4RB1A

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-e. coli fur box
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
VSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb1A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb1A02
3FWEA 2XAJA 4EM1A 1OYYA 3C18A 3KP7A 5K1YA 1QGPA 2QQ9A 3NEUA 3HHGA 1XN7A 1RNLA 3KLNA 2IP2A 4FX4A 2G7HA 2FQ3A 4S05A 1H0MA 1O3QA 1LEAA 4CICA 4I2OA 5HS8A 3IHUA 3EUHA 4OIOF 3L09A 2HKXA 4ETSA 1MZBA 1P4XA 2RNJA 2RV8A 4HX4A 2DFIA 4HW0A 5JI6A 4PZJA 4XLNF 1IF1A 3L2CA 1HXDA 1EH7A 3ZMZA 1VTNC 4ENKA 2CFXA 1FYKA 4OIQF 2QLZA 3GX4X 1FX7A 2FSWA 4HLXA 4LLLA 1BC8C 4P55A 4YIIA 3U1DA 2WV0A 4EGYA 3HTSB 1YW9A 2DI3A 5ICFA 5TJJA 2YR2A 2FBIA 4M74A 4G7ZF 5E1XA 1I6XA 2OU2A 4L18B 4AD9A 2IA1A 4EM0B 3K9TA 5CVJA 4BHBA 2M1BA 3NRVA 3KEOA 3WODF 4CHUA 5LLQA 4R8HA 2P6TA 2FA5A 3IRQA 4AIJA 2BEOA 5FFZA 1OPCA 4BXUA 1K78B 5F1RA 2K02A 3K69A 5ILSA 2ACJA 1BI2A 4LK0F 1FWZA 5DCMB 3GLXA 4M9ZA 3L9FA 3TKYA 2O03A 4Z2YA 1TW2A 4ZZDA 2E7WA 2H09A 1PP7U 2O0YA 5CLSA 1U3EM 1ON2A 4G7HF 5J6XA 1LB2A 4LK1F 4XBFA 1EH8A 1ZGJA 3JTHA 1ZAOA 2F2EA 4I01A 1YW7A 3GF2A 1TTYA 1KU9A 2C6YA 1Z91A 1SFEA 1H9TA 2DW4A 2MH2A 1ZG3A 4PCQA 2Z99A 3IRRA 1QZZA 5DCFA 1KGSA 3E5QA 2K4JA 1L0OC 2EA4A 2JTVA 3GZ5A 3Q9SA 5CJ9A 2P7CB 1FZPB 2K86A 3F8FA 1FT9A 2LDUA 2FMLA 1S29A 2QZ8A 3H92A 3SHFA 4WXCA 3F22A 4RAZA 3WU1B 2ZJ2A 4L5IA 1J2XA 2ELHA 4ESFA 2NYXA 1XGOA 2VC1A 3VODA 1WI9A 2OZ6A 4BHPA 1STZA 4O6JA 2V6CA 1GXPA 3DFGA 3CO7C 1MJAA 3DPLC 3I59A 5ERIA 4KNYA 5DUIA 2MBFA 4IJAA 1U5TA 5E1WA 2Y75A 1XGNA 5D6FA 2L02A 2VODA 4A6DA 5H20A 2BBYA 2G9WA 1Z6RA 2HS5A 3LSTA 1C0WA 5A2QK 2XAHA 2PEXA 2NAZA 4A0XA 1ZREA 5FLXZ 2HOEA 3WE2A 3QP6A 3GO5A 4Q47A 1U2WA 4RB0A 4QLCU 3WG9A 2K27A 1G3TA 3DP7A 2XV4S 3HHHA 2FBKA 3HYIA 2DT5A 4U7DA 1I5ZA 1XCBA 1FOKA 2DQRA 1P92A 4IPAA 3ZMUA 1MDMB 3E97A 3U2RA 2P6SA 3N4MA 1FYMA 1HKTA 2B0LA 1LQ1A 1QO0D 4RGXA 1O7LA 1IRGA 2XUBA 2GQQA 4DQ2A 1TQMA 4O5VA 5FO5A 4G6QA 2Q8KA 1I1GA 1Z05A 4GCVA 3QU6A 4WCGA 2F5FA 1BIAA 1G4DA 2ISYA 1O57A 2JPBA 2JZYA 4NQWA 2Q0OA 3WGIA 1KYWA 1ZN2A 2K7LA 3PQJA 3VOEA 4EV0A 4ZZLA 5CVRA 1FBUA 1BN5A 2YX4A 2AS5F 3HSRA 4H0EA 2RQPA 4P9FA 4A0YA 5ICGA 3WGHA 3I53A 4EM2A 2NRAC 4PGGA 4I7HA 2RKHA 4CXFA 2PLYA 1P4WA 3DV8A 4ENJA 1RI7A 4EVIA 2HDCA 2P8TA 3T8RA 4FT8A 3AAFA 4LMYA 1R23A 4GYIA 4HBLA 1LEBA 4L9NA 4HZFA 3E3VA 1YQAA 4N9IA 3O6BB 1FPQA 2EFNA 4UVAA 5H6QA 1BBYA 5LHGA 3K2ZA 2PQ8A 1NHAA 2IPQX 3GFJA 3I59B 3R0AA 1JE8A 2L3DA 1U5TB 1FLIA 3K1NA 5ED4A 1J75A 3O2PE 4RB3C 5DEQA 1G3SA 3ZMVA 1CGPA 1J9IA 2P5KA 3V4GA 4BH9A 1K7AA 4ON0A 3G73A 2MLKA 1LNWA 3ML6A 5F64A 4CGZA 3VFZA 1T39A 3H3ZA 1R5HA 3QOPA 4XLPF 2IT0A 2IA0A 2O3FA 1YG2A 5LBQA 4ZH4F 3HIFA 3LQQA 4U88A 4RB1A 1P6RA 1J5YA 2E1CA 3K1MA 1XSVA 1L3LA 3R0JA 1HSTA 3TGNA 3FXQA 5LEKA 2CYYA 2VOPA 4D0PA 1P2FA 1IXCA 2E7XA 5ICEA 5D8LB 2STTA 2J5PA 5LEJA 4ZYHA 1R1TA 4MEXF 3RIRA 2ZMEB 3MAJA 1PP8F 1B6AA 2QQBA 4G7OF 3TO9A 1Y0UA 1F1ZA 2ZO4A 1D8KA 1R22A 2RVCA 4HQEA 2FBHA 2OZUA 3H3UA 4P96A 2D45A 3KP2A 4RGSA 4Q5SF 4FX0A 2DU9A 2VBWA 3SZPA 3MEXA 5LGNA 1QPMA 3RYPA 1R58A 1EV7A 2CW0F 2Z3YA 4CZZA 1UHWA 5ILUA 3P9KA 5D8KB 5CVUA 2BE5F 2VC0A 2O6GE 3O3KA 3GYHX 4HX7A 5K5QA 3IC7A 2XAFA 3MCZA 1D5VA 1IN6A 2GWRA 4U0VA 2QM3A 2ETHA 1HW5A 4KFCA 5CVVA 5ILVA 3D5LA 3WTVC 2QQAA 2GXBA 1SD7A 2FMYA 4HX8A 2VT2A 4HV5A 4ESBA 2D1VA 3TOAA 1KA8A 1DDNA 4PGHA 3FZVA 2EFPA 1XCVA 5DD4A 3BPXA 4NHJA 1SMTA 1USSA 4HOBA 3QPTA 2OD5A 3G3ZA 3C7JA 1FYLA 3CO6C 2HZTA 1HW1A 2JT1A 2W84A 1FC3A 5FD6A 2FNPA 2HQRA 1MGTA 2IA2A 1FY7A 4I02A 1E17A 1ZLKA 3ABUA 3HUGA 2LF8A 3M8EA 1O3TA 3WTYC 1YO5C 1KYZA 2RGVA 1BIBA 3ECOA 3KZYA 2P4WA 2ZXJA 2DK8A 1SD5A 1T0FA 2HQNA 3JW4A 2A61A 4AIHA 1AWCA 2EFWA 2X4HA 3DF8A 3P7NA 2IW5A 2HTJA 2BGCA 4FHTA 1XDUA 3S2WA 4BAYA 3DPTA 4L5JA 4L0ZB 3RKWA 4I98B 6PAXA 4KN4X 3EDPA 4EJWA 1S7AA 3WTXC 2GZWA 3R61A 1RIOH 1YW8A 3ULQB 2WTEA 2LKPA 3ABTA 4A5MA 3RPUA 3LAPA 5BMZA 3WTSC 3ZN1A 5JR3A 5L3FA 4OOIA 3BJOA 4DNCA 2XKPA 3LA3A 4HLYA 1BC7C 2Z33A 4UXNA 2YX7A 4AWXB 4ZYGA 3V7RA 4P5OA 3RJPA 4RAYA 3M9AA 4I0AA 1OKRA 1G3YA 1MJBA 4A0ZA 1B59A 1MJ9A 1XSDA 2MC3A 5LRRA 4ZYEA 1IZ1A 4WX9A 3QAHA 1RUNA 2FEZA 4JQFA 4LFUA 3BP8A 2VXZA 2FXAA 2KJCA 4ASNA 5LHHA 4BNCA 3J81Z 1JHHA 3ZPLA 3F6VA 3MWMA 1Z6TA 1SAXA 2HR3A 4EJTA 2V1DA 2GA2A 2YPRA 4MGRA 4B09A 4BQAA 1LJ9A 2A5YB 4Y15A 1KQ8A 3C1DA 1R36A 1BI3A 1HSJA 3M8FA 1H9GA 3CLOA 3BPVA 3ERED 4ZYDA 2VN2A 4CDGA 4UNOA 2XAGA 2FE3A 1D3YA 4CO8A 1XGMA 1PUEE 3LFKA 5HDKA 1YYVA 1WKMA 3WTZA 2YSRA 3TO7A 1SMYF 3IL2A 2KIMA 3MQ0A 4BHCA 1U78A 4MQVA 3RKYA 3KE2A 4S04A 3T5XA 2M45A 1IN7A 4XRFA 2ISZA 3IKTA 3SXYA 1S3JA 2L4MA 2PFBA 2XKOA 4YFKF 3L7WA 1J59A 5FLXK 5D6EA 3IWZA 1LDJA 1D8JA 2ZCWA 4RS8A 1T2KA 1KQ9A 1FBQA 1YS7A 2NNNA 5IT3A 1IN8A 2F5DA 3LQRA 2HFHA 2CG4A 1FP2A 4BYYA 3E6BA 3EYIA 3CTAA 4UVCA 4AIKA 3MFKA 3MZHA 2XAQA 3I54A 1FSEA 1BOAA 3ECHA 5KVRA 4KN7X 1XD7A 2COMA 1I27A 5ICCA 3ZMSA 2X0LA 1B9MA 1ZLJA 1REPC 2ZKZA 2EA2A 3KFWX 2Z5UA 4A2UA 4LG0A 2R3SA 4IRIA 3QP5A 3ZQ7A 2RC4A 3KZZA 1WRJA 4RGRA 3I71A 3KETA 2EV6A 2Q2EA 1R5GA 2Y48A 2WWYA 2ZBKA 3KP5A 2D2WA 1DUXC 1SD4A 3QRFF 2EWNA 4LGWA 4YIFA 1XSXA 1ZHFA 3I0TA 2CQKA 2E1NA 4KA4A 1LDDA 1UFMA 1ZRFA 1W5SA 1T98A 3R4KA 2YU3A 5DDGA 4O3MA 2JRTA 4KT5C 4Y13A 4WXDA 2L01A 4M6YA 3LWFA 4R1HA 4HF0A 2CO5A 1TNSA 2BYVE 4HF2A 4G94A 2QENA 4M71A 2Z9OA 4KDPA 3OV8A 5DV5A 3ROUA 2OBPA 3KEQA 3HRMA 1HKQA 4OMZA 5HDNA 2J5OA 5J8CA 4LJZF 5J8FA 2EB7A 1TNTA 5HOOA 3TDUC 2R7FA 4KUMA 2Y0MA 4KYWA 2FOKA 3CJNA 3EETA 4MTDA 1TBXA 4KIBA 5L3BA 4RB2C 4EJVA 2KJBA 4A6EA 2CSOA 3JSPA 2KIUA 1XDSA 4N0BA 4XSZF 1WWXA 1ZGAA 4TV7A 3FX3A 3K1PA 2OQRA 2A3SA 3BY6A 1V3FA 2H6CA 4MNUA 1BM9A 3W6JB 2XHKA 5DYMA 4WWCA 2P5VA 4EJUA 1B4AA 1ULYA 4N9HA 2OA4A 4M73A 4OU0A 5LGTA 5IT9Z 2FNAA 1R7JA 3I5UA 1S7OA 2KRFA 2A07F 5AIQA 3HOSA 5E8IA 3WU0A 3JAMZ 4OIPF 1FNNA 4QWQA 5K5RA 3TQNA 2VT3A 4UUVA 1IRFA 2W57A 1XMKA 4M9SA 1RUOA 2QUFA 1JGSA 4MHGA 2UZKA 2MA3A 3J80Z 4HA8A 5DUKA 2QBYA 4LD5A 3I58A 5FGMA 4UV9A 3SZTA 1K78A 2NS0A 2K4BA 3BOQA 3F8NA 4EJOA 1GVJA 1AOYA 1FBSA 5AIPA 5LGUA 1Q1HA 4I0BA 5D4RA 2V1UA 1W7PA 4GO1A 2V1XA 2UWMA 2UXXA 3TO6A 3RKXA 4JK1X 3DEUA 3FF5A 3GFIA 5JHUA 5E18F 4A5NA 2ESHA 1IN4A 1OYWA 4OIRF 2DLLA 3RPQA 3RTRA 2EK5A 1KU7A 3CUQC 3BROA 5L3DA 1LDKB 1EH6A 2W25A 4KMUX 3ZN0A 4Q48A 4G9YA 5EEGA 2W24A 4HYEA 2D1HA 2DQLA 1LVAA 1DP7P 5L3GA 2ESNA 3GVAA 3DQVC 1TQIA 1BJAA 1UCRA 1HQCA 4ESJA 1ZARA 4M9XA 5D5UB 1USTA 3FMQA 3ZP5A 3KCCA 2QVOA 1X3UA 2VONA 5FB2A 2G7UA 2DBBA 1J7KA 1U5TC 2VBXA 3E5UA 4WXHA 5HS7A 3ISPA 2M8EA 4OINF 2QYOA 1KU3A 1W4MA 3E6DA 2F5EA 5H6RA 3F23A 2L54A 1P4AA 2JPCA 3WTWC 2CWEA 1IN5A 1IXRC 3WTTC 2DPUA 5CVIA 4GXOA 1IUYA 2O8XA 1T38A 2XVCA 5D5VB 2XRNA 1JXSA 5L3CA 3FM5A 2P7VB 3OOPA 5TRDA 3V7SA 4YFXF 1IW7F 2M5WA 2IVMA 4M6XA 2ZNYA 1QZYA 2A69F 1IXSB 3IWFA 2L4AA 2HTSA 2DPDA 1Z9CA 1OMIA 4HDVA 2VOOA 2EFQA 4G8XA 1ZYRF 2QBYB 5BPDA 1O3SA 4IHSA 3LA7A 3I64A 2O61A 4MTEA 1S8NA 4L9JA 1OYIA 2IJLA 1GHCA 2EV5A 5D5XB 1ON1A 3VB2A 1XMAA 1MDMA 3KLOA 1W7PB 1WQ2A 4OMYA 3RYRA 5FD5A 2H6BA 1FP1D 2EV0A 1KQ0A 1YFHA 3FMRA 3U9GA 5LHIA 2MH9A 3F8MA 5E20A 3B02A 4KMFA 3F3XA 3DKWA 5BOXA 1Z1DA 3HSEA 3JSOA 3WE3A 3E5XA 3FHZA 5KK1A 1UB9A 2FU4A 2HYGD 3HRUA 4EGZA 3J81K 2M30A 1HBXG 3HTUA 3W6KB 1ZH5A 1QQIA 4HQMA 5JFRA 1G3WA 3V7CA 4E70A 4GYGA 4GGGA 3PFIA 3HSFA 4ENMA 5HVQC 2IRFG 3HOTA 1ODDA 4R79A 1TLHB 1YLFA 2JSCA 3HRSA 4KIGA 4LLNA 5AONA 1F5TA 5CYVA 3E6MA 3V8LA 3CUQA 3K0LA 4G6DA 3R6SA 1B9NA 1K6OA 3F8CA 2F5CA 3KP4A 3LA2A 1SD6A 5E8GA 4NB5A 1BI1A 1ONVA 4M72A 5JVTA 1GXQA 5EEHA 3DXJF 4IRGA 1PDNC 2XROA 2P5LC 1O3RA 5FFXA 4U0YA 4P9UA 3GZ6A 2RN7A 4I09A 3MZYA 1U6GA 3FM3A 2PMHA 4LB6B 3D0SA 2GXGA 2A6EF 2A6HF 5E17F 1DPRA 1W7PD 2OQGA 4Y17A 3N97A 5BPIA 1YS6A 2DO7A 5L3EA 3M1EA 2VE9A 2EFOA 2EJRA 4WK8F 2WC2A 1MD0A 1QNTA 2HWVA 3P9IA 2PN6A 2R7DA 1I1SA 5D5WB 2GA1A 1IAWA 2QWWA 5A2QZ 4UVBA 4EMSA 4IVNA 3PQKA 1SFUA 2ZNZA 3BWGA 2CGPA 3HRTA 1RZ4A 5HLGA 3V8KA 3BJ6A 3C3WA 1O7FA 3J7AO 2V9VA 4PDKA 2LF7A 3CDHA 2LNBA 4U0WA 3LAJA 1ZRCA 3EYYA 3GUDA 2XASA 5HDGA 1U8RA 4Q4ZF 1E2XA 3R60A 5BS6A 3REOA 4L9TA 3EQLF 3RDIA 1XGSA 2KIFA 2UXNA 2ZMEA 2VBYA 2VE8A 3V8JA 1CF7A 3ZMDA 3BDDA 4IF4A 4HDUA 1R1VA 4B8XA 1BI0A 4K2EA 1W5TA 1YIOA 4L9VA 2AXLA 2NNYA 1T6SA 4CYDA 3Q9VA 4F7ZA 2FF4A 1OR7A 3E6CC 2BV6A 1TW3A 3WTUC 3F6OA 3GXOA 2STWA 4JBAA 1V4RA 2ADUA 2TDXA 3ZMTA 2KKOA 3FXUA 2OAZA 4MEYF 1SFXA 4UHTA 3FXRA 3SQNA 4HV6A 3CUQB 3F21A 3T0YA 1TQPA 4RGUA 1YTYA 3I4PA 4WF2A 4UV8A 3T8TA 4AVPA 1MKMA 2DAOA 4EQQA 3WGGA 3FMSA 3L00A 3NQOA 5E1ZB 3P9CA 3GWZA 3RI4A 2HKOA 3QPHA 3F72A 3F8BA 2GAUA 2HEOA 3COAC 1JHFA 4LLGF 5IT9K 5BQTA 1G6NA 2PMUA 3T1BA 4ENNA 2HYFA 5DD8A 2DTRA 1DPUA 4HF1A 2M87A 4IRHA 3IKVA 3JAMK 4MQ9F 3BZ6A 3KP3A 3GEZA 5HLIA 4XSXF 2A68F 2PBIA 1ZG5A 3J80K 3ELKA 3TDZC 4YFNF 1QBJA 3TOBA 2MLGA 3SFZA 2GIVA 4L0YB 1R00A 3KP6A 2HGCA 4U7BA 2PI0A 2H94A 2V79A 1B1BA 2XGXA 1HKSA 2DK5A 1XB4A 4A12A 1F9NA 5HS9A 2H27A 2RDPA 5HLHA 1UHMA 4KICA 5F6FA 3GFLA 3QU3A 1K79A 1HW2A 5DCMA 2FRHA 1FSHA 2PJPA 3M7GA 5D4SA 1F4KA 4LG0B 1ZG1A 4LB5A 3CUOA 4IHTA 3VEPA 3Q5FA 1ZRDA 2W85A 1R1UA 1WSUA 5K5OA 3GW2A 1S6LA 4YG2F 1A04A 2ZFWA 2VBZA 2XIGA 2MD5A 3GFMA 4KIFA 2PG4A 2LSOA 3JTGA 1KU2A 5LRSA 1J0RA 1Z7UA 4HAMA 3BJAA 4IXAA 1CF7B 3B73A
chains in the Genus database with same CATH superfamily
5KFQA 3FWEA 1SVLA 2HOSA 3KIOA 3OYEA 4FE4A 4O2AF 2IXSA 3PZPA 2XAJA 4EM1A 1OYYA 3C18A 5FKMA 3IH4A 3JCUC 3KP7A 2QGUA 4HQ6A 2EIKH 9ANTA 1XPXA 4YAKB 2NU8B 4HG2A 1AUVA 2YS9A 5K1YA 4TQRA 4JI0H 3E1SA 1QGPA 4RUAA 1JT0A 2QQ9A 2MFZA 3N42B 2B63J 1I39A 2JWTA 3HGGA 4O4IF 3NEUA 2WA0A 3HHGA 1XN7A 1RNLA 3KLNA 2IP2A 4CCLA 1EYZA 4DR1H 4FX4A 2G7HA 2FQ3A 4S05A 3ZOBA 3OHAA 1H0MA 2EH3A 1O3QA 3KEYA 2WE6A 5JQWA 1LEAA 4EEFG 4CICA 2XGDA 4PDBA 4I2OA 2PN1A 1NTCA 2LH9A 4NNJA 5HS8A 3IHUA 3CC2I 5KFYA 3L2WA 2TRTA 3R5FA 1SAUA 1IV8A 1ITYA 3O8GA 5IY5H 3LL7A 1AKHB 2UUAH 4F52A 3EUHA 4OIOF 4CSWA 3L09A 2HKXA 2JK3A 4ETSA 3PR5B 2CQQA 2DDBA 3KZIC 5EWGA 1MZBA 1DU6A 1P4XA 4ECRA 4XN3A 3FISA 4DZJA 2JUCA 5LL6b 3IH2A 2RNJA 3D1NI 2K5CA 5KT3A 3PW4A 2UUCH 4MV6A 1Z21A 2RV8A 4HX4A 2DFIA 3CMAI 4EFBA 2IS2A 4LIVA 1BJZA 4CZCA 4HW0A 5KFCA 5TGTA 5JI6A 3RUPA 4PZJA 4XLNF 5CAEB 3MWDA 2FP4B 4CC5A 3BLYA 1T8IA 4XORA 1IF1A 4BBRJ 3L2CA 5IYCJ 2C35B 3FXJA 1HXDA 1VQ6I 1EH7A 3K4BA 2Z2SB 3A03A 3ZMZA 1WJFA 1VTNC 5KFLA 4ENKA 4G6TB 1K1SA 2CFXA 2MABA 3SDGA 1FYKA 4OIQF 1Z2OX 2QLZA 4ABZA 4GFBA 3GX4X 2IMWP 1FX7A 4XNFA 2VR1A 2FSWA 2P0WA 4HLXA 4LLLA 2KZVA 3WHCA 2CS3A 2KLOA 5J47A 2E5ZA 4P55A 3DCFA 4YIIA 3U1DA 1BC8C 2QK4A 2V7FA 5C8YF 4ECSA 2WV0A 1X58A 1BXRA 5EDWA 4EGYA 3HTSB 1YW9A 2DI3A 5ICFA 5TJJA 4M3EA 4UUSA 4FS2A 1S9HA 2K9MA 2YR2A 2L9RA 3BABA 2FBIA 3S1QJ 4M74A 4G7ZF 4YHHH 1HNWH 1ZELA 5E1XA 4MFEA 5JUMA 3SI8A 1R5ID 1DGRM 1MIJA 1I6XA 4I50F 2C2RA 4Y52J 5KAIC 4MV1A 4DBQA 2OU2A 4L18B 4R8UA 4AD9A 4UCTA 3H40A 2IA1A 4XZ3B 1G8XA 1Z0XA 4EM0B 4B48A 2SCUB 3K70D 4F4XA 4XONA 4X6AJ 2HOTA 1GSHA 3K9TA 5CVJA 3RGXA 4BHBA 2JQ7A 4CYCB 2ATLA 2XDVA 3PL8A 2JA6J 2H8RA 2M1BA 3NRVA 4A3GG 1I7NA 2E36A 3WO0A 3W3CA 3KEOA 3WODF 4YJ2F 4CHUA 5LLQA 4A93G 4IR9A 4R8HA 2VKDA 3MR5A 3JRFA 2P6TA 2MYSA 2BW3B 2FA5A 3IRQA 4MV3A 2BEOA 4AIJA 5FFZA 4Y8VB 1OPCA 1B72B 1P7JA 2FD5A 4NBQA 4BXUA 2FK2A 1H88C 1K78B 4F4YA 2YS7A 1DQUA 5F1RA 2DTZA 2VLAA 2K02A 1XNRH 2E60A 1PJRA 2XSJC 3K69A 5KG3A 4XN0A 1VQNI 1N33H 5C4XJ 3GTQJ 3I12A 1HDPA 2EBIA 2DDAA 1BI2A 4LK0F 5ILSA 2ACJA 1FWZA 2W6PA 5DCMB 2I8DA 2DN0A 4DUYH 3GLXA 4QTRA 5LD2C 5L1JA 2HQAA 4M9ZA 3VPBA 3L9FA 2F4OB 3TKYA 3J7AY 1OQYA 2O03A 2RF4A 4Z2YA 4YBZB 3S2HJ 1TW2A 2L2OA 3M9NB 5F0FA 4ZZDA 2VI6A 3H4BA 1JTXA 2E7WA 2H09A 1PP7U 4LF8H 3CCLI 1JTYA 2O0YA 5K2MA 4QIWE 5CLSA 1BOBA 2UXBH 2AU0A 3MVPA 3I55I 1MH4A 2RAEA 3H4DA 5CQEA 1ON2A 1U3EM 4G7HF 4ZDOA 3FDSA 3T5HA 5J6XA 1LB2A 2JA6A 2BY3A 2COBA 3ASNH 4LK1F 4BBSG 2FK1A 5GADJ 2FPPB 3OR1C 3H0DA 4DL2A 3MFHA 1A36A 4A3DJ 3FKIG 4ZHQF 5FLMG 1B33N 4XBFA 1EH8A 3OSFA 2GPSA 1ZGJA 2BR0A 4B1RA 3JTHA 1ZAOA 2ME0A 2F2EA 3UFXB 4I01A 1WGXA 1YW7A 3K4NA 3LSGA 5J4VA 4XKVA 3UR3C 3GF2A 1TTYA 4HEA2 1I7LA 1JKJB 1KU9A 4S0HB 3DBRB 3I56I 2C6YA 1KJ9A 3GTQA 5KX5F 2Q1ZB 3X2QH 5GPCA 2RDIA 1PUFA 1Z91A 3NWSA 4J9MA 3B6CA 4EYIB 1SFEA 1CE8A 5FPRA 3Q8SB 5CA1F 1H9TA 2DW4A 4C3HJ 2MH2A 3CD6I 1ZG3A 3LSHA 4BE1A 1RJRA 4PCQA 2Z99A 2XCLA 4F3QA 3IRRA 3S1RJ 3N8DA 2HZDA 1BJTA 1QZZA 1TZLA 4BY7J 5DCFA 3W2AA 3CDLA 1KGSA 2P0AA 1AU7A 1OISA 3E5QA 3H1CA 5M5WJ 1QZEA 4PJLA 5KFXA 3SEQA 1SANA 3BTJA 3J81W 4ED6A 2K4JA 4NC7A 2XC7A 2ALZA 1L0OC 1Z7LA 2EA4A 3OMYA 1YIJI 2OF7A 2R7TA 3JRXA 2FPIB 2JTVA 1BW6A 4MV9A 3GZ5A 3Q9SA 1U0JA 2CZGA 5CJ9A 2M9HA 4B4CA 3BG3A 2P7CB 5C4JJ 1FZPB 3L2PA 3OWTA 2K86A 3BG6A 4BXFA 2IGMA 3F8FA 4E7LA 2BQUA 2R8KA 5EGOB 5EEAA 1FT9A 2LDUA 2NVTJ 4IOAF 2FMLA 1S29A 1VQ8I 2QZ8A 4DJAA 4DR6H 3S3OA 2DA1A 3H92A 3SDBA 2QA4I 2VOBA 3SHFA 3RZDJ 3GTMJ 3B6AA 3DU6A 1S97A 1HR0H 3CZ6A 4WXCA 4X65H 1G2HA 1ZR4A 4Y7NJ 2VQFH 2ZJTA 3F22A 4RAZA 5KKNB 2XCPA 1MMAA 1S0MA 2JA7J 3WU1B 2PJRA 2ZJ2A 4PJMA 2H1KA 4L5IA 2VUMG 4E7HA 1J2XA 5H2FC 2UVUA 2ELHA 3CMMA 4ESFA 3C2BA 2NYXA 1XGOA 4ECXA 3SJMA 2VC1A 4O3PA 3VODA 1WI9A 1QHHD 2X0SA 2WAFA 3GTPJ 2R7RA 1XTAA 2OZ6A 2JN6A 4BHPA 3FK6A 2UUZA 5HV6A 3JSNA 1STZA 4O6JA 4RAGA 3HOVJ 2VB6A 3BCAA 2V6CA 4RAFA 4XR6A 1GXPA 2O5RA 5EZHA 3DFGA 3CO7C 3H0GJ 1E4EA 3Q2OA 2FK3A 1MJAA 2YU9J 4LF6H 3DPLC 2JEIA 3I59A 4JYAH 2DCEA 5DQIA 5ERIA 1X4OA 2MBFA 2BOLA 5DUIA 4IJAA 2WBMA 4KNYA 3JRWA 1U5TA 5E1WA 1APLC 2DOAA 2VQGA 4YB8B 4ZTJA 2Y75A 3GTGJ 1XGNA 5D6FA 4A3MG 1TWCJ 2Q2UA 2L02A 2VODA 2VKHA 4A6DA 2WY8Q 5H20A 2BBYA 2EQRA 2G9WA 1Z6RA 3HOWJ 4FU0A 4QWEA 4LSXA 2HS5A 5LYJF 2VPQA 3C2HA 3GTMA 3LSTA 4R8UB 1C0WA 5A2QK 3CCRI 1FIPA 2XAHA 3KALA 1FMWA 4DV5H 2PEXA 2JA7A 2NAZA 2FJZA 4YEJA 3LWBA 5FLXW 4A0XA 3BR5A 1ZREA 5FLXZ 1HCRA 2R7KA 2W6QA 2WAQE 1W0TA 2HOEA 3WE2A 2AGQA 2W00A 1YX3A 4O3RA 2KQRA 3GV5B 1RESA 2XSDC 4XYLB 3GTKJ 3K7AJ 2Y2ZA 2BQRA 3E5NA 1IDYA 1UC9A 3GTPA 4WBNF 3QP6A 3GO5A 2O7OA 4XLEA 3G8CA 1MBHA 1JKRC 4F91B 1KJ8A 1R6RA 2J6TA 4Q47A 1U2WA 2PBZA 4C9YA 3H0GA 1V51A 4PJJA 2DJNA 3PIOF 4RB0A 4QLCU 3WG9A 2K27A 1G3TA 3DP7A 2W6ZA 3HOYG 2XV4S 2NVYJ 1KC7A 3HHHA 2R7UA 2FBKA 3GTGA 2F48A 5KG5A 1TWCA 4I76A 3HYIA 1A5JA 2DT5A 4EEQA 1XMOH 2Y0SE 2A6TA 4U7DA 5B1BH 2M7BA 1I5ZA 1XCBA 1FOKA 2DQRA 3CP2A 4E7KA 1P92A 4IPAA 2AGOA 3UKGA 5M5XJ 1VQ7I 3PVXA 5J2UF 3ZMUA 2R7ZG 1MDMB 3E97A 5J3LA 1NH3A 4FM9A 1QA6A 3U2RA 1X3WB 2P6SA 3N4MA 4I4TF 1FYMA 1HKTA 2M4KA 4UCOA 2B0LA 3FBIB 4ME6A 2JA5G 1WH5A 1LQ1A 1W36D 1QO0D 5KNLA 4J00A 1U9OA 3JRHA 4RGXA 5KFDA 4YP3A 1O7LA 4X1EA 1IRGA 2L7ZA 2XUBA 1XS9A 2GQQA 4DQ2A 3TL4X 2E2IJ 1TQMA 4O5VA 5FO5A 3RKQA 4G6QA 2Q8KA 5IYDJ 1I1GA 1Z05A 2E2HJ 4GCVA 3HOUJ 4ED2A 4HNUA 5L1LA 3QU6A 1X2MA 4YIRX 1JJ8C 4WCGA 3S1MJ 1L2ZA 5EYRA 4FISA 2F5FA 1FVIA 1BIAA 1G4DA 2ISYA 4V2FA 3ZRGA 1O57A 4F4ZA 4LFBH 2JPBA 2JZYA 3PSIA 3HXLA 4NQWA 4J19A 3G4SI 2Q0OA 3CVZA 5C5JA 2W9AA 3WGIA 3GV7B 2M4GA 4KT6A 4AYBN 3D5SC 2R5YA 1M6VA 4BE0A 1N75A 5IOYA 1KYWA 1ZN2A 2K7LA 3PQJA 2BZTA 3VOEA 1PUFB 4EV0A 2ZJPF 3OYNA 2PMZE 3RQ4A 2CQYA 3FXOA 4ZZLA 3GTJJ 5CVRA 1VF9A 1Z77A 1GSAA 1FBUA 1R71A 1BN5A 1U9NA 2HHHH 3ZQQA 2YX4A 2AS5F 1HA8A 2R92G 3HSRA 5IOZA 1G59A 4JV1A 3I3LA 2L7KA 3RAXA 1W5CC 4H0EA 5C3EJ 4DV7H 3FKJA 2WB1N 2W7PA 5KG4A 2RQPA 2Y9YA 1R9TJ 3R5HA 4P9FA 5BNGA 4A0YA 5ICGA 3PO3G 3WGHA 3VYSB 3I53A 4EM2A 2NRAC 4C5BA 4DZPA 4PGGA 2W6MA 2BY1A 2ZSHB 5BR8H 1EKEA 2QSHX 2E2IA 3HB9A 4I7HA 4B47A 4ZOLF 2RKHA 4CXFA 2PLYA 2E2HA 1Y39A 3AL0B 1DV2A 2V4RA 1VQLI 2V9PA 2F4VH 1P4WA 3Q3SA 3DV8A 2VJIA 4AYBA 1ZGWA 4UUTA 1YRNB 1W1WE 1LUJB 2V26A 4ENJA 1RI7A 4EVIA 4ZI7F 2YZGA 2XF5A 2HDCA 2HJWA 1S7EA 2ID6A 2P8TA 3T8RA 4FT8A 3AAFA 4LMYA 3H9GA 3HDDA 2ASJA 2VQCA 1R23A 5D1OA 4U6PA 3W2WA 1X2NA 4GYIA 3JREA 4EGQA 4HBLA 1ZR2A 1LEBA 1PX2A 3OYAA 4C3JJ 2R7SA 2PJRB 2LKSA 4L9NA 4ED0A 4A3IG 4HZFA 3GTJA 5KFMA 4NXNH 3PO2J 2WB1A 3E3VA 1YQAA 5FKNA 4XLCA 4N9IA 5IP7G 2JEGA 3O6BB 4XOTA 4GDFA 2L5QA 2XAUA 3BZKA 1V9PA 1FPQA 2EFNA 3H5RA 1C30A 3MR2A 3M9MB 5T14A 2WTFA 3HGYA 4UVAA 5H6QA 1Z2NX 3VSKA 2KSWA 1BBYA 1M0WA 3CJTB 4UCRA 5LHGA 1EZ1A 3GIPA 3IN5A 1D1BA 3ORRA 4FQGA 3K2ZA 2AO9A 1B04A 3PW2A 3TIGA 2A5WA 3OTOH 2PQ8A 1NHAA 2IPQX 4JI8H 4CCOA 1T0FC 2XGPA 3GFJA 5KFPA 3I59B 3R0AA 1SC7A 1JE8A 2OJED 2L3DA 4XLFA 1M1EB 1KJQA 3R23A 3TIIA 1U5TB 4BL0B 4AM3A 1FLIA 3KYCB 1JIHA 4UCSA 2LREA 1UG2A 3RGZA 3K1NA 3NARA 3OS1A 3QZ8A 2EILH 5ED4A 3O2PE 1J75A 3V6KA 4RB3C 5EOYA 3JRBA 2RQQA 1ETQA 1JJ6C 2K85A 4YJ3F 4A3CG 5DEQA 1XC5A 3FXKA 1G3SA 3ZMVA 1CGPA 2GM4A 3HG9A 2P5KA 1IV6A 1IG7A 1J9IA 5GONF 5IT9W 3V4GA 1GV2A 3JR9A 3CC4I 2V59A 4BH9A 1K7AA 2V58A 3S8PA 5KG7A 3PJRA 3KHLA 1IC8A 4Y3OA 2R7OA 3S32A 4ON0A 3CLQA 4HSRA 2MW8A 4B3MH 2HQ5A 3G73A 1E3PA 1ORKA 2BHZA 3JAMW 2MLKA 1FEXA 3OSNA 3KYDB 4JI4H 1LNWA 1TL8A 3ML6A 4TV8F 3ESWB 1ZK8A 3G1OA 4A3FG 5F64A 4A3LJ 4E7IA 4CGZA 4EBEA 3VFZA 1T39A 5KFOA 4AC0A 3Q0VA 3H3ZA 4JI5H 1R5HA 3KHHA 3QOPA 4XLPF 2IT0A 2OPTA 2IA0A 4YR0A 3J80W 2O3FA 1YG2A 5LBQA 4ZH4F 3TBIA 3FHNA 1T94A 3HIFA 3LQQA 4U88A 2ZJRF 3KHGA 3DBHB 5IP9J 4RB1A 1P6RA 2R8HA 3FXMA 3H3VK 1WCMG 3OYFA 4BY1J 2LP0A 1J5YA 2E1CA 4BXXG 5BPHA 3K1MA 1OCCH 4RMNA 2EIMH 2JA8G 1QHGA 5KFUA 2YZNA 1XSVA 1L3LA 1B8IA 3R0JA 1HSTA 2R7MA 5KFGA 1WH7A 3TGNA 3FXQA 5LEKA 2CYYA 2W7NA 2VOPA 2JMWA 4NDLA 1RC9A 2HU9A 1P2FA 4D0PA 3CMEI 3N41B 1IXCA 4J9SA 2E7XA 1ETVA 2K3PA 5ICEA 3CP8A 2CUFA 5D8LB 4X66H 2STTA 2J5PA 2L9NA 2M0MA 5LEJA 3V4ZA 2GBYA 4ZYHA 4RNMA 1R1TA 4MEXF 3RIRA 4A3KG 4R7RA 2ZMEB 4PJNA 3MAJA 3W6VA 5JVLA 2R7WA 1PP8F 1B6AA 3PM1A 4O4HF 2BXZA 1WHUA 2QQBA 4G7OF 3TO9A 1Y0UA 1F1ZA 2ZO4A 1TWAA 2C2EA 3GLLA 1D8KA 1R4MB 1T56A 1QU3A 1R22A 1MBJA 2RVCA 4HQEA 2FB9A 2HPMA 5FKOA 2FBHA 2OZUA 2YUSA 3H3UA 4P96A 2R5YB 4IRDA 2D45A 4LITA 2RDJA 3KP2A 2W9CA 4RGSA 1ERDA 4LOCA 2ELKA 4J0MA 4RLQA 2J9GA 4Q5SF 4FX0A 5KFTA 4GLXA 2DU9A 2VBWA 3SZPA 4JYKA 3MEXA 2VKVA 5LGNA 2LMDA 1QPMA 3RYPA 1UHSA 3K4MA 1R58A 1EV7A 2CW0F 3D5RC 2W4SA 5EZYF 2Z3YA 4FTHA 2FLPA 4CZZA 2HPIA 3S3MA 2FX0A 1UHWA 5C1PA 2MD0A 2Y9ZA 5ILUA 3P9KA 5D8KB 2IS4A 1EHIA 3PUFA 5CVUA 2BE5F 2VC0A 5FKKA 1NG7A 2O6GE 3O3KA 5KFKA 4BJ5C 3GYHX 3JRCA 5KT7A 2XCAA 4HX7A 4JI3H 2OH2A 3ZGKA 4PK4A 5K5QA 1A6IA 2XAFA 3IC7A 4IO9F 1RYSA 1OCZH 4XRSA 3MCZA 4O3OA 1D5VA 1VQ5I 1IN6A 3CCEI 3BA8A 3LP8A 4IX7A 3HJEA 2I5UA 1V5FA 2LC2A 2GWRA 4U0VA 2QM3A 2ETHA 1BW5A 3HPGA 1HW5A 2YW2A 4IWXA 3WHBA 1A6QA 5TISC 2DYRH 4KFCA 1ETXA 5CVVA 5IWAH 3A1YA 5ILVA 2UVRA 3D5LA 3J7YJ 3ETJA 2ZXWH 3ZCOA 2JUGA 2X48A 3OS2A 5D1OB 3WTVC 4IZZA 1VQKI 4IHXA 2X1CA 1N32H 2QQAA 3S3NA 1SD7A 2GXBA 1M0TA 2FMYA 3BC8A 4HX8A 2VT2A 4UCVA 2VQEH 2RGRA 4HV5A 1D1AA 1V55H 4ESBA 2LY1A 2R85A 2ZM6H 2V6EA 4I55F 1Z67A 1E3OC 3BQ0A 2DA2A 2DA6A 2D1VA 2QKLB 4KITB 1ZQ3P 1Y1VJ 3TOAA 3QZ7A 1KA8A 2ELJA 1DDNA 2B63A 1VKZA 4PGHA 2E1MB 3FZVA 4LFAH 2AXTC 2JEJA 2EFPA 4BEHA 4IHJF 1XCVA 5DD4A 3BPXA 2UUBH 1QPIA 3K4CA 1Y1WJ 1E4GT 3RB4A 4NHJA 2I87A 1D1CA 2FMAA 1SMTA 3CCYA 4RUCA 1USSA 4BS9A 4A3GJ 3Q0UA 4HOBA 4MV7A 3QPTA 2OD5A 2LY9A 1QRYA 3G3ZA 3RFCA 1RK5A 1SVOA 3C7JA 1FYLA 3VWBA 3WG7H 2CV1A 3CO6C 4O2BF 2HZTA 1HW1A 2JT1A 2VPRA 1JI8A 2W84A 4GC7A 1FC3A 3K3PA 2AGPA 4HR7A 5FD6A 4MV8A 2IA6A 3CCJI 2FNPA 1I3AA 1KONA 5KFVA 4LF9H 3QPLA 1ETYA 2HQRA 1MGTA 2IA2A 1FY7A 4XLAA 4I02A 3VYUB 1E17A 4J9PA 2IGKA 1ZLKA 4IZOA 2M2EA 3ABUA 5DM7F 2DT7B 4ECYA 4CCMA 3OIOA 2NUAB 1WJDA 5KAFC 3HUGA 2LF8A 3MKYB 5EF6A 4QSHA 1YJNI 3M8EA 1FJLA 1O3TA 1BA5A 1FJGH 3WTYC 4C3IJ 1YO5C 1KYZA 5EJCA 2RGVA 1O4XA 5FLVA 1B6SA 1Y1VA 1BIBA 3ECOA 4RA2A 3ZQFA 3KZYA 1RJQA 5DG9A 4BBRG 2P4WA 4B44A 1Y14B 2ZXJA 1IRZA 2DK8A 3GMEA 5IYCG 3QPSA 1JXLA 1WZ2A 5BMVF 1SD5A 2Q2TA 1T0FA 2HQNA 1K4SA 1HNZH 1Y1WA 3JW4A 2A61A 4AIHA 2ASDA 1AWCA 2EFWA 2X4HA 3DF8A 3P7NA 2IW5A 3S16J 2HTJA 2BGCA 2CU7A 2I8CA 4FHTA 3M9OB 3I4NG 1XDUA 4QJFA 2M3AA 3S2WA 4BAYA 3FKIJ 3GBGA 4J9NA 3L2VA 2QSFX 4IHWA 5FLMJ 3DPTA 4L5JA 4PSXA 4L0ZB 3RCOA 4XRMA 3PSFA 4JV0A 5BPFA 3GILA 4DV1H 3PNTA 4I98B 3RKWA 4FCYA 3Q8QB 4J9KA 6PAXA 3G1LA 4KN4X 2DFHA 3EDPA 2R0QC 3S17J 1ULZA 4EJWA 3ETHA 2GIZA 2VIXA 2NVUB 4ECQA 4DR4H 2E5LH 1S7AA 1NG6A 1UNNC 2HGSA 3WTXC 4MA0A 4EYHB 1F43A 3K3VA 4TUYF 2GZWA 1Y8QB 5C44J 3FXLA 2VQLA 3R61A 1B8IB 1RIOH 3OUZA 1UAAA 1YW8A 3ULQB 1ETOA 4G3IA 2NVQJ 2WTEA 2LKPA 4MA5A 3ABTA 3IAS2 3M1CA 4BJTA 5E3MA 4ZQIA 2DA5A 1VQ9I 2ZDQA 4A5MA 3ORQA 3RPUA 2XB0X 3BR1A 4XKBA 3LAPA 4YAJB 2JSPA 5BMZA 3WTSC 4AVZA 3ZN1A 1Y8RB 5JR3A 3U1KA 5L3FA 1MBGA 1RKWA 3G6YA 3RZOJ 4ECWA 4OOIA 1T95A 2JRMA 3BJOA 1JUSA 5EG0A 5DG7A 2UVVA 4KJZA 2JA6G 4DNCA 2XKPA 2F6CA 3HBLA 3LA3A 2KISA 3QYBA 4LIUA 5FKLA 4HLYA 1BC7C 4JI1H 2Z33A 1HF0A 3ASOH 4UXNA 2YX7A 4AWXB 4ZYGA 1KZHA 3V7RA 3CF5F 4P5OA 1HLVA 3RJPA 4IKFA 4RAYA 4QPQA 3M9AA 3N05A 2M05A 4I0AA 1EUDB 1OKRA 3F9KA 1G3YA 1MJBA 5B3SH 4A0ZA 1B59A 3W2VA 1MJ9A 1XSDA 2MC3A 5LRRA 1VQPI 1RYRA 4LFCH 4ZYEA 5C4XG 3F0CA 4BJ6C 1H89C 2UXCH 1IZ1A 1N25A 2R7VA 2ID3A 4WX9A 3GIJA 4A3JJ 3QAHA 1RUNA 3EPIA 2FEZA 4JQFA 4LFUA 1LKXA 3BP8A 2V9KA 2VXZA 2G0EA 5FROA 2FXAA 2PVPA 2KJCA 3I4MJ 4ASNA 1MW7A 1D5YA 5EZGA 5LHHA 1K4TA 5F1JA 4BNCA 3T5JA 3HZJA 3J81Z 1AHDP 1JHHA 1P7IA 3ZPLA 1S5LC 3HOXJ 3F6VA 3L4KA 3MWMA 4RZQA 3CC7I 2X9DA 1Z6TA 3KX2A 3OYLA 1SAXA 3OYIA 2HR3A 3LMMA 4EJTA 5JVDF 3C2GA 2V1DA 3BTCA 3EUKL 3QQAA 2GA2A 2YPRA 4MGRA 4B09A 5E3OA 1LJ9A 2A5YB 2JA2A 4BQAA 2KMUA 3NGDA 2VJJA 4Y15A 1KQ8A 3C1DA 1R36A 3H20A 4A3DG 3GIDA 1GVDA 1BI3A 1HSJA 3MZ8A 4NC6A 2CV2A 3GIIA 3CESA 3ZQGA 3M8FA 1S0NA 1H9GA 2X51A 3CLOA 3KYLA 4OX9H 3BPVA 3ERED 2VKEA 2CRGA 4BU2A 3AG4H 1BNCA 5KFWA 4ZYDA 5B5EC 5E3LA 2VN2A 4CDGA 4UNOA 4A3BJ 5LXTF 2XAGA 5HLTA 3GIKA 2FOWA 4XYMB 2R8IA 2R7XA 4DV2H 2CJJA 2YRXA 2FE3A 4F93B 1D3YA 2I80A 4CO8A 1X1BA 4BEHB 1XGMA 3JSLA 1S0OA 5GTIC 1PUEE 2WYOA 1ETWA 3ABLH 3LFKA 4B43A 3MJFA 2IEKA 5HDKA 3CF2A 1YYVA 3AG2H 1WKMA 3WTZA 2YSRA 3TO7A 1SMYF 1J5EH 3T1HH 2XC9A 4MFDA 4BY7G 3IL2A 2KDOA 4ED3A 3KTMA 3T5KA 2KIMA 3FK7A 3MQ0A 1GSOA 5IP6A 1WJAA 4BHCA 1U78A 2YRWA 4MQVA 3RKYA 4ECZA 3KE2A 4LG3A 1UG0A 1S72I 4UUSB 4S04A 3T5XA 3N43B 2M45A 4DV6H 2VA2A 1IN7A 4XRFA 3DTIA 4W1UA 2FLNA 2L7FP 2KRHA 4E7JA 4X0GA 2ISZA 3KXYT 5HNFA 3IKTA 3SXYA 5CA0F 4K0KH 1S3JA 2L4MA 2PFBA 2XKOA 4YFKF 3L7WA 3HUGB 3CDIA 3BR6A 2DJIA 5CQGA 1J59A 2W6NA 2YYAA 4DV0H 2QKMB 4BUPA 5FLXK 4W97A 5D6EA 2HI3A 3IWZA 3OY9A 1JKPC 3M3YJ 2WAQN 3ZQCA 2QF7A 3BT9A 1NK3P 2DPJA 1LDJA 3QYFA 1D8JA 4IQJA 2YL2A 2ZCWA 4RS8A 2R7ZJ 3PW5A 5K7FA 1T2KA 4ZDLA 1KQ9A 2JA7G 3SE7A 1FBQA 1YS7A 2K40A 2NNNA 5IT3A 1IN8A 2F5DA 4CUGA 1Y0NA 3LQRA 1W96A 3RSNA 2HFHA 2CG4A 4JX6A 4CCKA 5FRNA 4DYCA 3RB6A 1FP2A 2KFDA 3V6JA 3CQZJ 4I6ZA 4DIQA 5A2QW 2V5AA 4BYYA 3LFUA 5JHFA 2YU9A 2M34A 3E6BA 3ABMH 4UB8C 3EYIA 3HOVG 3CTAA 4UVCA 4XL9A 3MKLA 4AIKA 3MFKA 1W0UA 1JT6A 1WFXA 5J1YA 3H0GG 2Y0SN 3MZHA 1XNQH 1KJJA 2XAQA 2LRDA 1TWAJ 3I54A 3LSKA 2QEXI 1FSEA 2E5NA 1HNXH 1BOAA 3DU5A 3ECHA 2W48A 5KVRA 2W70A 2L0KA 2CUEA 4KN7X 1OFCX 2WAQA 5HBRB 4APMA 1RR7A 3RAQA 2AQFA 1XD7A 2CQNA 1DIKA 2COMA 3HOZJ 1SCUB 1I27A 5ICCA 3OR2C 3OYHA 3JRAA 4AU7A 3ZMSA 2HYJA 4BQQA 3MN2A 2X0LA 1B9MA 1JX4A 3MR3A 2IP4A 1ENHA 3BG5A 5FJ8J 1ZLJA 4L5EA 1REPC 2ZKZA 2EA2A 5M5YJ 3KFWX 2Z5UA 3GTKA 4A2UA 4LG0A 4IR1A 2R7LA 4RU9A 4QWDA 5KCMA 2R3SA 4OAZA 1M7JA 4IRIA 3HPHA 3QP5A 3ZQ7A 2R86A 1ZQ7A 2VA3A 2DA7A 3CQZA 2R7NA 3V4SA 2RC4A 5JVGF 2DODA 3LSMA 5KT6A 2F5VA 3KZZA 2Y0SA 1WRJA 3DLLF 3WNZA 4RGRA 1IGNA 3I71A 5B66C 5M3MJ 3KETA 5DGBA 4GKJH 2EV6A 2Q2EA 1R5GA 2PMZN 2ME6A 2Y48A 1MSEC 2R93J 5D1PA 4I99C 2DFEA 1FTZA 2NVYA 2WWYA 4AIDA 2ZBKA 3KP5A 4J01A 2D2WA 2DT6A 1SD4A 2E71A 2EWNA 2NS7A 4CCJA 3QRFF 1DUXC 4YY3H 4LGWA 4YIFA 1XSXA 1ZHFA 1MBFA 3I0TA 3ZXSA 4L1KA 2CQKA 2E1NA 2HXIA 2R7QA 4KA4A 2H1LA 2XB5A 5JH7F 1RPWA 1WJEA 1LDDA 1UFMA 1X1PA 3HKZN 3BG7A 4Z6YA 1ZRFA 4O3NA 3CCSI 3K4KA 1W5SA 2M0CA 4C2UA 1T98A 4F50A 3R4KA 2YU3A 2W7OA 4EEYA 4CCNA 5DDGA 4O3MA 4AYBE 2JRTA 4KT5C 4Y13A 4WXDA 2L01A 3RV3A 3GTLJ 4M6YA 1XMXA 1W36C 2DMPA 2LR8A 3LWFA 4R1HA 4HF0A 2CO5A 5L9XA 4KHPH 1TNSA 2BYVE 4HF2A 4G94A 1YI2I 2QENA 4M71A 2Z9OA 2NXNB 4ED8A 1N78A 5IYBJ 4KDPA 2PMZA 3OV8A 5IYDG 5F0HA 3HOUG 5IYZF 5DV5A 1Z2PX 3ROUA 2UXDH 2OBPA 3KEQA 5KT4A 1LPQA 2R93A 1ETKA 3HRMA 1UJ8A 1HKQA 4D7NA 4OMZA 5HDNA 2IS1A 4MAMA 1DP3A 2W1OA 4D5FA 3O8HA 2J5OA 2OCCH 3LSJA 4U87A 5J8CA 2VJ5A 4LJZF 4GC6A 4IEJA 5J8FA 2EB7A 1TNTA 2JVHA 2PX9A 3HKZA 1I6UA 5HOOA 3TDUC 4C2TA 1VBHA 4E4HA 2R7FA 2OUMA 4KUMA 3OIPA 3S2DJ 2EINH 2V9WA 2Y0MA 4KYWA 1S03G 2FOKA 2NS8A 3CJNA 3EETA 5H80A 4MTDA 3T1YH 1GLNA 4IWYA 1TBXA 4KIBA 1N36H 2DXIA 1JGGA 4A69C 5L3BA 4RB2C 4B3AA 3G6EI 5C3EG 2FLLA 5B1AH 4EJVA 2KJBA 4QPOA 4A6EA 1E4EB 4Y4RA 2CSOA 2DA3A 3JSPA 2Z1DA 2KIUA 1XDSA 3RPUD 4N0BA 2JEFA 3K6GA 4XSZF 1WWXA 1OCOH 3PR4A 1ZGAA 2H8WA 4B3TH 4FE7A 4TV7A 1PYVA 3FX3A 4ECVA 3K1PA 4UFZA 2OQRA 2RREA 2ZFUA 3RB0A 2A3SA 3BY6A 4PSWA 4EG0A 1V3FA 2GPWA 2H6CA 4MNUA 1BM9A 2M8GX 3PNVA 2XHKA 5DYMA 3W6JB 2P5VA 4WWCA 3HL2A 4EJUA 1B4AA 4PJ0C 1ULYA 4N9HA 2OA4A 4C30A 1BL0A 4A2BA 4M73A 4OU0A 3BQYA 4A3EJ 5LGTA 5KFNA 4EBDA 2WDTA 3V6HA 1R49A 5IT9Z 5JLXA 3EPGA 1GYFA 2IGOA 1Q1VA 5E79C 2FNAA 1R7JA 1WI3A 3I5UA 4PUSA 4F4WA 4FASD 5I47A 1S7OA 1WJBA 2EZHA 2KRFA 3RBDA 2A07F 1A31A 5DTDA 1ZHQA 2FKLA 2LFBA 4O3QA 2R5ZA 5AIQA 3HOSA 3PO2G 5E8IA 3WU0A 3JAMZ 4OIPF 1FNNA 2QCOA 4QWQA 3G2BA 1XG1A 3TQNA 5K5RA 3L1PA 2VT3A 5KFJA 4NC8A 4HYKA 4D9JA 1IRFA 4UUVA 1AA7A 2W57A 4XM3A 1T36A 2YZMA 1XMKA 4NUBA 4M7EA 4M9SA 1RUOA 2QUFA 3IG0A 1JGSA 4MHGA 2UZKA 2NOGA 2MA3A 2R8JA 3J80Z 4RDUA 4ECTA 4HA8A 5K7HA 5DUKA 3AYHB 4P1WA 3A0BC 3CJQB 2KPMA 2N8GA 2QBYA 4TQSA 4IQ4A 4LD5A 1HOMA 3K2AA 3BA9A 3RTXA 1MNEA 5DM6F 3I58A 2UVWA 5FGMA 2HNHA 1VFCA 4UV9A 2LBFA 3SZTA 1K78A 2ZJQF 4II3A 2X6YA 2NS0A 1EA3A 4IL6C 1MH3A 2K4BA 3BOQA 1JDBB 2GLTA 2LLKA 3F8NA 4EJOA 1GLVA 3BCBA 1JDEA 3LOCA 1GVJA 2AHQA 3EPZA 1AOYA 1OJLA 1FBSA 4JP0A 3H35A 5EWEA 2O9LA 4DR3H 4JI2H 5AIPA 1X3ZB 3CCUI 5LGUA 1Q1HA 1NK2P 4I0BA 3G6VA 5D4RA 5IPAA 4DR2H 3NWTA 5C1OA 2NU7B 2V1UA 5GAEJ 1W7PA 4NQWB 3Q8PB 4GO1A 3WO1A 1CQIB 2V1XA 1CQTA 3SYTA 2UWMA 2UXXA 3TO6A 1VBGA 4A3LG 4EGJA 2VL8A 5F27A 5LOVF 3UQ8A 4DL7A 2RNGA 3RKXA 2KP6A 1SEIA 4JK1X 4IOCF 2VPSA 3DEUA 4LF5H 5M3FJ 3FF5A 3GFIA 2L9VA 2X6OA 2XRLA 2J6SA 4JOMA 5JHUA 2YCHA 4LH7A 4JV2A 5E18F 4A5NA 5IP9G 2ESHA 2QQ8A 1K1QA 4IRKA 3H5NA 3VDXA 1IN4A 1OYWA 3N6XA 5F0CA 5F9NA 1P8LA 4OIRF 2DLLA 3RPQA 4V2GA 1TC3C 3AL0C 5FJ8G 3RTRA 2EK5A 4EFEA 1KU7A 1PK8A 4BY1G 3CUQC 2X6WA 1T08B 3N40P 4J9OA 1X9NA 3BROA 3AG3H 2BVMA 5DGAA 5L3DA 1LDKB 1EH6A 2W25A 4KMUX 1R9TA 4MO7A 4Q48A 3ZN0A 5GAGJ 2W71A 4DR7H 4G9YA 5EEGA 3CJRB 2F4IA 3HM5A 3L2RA 3A2KA 2OWOA 3PUBA 5L1IA 2JVGA 2W24A 2D1HA 2DMNA 2DQLA 4HYEA 5J2TF 3BJYA 1IJWC 1LVAA 5F08A 3WU2C 1DP7P 5L3GA 2KHMA 2ESNA 1E4FT 3RBEA 2E19A 4XRSG 1WPKA 1EJ9A 2L9SA 3BQZA 5KT5A 3PW7A 3GVAA 4Q44A 1IRXA 3MWEA 2OTJI 4RNNA 3DQVC 1TQIA 4F55A 1BJAA 2HDDA 1UCRA 2E35A 4XQFA 5LFAA 1HQCA 1ZARA 3MKZA 4ESJA 4M9XA 5D5UB 1USTA 2ZDHA 1JLLB 2R8GA 2C28A 3FMQA 1O75A 3ZP5A 2NU6B 1Y6IA 3KCCA 1JUMA 1OLTA 1QVUA 2ECCA 2QVOA 1T33A 1KJIA 1X3UA 3GIMA 2VONA 5FB2A 5EGOA 2QYZA 2G7UA 2LTPA 3EUAA 5DG8A 1YX5A 2LK2A 2DBBA 1J7KA 1U5TC 2VBXA 3E5UA 4WXHA 3KPHA 4ZYAA 4E6KG 2B63G 5HS7A 4YRVA 2BXYA 2VUGA 2DYSH 3ISPA 2M8EA 3OL3A 4OINF 1VS0A 4HPQA 1A9XA 1LFUP 2IAIA 2HVSA 2XD4A 2QYOA 2K9QA 1KU3A 2LY2A 4C2MJ 4E7ZA 1W4MA 1A0IA 1IBKH 3E6DA 3J7AK 2F5EA 5H6RA 4A93J 3F23A 3P5JA 2L54A 1P4AA 2JPCA 3RQIA 2CWEA 1IN5A 1IXRC 3WTWC 3WTTC 2DPUA 1POGA 3C0FB 3T5LA 2E1OA 5CVIA 1SFKA 2X85A 3OSPA 4GXOA 1IUYA 1JKQC 3ONQA 4M9UA 2O8XA 1VI0A 3I4NJ 2XPUA 1T38A 3OYKA 3K4JA 1RR8C 2ASLA 5HODA 5J4YA 2XVCA 4DBRA 1SYXB 5D5VB 1Y56A 2XRNA 4DL5A 1I94H 2ZXHA 1JXSA 5DQHA 4NLGA 5L3CA 3FM5A 3LSIA 3M4IA 1D0ZA 1R4NB 2P7VB 5KFEA 1GUUA 3OOPA 2UV1A 2P81A 3VPDA 5LMNH 4BQNA 2FUG2 1LE8A 3H9QA 3JZIA 4XICA 2W9BA 2NVXJ 1TT5B 1WVRA 2VQHA 3NAUA 5TRDA 1RJPA 4JUZA 3V7SA 2R5ZB 5KFAA 4FBTA 3IUOA 1Y1VG 4YFXF 3TP0A 3MKWB 2MGQA 1IW7F 3OS0A 4J9QA 2IS6A 2M5WA 3G71I 2IVMA 3A0HC 4M6XA 1UZCA 3S93A 3DTKA 2ZNYA 1QZYA 1IOVA 4AQYH 2A69F 4BBSJ 3TMOA 1Y1WG 4C2MA 3GV8B 3QWLA 1OWTA 1IXSB 1I50J 3IWFA 2L4AA 4HSTA 5FRMA 4ED7A 3RB3A 2HTSA 3ZQLA 2DPDA 1Z9CA 1OMIA 4HDVA 2VOOA 4ED1A 2EFQA 5DQGA 4G8XA 3DWLE 1ZYRF 4MV4A 1V4YA 4GKKH 2QBYB 5KFRA 5BPDA 2K3FA 3JRIA 1MBKA 2A05A 1O3SA 3LMLA 2LYCA 4IHSA 4HNTA 3LA7A 1ZHSA 2LBFB 4PWQA 1EUCB 3I64A 2WY7Q 2ZMEC 2O61A 4WD3A 4QIWN 4X62H 3QYEA 4XX0B 1MNDA 5KHDA 4N4OB 2K9NA 4MTEA 4U7CA 2HVRA 3A02A 3DF7A 4XKCA 4UCUA 4LSAA 1DU0A 1S8NA 1HDDC 4RZRA 3QFFA 4L9JA 1OYIA 3K70C 1TWFJ 2IJLA 3CCQI 1GT0C 1GHCA 2NVXA 3PNYA 2EV5A 4JX5A 5D5XB 1ON1A 2HOAA 1T3NA 3VB2A 1XMAA 3DPUA 1MDMA 4BQOA 3KLOA 1W7PB 3M4OJ 2E34A 2ZDGA 5F04A 3MD2A 4BE2A 1WQ2A 4OMYA 3A4CA 1OR7C 2OC6A 2GOXB 1ZKGA 3RYRA 4BWSC 3GLKA 4LH6A 3FKIA 2ECBA 1I50A 1EF4A 5FD5A 3PFYA 2H6BA 3BQ2A 1FP1D 2EV0A 3E0JB 2W9CB 4DV4H 5L1KA 3PW0A 1V5EA 5KFHA 1KQ0A 1YFHA 2VQDA 2C22A 5E3NA 3SFIA 4D5CA 3DTEA 3FMRA 3U9GA 4DV3H 4GRIA 4QIWA 5LHIA 2MH9A 3F8MA 5E20A 3B02A 3FMAA 4KMFA 4M6VA 3F3XA 3DKWA 5BOXA 1Z1DA 3HSEA 3JSOA 3WE3A 4YELA 3LSRA 3E5XA 2Y30A 3FHZA 5KK1A 2Y31A 1K83J 1UB9A 2FU4A 2HYGD 3HRUA 4MLOA 4EGZA 1JKOC 2XPVA 3J81K 3KAJA 2M30A 2DOEA 1HBXG 5C44G 3HTUA 2VUMJ 3W6KB 4EBCA 1ZH5A 1QQIA 4HQMA 5JFRA 1G3WA 3V7CA 4E70A 2CQXA 4GYGA 1TWFA 2UU9H 4GGGA 4YR2A 4TV9F 3PFIA 3HSFA 2B9SA 3RIZA 2WADA 1FMVA 4ENMA 3DEEA 2W82A 5HVQC 2HDWA 1N56A 2CQ7A 4QWCA 4IHVA 2IRFG 2D5VA 2DMTA 3VSLA 3HOTA 4IHYA 2MCTA 1ODDA 3MFIA 4R79A 3FDYA 2E1MC 1N77A 3BTLA 3ERMA 3G1MA 1TLHB 2XGCA 1K61A 1YLFA 2DFFA 1H8AC 2JSCA 3HRSA 1IUFA 4KIGA 4IAJA 4F92B 4A3MJ 4LLNA 4AUXA 2NOJB 2XF7A 3QOEA 4II2A 5AONA 1F5TA 5CYVA 1AUXA 3PN1A 3E6MA 3V8LA 5CPRB 4O4LF 4JI7H 3CUQA 3K0LA 4G6DA 3R6SA 3ZQIA 2KDZA 1B9NA 1YRNA 5KFSA 1IBLH 1K6OA 3F8CA 2F5CA 3M8JA 3KP4A 1D0YA 5LP6F 2IBDA 4RNOA 3LA2A 2BHYA 1VNDA 1SD6A 5E8GA 1K83A 2WAEA 4NB5A 1BI1A 1GV5A 1ONVA 4M3GA 3S15J 1S68A 4M72A 5JVTA 4A3JG 2VUMA 2KL4A 1GXQA 4XKWA 4NXMH 3VYTB 2F4MB 1E3HA 5EEHA 5J1UA 3DXJF 4DGWB 3I4MG 4IRGA 1PDNC 2ZSIB 3RJ0A 3K5IA 2R6FA 1UELB 1BR2A 2XROA 2P5LC 4LF7H 1O3RA 3TW7A 5FFXA 4U0YA 1DGWY 4G12A 3Q0WA 4P9UA 3HOXG 3GZ6A 2RN7A 4I09A 3MZYA 1U6GA 2V4QA 2YS6A 3FM3A 5KT2A 2PMHA 3OUUA 4LB6B 1K6YA 3D0SA 1QVTA 4HNVA 4M3DA 2CH0A 2A6EF 2A6HF 2GXGA 5E17F 3HOYJ 2W8KA 1DPRA 1W7PD 5J40A 4BACA 5GP9A 2OQGA 3FBNB 3K4LA 4Y17A 3N97A 1X19A 1WSCA 3SZGA 5BPIA 1YS6A 2DO7A 5L3EA 3M1EA 4BDYA 1LE8B 2VE9A 1MMGA 3OOUA 4O3SA 2EFOA 3I9V2 4ZDPA 3GTOJ 3GIQA 3HEFA 2W9BB 4A3BG 2EJRA 4WK8F 2WC2A 5CB4F 2CFOA 1VZ0A 1MD0A 2OCEA 1QNTA 2HWVA 3P9IA 5KG6A 2K9SA 2JA5J 2PN6A 1I6HJ 2R7DA 1I1SA 4CA0A 5D5WB 5KFFA 2X6XA 3TQTA 1FKAH 5KG1A 1XMQH 2GA1A 1ZTRA 1IAWA 2QWWA 4FS1A 2B7EA 5A2QZ 3KHRA 4UVBA 1MSFC 4EMSA 4IVNA 3PQKA 4BGDA 1SFUA 2ZNZA 2R82A 3BWGA 5EDNA 2CGPA 2MC4A 3HRTA 1RZ4A 2R4GA 5HLGA 2GOMA 5LMUH 2EZLA 1MBEA 1WJ5A 3CCVI 3V8KA 3BJ6A 2ICWG 2CV0A 2CW8A 1MMNA 3ZR8X 3C3WA 3QODA 5LA6F 4Q43A 1O7FA 4DL4A 1N48A 3HOWG 3J7AO 2V9VA 2OTLI 1MMSA 1F36A 4PDKA 2CW7A 1TP4A 3G6XA 2LF7A 2EZIA 1OCTC 2FPGB 3OIQA 4EATA 3CDHA 2LNBA 4U0WA 4BDZA 4Q0YA 3OYMA 1FOWA 3FIWA 4J9RA 2R92J 3LAJA 1CS0A 5GAHJ 3OHBA 3GTOA 1MNMC 2R7ZA 1ZRCA 3EYYA 1KBLA 5K7ZA 1IO2A 2Z16A 3BR0A 1A35A 2DLNA 1YITI 5EG0B 2JA5A 3GUDA 3OYCA 1FOYA 2XASA 1RKTA 3PO3J 5HDGA 1U8RA 3KAKA 3BR3A 4Q4ZF 1E2XA 2CUJA 3R60A 4HRIA 3S1NJ 3RF2A 1KEEA 3OSGA 2V4JC 1TWHJ 5DLGA 5BS6A 1GO3E 3REOA 2L7MP 4L9TA 5J1RA 3L2UA 3Q8RB 3MR6A 3EQLF 4DUZH 2M7AA 3RDIA 1JUPA 2ZC2A 3A01A 1XGSA 2KIFA 3H36A 2LG4A 1Z3YA 2UXNA 2WV1A 3VPCA 1BR4A 2ZMEA 2DA4A 2VBYA 1CQJB 3H5AA 4Y33A 2HXOA 2VE8A 4Q8EA 2KZGA 2VJ4A 2BQ3A 5KFBA 3V8JA 1CF7A 3ZMDA 3LNQA 1HC8A 3EUHC 3BDDA 2HVQA 3IAM2 4RBOA 4IF4A 1UMQA 1YHQI 4Q45A 3DBLB 4D7MA 4HDUA 1V54H 4BKXA 2R84A 1R1VA 4A3IJ 5CKTA 4B8XA 1BI0A 2LKXA 4K2EA 1IOWA 4QWBA 4DLKA 2R87A 1W5TA 4DW6A 5IP7J 3JRGA 2DIKA 1YIOA 4L9VA 2DWCA 4E7SA 3HOZG 2R92A 2AXLA 2NNYA 1T6SA 4CYDA 4ITVA 2IBKA 1N34H 4KISA 3Q9VA 5GTHC 3E7LA 4F7ZA 2QSGX 2FF4A 2J6UA 1S9FA 2LOOA 1VAJA 4YR3A 1OR7A 1E0EA 3MMYB 3E6CC 4J9LA 3V42A 1YJWI 2ZXIA 2BV6A 2EPFA 1TW3A 2VASA 3DLAA 3GZNB 2K9LA 3K10A 5GPAA 3F6OA 3WTUC 2FQ4A 3ABKH 3GXOA 2XGEA 2STWA 4JBAA 3HKZE 1TWHA 1C3OA 4ZC3A 1DGSA 1V4RA 2WB1E 3H3VH 2ADUA 2Y69H 2TDXA 3BTIA 1RETA 4B3RH 2FJ1A 4DL6A 5JLWA 2EZKA 4B3XA 3ZMTA 2KKOA 3FXUA 3TEDA 3DKXA 2OAZA 4MEYF 1SFXA 1AKHA 1SVMA 3FXRA 4UHTA 3SQNA 2R93G 3OYDA 4DYQA 3OYGA 1VQOI 4A3CJ 4HV6A 3CUQB 3BQ1A 3F21A 3T0YA 4DOZA 3AKZA 1YJ9I 3DEWA 2GLOA 3U9SA 4DR5H 1FIAA 5HNHA 3VMMA 4ZTFA 1TQPA 1W93A 5DS9A 1S10A 1BGWA 1XX5A 4RGUA 1YTYA 2LVSA 3BZCA 3L2QA 5D8DA 2C00A 3TQ1A 3I4PA 4WF2A 4RM2A 3JRDA 3K5HA 1XDNA 2E2JJ 3GTLA 4YQWA 1OCPA 3AG1H 4UV8A 3T8TA 4XOPA 4AVPA 1MKMA 2DAOA 5FPOA 5KG2A 2AQEA 2BY0A 1PVEA 3AFHA 3H9JA 4EQQA 1V5GA 3GCMA 1I3QJ 4XIDA 5EWFA 4DL3A 3Q1KA 3WGGA 4RM3A 4A3FJ 3FMSA 3L00A 2MSYA 3NQOA 5E1ZB 4QW8A 1X1CA 3SEZA 3GQCA 4ANJA 3P9CA 3GWZA 2O8KA 4V19K 3RI4A 2XF6A 2HKOA 3QPHA 4Q8FA 3F72A 3F8BA 3IP4B 4FETA 3N44B 2GAUA 2HEOA 4CC6A 4A2AA 1SFOJ 3COAC 1JHFA 1DV1A 5IYBG 2XGQA 3TP3A 4LLGF 5IT9K 2DZDA 5BQTA 2DMQA 1G6NA 2PMUA 3OL4A 3PIPF 3T1BA 1B6RA 4ENNA 1UC8A 1WH2A 2I10A 4UY8I 2HYFA 2X1DA 1YOVB 5DD8A 1WCMJ 2KIQA 1RRJA 4PFPA 5KFIA 2OV7A 4BXXJ 2DTRA 1LFPA 1MMDA 2M87A 4IRHA 3VYRB 4HF1A 1DPUA 3IKVA 3U21A 4JV5H 2JA8J 2CUZA 3JAMK 1D0XA 4H4KC 2C2DA 4MIMA 4MQ9F 3ZQHA 3BZ6A 3KP3A 5DLFA 1OCRH 4N4NB 1X1AA 2EIJH 3GEZA 4RLFA 1GDTA 2OLSA 5HLIA 4XSXF 2A68F 2PBIA 4XMYA 4JX4A 4M3FA 1VQMI 3S14J 3BAAA 1TWGJ 2W8LA 4JI6H 1SEUA 4C5AA 2CKZB 1IBMH 1ZG5A 2GXAA 3IH3A 3IV5A 3J80K 4LF4H 1LFBA 3ELKA 4XK4A 4A3KJ 3TDZC 3CMYA 4E4TA 4FBUA 2KRCA 2W6OA 1I3QA 4YFNF 1GGOA 2XPWA 4CYCA 3OYBA 2MLGA 3TOBA 2BVLA 2JJ7A 1QBJA 3SFZA 1VQ4I 1WJCA 1X1DA 5KFZA 2GIVA 4L0YB 1R00A 3BG9A 3KP6A 1FOXA 4M3BA 3L4JA 2X1EA 4IRCA 3BR2A 5KG0A 1LVKA 2DMUA 2BW3A 2HGCA 4U7BA 2VXDA 2PI0A 1IDZA 2H94A 2V79A 1B1BA 2XGXA 1B72A 2AQ4A 2DOFA 1SFOA 1HKSA 3HC7A 3M07A 4XLHA 3CCMI 2DK5A 1XB4A 1TAEA 3U9TA 5F9LA 4A12A 3TINA 1F9NA 1YE9A 4UB6C 5HS9A 2LD5A 2H27A 2CMPA 2RDPA 5HLHA 4X64H 1UHMA 4KICA 5F6FA 1WCMA 3GFLA 3QU3A 3J7ZI 1K79A 2IGNA 1ACIA 4QW9A 1P9QC 4A3EG 4QWAA 4CH7A 1ZETA 4D1QA 2TCTA 1HW2A 5DCMA 2FRHA 1FSHA 2ZB9A 2PJPA 3M7GA 1FTTA 3VPRA 5D4SA 1F4KA 4LG0B 1RK6A 1TA8A 1ZG1A 4OAYA 3CUOA 4LB5A 4IHTA 3VEPA 4ZJZA 3Q5FA 2W85A 1ZRDA 1R1UA 2BY2A 5K5OA 1WSUA 3GW2A 1S6LA 1TWGA 4ECUA 3UNGC 4YG2F 1AN7A 3R5XA 4B3SH 4C5CA 3RV4A 1A04A 3LSPA 1X4PA 2ZFWA 3OYJA 4DYRA 2MG4A 2Q2EB 2VBZA 4OWRB 3A01B 3TW6A 2DPIA 4PFOA 2XIGA 2MD5A 3GFMA 4KIFA 2PG4A 1Z3XA 1WR2A 2LSOA 1J09A 3DKYA 3JTGA 1KU2A 5LRSA 1TT0A 1J0RA 1Z7UA 2KT0A 2NU9B 4HAMA 3BJAA 4IXAA 1CF7B 2V1NA 1U8BA 3B73A 2VPLA 1BR1A
chains in the Genus database with same CATH topology
3FWEA 2XAJA 4EM1A 1OYYA 3C18A 3KP7A 5K1YA 4JI0H 1QGPA 2QQ9A 3N42B 3NEUA 3HHGA 1XN7A 1RNLA 3KLNA 2IP2A 4DR1H 4FX4A 2G7HA 2FQ3A 4S05A 1H0MA 1O3QA 2WE6A 1LEAA 4CICA 4PDBA 4I2OA 5HS8A 3IHUA 2UUAH 3EUHA 4OIOF 3L09A 2HKXA 4ETSA 1MZBA 1P4XA 5LL6b 2UUCH 2RNJA 2RV8A 4HX4A 2DFIA 4EFBA 4HW0A 5JI6A 4PZJA 4XLNF 4CC5A 1IF1A 3L2CA 1HXDA 1EH7A 3ZMZA 1VTNC 4ENKA 2CFXA 1Z2OX 1FYKA 4OIQF 2QLZA 3GX4X 1FX7A 2FSWA 4HLXA 4LLLA 1BC8C 4P55A 4YIIA 3U1DA 2WV0A 4EGYA 3HTSB 1YW9A 2DI3A 5ICFA 5TJJA 2YR2A 3BABA 2FBIA 4M74A 4G7ZF 4YHHH 1HNWH 5E1XA 1I6XA 2OU2A 4L18B 4AD9A 4UCTA 2IA1A 4EM0B 3K9TA 5CVJA 3RGXA 4BHBA 2M1BA 3NRVA 3KEOA 3WODF 4CHUA 5LLQA 4R8HA 2P6TA 2FA5A 3IRQA 4AIJA 2BEOA 5FFZA 1OPCA 4BXUA 1K78B 5F1RA 2K02A 1XNRH 3K69A 1N33H 5ILSA 2ACJA 1BI2A 4LK0F 1FWZA 5DCMB 4DUYH 3GLXA 4M9ZA 3L9FA 3TKYA 2O03A 4Z2YA 1TW2A 4ZZDA 2E7WA 2H09A 1PP7U 4LF8H 2O0YA 5CLSA 2UXBH 1U3EM 1ON2A 4G7HF 5J6XA 1LB2A 4LK1F 4XBFA 1EH8A 1ZGJA 3JTHA 1ZAOA 2F2EA 4I01A 1YW7A 3GF2A 1TTYA 1KU9A 2C6YA 1Z91A 1SFEA 5FPRA 1H9TA 2DW4A 2MH2A 1ZG3A 4PCQA 2Z99A 3IRRA 1BJTA 1QZZA 5DCFA 1KGSA 3E5QA 3J81W 2K4JA 1L0OC 2EA4A 2JTVA 4MV9A 3GZ5A 3Q9SA 5CJ9A 2P7CB 1FZPB 3L2PA 2K86A 3F8FA 1FT9A 2LDUA 2FMLA 1S29A 2QZ8A 4DR6H 3H92A 2VOBA 3SHFA 1HR0H 4WXCA 4X65H 2VQFH 2ZJTA 3F22A 4RAZA 3WU1B 2ZJ2A 4L5IA 1J2XA 2ELHA 4ESFA 2NYXA 1XGOA 2VC1A 3VODA 1WI9A 2OZ6A 4BHPA 3JSNA 1STZA 4O6JA 2V6CA 1GXPA 3DFGA 3CO7C 4LF6H 1MJAA 3DPLC 3I59A 4JYAH 5ERIA 4KNYA 5DUIA 2MBFA 4IJAA 1U5TA 5E1WA 2Y75A 2Q2UA 1XGNA 5D6FA 2L02A 2VODA 4A6DA 5H20A 2BBYA 2G9WA 1Z6RA 4LSXA 2HS5A 3LSTA 1C0WA 5A2QK 2XAHA 3KALA 4DV5H 2PEXA 2NAZA 5FLXW 4A0XA 1ZREA 5FLXZ 2HOEA 3WE2A 3QP6A 3GO5A 4Q47A 1U2WA 4RB0A 4QLCU 3WG9A 2K27A 1G3TA 3DP7A 2XV4S 3HHHA 2FBKA 3HYIA 2DT5A 4EEQA 1XMOH 4U7DA 1I5ZA 1XCBA 1FOKA 2DQRA 1P92A 4IPAA 3ZMUA 1MDMB 3E97A 4FM9A 3U2RA 2P6SA 3N4MA 1FYMA 1HKTA 4UCOA 2B0LA 1LQ1A 1QO0D 4RGXA 1O7LA 1IRGA 2XUBA 2GQQA 4DQ2A 1TQMA 4O5VA 5FO5A 4G6QA 2Q8KA 1I1GA 1Z05A 4GCVA 3QU6A 4WCGA 1L2ZA 1FVIA 2F5FA 1BIAA 1G4DA 2ISYA 1O57A 4LFBH 2JPBA 2JZYA 4NQWA 3CVZA 3HXLA 2Q0OA 3WGIA 1KYWA 1ZN2A 2K7LA 3PQJA 3VOEA 4EV0A 4ZZLA 5CVRA 1FBUA 1BN5A 2HHHH 2YX4A 2AS5F 3HSRA 4H0EA 4DV7H 2RQPA 4P9FA 4A0YA 5ICGA 3WGHA 3I53A 4EM2A 2NRAC 4PGGA 5BR8H 4I7HA 2RKHA 4CXFA 2PLYA 2F4VH 1P4WA 3DV8A 4ENJA 1RI7A 4EVIA 2HDCA 2P8TA 3T8RA 4FT8A 3AAFA 4LMYA 1R23A 5D1OA 4GYIA 4HBLA 1LEBA 4L9NA 4HZFA 4NXNH 3E3VA 1YQAA 4N9IA 3O6BB 1V9PA 1FPQA 2EFNA 4UVAA 5H6QA 1Z2NX 2KSWA 4UCRA 1BBYA 1M0WA 5LHGA 3K2ZA 1B04A 3OTOH 2PQ8A 1NHAA 2IPQX 4JI8H 3GFJA 3I59B 3R0AA 1JE8A 2L3DA 1U5TB 1FLIA 4UCSA 3RGZA 3K1NA 5ED4A 1J75A 3O2PE 4RB3C 5EOYA 5DEQA 1G3SA 3ZMVA 1CGPA 1J9IA 2P5KA 5IT9W 3V4GA 4BH9A 1K7AA 4ON0A 4B3MH 3G73A 3JAMW 2MLKA 4JI4H 1LNWA 3ML6A 5F64A 4CGZA 3VFZA 1T39A 3H3ZA 4JI5H 1R5HA 3QOPA 4XLPF 2IT0A 3J80W 2IA0A 2O3FA 1YG2A 5LBQA 4ZH4F 3HIFA 3LQQA 4U88A 4RB1A 1P6RA 1J5YA 2E1CA 3K1MA 1XSVA 1L3LA 3R0JA 1HSTA 3TGNA 3FXQA 5LEKA 2CYYA 2VOPA 4D0PA 1P2FA 3N41B 1IXCA 2E7XA 5ICEA 5D8LB 4X66H 2STTA 2J5PA 5LEJA 4ZYHA 1R1TA 4MEXF 3RIRA 4R7RA 2ZMEB 3MAJA 1PP8F 1B6AA 2QQBA 4G7OF 3TO9A 1Y0UA 1F1ZA 2ZO4A 1D8KA 1R22A 2RVCA 4HQEA 2FBHA 2OZUA 3H3UA 4P96A 2D45A 3KP2A 4RGSA 4J0MA 4Q5SF 4FX0A 4GLXA 2DU9A 2VBWA 3SZPA 3MEXA 5LGNA 1QPMA 3RYPA 1R58A 1EV7A 2CW0F 2Z3YA 4CZZA 1UHWA 5ILUA 3P9KA 5D8KB 5CVUA 2BE5F 2VC0A 2O6GE 3O3KA 3GYHX 4HX7A 4JI3H 5K5QA 3IC7A 2XAFA 3MCZA 1D5VA 1IN6A 3BA8A 2GWRA 4U0VA 2QM3A 2ETHA 1HW5A 5IWAH 4KFCA 5CVVA 5ILVA 3D5LA 5D1OB 3WTVC 1N32H 2QQAA 2GXBA 1SD7A 1M0TA 2FMYA 4HX8A 4UCVA 2VT2A 2VQEH 2RGRA 4HV5A 4ESBA 2ZM6H 2D1VA 3TOAA 1KA8A 1DDNA 4PGHA 3FZVA 4LFAH 2EFPA 1XCVA 5DD4A 3BPXA 2UUBH 1E4GT 4NHJA 1SMTA 1USSA 4HOBA 4MV7A 3QPTA 2OD5A 3G3ZA 3C7JA 1FYLA 3CO6C 2HZTA 1HW1A 2JT1A 2W84A 1FC3A 5FD6A 2FNPA 4LF9H 2HQRA 1MGTA 2IA2A 1FY7A 4I02A 1E17A 1ZLKA 3ABUA 3HUGA 2LF8A 3M8EA 1O3TA 1FJGH 3WTYC 1YO5C 1KYZA 2RGVA 1BIBA 3ECOA 3KZYA 2P4WA 2ZXJA 2DK8A 1SD5A 2Q2TA 1T0FA 2HQNA 1HNZH 3JW4A 2A61A 4AIHA 1AWCA 2EFWA 2X4HA 3DF8A 3P7NA 2IW5A 2HTJA 2BGCA 4FHTA 1XDUA 3S2WA 4BAYA 3DPTA 4L5JA 4L0ZB 4DV1H 3RKWA 4I98B 6PAXA 4KN4X 3EDPA 4EJWA 4DR4H 2E5LH 1S7AA 2HGSA 3WTXC 3K3VA 2GZWA 3R61A 1RIOH 1YW8A 3ULQB 2WTEA 2LKPA 3ABTA 4A5MA 3RPUA 3LAPA 5BMZA 3WTSC 3ZN1A 5JR3A 5L3FA 4OOIA 3BJOA 4DNCA 2XKPA 3LA3A 4HLYA 1BC7C 4JI1H 2Z33A 4UXNA 2YX7A 4AWXB 4ZYGA 3V7RA 4P5OA 3RJPA 4RAYA 3M9AA 4I0AA 1OKRA 1G3YA 1MJBA 4A0ZA 1B59A 1MJ9A 1XSDA 2MC3A 5LRRA 4LFCH 4ZYEA 2UXCH 1IZ1A 4WX9A 3QAHA 1RUNA 2FEZA 4JQFA 4LFUA 3BP8A 2VXZA 2FXAA 2KJCA 4ASNA 5LHHA 4BNCA 3J81Z 1JHHA 3ZPLA 3F6VA 3L4KA 3MWMA 4RZQA 1Z6TA 1SAXA 2HR3A 4EJTA 2V1DA 2GA2A 2YPRA 4MGRA 4B09A 4BQAA 1LJ9A 2A5YB 4Y15A 1KQ8A 3C1DA 1R36A 3H20A 1BI3A 1HSJA 3M8FA 1H9GA 3CLOA 4OX9H 3BPVA 3ERED 4ZYDA 2VN2A 4CDGA 4UNOA 2XAGA 4DV2H 2FE3A 1D3YA 4CO8A 1XGMA 3JSLA 1PUEE 2WYOA 3LFKA 5HDKA 1YYVA 1WKMA 3WTZA 2YSRA 3TO7A 1SMYF 1J5EH 3T1HH 3IL2A 2KIMA 3MQ0A 4BHCA 1U78A 4MQVA 3RKYA 3KE2A 4S04A 3T5XA 3N43B 2M45A 4DV6H 1IN7A 4XRFA 2ISZA 3KXYT 3IKTA 3SXYA 4K0KH 1S3JA 2L4MA 2PFBA 2XKOA 4YFKF 3L7WA 1J59A 4DV0H 5FLXK 5D6EA 3IWZA 1LDJA 1D8JA 2ZCWA 4RS8A 1T2KA 1KQ9A 1FBQA 1YS7A 2NNNA 5IT3A 1IN8A 2F5DA 3LQRA 2HFHA 2CG4A 1FP2A 5A2QW 4BYYA 3E6BA 3EYIA 3CTAA 4UVCA 4AIKA 3MFKA 3MZHA 1XNQH 2XAQA 3I54A 1FSEA 1HNXH 1BOAA 3ECHA 5KVRA 4KN7X 4APMA 1XD7A 2COMA 1I27A 5ICCA 3ZMSA 2X0LA 1B9MA 1ZLJA 1REPC 2ZKZA 2EA2A 3KFWX 2Z5UA 4A2UA 4LG0A 2R3SA 4IRIA 3QP5A 3ZQ7A 2RC4A 3KZZA 1WRJA 4RGRA 3I71A 3KETA 4GKJH 2EV6A 2Q2EA 1R5GA 5D1PA 2Y48A 2WWYA 2ZBKA 3KP5A 2D2WA 1DUXC 1SD4A 3QRFF 2EWNA 4YY3H 4LGWA 4YIFA 1XSXA 1ZHFA 3I0TA 2CQKA 2E1NA 4KA4A 1LDDA 1UFMA 1ZRFA 1W5SA 1T98A 3R4KA 2YU3A 5DDGA 4O3MA 2JRTA 4KT5C 4Y13A 4WXDA 2L01A 4M6YA 3LWFA 4R1HA 4HF0A 2CO5A 4KHPH 1TNSA 2BYVE 4HF2A 4G94A 2QENA 4M71A 2Z9OA 4KDPA 3OV8A 5DV5A 1Z2PX 3ROUA 2UXDH 2OBPA 3KEQA 3HRMA 1HKQA 4OMZA 5HDNA 2J5OA 5J8CA 4LJZF 5J8FA 2EB7A 1TNTA 5HOOA 3TDUC 2R7FA 4KUMA 2Y0MA 4KYWA 1S03G 2FOKA 3CJNA 3EETA 4MTDA 3T1YH 1TBXA 4KIBA 1N36H 5L3BA 4RB2C 4EJVA 2KJBA 4A6EA 2CSOA 3JSPA 2KIUA 1XDSA 4N0BA 4XSZF 1WWXA 4B3TH 1ZGAA 4TV7A 3FX3A 3K1PA 4UFZA 2OQRA 2A3SA 3BY6A 1V3FA 2H6CA 4MNUA