 3KP3A 4O5VA 1TWFA 3I4NJ 5IOZA 3KHLA 4EBDA 1E4EB 4EM2A 1D1AA 4XLAA 3BJOA 3CUQA 4AD9A 1EKEA 2Y69H 2BE5F 1QU3A 2HOEA 2BVMA 2X6OA 2OLSA 1RNLA 1XG1A 2AQFA 3DEUA 3ZRGA 3K6GA 1MD0A 3BC8A 3MR3A 2IBDA 2NOGA 1ETYA 3AG4H 4AIHA 4LLNA 1R22A 4BU2A 2RGVA 1R49A 2Y2ZA 4KIBA 1AKHB 5KFOA 1W7PB 1HF0A 2HGCA 4XKCA 4DL4A 4Y8VB 2WTEA 5L1KA 4M3EA 2R5ZA 4G94A 4OMZA 1FLIA 4G7ZF 3RBEA 4DNCA 2M7BA 3LSHA 1ZG1A 2JN6A 4B43A 2JA6A 4HLXA 2I87A 4ME6A 2FMLA 4ZC3A 3Q8QB 2DK5A 5KFXA 4BY7G 4G6DA 4O4LF 5KFMA 4OAZA 1H9GA 1TW3A 4E4TA 3T5LA 3PNVA 5FJ8G 3R5FA 3GTGA 3PR5B 5IP7J 1YW8A 2DK8A 2P5KA 3TKYA 4FCYA 3G2BA 4S05A 1MDMA 1W93A 2HKOA 2FK1A 4EEQA 2EV0A 2DTRA 2MW8A 2C2DA 4MTDA 5KFAA 5K1YA 1IXSB 1ZRCA 1TNTA 1JX4A 4RM3A 4MTEA 2E7WA 2F4VH 2NAZA 3DKXA 2UZKA 3VPRA 1F5TA 5CVIA 1T36A 5DQGA 3IN5A 2QBYB 1IBLH 5ERIA 2LR8A 4ABZA 5GTIC 3EYYA 2B9SA 4XL9A 2W48A 2DN0A 3F6VA 2GWRA 1RJQA 1A0IA 3FXKA 2WYOA 3GF2A 2ZXHA 3GIMA 3KHGA 4KICA 4UHTA 2V4RA 3RB6A 3UNGC 4I50F 4IAJA 1JDBB 2KIQA 2L5QA 2ZSHB 3SEQA 4CUGA 4BJ6C 5L3CA 1XCBA 5D8LB 4UCTA 1MMAA 1U2WA 2FKLA 1DGWY 2XKPA 2ZMEC 1SMTA 3K10A 3V4GA 3S32A 4MFDA 3VFZA 3RGZA 1LDKB 1DDNA 2YS7A 1FJGH 3R6SA 3G4SI 3WGGA 3CD6I 2ZDQA 3GX4X 1QQIA 2QCOA 2EFWA 4C5AA 2R84A 2QQ9A 1PP8F 2XGXA 2K9SA 2VKVA 5EZGA 4YIRX 1R6RA 2BYVE 1IC8A 4B8XA 2W8KA 2MGQA 2JA6G 2BY0A 3OS1A 3S17J 4J9MA 2G9WA
chains in the Genus database with same CATH topology
2LNBA 4IF4A 3HRMA 3PFIA 1J5YA 5BOXA 4K0KH 3REOA 4P96A 2GXGA 4M74A 1LJ9A 3WTUC 5J8FA 1V9PA 3HRTA 3GLXA 2A3SA 1OYWA 3N40P 1MGTA 2QQAA 2O3FA 3I53A 5D8KB 5BPIA 3HTSB 3BZ6A 3MFKA 1Y0UA 2DAOA 4HA8A 3RYPA 2V9VA 2GA2A 2OZ6A 3NEUA 4A5NA 2G7UA 5BQTA 3R0JA 1P4XA 3F8CA 1FY7A 1RUNA 1EH6A 1U5TB 1HSTA 4ZYGA 4UNOA 2Q2EA 5DUKA 2H27A 3T1YH 2F5FA 1J0RA 3LFKA 4D0PA 4G6QA 2W57A 1X9NA 1K78B 3E97A 3GEZA 1Z91A 3HSFA 4X62H 2LF8A 4ENJA 2H6BA 3RPQA 2ISYA 1T2KA 2PG4A 1SD6A 2NRAC 3N44B 3N42B 1HNXH 4LLGF 1TNSA 4KMUX 2EB7A 1XDNA 3KCCA 2QBYA 3WTZA 1KQ8A 4BHBA 4LF8H 3D0SA 2ZJ2A 2FNPA 4OU0A 4CC5A 1KQ0A 4L5JA 2VOPA 3EETA 4N0BA 1I6UA 4AWXB 3H92A 2P7CB 4RZQA 1YIOA 1KU3A 3I64A 1D8KA 4DR4H 1OYIA 3HRUA 2R7FA 4DUZH 2HTSA 3E6MA 3M8EA 4M73A 2JZYA 4A2UA 5L3EA 4I09A 4DV3H 3LA3A 2KJCA 5FO5A 1R7JA 3ULQB 1ODDA 1N32H 3FMAA 3CTAA 3LA7A 4DR5H 4NXMH 3RJPA 4BH9A 3V7RA 2HFHA 3K1PA 4DR1H 3FHZA 2E1NA 5DYMA 2EJRA 5LHIA 4PCQA 3J81Z 4TV7A 3MWMA 4NXNH 4CDGA 1LQ1A 5JVTA 1DPRA 2DW4A 5FB2A 1Q1HA 3KFWX 3WE2A 1S3JA 2UXXA 4DV1H 1S6LA 4EJWA 3HTUA 4CZZA 4JI0H 4AQYH 5CVUA 5J6XA 2JTVA 2JPCA 1W5TA 2MBFA 1R1VA 1TQPA 4OOIA 1X3UA 1TAEA 2EV5A 3NQOA 3J80W 4P5OA 3L7WA 3HRSA 4O3MA 4OMYA 2UUAH 4MHGA 3WTTC 4U0YA 2GXBA 4EJTA 3DKWA 3MQ0A 2ACJA 1LEAA 1RZ4A 4UCOA 4DR7H 4EVIA 1S7AA 1LB2A 3RIRA 5FPOA 1TBXA 2F5DA 1U5TC 2P8TA 2V1DA 5DD4A 3RYRA 2OU2A 1O3RA 2RNJA 4MV7A 3QU6A 2R3SA 3HHHA 3V7SA 4LK0F 2M1BA 4LFBH 3HSEA 4G8XA 1YS7A 2XASA 2RQPA 3C7JA 2FBIA 4L9NA 3ZMVA 2L4MA 1BI3A 1RI7A 2W25A 1B6AA 4ENMA 5D6FA 4YIIA 4UCUA 1ZHSA 4A0XA 1HSJA 3ERED 1Z2PX 1G3TA 1OR7A 2BEOA 1HW1A 2DBBA 2Y48A 1B1BA 4ENKA 5F6FA 2A69F 2ESNA 1K79A 4UCSA 2MH9A 3TO6A 1KGSA 3C0FB 5ILSA 3G3ZA 2H6CA 1QBJA 1P8LA 4UVBA 3BPVA 3BROA 4M71A 1M0TA 1SD4A 3FMQA 4MQVA 1REPC 2Y0MA 1XSXA 1YG2A 3IRQA 2RDPA 4F7ZA 1J7KA 2BV6A 4ESFA 5ICEA 2DQRA 5ICCA 2TDXA 5DV5A 4BYYA 1IF1A 1SMYF 5HLHA 4H0EA 1BC7C 4OINF 5LRRA 3IKVA 2A07F 4WX9A 5D6EA 1FYLA 1PUEE 5A2QW 2XAQA 4GO1A 2EFPA 1S29A 1SFXA 3CO6C 1Z6RA 4HBLA 1Z1DA 3SZTA 3COAC 2XAJA 4FHTA 3L2CA 4LH6A 2VT2A 4DV2H 2P6SA 3K1NA 5H6QA 4B3TH 4KN7X 5D1PA 1FP2A 3ZMTA 1J59A 3GZ5A 3BABA 2CW8A 3ABTA 1YYVA 5H20A 2GIVA 4HQEA 4U7DA 5CLSA 1B59A 5F1RA 3F8BA 5L3DA 3IWZA 3KP4A 3V8LA 1W5SA 1WI9A 2P6TA 4HV5A 1IN8A 3V8JA 3E5XA 1KQ9A 2FMYA 4HZFA 1OYYA 3ZN1A 2HVRA 1I1SA 3FF5A 2G7HA 3H3UA 1ZLKA 3F3XA 1Z2OX 3FMSA 3ZMZA 2DPUA 2FOKA 1LVAA 2RVCA 4L5IA 4A6DA 2O8XA 1K7AA 5FGMA 5DEQA 4KHPH 1T39A 4RGXA 2O6GE 4MV9A 4KN4X 3J81W 2KSWA 4L9JA 1XGMA 2ZBKA 1IN5A 3ECOA 4FM9A 1CF7B 4DR2H 3ROUA 3TDUC 5ED4A 1F9NA 3KLOA 1BC8C 5LBQA 1IRGA 3RGXA 3OTOH 3T1BA 2AXLA 5KVRA 2OBPA 3P9CA 2VE9A 5DDGA 1ZREA 2X4HA 2V6CA 1QNTA 1K6OA 4DV0H 1IN4A 3DP7A 3HOTA 1R58A 2ZMEB 3IWFA 2RN7A 3HYIA 1FWZA 3J7AO 4R8HA 3F6OA 2IPQX 4U0VA 2CG4A 2HZTA 4LF7H 2D2WA 2LSOA 2E7XA 3JW4A 3QP5A 5LLQA 2MLGA 1BJTA 4MEYF 3GUDA 3GYHX 4OIRF 2HKXA 1BIBA 5ILVA 3P7NA 2EK5A 2L02A 5K5RA 4BQAA 2YR2A 2CO5A 2Q0OA 1EV7A 4LG0A 2PMHA 4CO8A 2WE6A 1MJ9A 4ZZDA 4JBAA 5D5XB 5EOYA 3KALA 3EQLF 2JT1A 1MZBA 1D8JA 3JSOA 2FU4A 4EJUA 5F64A 2O61A 3GFMA 1JHHA 2M87A 2A61A 4Y15A 4JV5H 5D5UB 1DGSA 4EM1A 3HXLA 5D1OA 5D5VB 5JI6A 4XRFA 3ECHA 5HLGA 5IT9Z 5DUIA 1USTA 5AONA 1XSDA 2X0LA 1DP7P 3IRRA 3FMRA 3MEXA 4JI8H 3N43B 2OA4A 5LHGA 5IT3A 5LHHA 2D1HA 3L9FA 2HVSA 3E6DA 4JI5H 4GLXA 4PZJA 5LRSA 3GXOA 5CJ9A 2K27A 1XDSA 4CYDA 1S7OA 1ZH5A 1A04A 2HQNA 4EJVA 1AWCA 2HEOA 2VPSA 4EGZA 1SFEA 2CSOA 3SFZA 2ZNYA 1O75A 2CQKA 3BP8A 4FT8A 4L18B 3M7GA 3FX3A 2WC2A 5H6RA 1MJAA 5HVQC 4NHJA 2NNNA 1P6RA 5E18F 2CW7A 3BAAA 5L3BA 2IP2A 2PMUA 4KUMA 3RI4A 1OPCA 2PFBA 3ISPA 3WU1B 2Q2UA 3L4JA 3JSNA 2O0YA 1O57A 2Z99A 3DPLC 5CVRA 4WCGA 2IA2A 1XMOH 5CVVA 3BA8A 3HIFA 2UXBH 1WH2A 2CFXA 3K69A 2OWOA 4M72A 1FBQA 1XMAA 4GYGA 4ENNA 2P7VB 1XGOA 3R60A 5BPDA 4CICA 1ZHFA 5ILUA 3F8FA 2AS5F 4IRHA 4P9FA 4U0WA 1BI0A 4KIGA 2CWEA 2COMA 1OKRA 2VQEH 3CO7C 3FXRA 1O3TA 3ML6A 2UXDH 1E4GT 1BN5A 4X64H 4MGRA 4XSZF 1YO5C 3BPXA 5ICFA 1T38A 2HVQA 1YW9A 2STWA 2VBWA 3SXYA 3D5LA 1GVJA 1JXSA 1GXPA 3CLOA 3ZP5A 1FPQA 1HNWH 2VE8A 2ETHA 3L4KA 4OX9H 3WG9A 2RV8A 1N34H 2QZ8A 1YQAA 3U2RA 1ONVA 1R23A 4LFAH 4EMSA 3ZMDA 2ZKZA 4ZYHA 1I6XA 5FD6A 4RAZA 1XGSA 5IWAH 5HDKA 3WTXC 4UV8A 2M5WA 1O7FA 2UUBH 5JR3A 2KIMA 2VT3A 4OIPF 3QPHA 5LMNH 1H0MA 3DF7A 1T98A 1W7PD 3T1HH 1LDJA 2D45A 4A0ZA 1D3YA 4I7HA 3R0AA 1F1ZA 4BXUA 3HUGA 3KP5A 3T8RA 4CHUA 1EH7A 5HDGA 3CVZA 4MEXF 4R7RA 4IHTA 1FOKA 3EDPA 1TW2A 4YIFA 3BJAA 3GFIA 4LB5A 1ZG3A 1G4DA 4BHCA 1USSA 4EV0A 4HF2A 4A5MA 4JI7H 5E1ZB 1SEIA 2L4AA 2MC3A 5FLXK 3QAHA 3JSPA 4PDBA 2ZJTA 4YHHH 3GO5A 3I71A 2XROA 4YG2F 2DU9A 3WE3A 3L00A 1SYXB 3V8KA 4U7BA 5K5QA 2GA1A 1STZA 2RGRA 1R1UA 5A2QK 4A2BA 2HTJA 1B9MA 3I5UA 3KETA 3N41B 2D1VA 1G3WA 3GW2A 2M8EA 2KRFA 5KK1A 3N97A 1G6NA 2F5EA 4JI2H 4Q47A 1P4WA 1ULYA 4DR3H 3K9TA 1O3SA 1IN7A 3TQNA 4RGUA 2Z3YA 1I94H 3DFGA 1S8NA 5LEKA 1YW7A 5LGUA 5ICGA 1GYFA 1LDDA 4ESJA 2K02A 2DQLA 1ZARA 1FYKA 3DXJF 2FEZA 3F72A 3WODF 1W4MA 2XIGA 1TA8A 1SFUA 1FSEA 2XV4S 2IRFG 1FBUA 2YCHA 5EEHA 3Q9SA 1IAWA 4IHSA 2V1UA 4DQ2A 3M1EA 4ZYEA 4A0YA 1L2ZA 1B4AA 1ZGJA 2FA5A 2UXCH 1QO0D 4P55A 1VTNC 5JFRA 3TO9A 1XB4A 2PN6A 2L01A 1TLHB 3CJNA 1L3LA 4Y17A 2VC1A 2ISZA 4QWQA 1ON1A 2VOBA 3EUHA 4K2EA 3G73A 3W6KB 2A68F 5J8CA 2EA4A 2DLLA 3MZHA 2VC0A 4LB6B 1KU2A 3M4IA 1PDNC 2CYYA 3FZVA 4HOBA 3SHFA 1I5ZA 1M0WA 4LK1F 4YFKF 2ZCWA 1FYMA 2XAGA 4P9UA 3ELKA 4WWCA 3TOBA 1FX7A 3MCZA 3MAJA 3M9AA 5E20A 1KU9A 1WRJA 4IRGA 3FM5A 4AIJA 2P5VA 4Z2YA 1DPUA 4NB5A 4XLNF 4ZYDA 3RPUA 3T0YA 2EFQA 4JK1X 1E17A 1B04A 2EV6A 4UV9A 2ZXJA 3PQKA 2WDTA 4G7OF 4RB2C 4KA4A 5BS6A 5L3GA 1XDUA 3LWFA 1I27A 1E4FT 1HKQA 4HX7A 1XMKA 2W84A 1HQCA 1LEBA 1XN7A 5HS9A 3O2PE 1ZRFA 5IT9W 1WWXA 4G9YA 2FSWA 2QQBA 1HXDA 4XSXF 3JSLA 1KA8A 2IA1A 1NHAA 4BNCA 2VN2A 3T5XA 5E17F 2M45A 5E1WA 2MD5A 1N33H 3KXYT 4I98B 4LJZF 1FBSA 1T0FA 3GFJA 4OIOF 3H20A 3K2ZA 5FLXZ 4L0ZB 2DPDA 3J80Z 2DFIA 3TGNA 5TRDA 3F8NA 1U5TA 4IRIA 4LD5A 4LF6H 2HR3A 2OD5A 3HSRA 2NS0A 4BHPA 2VXZA 3IHUA 4Q4ZF 2STTA 4UUVA 3C18A 3LQRA 1K78A 2HWVA 3JAMZ 2P4WA 5D1OB 1S03G 3BOQA 3I59B 3MZYA 1CGPA 4IPAA 4UVAA 5K5OA 2M30A 2L54A 2KJBA 5DCMB 4HF1A 2Q2TA 4HYEA 4KIFA 3BDDA 2LKPA 1XMQH 1XCVA 3PN1A 3JAMW 1QGPA 4JQFA