4RB1A

Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-e. coli fur box
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
b'VSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb1A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb1A02
1O57A 5ILSA 2KJCA 3SFZA 2OQGA 4E70A 4IHTA 4U88A 3LSTA 1BI0A 1A04A 3R60A 2G7UA 5ICCA 1EH8A 2GIVA 3ECHA 2NRAC 2Y75A 3T1BA 3I71A 3NRVA 4NHJA 2GAUA 3WTYC 2LF7A 1HKTA 5L3EA 2D1HA 5LGUA 2ZMEB 1OYYA 3TO9A 1ZG1A 4BQAA 1HQCA 5L3CA 2ESHA 2PEXA 3P9IA 1U5TA 2MC3A 1HSJA 3FMQA 1R5GA 4Z2YA 1G4DA 2VBYA 5L3DA 3D5LA 2DK8A 3U9GA 1TLHB 4ESBA 5DEQA 3GWZA 3F8MA 1U6GA 3ABUA 5DD4A 1FT9A 2HKOA 3J80K 4M6YA 3FZVA 5DD8A 1R1TA 2FXAA 5ILUA 1Q1HA 5E1XA 1PUEE 5K5RA 3H3UA 2HOEA 4BAYA 3CO6C 4RGSA 1R1UA 3F6VA 4JK1X 4M73A 1XDUA 3KP7A 1FP2A 3JTGA 4ENKA 3FMRA 3H3ZA 1I1SA 4UXNA 4R8HA 1J2XA 1XDSA 2XKPA 3CDHA 3V7SA 2H27A 3VEPA 1FBSA 2MD5A 2GXBA 4FT8A 4A6EA 5HLGA 2VC0A 4LG0B 5LRSA 1YTYA 4OMYA 4WXHA 2HYGD 5CVUA 3KEQA 3MCZA 4XSXF 4FX4A 3BJ6A 1PP7U 2KRFA 3I59A 1O3RA 3ZN1A 1J59A 3IHUA 3F6OA 1AWCA 3NEUA 3E6DA 1F4KA 1SAXA 3FX3A 3I64A 3KCCA 2F5FA 2KIUA 1XSXA 5JVTA 1HW1A 3WTUC 1YFHA 2M8EA 4OU0A 1IXRC 1RNLA 2HTSA 2YX7A 1J7KA 2DLLA 4I02A 2VODA 3FXUA 2VE9A 3JAMZ 4CHUA 5BPIA 1SFXA 4A0YA 1S7AA 2CO5A 3C7JA 1BC7C 4RB3C 3RI4A 3HRTA 2DW4A 3FMSA 1IN8A 1Z05A 2RVCA 4IVNA 1USSA 2HEOA 1FP1D 5BS6A 5LGNA 3LA2A 1SFUA 3HHGA 1OYWA 2WC2A 5FD6A 1B6AA 3K2ZA 4HAMA 2EFPA 3GXOA 2AXLA 4UV9A 5A2QK 4L9NA 1UCRA 2DFIA 3RKXA 2O6GE 4ENMA 1TTYA 5BQTA 5LHGA 1CF7A 3CTAA 3GEZA 1B4AA 4Y13A 3LQQA 2JTVA 2PMHA 3RYRA 1ZGJA 3BOQA 3BPVA 3EETA 2QUFA 3EYIA 1ZLJA 1PDNC 3WTTC 1IXCA 3OV8A 3ZMSA 1JHFA 4MTEA 2XAGA 4OIOF 2ZCWA 5HVQC 1QZYA 5LLQA 3JSPA 3K1NA 2DK5A 3V7CA 3CUQB 3R61A 2XKOA 3HOSA 5BMZA 2Q2EA 1Z9CA 3TDUC 4ASNA 3O6BB 4EGZA 1ZAOA 2DI3A 1D8JA 4B8XA 4KUMA 4CO8A 2ADUA 1SMTA 2EA2A 4ZZDA 3EYYA 1VTNC 4TV7A 4UUVA 1R5HA 3GFMA 2PQ8A 3HSRA 5JR3A 3P7NA 2EV0A 1L3LA 2VN2A 3KZYA 4RAYA 1IRFA 3C3WA 2VC1A 5EEHA 1ZREA 2ZXJA 3IKVA 1DDNA 3GX4X 2XRNA 4EJUA 3NQOA 2FA5A 5HOOA 2HQNA 1P4AA 4CZZA 2M1BA 1ZGAA 2HS5A 1R7JA 5D5XB 5CJ9A 2Z99A 2IT0A 3WTZA 1R36A 2RNJA 4IRHA 1R22A 3ELKA 1XGMA 3E6BA 1HKSA 2KKOA 4HQMA 4WXCA 3HHHA 4G7HF 2QLZA 2R7DA 2OZUA 4LFUA 1XSVA 2QYOA 1UFMA 3W6KB 2X0LA 2G7HA 4A5NA 2EV6A 4EM2A 1MZBA 3L09A 1H9GA 2CWEA 1B9NA 4UHTA 5DV5A 4A12A 2GXGA 1U5TC 2C6YA 4ENJA 3QU3A 1Z6RA 2H6BA 1BBYA 1T0FA 4LLLA 5AIQA 4RAZA 2HYFA 1FYLA 1XGNA 4BHCA 5FO5A 1QNTA 1XMKA 1TQPA 4MQVA 1SD7A 2P5VA 2VT3A 2F5CA 4Y15A 3F8FA 2P8TA 4ZZLA 1FWZA 4IHSA 4EJWA 4HYEA 1B1BA 1LDDA 3SHFA 1OPCA 3HSFA 1K78A 1O7FA 4K2EA 1FYKA 2Z9OA 4AIKA 3DV8A 3DPTA 2EK5A 4HV5A 1PP8F 3K9TA 3KP3A 4YIIA 2M45A 4BHBA 3Q9SA 5HDNA 3RPQA 2MH9A 2ZFWA 2FBIA 1KYWA 1KU7A 1B9MA 5ILVA 3FM3A 1HW2A 1RZ4A 2LNBA 4HF0A 1ZHFA 2OAZA 3IL2A 1F9NA 2CGPA 4Q48A 3LAJA 4N9IA 2NYXA 2KIFA 1W7PA 4IRGA 2BYVE 1BI1A 4L9VA 1E17A 3D0SA 1B59A 2UWMA 1TNSA 1U2WA 2H6CA 2IA2A 5L3BA 3M1EA 2K02A 4RB0A 2D2WA 5F1RA 2DPDA 1WKMA 4RGXA 3E6CC 1U3EM 2LKPA 2VOPA 3BJAA 3BY6A 3F72A 3R0JA 1Z91A 2L4AA 3RKYA 4AWXB 4OIRF 4I0BA 1W7PD 2XV4S 2LF8A 3RDIA 5E8GA 2HZTA 3WTSC 3QP5A 3TQNA 2F5DA 1BM9A 3U2RA 4MEYF 4EQQA 4IF4A 5CVJA 4HX4A 3T5XA 3AAFA 3PFIA 2VBWA 3I54A 3M8FA 4FX0A 1P2FA 3GO5A 1STZA 3BP8A 4G7ZF 4L5IA 2P7VB 4L9JA 3L7WA 3WGIA 4IXAA 3TOBA 1IZ1A 1YS7A 4L18B 1Z7UA 4IJAA 2FBHA 2CG4A 2GQQA 3WGHA 2NNYA 4U7BA 1J75A 1H0MA 2XAJA 1HKQA 4KMFA 2O61A 2NAZA 4ETSA 1HBXG 5E1ZB 2D1VA 2JSCA 1ZYRF 3HRUA 5K1YA 4P55A 2W25A 4GO1A 2EV5A 4RB1A 2QBYB 3RYPA 1QO0D 3FHZA 1C0WA 4G8XA 4F7ZA 2Z5UA 3ABTA 2HFHA 2O3FA 2EFWA 3QRFF 4KNYA 2PMUA 4OINF 2A07F 1CF7B 2XIGA 4M72A 2MH2A 1K7AA 3GFIA 2ESNA 4N9HA 2VBXA 2P6TA 4XSZF 4M9SA 3RPUA 2FQ3A 1O3QA 4HOBA 3EDPA 2EB7A 2O0YA 2RV8A 3DP7A 2HR3A 3EQLF 2L54A 4BNCA 4QWQA 1T38A 2PLYA 3VB2A 2RC4A 1D5VA 4KMUX 2NNNA 4N0BA 1IN5A 5LEKA 3C18A 4LGWA 1XB4A 2Z3YA 4KN7X 4M9ZA 1ON1A 5HLHA 3HRMA 1T98A 1GVJA 2MLGA 2QQ9A 1R58A 2A3SA 1U8RA 3LA7A 1NHAA 1LEAA 2K86A 2IJLA 5EEGA 2PJPA 4EJVA 2WV0A 3ZPLA 1J9IA 1ZN2A 3QP6A 2HWVA 2WTEA 4EJOA 1QZZA 2RDPA 4A6DA 2H09A 2STTA 3IWFA 3I4PA 2HKXA 1OMIA 1LJ9A 4EMSA 2ZNYA 3L00A 2QQAA 1IW7F 3K69A 3KLNA 3VFZA 1DPUA 2NS0A 1FLIA 4IPAA 4BYYA 3J81K 1TQMA 4KDPA 2DO7A 2M30A 2X4HA 5IT9K 5DCMB 2ZMEA 1YIOA 3K1PA 3TO6A 4CDGA 3F22A 2L01A 1RUNA 1IN6A 4I09A 2IVMA 4MTDA 4ZH4F 5LGTA 2XHKA 3B73A 2JRTA 5FLXK 4BHPA 2UXXA 4GXOA 3ROUA 3KE2A 3HIFA 1D8KA 1J0RA 3FF5A 3ZMUA 3LAPA 4B09A 3GUDA 2IA1A 1G3WA 4ZYHA 2VT2A 3COAC 2CFXA 5D6FA 1P4WA 4ZYEA 3QPHA 1ODDA 4ESJA 3I0TA 2FNAA 2EFNA 1DP7P 2J5PA 3JTHA 5DYMA 2M87A 2RKHA 3GZ6A 5L3GA 3IRQA 2XAHA 2V1DA 4NB5A 3E6MA 3G73A 2PI0A 1H9TA 4P96A 3PQJA 5E8IA 4CICA 1G3SA 4LG0A 4O5VA 2GZWA 5K5QA 4M9XA 1SMYF 4QLCU 4WK8F 2L4MA 1O7LA 2YPRA 2AS5F 2XASA 4JBAA 2FSWA 4UNOA 3F8BA 3BDDA 4G6QA 2DPUA 2XAFA 1R00A 2EA4A 3Q9VA 4G94A 1SD6A 2HGCA 1P4XA 3TKYA 3IRRA 4GYGA 4WWCA 3B02A 2STWA 2XUBA 5H6RA 4M71A 2GA2A 3CJNA 1ULYA 5D8KB 3GF2A 3T8TA 3J80Z 1S3JA 3HSEA 3SZTA 1BN5A 2G9WA 3R4KA 1SD5A 2JPBA 4A0XA 1LEBA 4ESFA 3GFJA 1W7PB 2MBFA 5FB2A 2GA1A 2K7LA 1Y0UA 1EV7A 3W6JB 4HX7A 1RI7A 5LRRA 3QAHA 2FEZA 5CYVA 2RQPA 2E7XA 2ACJA 3VODA 1P6RA 1TNTA 2A69F 4HQEA 4L9TA 1MJAA 3TO7A 1SFEA 1W5SA 3V7RA 3F8CA 1MJBA 4GYIA 2P7CB 5D6EA 2OA4A 4AD9A 4ENNA 5HS8A 5DUKA 2LSOA 3TOAA 3S2WA 1QGPA 3MZYA 2D45A 4RB2C 4GGGA 4HDVA 5JFRA 4YFXF 1KQ9A 4YG2F 2O8XA 3IC7A 4KIBA 2H94A 4XRFA 3CUOA 2QQBA 4Q5SF 3GVAA 3KZZA 2A61A 1LDJA 2XAQA 3WU0A 1FY7A 3HUGA 1TQIA 1R1VA 1RUOA 3KP6A 5JHUA 2ELHA 1HXDA 3WGGA 1MKMA 3CUQA 3K1MA 1U5TB 4A0ZA 3BZ6A 4WCGA 1BC8C 4EM1A 3KLOA 3CLOA 5CVVA 2V79A 1WI9A 3N4MA 3L2CA 1F5TA 3T8RA 2RN7A 3KETA 4G6DA 2VE8A 2A6HF 2MLKA 3KFWX 3E3VA 3QPTA 4KT5C 5IT9Z 4YFKF 3JAMK 2A5YB 3SQNA 2E7WA 1KQ0A 4OMZA 1MD0A 2L3DA 2E1NA 4CYDA 3DXJF 5A2QZ 3ML6A 3P9KA 1LNWA 4LB6B 1BI2A 2PBIA 1ONVA 3M7GA 4MGRA 3FM5A 1FNNA 5ICEA 4MHGA 2QM3A 3KP4A 4KFCA 3I53A 2M5WA 3ERED 5F64A 4KIFA 4EM0B 2FNPA 2O03A 1MDMA 2EFOA 2CSOA 3HRSA 5LHHA 3F3XA 3REOA 3BPXA 2P4WA 2L02A 4BH9A 3H92A 3I59B 3KP2A 4CXFA 4RGUA 1Z1DA 4ZYDA 1ZARA 4IRIA 4LK1F 2FMYA 5J6XA 4PGHA 2BEOA 3E97A 2DAOA 2LDUA 2W57A 3V8JA 4HLYA 1F1ZA 1IN7A 3LA3A 2A6EF 1DPRA 1J5YA 4LD5A 1S29A 5KK1A 1XD7A 1WSUA 3MZHA 1KU2A 1IN4A 5H20A 1FYMA 1OYIA 1YS6A 1BIAA 5E20A 2V6CA 4UVCA 2VXZA 3GLXA 4GCVA 2Q0OA 2KIMA 1YW9A 2J5OA 3M8EA 3FWEA 1FBUA 2W24A 3WTVC 4EV0A 3DF8A 1HW5A 5E1WA 3MQ0A 1JXSA 4P9UA 3O2PE 1T2KA 1YYVA 1FBQA 3DKWA 4LLNA 3CO7C 5DUIA 3K0LA 2IP2A 4Q4ZF 2UXNA 2IW5A 4KICA 3WU1B 1V4RA 1OKRA 3IWZA 2BBYA 1D3YA 1O3TA 1YG2A 3U1DA 1OR7A 2DBBA 5LHIA 3KEOA 4LJZF 2K4BA 4HX8A 1SD4A 2DT5A 4KA4A 3F21A 4OIQF 1AOYA 5E18F 2ZJ2A 5HS9A 1ZH5A 2PN6A 5D4RA 3E5UA 4CGZA 4HV6A 5KVRA 5BOXA 5HDGA 4LLGF 3LWFA 1REPC 4PCQA 5D8LB 2ISYA 3R6SA 5TRDA 3E5QA 4UVAA 4I0AA 2ETHA 3V4GA 3ZQ7A 5FFXA 2BE5F 2COMA 2OBPA 1I5ZA 2P5LC 1ZG5A 3PQKA 5D4SA 3SXYA 2FMLA 5CLSA 2JPCA 5JI6A 2DTRA 3HOTA 3WE2A 4AIJA 5LBQA 4WXDA 3ULQB 3ECOA 1WQ2A 4KYWA 1MJ9A 4L0YB 4O3MA 1TW2A 3WTXC 1IXSB 5DCFA 4M6XA 1FZPB 4L5JA 1KA8A 4UVBA 4HDUA 4MQ9F 4I01A 1BIBA 1KU9A 2Z33A 1XGSA 4DNCA 4EGYA 4D0PA 4G9YA 4HF2A 2BV6A 1BOAA 4ZYGA 2QENA 3HTUA 4PGGA 2DQRA 3ZMDA 1BJAA 5CVRA 1KU3A 1W5TA 2QVOA 5AONA 1ZRDA 3MEXA 1KGSA 2EFQA 5ICGA 5HS7A 4MEXF 2IPQX 4HZFA 1G3TA 1K6OA 4U0YA 2Y0MA 3M9AA 3BWGA 2QBYA 5K5OA 1ZRFA 3TGNA 4OIPF 1P92A 5ED4A 3DEUA 2FBKA 5J8FA 4S05A 4R1HA 2EJRA 2ZKZA 2OD5A 1YO5C 3CUQC 4O6JA 1KYZA 2Y48A 5F6FA 3RIRA 1XCBA 1O3SA 1IAWA 4HW0A 4I7HA 1QQIA 2PFBA 2W85A 2HQRA 3HTSB 4PZJA 2MA3A 1XSDA 2DU9A 5FD5A 3JSOA 3GYHX 1YW8A 3BJOA 3E5XA 4L0ZB 3N97A 3QU6A 1JE8A 1W4MA 3Q5FA 1G6NA 4P5OA 1IUYA 5FGMA 1IF1A 2ZBKA 3GZ5A 3KP5A 1LVAA 4U7DA 1X3UA 1K78B 3ZMZA 1LB2A 2VOOA 3V8KA 2TDXA 2ZO4A 1S6LA 2RGVA 5D5VB 3IKTA 1RIOH 5BPDA 2R7FA 3RJPA 5ICFA 3WTWC 1K79A 2JT1A 5E17F 2KJBA 4LMYA 5ERIA 3T0YA 4LB5A 2P6SA 4EVIA 2CYYA 4PDKA 2XGXA 2F2EA 5DDGA 1ZG3A 1V3FA 1I1GA 4H0EA 2OU2A 1ZRCA 2B0LA 4BXUA 3FXRA 3VOEA 1E2XA 1ZLKA 5LEJA 3F23A 1T39A 4WX9A 1UB9A 4R79A 2QZ8A 1YLFA 1XN7A 2E1CA 3GW2A 3QOPA 1JGSA 1GXQA 1WWXA 4OOIA 4ON0A 1XGOA 3J7AO 4A5MA 5DCMA 3WODF 2K4JA 1Z6TA 3LFKA 5H6QA 3FXQA 1EH7A 2ISZA 2JZYA 1JHHA 1LDKB 4Y17A 4U0VA 2FOKA 1S7OA 1TBXA 1TW3A 1LQ1A 1XMAA 1USTA 1FSHA 1S8NA 3ZN0A 1MDMB 3GFLA 4RGRA 4Q47A 2P5KA 2FU4A 3JW4A 4I98B 1FX7A 1CGPA 4HF1A 2FRHA 2V1XA 2HDCA 2R3SA 3MWMA 1BI3A 2PG4A 3L9FA 2UZKA 3ZMTA 2YU3A 1ON2A 4NQWA 2YSRA 3I58A 3ZMVA 2HTJA 3F8NA 5HDKA 4UV8A 5TJJA 2OQRA 5L3FA 4RS8A 1WRJA 3OOPA 4JQFA 1FOKA 2YR2A 2ZNZA 5CVIA 2BGCA 4FHTA 1GHCA 4KIGA 4XLPF 4MNUA 3MAJA 4U0WA 4LK0F 3DFGA 2GWRA 3WG9A 2V9VA 4HLXA 4AIHA 3EUHA 1GXPA 2WWYA 2F5EA 4KN4X 3BROA 3I5UA 3J81Z 1UHWA 4XBFA 3WE3A 4YIFA 3DPLC 1KQ8A 3SZPA 4I2OA 2A68F 4P9FA 5IT3A 1QBJA 2FF4A 2DQLA 5FLXZ 2XVCA 4G7OF 4HBLA 2K27A 2V1UA 2EWNA 3HYIA 2W84A 3MFKA 4EJTA 2FE3A 3RKWA 3C1DA 1IRGA 1DUXC 3RTRA 1U78A 5J8CA 2OZ6A 1L0OC 4AVPA 1T6SA 2IRFG 3LQRA 1FPQA 2XROA 4YFNF 2QWWA 3R0AA 3O3KA 2CW0F 1YQAA 1UHMA 2IA0A 1I27A 2VONA 4HA8A 5HLIA 6PAXA 1MGTA 4S04A 4DQ2A 1QPMA 2CQKA 4XLNF 1FSEA 3ISPA 3DQVC 4A2UA 3TDZC 5D5UB 1R23A 4M74A 2YX4A 3V8LA 1FC3A 1XCVA 5D5WB 1HSTA 2VBZA 1I6XA 1YW7A 3P9CA 1EH6A 4WF2A 5AIPA 5FFZA 3ZP5A 2Q8KA 3G3ZA 1G3YA
chains in the Genus database with same CATH superfamily
1O57A 3H4DA 5ILSA 2KJCA 3SFZA 5C1PA 2OQGA 4E70A 4IHTA 4U88A 2B63J 3LSTA 1WVRA 1BI0A 1JJ6C 3U9SA 3EPZA 5IWAH 1A04A 4C2TA 4U7CA 4AQYH 3R60A 5D1OA 2G7UA 5ICCA 3DF7A 1EH8A 2HNHA 2GIVA 3ECHA 5FKKA 3KPHA 1W36C 2NRAC 2Y75A 3OYMA 3J81W 3KAJA 1JT0A 2XB5A 3H40A 3ZQHA 2UVRA 2LREA 3CJQB 3T1BA 2H8RA 1QVTA 2E5NA 5HV6A 3I71A 3NRVA 2YW2A 5IT9W 4NHJA 1QHGA 1YX5A 2GAUA 3WTYC 1AUXA 5IOZA 1EUDB 3DBRB 2BXZA 5GONF 2LF7A 1HKTA 2R7NA 3WNZA 3W6VA 3OYHA 5L3EA 1RYSA 1E4EB 2D1HA 2VQHA 2C2DA 1YRNB 5LGUA 2ZMEB 1OYYA 3TO9A 1ZG1A 4BQAA 1HQCA 1N25A 5L3CA 5J2TF 1VQ7I 2ESHA 2KISA 2PEXA 3GTPJ 3P9IA 1U5TA 5E3LA 4NC7A 1S0OA 2MC3A 3ESWB 1YJNI 4IHVA 1HSJA 2VOBA 2DTZA 1S9HA 3FMQA 2VKHA 1PUFB 1R5GA 3K3PA 4Z2YA 1G4DA 5C3EG 2VBYA 5L3DA 5J4YA 1A9XA 3D5LA 1IBMH 2BXYA 2DK8A 3U9GA 2IS4A 2GIZA 1TLHB 4ESBA 1SYXB 3BG9A 5FRMA 2J6TA 3HJEA 1TWHJ 5DEQA 4MV9A 2CUJA 4GC7A 3GWZA 2X6WA 2V58A 1AUVA 3F8MA 1U6GA 3ABUA 5DD4A 1FT9A 2HKOA 3BAAA 4TV9F 3J80K 4BBRJ 1LVKA 1V5EA 4M6YA 3FZVA 2GBYA 5DD8A 1R1TA 2FXAA 3MKLA 5ILUA 2EZLA 1Q1HA 4RM2A 5E1XA 1W1WE 1PUEE 3KIOA 3JCUC 5K5RA 4RU9A 2VKEA 3H3UA 3CQZJ 2J6SA 2HOEA 4LIVA 1LUJB 2VXDA 3CC2I 3HDDA 3FDYA 3RB4A 4BAYA 5K7ZA 3CO6C 3WU2C 4RGSA 1R1UA 5BNGA 2TCTA 4MV1A 3BTLA 3F6VA 2W7PA 2FLPA 4LFCH 4JK1X 4M73A 1XDUA 4ZHQF 3KP7A 1FP2A 1RRJA 1MBJA 3DCFA 5KFYA 4ED6A 2R7KA 4RAGA 2M0MA 3JTGA 5JVGF 2DA3A 5EDWA 4ENKA 3FMRA 3H3ZA 5CQEA 1QRYA 3M1CA 1I1SA 1D1BA 3PW2A 4UXNA 3WG7H 4R8HA 4DR7H 4MV3A 4DV6H 1J2XA 1XDSA 3AG1H 3OHAA 4JI3H 2XKPA 4A3MG 3CDHA 4DL4A 1E3HA 4ZDPA 3V7SA 2H27A 2L7ZA 3VEPA 4IO9F 4CC6A 1FBSA 4JI6H 2Y0SE 5EF6A 3H3VH 2MD5A 4CYCB 2VPRA 1ZQ3P 2HYJA 2GXBA 2R86A 1MSEC 4RNMA 4FT8A 1RESA 2MC4A 4HSTA 4A6EA 2VC0A 5HLGA 4XRMA 4LG0B 5I47A 1Z3XA 5GP9A 2YRXA 4XZ3B 5LRSA 3GIIA 1YTYA 2ELKA 2Y30A 4E7ZA 4C2UA 4OMYA 2HOAA 4ECWA 4XKCA 4WXHA 2HYGD 2R82A 4IWXA 5F1JA 3RV4A 2RDJA 2M7AA 5J1YA 2OCEA 1Z2OX 5CVUA 3KEQA 3MCZA 2XCLA 3K5HA 1VQLI 4XSXF 4FX4A 1JDEA 2QSGX 2WBMA 4X6AJ 2ALZA 3BJ6A 3BTJA 4IQJA 1PP7U 2KRFA 1UZCA 2EIKH 2IXSA 4XX0B 3I59A 4XOTA 1O3RA 4TQSA 1BW6A 3ZN1A 1J59A 1SVOA 2P0WA 3AG4H 3IHUA 3F6OA 1AWCA 2XGQA 2L9RA 4RDUA 3BT9A 1RJPA 4E7KA 2LOOA 3NEUA 3E6DA 2R7WA 4DGWB 3M3YJ 5D1PA 1F4KA 1Y6IA 4BE2A 1WPKA 1SAXA 3FX3A 3I64A 1XNRH 3KCCA 2JK3A 2F5FA 2KIUA 1XSXA 3CDLA 2DMNA 4BS9A 4GKJH 5JVTA 2NOGA 2CQXA 3HM5A 4DV3H 4DR5H 1HW1A 1JKPC 1Z77A 3WTUC 2WAQE 4BXXJ 4EGJA 1GYFA 1YFHA 3K2AA 2M8EA 2HPIA 5KG4A 1YX3A 3GTLJ 2KDOA 4OU0A 2JA8J 3SYTA 1IXRC 1RNLA 3PR4A 1J09A 2HTSA 3I56I 2YX7A 1J7KA 2DLLA 4I02A 4JOMA 2VODA 5IYCJ 3FXUA 2DFFA 2E2HJ 2VE9A 4WD3A 3JAMZ 2ME6A 5F08A 1HOMA 1Z21A 4LF4H 2MD0A 4CHUA 3TL4X 5KG7A 2ME0A 2LKSA 5BPIA 2AU0A 1Y1VG 1SFXA 4OAYA 2QQ8A 3W2WA 4JI2H 4A0YA 1VF9A 1S7AA 2CO5A 2H1LA 3C7JA 3HOVG 1BC7C 1JKJB 2AGOA 4RB3C 3RI4A 5KFKA 2VKDA 2C2EA 3HRTA 2DW4A 2CJJA 2YS7A 5FKOA 1MBGA 4C3JJ 2VR1A 3FMSA 1IN8A 1WJAA 4O4HF 5TISC 4BY1G 1Z05A 1K4SA 1AHDP 5IYZF 1HNXH 2RVCA 5EZHA 3WHBA 4IVNA 1USSA 4ED0A 1M7JA 2K9QA 1C3OA 4A69C 3T1HH 2BQUA 5KCMA 3I4MG 4DL7A 2DCEA 4BUPA 2HEOA 2EINH 2IMWP 4B4CA 3J7ZI 2OJED 1FP1D 5BS6A 3D5SC 4B43A 2QKLB 2BY3A 1XG1A 1LKXA 3LA2A 5LGNA 4O3OA 2DPIA 1SFUA 3LSGA 3HHGA 1OYWA 2WC2A 5FD6A 1B6AA 3K2ZA 4HAMA 2R7RA 2EFPA 3GXOA 2AXLA 4UV9A 3LSMA 3K10A 5A2QK 4L9NA 1D1CA 4QW8A 1UCRA 4RAFA 1D1AA 2MSYA 2DFIA 3RKXA 3HOZG 2O6GE 4BQOA 4ENMA 1TTYA 1VQ4I 4MIMA 3RSNA 5BQTA 5LHGA 3CTAA 1AU7A 1CF7A 3GIPA 4UCTA 2DODA 3ZQLA 2KZVA 4J9RA 2HI3A 3OIOA 3ORQA 3Q8RB 1OWTA 3GEZA 1UG0A 2I80A 1R4MB 1B4AA 3BG6A 5C3EJ 1WGXA 2CKZB 4DR4H 3H0GG 4Y13A 2CUZA 4XYLB 3GIMA 5KFQA 3Q8PB 3ZCOA 4E7LA 3EUHC 3LQQA 4NDLA 5C1OA 2JTVA 3PSIA 4NQWB 4IHWA 3K4JA 2KIQA 2PMHA 5H2FC 3RYRA 2R5YA 1ZGJA 3PIOF 3BOQA 3BPVA 3EETA 2JVGA 2QUFA 4DV2H 2B63A 3IH3A 4ECTA 4AYBA 3EYIA 1ZLJA 3GTKJ 2QSFX 5DQHA 1HLVA 1PDNC 3I12A 1A35A 3WTTC 1IXCA 1WFXA 5LXTF 3OV8A 1OCOH 1IV8A 3CP2A 4XRSA 3ZMSA 2E19A 2R7LA 1JHFA 4MTEA 2I8CA 2VJ5A 2XAGA 2ZSIB 3Q2OA 4OIOF 4RLQA 3HUGB 3N8DA 2ZCWA 2IGKA 5HVQC 4FISA 4YEJA 4R7RA 1QZYA 4UY8I 5LLQA 3JSPA 3K1NA 5DGAA 2QYZA 2DK5A 2NUAB 3V7CA 5KFGA 3PN1A 3CUQB 3R61A 5F9LA 2XKOA 5F9NA 3HOSA 2UVUA 5BMZA 2Q2EA 1Z9CA 3TDUC 1BR2A 5DG9A 4X64H 1N75A 2PMZA 3N41B 4ASNA 3CC7I 3G6VA 3O6BB 4EGZA 1BNCA 4V2GA 1ZAOA 5EWGA 2DI3A 3GCMA 4YY3H 2DOFA 3K7AJ 1D8JA 2BW3B 3HKZE 2MYSA 2GOXB 4B8XA 2EZKA 1XMXA 4A3MJ 1WI3A 4KUMA 3M4OJ 4CO8A 2KRCA 3AL0C 4PJLA 2QEXI 2W00A 2ADUA 3LSJA 3JAMW 5IY5H 3KAKA 3OSFA 1SMTA 4ED8A 4B3MH 5DLFA 2P81A 2EA2A 4ZZDA 2JSPA 2CV0A 4LF9H 3EYYA 1VTNC 4TV7A 3SDGA 4J9SA 4UUVA 3Q8QB 3VYSB 4YHHH 2W48A 3CQZA 1R5HA 2V9WA 2VQFH 5CKTA 3T5JA 3GFMA 4B3RH 2B9SA 1RC9A 2PQ8A 3HSRA 2M7BA 4EG0A 5JR3A 1E4FT 3P7NA 4O4LF 2R7VA 1G8XA 2EV0A 3L2WA 4PJJA 3BQZA 4V19K 1L3LA 4G12A 2L2OA 1X1PA 3HPHA 4BQQA 2X48A 2VN2A 2RAEA 3KZYA 4YR3A 4RAYA 3QPSA 1IRFA 3C3WA 2LVSA 4CCJA 3ZQCA 2VC1A 5EEHA 1ZREA 3DEWA 2ZXJA 3IKVA 2R5ZA 2NU6B 1DDNA 1B6RA 1NTCA 2H8WA 2CS3A 4OX9H 3BR3A 1MBHA 3GX4X 1GLVA 1A0IA 3RAQA 2XRNA 2UUAH 3M4IA 2UXBH 4EJUA 3NQOA 2FA5A 2K9LA 5TGTA 3S32A 1X1AA 4XLAA 5HOOA 2HQNA 1P4AA 4CZZA 2M1BA 2LD5A 4FM9A 2CV1A 1ZGAA 5B3SH 2HS5A 1WCMG 1UNNC 1R7JA 1QVUA 5D5XB 2MW8A 5CJ9A 2QF7A 2Z99A 3W2VA 3OYFA 2IT0A 3WTZA 1YHQI 1R36A 2RNJA 4HRIA 4IRHA 2WV1A 1R71A 2MCTA 1R22A 2R7QA 4IZOA 5L1IA 3ELKA 3QQAA 1XGMA 3LP8A 3ZR8X 3E6BA 1HKSA 2VIXA 1Y1VJ 2KKOA 4HQMA 1ZR4A 5IP6A 2VUGA 4WXCA 5KFNA 3A0HC 5E3NA 3HHHA 2KP6A 4G7HF 4ME6A 5KFMA 3EUKL 2DLNA 2QLZA 4M3GA 4IQ4A 4Y7NJ 3N40P 5FLVA 3OSGA 2ID3A 2OZUA 2R7DA 3VSLA 4BGDA 1R49A 4LFUA 4XONA 5BR8H 4DZJA 1XSVA 2HZDA 4BE1A 1MIJA 2QYOA 1VQ5I 4IHJF 1UFMA 3GTOJ 3W6KB 3A01A 2X0LA 4BY1J 4ZDOA 1KJQA 2G7HA 4A5NA 1FJLA 2EV6A 4EM2A 2NVQJ 1MZBA 3BQ1A 3L09A 3IP4B 4RMNA 1H9GA 4IEJA 5C8YF 2CWEA 1TC3C 2R6FA 1B9NA 5KT5A 3M9NB 4UHTA 3H0DA 3PNVA 3RIZA 1SFKA 2W9BB 2R7SA 5DV5A 2LLKA 5LP6F 4A12A 2CH0A 1BGWA 2GXGA 1UC9A 1U5TC 2DYRH 1N36H 1Z67A 2C6YA 2LR8A 4ENJA 1Z3YA 3QU3A 1Z6RA 3BCBA 2H6BA 1BBYA 1T0FA 4LLLA 4UCSA 4DOZA 3N44B 4IL6C 4ZJZA 2W8LA 1X3WB 1ZGWA 1E3OC 3VPBA 3BZCA 5AIQA 2ELJA 1OCRH 4RAZA 1O4XA 2HYFA 3JRFA 1FYLA 3HOZJ 1XGNA 4BHCA 4MV7A 4JV0A 2E2HA 2A5WA 1T56A 5FO5A 3MFHA 2KFDA 3A2KA 1JI8A 4J0MA 2ID6A 1QNTA 1XMKA 1TQPA 3H0GJ 4A3BG 2OF7A 4MQVA 4ECXA 3J7AK 1SD7A 3E1SA 2P5VA 2VT3A 2F4MB 2F5CA 2K9NA 1GSOA 2ZDGA 4Y15A 3H3VK 4LH6A 3F8FA 2HDDA 2P8TA 2AHQA 4FCYA 2WB1N 4ZZLA 1FWZA 4IHSA 4EJWA 1TT5B 1T3NA 4HYEA 5GAEJ 2M0CA 4AYBE 1B1BA 1LDDA 2LMDA 4LIUA 4W1UA 3SHFA 1OPCA 2PN1A 5KFCA 1VFCA 3HSFA 1K78A 4B3SH 2CU7A 1TT0A 1O7FA 4K2EA 5J40A 2DJNA 3OYEA 2PBZA 3SI8A 1LE8B 5C5JA 1FYKA 5KFLA 2Z9OA 1AKHA 5KFZA 3H5NA 2XAUA 2TRTA 3FXKA 3MKYB 3CDIA 3VMMA 4FU0A 3I55I 4LOCA 3KTMA 5KT7A 2LY9A 4AIKA 3W2AA 2UUCH 3DV8A 3PL8A 3DPTA 1VQMI 3M9OB 3LSPA 1GSHA 2E34A 2EK5A 4FS2A 4U87A 5JLXA 4YB8B 4HV5A 2OTJI 4RA2A 1PP8F 2L9NA 1MBKA 3K9TA 3KP3A 1ERDA 4ED2A 4YIIA 2PMZE 4QIWE 4ED7A 3Q0UA 2M45A 4BHBA 5DG8A 3Q9SA 4IRCA 4YJ2F 5HDNA 3RPQA 5EG0A 2MH9A 4L5EA 4F52A 2ZFWA 3H5RA 3IG0A 4C5BA 3BQYA 3OSNA 4F4XA 4XKWA 3DLAA 4HNVA 1ZELA 3IAM2 1K83J 3RB3A 2FBIA 4C5AA 1KYWA 2OTLI 4YRVA 1KU7A 1B9MA 5ILVA 3FM3A 2O8KA 3IN5A 1HW2A 3KHLA 1RZ4A 3NAUA 3KALA 5IYBG 2LNBA 4HF0A 1ETYA 1ZHFA 2OAZA 3IL2A 1ZHSA 4Z6YA 2R85A 5JH7F 2NVYJ 3AYHB 1F9NA 5KFVA 1CQJB 2CGPA 4Q48A 3LAJA 4N9IA 4O4IF 2NYXA 4DYQA 4O3QA 3BR6A 2KIFA 2R7TA 3HPGA 1W7PA 1K1SA 4IRGA 3GTKA 2BYVE 1JKOC 1NG7A 1BI1A 4L9VA 1E17A 3D0SA 1KJIA 1B59A 2UWMA 1TNSA 1U2WA 3G6YA 3OS1A 3PO2G 3UQ8A 2H6CA 4I4TF 1B8IB 2IA2A 5L3BA 3RV3A 3M1EA 2NOJB 5GPCA 3X2QH 3HL2A 4L1KA 2K02A 4RB0A 2D2WA 2PJRB 1RJQA 3GMEA 1PX2A 3T5HA 4MA0A 2YYAA 1UMQA 5F1RA 4UCVA 3VSKA 2W82A 2DPDA 1PK8A 2Z2SB 1P7IA 2BZTA 1WKMA 1SVLA 3PNYA 4RGXA 3E6CC 3S3OA 2LKPA 1U3EM 2VOPA 3MWEA 4RNOA 2V4QA 1V9PA 3IUOA 4A3EG 1R9TA 5EWEA 2AQ4A 3BJAA 3BY6A 3F72A 4F92B 1O75A 2DMPA 1ZKGA 1Z91A 3R0JA 4F55A 3ASOH 2E36A 4B3TH 4JI0H 2DYSH 2L4AA 3RKYA 3SEQA 2DDAA 5GADJ 4AWXB 2IAIA 3OY9A 4OIRF 4PJNA 4I0BA 3Q8SB 2Y9YA 1W7PD 1MMAA 2FQ4A 2XV4S 3M07A 2LF8A 2GPSA 1WCMJ 3RDIA 1FMVA 2AO9A 1ZTRA 3V4ZA 5K7HA 4A2AA 3M9MB 2AXTC 2YRWA 5E8GA 2DJIA 2HZTA 2H1KA 2BR0A 3OIPA 1RJRA 3WTSC 2FPPB 2XGCA 3QP5A 1JTYA 3TQNA 2BVLA 2F5DA 1BM9A 1DQUA 3RCOA 3T5LA 4PFPA 5J1UA 3U2RA 4MEYF 1K61A 4IF4A 3T5XA 5CVJA 4HX4A 4EQQA 3AAFA 3PFIA 4J19A 2VBWA 3I54A 3M8FA 5KX5F 4FX0A 3FK7A 1P2FA 3OYLA 4QWDA 4YR0A 3GO5A 4GRIA 2HVSA 3H9QA 1Y8RB 3S2HJ 3OR1C 1W5CC 3R5FA 2R8GA 1STZA 3BP8A 4DJAA 2R84A 2W1OA 4ZI7F 3VPDA 1FOYA 4G7ZF 1GV5A 4V2FA 4L5IA 2DPJA 2P7VB 4L9JA 1KJJA 1EJ9A 3RAXA 4ECSA 3L7WA 3WGIA 4IXAA 3TOBA 4N4NB 1IZ1A 1YS7A 4L18B 1Z7UA 5FLXW 1IBLH 1QU3A 4IJAA 2Y0SN 2FBHA 4CCLA 4YAKB 3MFIA 2CG4A 3RGXA 1IBKH 4KJZA 3J7AY 1D5YA 2GQQA 1EKEA 3QWLA 3B6AA 1BJZA 3CCRI 5IYDG 2JEJA 3WGHA 2NNYA 4U7BA 4BACA 3ETJA 5KFDA 3SJMA 1J75A 1K1QA 3JZIA 1H0MA 1I39A 4DL3A 2XAJA 3OYAA 2SCUB 1OJLA 3WHCA 4DBRA 3QOEA 1HKQA 3G2BA 2EIMH 4KMFA 2O61A 1ZHQA 4BBSG 1VQNI 1FJGH 2CQ7A 1WJBA 2NAZA 5C4JJ 2HOTA 2LBFB 4ETSA 1HBXG 1N48A 2FUG2 4MO7A 1WH5A 1XNQH 5E1ZB 4A3JG 4JYAH 2D1VA 1I3AA 2JSCA 1Y1VA 5J1RA 3RF2A 1ZYRF 3JRIA 3HRUA 5K1YA 4A3BJ 4P55A 2W25A 4F4YA 5KFFA 2Y31A 4GO1A 1A6IA 5KNLA 2EV5A 4RB1A 2QBYB 3G1OA 1RR8C 3H9GA 2JWTA 3RYPA 2LKXA 1QO0D 3FHZA 1C0WA 3PW5A 5KFSA 4G8XA 1WJFA 5F27A 3ZGKA 4F7ZA 1DU6A 2Z5UA 2R87A 3ABTA 1N33H 2HFHA 3Q1KA 2O3FA 3L2RA 2EFWA 3GTOA 3QRFF 4KNYA 2DDBA 2JRMA 3LSHA 2DA5A 2BY2A 3TP3A 1P9QC 1ITYA 1EA3A 1MBFA 2PMUA 2DMUA 3ERMA 3FXOA 4OINF 2WAQN 2KQRA 1H88C 2A07F 1CF7B 5C4XG 3HG9A 2R8HA 2XIGA 2XF6A 4UUSA 4M72A 2MH2A 1K7AA 3PIPF 3CESA 3GFIA 2ESNA 2ATLA 4N9HA 4RM3A 3BQ0A 5FROA 1I3QJ 2CUEA 1XX5A 2VBXA 2P6TA 2JUCA 4XSZF 3ONQA 4M9SA 3RPUA 2FQ3A 1O3QA 2DOEA 2EILH 4HOBA 3CMMA 4YELA 4HQ6A 3EDPA 2EB7A 5M3FJ 4IKFA 4F50A 4RLFA 3OYNA 2YL2A 3CMEI 1SCUB 4EFEA 2O0YA 4WBNF 2RV8A 5FKNA 2R5YB 3DP7A 1APLC 2HR3A 2W6NA 3JRWA 2Y2ZA 3G6XA 5GPAA 3EQLF 2L54A 4BNCA 1UG2A 4QWQA 2VB6A 4B3AA 1T38A 2PLYA 1FIAA 3VB2A 3JRHA 2RC4A 5EZGA 1D5VA 4KMUX 2VUMG 1GUUA 2V9KA 4DR3H 2NNNA 1SFOJ 2AGPA 2XDVA 4DV4H 4DR2H 9ANTA 4N0BA 3H0GA 1IN5A 5LEKA 3C18A 1I7NA 4LGWA 2Z3YA 1XB4A 2BHZA 4KN7X 4M9ZA 1ON1A 4KITB 5M5WJ 2DN0A 5IYBJ 5KFXA 2X85A 2WDTA 2F48A 2VPLA 3CJTB 4FTHA 5HLHA 3HRMA 4YP3A 1T98A 1SEIA 1GVJA 2MLGA 2QQ9A 3PW0A 4JUZA 4I76A 2ZM6H 1UJ8A 3HGYA 2QKMB 4PK4A 4ZOLF 2CMPA 1R58A 3DKXA 1KC7A 2A3SA 5EEAA 3RPUD 1U8RA 2GM4A 2ICWG 2IBKA 1LFBA 3LA7A 3QODA 1VQPI 1NHAA 1V5GA 1ETKA 1LEAA 1XPXA 3PO2J 2DMQA 1OCTC 2YS6A 5GAGJ 1RPWA 3LMMA 1KEEA 4M3EA 2K86A 3WO1A 2IJLA 5EEGA 2PJPA 5KHDA 1K6YA 4IZZA 1NK2P 4EJVA 5J4VA 3E5NA 4ABZA 4HNUA 2WV0A 2M34A 5L9XA 2FK1A 3ZPLA 4A3EJ 2W6ZA 2HJWA 1J9IA 4ITVA 1H89C 1IDZA 2XPVA 1ZN2A 1RR7A 3QP6A 1EYZA 2HWVA 2WTEA 3U1KA 4LG3A 4EJOA 4YAJB 1K83A 1QZZA 2RDPA 4PSWA 4NXNH 3VYTB 1BR1A 4A6DA 2H09A 2STTA 3CCUI 3IWFA 3I4PA 2HKXA 3FK6A 1I50J 4R8UB 1VQOI 1OMIA 1YJ9I 4RUAA 1F36A 3EPGA 2UUZA 1LJ9A 2VLAA 3IH2A 2ZNYA 3L00A 4EMSA 2QQAA 2NVYA 1IV6A 1IW7F 2ZB9A 3K69A 3KLNA 2R0QC 3VFZA 1DPUA 2JEFA 2NS0A 4C3HJ 3F0CA 3PW4A 1FLIA 5KFTA 4IPAA 4E7HA 1HA8A 3C0FB 4U6PA 2OH2A 2FK3A 4W97A 3QZ7A 5FPOA 3PW7A 4BYYA 3J81K 1TQMA 3L1PA 4KDPA 2DO7A 3TIGA 2M30A 1E4EA 3OUUA 2V59A 2X4HA 1Q1VA 4EATA 1YRNA 4UCUA 5IT9K 5DCMB 2W6OA 2ZMEA 2YZNA 3L2PA 1YIOA 2K85A 1U9NA 3K1PA 3TO6A 4CDGA 3F22A 2L01A 4LF7H 1RUNA 1MMDA 1IN6A 4I09A 2IVMA 4MTDA 4IRKA 1S03G 4ZH4F 5LGTA 2XHKA 3B73A 3G6EI 2K9SA 2JRTA 2DFEA 4ECUA 1S7EA 5FLXK 2VJIA 1PJRA 5KAFC 1JDBB 2OCCH 3PR5B 4BHPA 2W71A 2UXXA 3K4NA 5FJ8G 1PUFA 1TA8A 2IGNA 3HKZN 1T0FC 1MMGA 3BG5A 4GXOA 4IAJA 1V5FA 3ROUA 3OYCA 2YU9J 3KE2A 2E1MC 2JA5G 3HIFA 4DIQA 1D8KA 1W0TA 4J9OA 2RDIA 1IOVA 1J0RA 4ED3A 3N42B 3T5KA 1KJ8A 3Q0WA 3GTQA 3KYCB 3FF5A 3HZJA 4AIDA 3T1YH 1R5ID 2EH3A 3ZMUA 2HQAA 3EPIA 4D9JA 4C3IJ 3LAPA 4B09A 3GUDA 2BY1A 4XYMB 4YR2A 2IA1A 1G3WA 4ZYHA 1RK6A 5IYDJ 1ETQA 2VT2A 3COAC 3L2VA 1VQ8I 1WCMA 5H80A 2ECBA 2K9MA 3ZRGA 4C5CA 4ED1A 2OV7A 2CFXA 4ANJA 1OQYA 3R23A 5D6FA 1P4WA 4ZYEA 3PZPA 3QPHA 3GZNB 1ODDA 4ZTJA 2V7FA 4ESJA 1XS9A 3A01B 4BBSJ 2M05A 4A3DG 2DA7A 2C22A 4JV1A 3I0TA 2FNAA 1E4GT 4XLHA 3JRXA 4ECRA 1X4PA 3ASNH 2EFNA 1DP7P 2J5PA 4A3JJ 3JTHA 5DYMA 2L9SA 2M87A 2OC6A 1GDTA 1Y1WJ 5JUMA 4MA5A 2RKHA 1UHSA 2X1DA 4FETA 1B33N 3GZ6A 2ZSHB 4C2MJ 1Z2NX 4DR6H 5L3GA 2CRGA 3PJRA 3IRQA 2XAHA 2GOMA 2VQEH 1KONA 5E79C 3K5IA 2V1DA 1X19A 3LSRA 1E3PA 1TWAJ 2E1MB 2L7MP 3E6MA 4NB5A 2FLLA 3G73A 2UUBH 4Q8EA 2PI0A 1RYRA 4OAZA 3S93A 3CC4I 2HGSA 1R6RA 2ZJPF 1H9TA 1WH7A 3I3LA 5C4XJ 2YZMA 4P96A 3HC7A 3PQJA 1T8IA 4G3IA 5E8IA 4M3FA 4CICA 3HXLA 4DZPA 1G3SA 4CYCA 5EGOB 4Q8FA 2VQDA 2HOSA 3GTPA 2LTPA 2LK2A 4LG0A 2F5VA 4O5VA 1U8BA 2GZWA 5C44J 1B72A 5K5QA 4M9XA 5FPRA 2OWOA 1SMYF 4QLCU 2K40A 3SEZA 4WK8F 2L4MA 3CMAI 5LMUH 1O7LA 4RNNA 3MZ8A 2UXCH 1F43A 3OYKA 1TWHA 2YPRA 2AS5F 4P1WA 4QPQA 1YE9A 4JI1H 3QPLA 5F0CA 2XASA 2VUMJ 2Q2TA 3TQTA 2WAEA 1AKHB 1A36A 3U9TA 4IOAF 5DG7A 4JBAA 2AGQA 3FXLA 2DWCA 3OYIA 3OTOH 2FSWA 5B66C 5KG0A 4UNOA 3F8BA 3BDDA 1EF4A 4G6QA 2DPUA 2XGPA 2XAFA 1R00A 1B6SA 3HBLA 1T95A 5KFOA 2EA4A 3Q9VA 2IEKA 1P7JA 4G94A 3CCVI 5KFRA 1RKWA 5CA0F 1SD6A 2HGCA 2N8GA 1P4XA 3TKYA 3IRRA 4UCRA 4GYGA 4KT6A 4WWCA 3J7YJ 3B02A 3C2HA 3S17J 3MR6A 1Z2PX 2STWA 2XUBA 4AM3A 3S2DJ 3RKQA 5KAIC 3BC8A 5H6RA 3G1MA 1POGA 4M71A 2NU8B 2GA2A 4GFBA 5LFAA 3CJNA 3JSLA 5KFPA 1IGNA 1ULYA 2LP0A 3RB0A 2VL8A 5D8KB 3GF2A 4FS1A 3T8TA 4QPOA 3PSFA 3J80Z 1S3JA 1I3QA 4X65H 2ASDA 3HSEA 3SZTA 2W9CA 2I87A 1BA5A 1WJEA 1BN5A 1PYVA 2FD5A 2XPUA 2G9WA 3R4KA 1SD5A 2JQ7A 3AL0B 4PFOA 3S8PA 3DU6A 1FVIA 2LY1A 4Y52J 2JPBA 1NH3A 3N43B 2CQNA 4A0XA 1LEBA 4ESFA 2MG4A 3GFJA 4CCKA 3DKYA 1W7PB 2R92G 2R8JA 2MBFA 5FB2A 2GA1A 3OSPA 2ZXWH 1N56A 2K7LA 1SFOA 1DU0A 4BU2A 4XN0A 1Y0UA 3RUPA 1EV7A 3W6JB 2XGEA 1EUCB 3LSIA 4HX7A 1RI7A 5LRRA 3QAHA 2E5ZA 2FEZA 2GLTA 3MR2A 4J9LA 3RFCA 2E60A 5LD2C 5CYVA 2RQPA 2NS8A 4CH7A 2E7XA 2ACJA 2I10A 1QA6A 3VODA 1P6RA 3JRBA 3H35A 4AVZA 1TNTA 2A69F 5E3MA 4QW9A 4F4ZA 4HQEA 4L9TA 3GV5B 3OYGA 1MJAA 5KG1A 5M3MJ 5HLTA 4DUYH 1CQIB 3TO7A 4XKBA 1SFEA 1W5SA 3FBNB 3OL4A 4KHPH 1S5LC 4M3BA 4MFDA 3V7RA 3PVXA 4D5CA 4F91B 3F8CA 1MJBA 4GYIA 2P7CB 5DQIA 2W70A 4A3CG 2YS9A 4BY7G 4NXMH 5D6EA 1G59A 2OA4A 4AD9A 4ENNA 3C2BA 5HS8A 5DUKA 1U0JA 2LSOA 2PMZN 4QIWN 3TOAA 3BG3A 3S2WA 2W7OA 1JUSA 1QGPA 2VKVA 3MZYA 2FK2A 2D45A 3OYDA 2KT0A 4RB2C 4GGGA 4HDVA 5JFRA 4BEHA 4YFXF 2VJJA 4CCNA 1JUPA 1KQ9A 2B7EA 2O7OA 2COBA 5FJ8J 3OS2A 3BABA 2EQRA 4YG2F 2BQ3A 2JA5J 2O8XA 2X6OA 4DLKA 3IC7A 3GTLA 1ZK8A 4KIBA 3CCLI 2UXDH 4F93B 1DGSA 2H94A 4GDFA 2XF7A 4XRFA 3CUOA 2QQBA 4Q5SF 2W4SA 3K70D 3GVAA 4XLCA 5D1OB 1HNZH 4G6TB 3KZZA 1TWFJ 2V9PA 5F0HA 2A61A 1LDJA 2L5QA 4DBQA 2XAQA 4DW6A 3WU0A 1BOBA 3KEYA 4AUXA 1FY7A 1MSFC 1A31A 3QYFA 1BL0A 4CA0A 5J47A 3GIDA 4A3DJ 3DTKA 3HUGA 1TQIA 5HODA 1R1VA 4OWRB 2X9DA 4JP0A 1RUOA 1FKAH 3VWBA 2E1OA 3KP6A 5JHUA 2ELHA 3F9KA 2WTFA 1HXDA 2MFZA 3WGGA 5HBRB 2W9AA 3CP8A 2EBIA 1MKMA 3CUQA 5CAEB 3K1MA 1H8AC 1KZHA 4QWBA 1U5TB 4H4KC 4A0ZA 1GSAA 3BZ6A 3K4CA 4WCGA 1BC8C 4CC5A 2O9LA 1V4YA 5L1LA 3MR3A 2X1EA 4EM1A 3KLOA 3CLOA 4GLXA 3OS0A 1IOWA 2RF4A 3J80W 1ZETA 5CVVA 2V79A 1WI9A 3N4MA 1UAAA 2VA3A 2C2RA 3L2CA 4IX7A 4TUYF 3DU5A 1F5TA 3T8RA 4FE7A 3UKGA 2DA1A 3KHGA 2NS7A 4TV8F 2RN7A 3KETA 4G6DA 3AFHA 5EJCA 2Q1ZB 3LWBA 3RZDJ 1PVEA 2VE8A 2A6HF 2MLKA 2KRHA 3KFWX 3E3VA 3QPTA 4HSRA 4KT5C 3ZXSA 5IT9Z 1OLTA 4FBUA 4YFKF 3JAMK 3L2QA 3B6CA 5EZYF 2WY8Q 4HYKA 2HHHH 2A5YB 3LNQA 4II2A 1ACIA 1TZLA 4LSXA 3SQNA 2R7UA 3MR5A 2Y69H 4AU7A 2E7WA 3BCAA 3RQ4A 1SAUA 3PFYA 1T36A 1KQ0A 2GXAA 4OMZA 4BJTA 3EUAA 3S1RJ 3U21A 2PX9A 1MD0A 5LA6F 2HPMA 3H4BA 2L3DA 2JEIA 4QJFA 2E1NA 3BG7A 4JYKA 4CYDA 3DXJF 2JA7G 5A2QZ 1V51A 1AN7A 1JKRC 2KPMA 4IR9A 3ZQIA 3ML6A 5KFUA 4C2MA 3CCEI 2AQEA 3P9KA 4ZC3A 4I50F 3HOXG 4A3FG 2Y0SA 2IS6A 3JR9A 4LSAA 1N77A 1XC5A 1LNWA 2IS1A 1A5JA 3KXYT 1VQ9I 4LB6B 1ETXA 3ORRA 1BI2A 1QZEA 1V54H 2F4OB 2QSHX 2PBIA 5KFHA 1ONVA 3M7GA 2HXIA 4ECQA 4MGRA 3FM5A 3ZQFA 2E35A 1FNNA 5ICEA 2VASA 1I7LA 4MHGA 3MWDA 3D5RC 3FISA 3RQIA 2QM3A 3KP4A 3RTXA 4KFCA 3I53A 1D0ZA 2M5WA 4B1RA 1TL8A 3ERED 5F64A 3NGDA 4QTRA 4KIFA 3K3VA 3WO0A 4EM0B 3KYLA 2JMWA 2FNPA 1S10A 2XC7A 4M9UA 1U9OA 4XORA 2VQGA 2O03A 3GTJJ 1MDMA 2EFOA 2CSOA 2JN6A 2OUMA 3HRSA 4M3DA 5LHHA 2R7ZG 2BQRA 3AG2H 2FMAA 3F3XA 3BPXA 3REOA 2P4WA 2EPFA 2X6XA 4B44A 4BDZA 5KG2A 2L02A 3V42A 2JUGA 4B48A 3H92A 4BH9A 4DV0H 1N32H 2R92J 2E71A 3CZ6A 4BL0B 3I59B 1MNMC 3KP2A 2W7NA 5EOYA 2VUMA 1S0MA 4PJ0C 2AQFA 4CXFA 2WAQA 2FOWA 4D1QA 2OLSA 4D5FA 4RGUA 3QYBA 1Z1DA 4ZYDA 4PUSA 2WADA 3RB6A 1ZARA 4GC6A 4IRIA 4DL5A 4ZDLA 1YITI 1YJWI 4LK1F 3TP0A 4DYCA 4J01A 5CPRB 2FMYA 2IBDA 4HG2A 5J6XA 4PGHA 2BEOA 1NK3P 3SFIA 4IOCF 3E97A 1M1EB 4D7NA 2ZMEC 3LOCA 4XK4A 2W9BA 2DAOA 2LDUA 2W57A 3V8JA 4J9MA 1DGRM 4XICA 4HLYA 2IA6A 2V6EA 1F1ZA 4A3GG 2IS2A 1XMQH 1IN7A 3LA3A 1HNWH 3JRAA 5LYJF 2A6EF 1DPRA 5B1AH 1VQKI 3GTMJ 4A3CJ 1J5YA 4BY7J 4LD5A 1IC8A 1S29A 2NXNB 2WAFA 1XD7A 5KK1A 3BA8A 1WSUA 3MZHA 3RBEA 3G4SI 1KU2A 1IN4A 5H20A 2Y9ZA 2Z16A 1FYMA 1OYIA 3O8HA 1YS6A 2Z1DA 1BIAA 1WH2A 5KG6A 3H20A 5E20A 2V6CA 1MMNA 2VXZA 3GLXA 4UVCA 1Y39A 3PO3G 4GCVA 2Q0OA 2DT6A 2KIMA 4LFAH 1VQ6I 1X1DA 1YW9A 2J5OA 4Y3OA 3M8EA 2C35B 4HR7A 2CUFA 2KSWA 3FWEA 3CCMI 1FBUA 4QWAA 2W24A 3BR1A 3WTVC 4EV0A 3DF8A 5DQGA 2BY0A 5DM6F 1HW5A 4A3IG 2W6PA 5E1WA 4UUTA 3MQ0A 4CUGA 2VQLA 4UCOA 1JXSA 3LSKA 1N34H 1AA7A 4P9UA 3O2PE 1T2KA 1IG7A 1YYVA 1Y14B 2V4RA 1FBQA 1LE8A 3DKWA 3KX2A 1VKZA 4LLNA 3CO7C 3DTEA 5DUIA 5KFAA 3K0LA 3OYBA 3JRDA 5KFWA 2IP2A 2R7MA 1Y1WG 2DFHA 3FXJA 5B1BH 2XCAA 5JQWA 1JXLA 3QZ8A 4MAMA 4Q4ZF 5A2QW 2UXNA 3GQCA 2IW5A 2PVPA 4KICA 4NBQA 3WU1B 4LITA 3FKJA 1L2ZA 2RNGA 1V4RA 3BR0A 4ECZA 1OKRA 1XTAA 4CCMA 3IWZA 3CF5F 2BOLA 2BBYA 2LC2A 1D3YA 1O3TA 1EZ1A 2ZC2A 5J2UF 1YG2A 1KJ9A 3U1DA 2JA6G 1OR7A 2DBBA 5KT3A 1BR4A 4MLOA 3CVZA 1JJ8C 2GPWA 5LHIA 2DT7B 3CJRB 3KEOA 3R5XA 2ZFUA 3JRCA 4II3A 4LJZF 2K4BA 3RJ0A 4HX8A 1SD4A 1ENHA 5C44G 5L1JA 2JA5A 2FP4B 2XD4A 1X1CA 1WHUA 2DT5A 2J9GA 2RGRA 1JLLB 2DZDA 4KA4A 3P5JA 1X58A 2HVRA 1X3ZB 3F21A 2HVQA 2V4JC 4OIQF 1AOYA 3VYRB 2ZJ2A 2HXOA 5E18F 3ZQQA 3IV5A 4J00A 1C30A 4LH7A 4JV2A 1YOVB 4DV1H 5HS9A 3L4JA 2XRLA 1ZH5A 1TWFA 3TINA 4RZRA 2DMTA 2PN6A 4JX6A 1TWGJ 3Q3SA 5D4RA 3E5UA 3CLQA 4CGZA 1Z7LA 1IO2A 2EZIA 3FIWA 4HV6A 5KVRA 5BOXA 5HDGA 1WR2A 4LLGF 3LWFA 2ZDHA 2R93G 4M7EA 3S1NJ 4JV5H 1REPC 1BXRA 3HOWG 4PCQA 1VBHA 5D8LB 1B8IA 2ISYA 2W6MA 3O8GA 3PM1A 2PJRA 4EBDA 3R6SA 4O3SA 1YIJI 2K5CA 3PUFA 5TRDA 3E5QA 3HKZA 1M6VA 3FKIG 4UVAA 1OCCH 2JA7J 4I0AA 1RKTA 2E5LH 4NLGA 3SZGA 2ETHA 2VA2A 1Z0XA 3V4GA 3ZQ7A 4A3FJ 1IRZA 3HOXJ 2Q2EB 3S3NA 3NARA 5FFXA 1B72B 2BE5F 2COMA 2OBPA 4NC6A 1I5ZA 4NNJA 4XNFA 2P5LC 1ZG5A 2V5AA 4EGQA 3PQKA 4A3KG 5D4SA 2BVMA 3GIKA 3I4NG 4E7SA 3SXYA 2DA4A 3GV7B 2FMLA 3LMLA 3LL7A 5CLSA 2JPCA 2R8KA 4HEA2 5JI6A 3BQ2A 2I5UA 2M4GA 2DTRA 3HOTA 3WE2A 4E7JA 4MV6A 3GBGA 2VI6A 4A93G 4AIJA 2Q2UA 5LBQA 3S1MJ 4WXDA 3ULQB 5GAHJ 2XPWA 3ECOA 4I55F 1TWCJ 4ZYAA 2R7ZJ 3V4SA 2LH9A 1WQ2A 4D7MA 4KYWA 1MJ9A 4L0YB 4O3MA 1ULZA 1ORKA 1VI0A 1R4NB 3BR2A 1TW2A 3AKZA 3UR3C 3FXMA 2DIKA 2ZJTA 3WTXC 1IXSB 3G71I 5DCFA 4M6XA 4BXFA 3ETHA 2HQ5A 3K70C 4O2BF 1FZPB 4XQFA 5IP7G 4L5JA 4X66H 1KA8A 3OMYA 4UVBA 2E2IJ 4HDUA 4TQRA 4MQ9F 1DV2A 1M0TA 1HR0H 4I01A 4FQGA 1BIBA 4O3NA 3A02A 1MH3A 2W9CB 1KU9A 2Z33A 2FB9A 4EFBA 1GLNA 2R5ZB 1XGSA 3K4BA 3MD2A 4PSXA 4DNCA 4EGYA 4D0PA 3CD6I 1FEXA 4PWQA 4G9YA 4HF2A 5FRNA 2BV6A 1BOAA 5CA1F 3CF2A 4QWCA 3S3MA 4LFBH 1J5EH 4ZYGA 2QENA 2NVXJ 3I9V2 4Q44A 2F6CA 4FBTA 2K3FA 3HTUA 4PGGA 4A3GJ 2DQRA 2KZGA 2G0EA 2X51A 4Y4RA 3ZMDA 1BJAA 1GO3E 2NVUB 2XF5A 5CVRA 1KU3A 4DYRA 1W5TA 2W6QA 4F4WA 2QVOA 5AONA 3OHBA 1ZRDA 3MEXA 3KZIC 1KGSA 2EFQA 4FASD 5HS7A 5ICGA 4IWYA 4MEXF 4DL2A 2IPQX 2ZDQA 2LBFA 2R7XA 3GTJA 4HZFA 1GVDA 5KFJA 1G3TA 1K6OA 3TEDA 3PO3J 1GT0C 3GTGJ 2O5RA 4J9PA 2DA6A 3E7LA 4U0YA 2Y0MA 2R92A 3M9AA 5EWFA 3BWGA 2QBYA 1WJ5A 1X9NA 2ASJA 2KDZA 4EEQA 5K5OA 2FX0A 4A3IJ 1ZRFA 3TGNA 4OIPF 5L1KA 3OL3A 2VJ4A 1TAEA 1P92A 2F4VH 4MFEA 5ED4A 3DEUA 1VBGA 5LL6b 2FBKA 5J8FA 3SE7A 2V26A 2CW8A 3PUBA 4S05A 3RGZA 2L7KA 4R1HA 2EJRA 2ZKZA 2OD5A 1VZ0A 3N6XA 2LY2A 1RETA 3CUQC 1YO5C 3JREA 1QHHD 3N05A 4O6JA 4BEHB 3RZOJ 2XB0X 2P0AA 3TQ1A 1IRXA 2R7OA 3TW7A 1KYZA 5HNFA 1M0WA 2Y48A 2R4GA 4BQNA 5F6FA 4EYHB 3RIRA 1XCBA 4N4OB 1O3SA 1IAWA 5DS9A 4HW0A 4I7HA 3GTMA 1QQIA 2PFBA 2W85A 4XM3A 1OCPA 2HQRA 2JA6J 5FLMG 4BE0A 2WY7Q 4LF8H 2LYCA 3HTSB 4PZJA 4E4TA 2MA3A 3OWTA 1XSDA 1W36D 4LF6H 2DXIA 2XC9A 2DU9A 2W8KA 2VPQA 3DBHB 5FD5A 3JSOA 3G8CA 4HPQA 3MKZA 2L9VA 2CQQA 1YW8A 3BJOA 3GYHX 3E5XA 4L0ZB 2QA4I 3OOUA 4DV7H 3N97A 2QCOA 3QU6A 2XCPA 2F4IA 1JE8A 1W4MA 4QSHA 3Q5FA 1G6NA 1X2NA 3DEEA 4P5OA 3BA9A 4O3RA 1IUYA 2WE6A 5FGMA 3DBLB 1JUMA 1BW5A 4QWEA 4EBCA 2QGUA 1DP3A 4JX5A 1IF1A 2X0SA 2XSJC 2ZBKA 3C2GA 3GZ5A 1LVAA 3KP5A 3NWSA 4U7DA 1X3UA 2C00A 4XR6A 3ZMZA 1LB2A 1K78B 1HCRA 2VOOA 2ASLA 3D1NI 3V8KA 2TDXA 2ZO4A 2XSDC 1S6LA 2RGVA 3TW6A 1I6HJ 1R9TJ 2RREA 5EDNA 5D5VB 3IKTA 1FOXA 3HGGA 1X4OA 1RIOH 3IH4A 4APMA 4CCOA 5BPDA 2R7FA 4QIWA 4A2BA 4E4HA 3RJPA 1JT6A 5ICFA 5M5XJ 2R93J 3WTWC 1K79A 2JT1A 4KISA 3HOWJ 1FTZA 5E17F 4DR1H 2KJBA 4LMYA 2JJ7A 5ERIA 4PDBA 3T0YA 4ZQIA 2ZXHA 4X1EA 4LB5A 2P6SA 4C9YA 3FKIJ 4EVIA 1MH4A 3TIIA 2CYYA 3M8JA 2WA0A 4PDKA 2XGXA 2F2EA 3CCJI 5IP9G 5EG0B 1EHIA 3FDSA 5DDGA 3A0BC 1MNEA 3DTIA 4EEYA 2E2JJ 1I94H 1ZG3A 1V3FA 5K7FA 1I1GA 4H0EA 4XN3A 2OU2A 4A3KJ 4A3LG 2IGMA 2KLOA 3HOYG 2I8DA 2X6YA 4DUZH 3I4NJ 4JI5H 4EEFG 5M5YJ 1CQTA 1VS0A 1ZRCA 1SANA 2B0LA 1JKQC 4R8UA 4XL9A 4BXUA 1WSCA 3FXRA 1W93A 1I6UA 4BJ5C 3VOEA 5KFBA 1E2XA 1ZLKA 5LEJA 3MJFA 1ZQ7A 2R8IA 3KHHA 4DV5H 2WB1A 3F23A 2V1NA 4I6ZA 1T39A 4IR1A 4WX9A 3HB9A 4M6VA 4A93J 1UB9A 3L4KA 4YQWA 3HOUG 1ZR2A 3JSNA 4MV4A 4K0KH 4R79A 2QZ8A 1IDYA 1YLFA 3K4LA 1A6QA 3GV8B 1TWGA 1P8LA 4X0GA 1XN7A 5F0FA 3A4CA 3GW2A 2E1CA 2M2EA 1W96A 3NWTA 5CB4F 4JX4A 3QOPA 4AYBN 1JGSA 1GXQA 1WWXA 4OOIA 3MVPA 4XMYA 2YZGA 4E7IA 2DOAA 4ON0A 1XGOA 1ETOA 3J7AO 3V6JA 4CZCA 1IJWC 3VPRA 1XDNA 2IP4A 4A5MA 5DCMA 3WODF 2M8GX 3CCQI 4RZQA 3VYUB 2M9HA 2K4JA 3E0JB 3GLLA 1Z6TA 4BKXA 3LFKA 1D0XA 4UB8C 5H6QA 1VAJA 3FXQA 2JA7A 5IP7J 1EH7A 2ISZA 2JZYA 1JHHA 1LFPA 1LDKB 3H9JA 4Y17A 3ABKH 1G2HA 4JI4H 4O2AF 4B3XA 1OCZH 4U0VA 1XMOH 2FOKA 1S7OA 1TBXA 1TW3A 3BJYA 1T08B 2MGQA 3K4KA 1LQ1A 3OYJA 1UC8A 2HU9A 1XMAA 1USTA 1IUFA 5GTHC 1FSHA 2CW7A 5LOVF 1S8NA 1N78A 3A1YA 3ZN0A 3GILA 1MDMB 3GFLA 4RGRA 3BLYA 1DGWY 3KYDB 4NUBA 1HF0A 5B5EC 4Q47A 1DV1A 1QPIA 2B63G 3QFFA 4JI8H 1T94A 2P5KA 2FU4A 3BTIA 3JW4A 3HOVJ 4I98B 3CMYA 1FX7A 4YIRX 1CGPA 4HF1A 5D8DA 2FRHA 5CQGA 2ECCA 2V1XA 1ETWA 1SC7A 4XRSG 2HDCA 1WJDA 1KBLA 2R3SA 4XKVA 3MWMA 1BI3A 3KHRA 2OPTA 2PG4A 1B04A 1SVMA 3L9FA 2ZJQF 1HC8A 2CQYA 2UZKA 3V6HA 5KT6A 3ZMTA 2EIJH 2YU3A 1WJCA 1ON2A 4NQWA 4RBOA 1TWCA 4AC0A 2YSRA 2R7ZA 3I58A 2A6TA 5GTIC 2YUSA 4Q45A 1I50A 3ZMVA 2HTJA 3F8NA 4FE4A 5HDKA 4Y8VB 5BPFA 5E3OA 3V6KA 3I4MJ 5JVLA 4JI7H 4UV8A 2VQCA 5TJJA 4Q0YA 3DWLE 2OQRA 5KFIA 5L3FA 3TBIA 2UVVA 4J9QA 2L0KA 1WRJA 1Y56A 3OOPA 4JQFA 4RS8A 2YR2A 5FKLA 1FOKA 1GGOA 2HDWA 5KG5A 2ZNZA 3DLLF 3BTCA 1JGGA 5CVIA 1RK5A 5FKMA 4BDYA 2BGCA 2E2IA 3W3CA 4FHTA 1S97A 3K6GA 4MV8A 1GHCA 3UFXB 4KIGA 4XLPF 1FIPA 1X2MA 2LRDA 1S68A 4EBEA 1T33A 3VPCA 1OR7C 4MNUA 3ABMH 2XGDA 1JX4A 3MAJA 2NVXA 4U0WA 4LK0F 3DFGA 2CFOA 2GWRA 2EZHA 5K2MA 3WG9A 3TMOA 1Y8QB 5EGOA 1DIKA 4BBRG 2V9VA 4HLXA 5JVDF 2IGOA 1ETVA 4X62H 2WYOA 2L7FP 2NU7B 4O3PA 3UNGC 3CCSI 2LG4A 4ECYA 4AIHA 3BR5A 4S0HB 5DGBA 5DTDA 1W0UA 4BWSC 2BW3A 3EUHA 5FLMJ 2RQQA 1GXPA 4IHYA 4RUCA 1NG6A 3S1QJ 2UV1A 3OIQA 2WWYA 2YU9A 2F5EA 4KN4X 1WZ2A 2FPIB 3BROA 3I5UA 3J81Z 1UELB 1UHWA 2BHYA 4XLFA 4XBFA 3WE3A 3MKWB 4YIFA 4PJMA 3GTGA 3DPLC 3G1LA 5KT2A 1KQ8A 3SZPA 1E0EA 4I2OA 2A68F 3FHNA 3IAS2 4P9FA 5IOYA 5IT3A 1BJTA 3GIQA 1CE8A 1QBJA 4XOPA 5F04A 3CCYA 4E6KG 2FF4A 3PNTA 4HNTA 1OISA 2DQLA 3SDBA 5BMVF 5FLXZ 2XVCA 1Y0NA 3QYEA 4G7OF 4HBLA 2K27A 1GV2A 1LFUP 1FOWA 3ZOBA 2JVHA 2V1UA 3Q0VA 2EWNA 3K4MA 1MBEA 3ZQGA 2FLNA 4YJ3F 1S9FA 1SEUA 3L2UA 3HYIA 2W84A 2K3PA 4UUSB 3MFKA 2D5VA 1JIHA 4XLEA 3ABLH 4EJTA 4LF5H 1Y1WA 4DL6A 2M4KA 2FE3A 3RKWA 2NVTJ 3C1DA 3A03A 5J3LA 1IRGA 3HEFA 2KHMA 1DUXC 3RTRA 3H1CA 5JLWA 2DA2A 3MMYB 3VDXA 4UB6C 5JHFA 1OFCX 4IHXA 2KMUA 1U78A 1TWAA 5J8CA 2OZ6A 3S14J 4NC8A 1LPQA 2JA6A 4XIDA 2FJZA 2QK4A 1L0OC 2UU9H 4C30A 3R5HA 1HDPA 3FBIB 5KKNB 1MW7A 5BPHA 4AVPA 5EYRA 1T6SA 1MMSA 5IP9J 2IRFG 3FMAA 1S0NA 2M3AA 3LQRA 3OR2C 2GLOA 1FPQA 4I99C 2XROA 2JEGA 2JA2A 2FJ1A 5KT4A 3GLKA 4A3LJ 3MN2A 2QWWA 4YFNF 3R0AA 3HOYJ 4J9NA 3OUZA 2CV2A 4EYIB 3O3KA 2CW0F 1D0YA 5KFEA 4IRDA 1CS0A 2WB1E 2KL4A 3BZKA 4F3QA 4J9KA 3DPUA 1YQAA 1UHMA 4YBZB 4ZTFA 4Q43A 2NU9B 2IA0A 1I27A 2X1CA 2ZXIA 2VONA 5DLGA 3S15J 5KG3A 2YCHA 2MABA 4HA8A 5HLIA 3H36A 6PAXA 3HOUJ 5HNHA 4BXXG 1MGTA 2J6UA 4S04A 3S16J 1JTXA 4DQ2A 1QPMA 3LFUA 2FPGB 2JA8G 4GKKH 4ECVA 2VPSA 3GIJA 3H5AA 2R93A 4B47A 2CQKA 4XLNF 3RBDA 1FSEA 2LFBA 1TP4A 3AG3H 3ISPA 5IPAA 3GTQJ 3DQVC 4A2UA 5IYCG 3TDZC 1FMWA 5D5UB 2A05A 1R23A 3JRGA 4M74A 4CSWA 2UVWA 2YX4A 4Y33A 3V8LA 3FKIA 5LMNH 5DM7F 1V55H 1FC3A 2C28A 1XCVA 5D5WB 1K4TA 1HSTA 2CZGA 2FKLA 1YI2I 1FTTA 2VBZA 4UFZA 2ZJRF 1I6XA 1YW7A 3P9CA 1EH6A 4WF2A 5AIPA 4BJ6C 1X1BA 1HDDC 5T14A 1VNDA 5FFZA 1MNDA 3ZP5A 1S72I 2Q8KA 3G3ZA 1G3YA
chains in the Genus database with same CATH topology
1O57A 5ILSA 2KJCA 3SFZA 2OQGA 4E70A 4IHTA 4U88A 5IWAH 3LSTA 1BI0A 1A04A 4AQYH 3R60A 5D1OA 2G7UA 5ICCA 3DF7A 1EH8A 2GIVA 3ECHA 2NRAC 3J81W 2Y75A 3KAJA 3T1BA 3I71A 3NRVA 5IT9W 4NHJA 2GAUA 3WTYC 2LF7A 1HKTA 5L3EA 2D1HA 5LGUA 2ZMEB 1OYYA 3TO9A 1ZG1A 4BQAA 1HQCA 5L3CA 2ESHA 2PEXA 3P9IA 1U5TA 2MC3A 1HSJA 2VOBA 3FMQA 1R5GA 4Z2YA 1G4DA 2VBYA 5L3DA 3D5LA 1IBMH 1SYXB 2DK8A 3U9GA 1TLHB 4ESBA 5DEQA 4MV9A 3GWZA 3F8MA 1U6GA 3ABUA 5DD4A 1FT9A 2HKOA 3BAAA 3J80K 4M6YA 3FZVA 5DD8A 1R1TA 2FXAA 5ILUA 1Q1HA 5E1XA 1PUEE 5K5RA 3H3UA 2HOEA 4BAYA 3CO6C 4RGSA 1R1UA 3F6VA 4LFCH 4JK1X 4M73A 1XDUA 3KP7A 1FP2A 3JTGA 4ENKA 3FMRA 3H3ZA 1I1SA 4UXNA 4R8HA 4DR7H 4DV6H 1J2XA 1XDSA 4JI3H 2XKPA 3CDHA 3V7SA 2H27A 3VEPA 4CC6A 1FBSA 4JI6H 2MD5A 2GXBA 4FT8A 4A6EA 5HLGA 2VC0A 4LG0B 5LRSA 1YTYA 4OMYA 4WXHA 2HYGD 1Z2OX 5CVUA 3KEQA 3MCZA 4XSXF 4FX4A 3BJ6A 1PP7U 2KRFA 3I59A 1O3RA 3ZN1A 1J59A 3IHUA 3F6OA 1AWCA 3NEUA 3E6DA 5D1PA 1F4KA 1SAXA 3FX3A 3I64A 1XNRH 3KCCA 2F5FA 2KIUA 1XSXA 4GKJH 5JVTA 4DV3H 4DR5H 1HW1A 3WTUC 1GYFA 1YFHA 2M8EA 4OU0A 1IXRC 1RNLA 2HTSA 2YX7A 1J7KA 2DLLA 4I02A 2VODA 3FXUA 2VE9A 3JAMZ 4LF4H 4CHUA 5BPIA 1SFXA 4JI2H 4A0YA 1S7AA 2CO5A 3C7JA 1BC7C 4RB3C 3RI4A 3HRTA 2DW4A 3FMSA 1IN8A 1Z05A 1HNXH 2RVCA 4IVNA 1USSA 3T1HH 2HEOA 1FP1D 5BS6A 5LGNA 3LA2A 1SFUA 3HHGA 1OYWA 2WC2A 5FD6A 1B6AA 3K2ZA 4HAMA 2EFPA 3GXOA 2AXLA 4UV9A 5A2QK 4L9NA 1UCRA 2DFIA 3RKXA 2O6GE 4ENMA 1TTYA 5BQTA 5LHGA 1CF7A 3CTAA 4UCTA 3GEZA 1B4AA 4DR4H 4Y13A 3LQQA 2JTVA 2PMHA 3RYRA 1ZGJA 3BOQA 3BPVA 3EETA 2QUFA 4DV2H 3EYIA 1ZLJA 1PDNC 3WTTC 1IXCA 3OV8A 3ZMSA 1JHFA 4MTEA 2XAGA 4OIOF 2ZCWA 5HVQC 4R7RA 1QZYA 5LLQA 3JSPA 3K1NA 2DK5A 3V7CA 3PN1A 3CUQB 3R61A 2XKOA 3HOSA 5BMZA 2Q2EA 1Z9CA 3TDUC 4X64H 3N41B 4ASNA 3O6BB 4EGZA 1ZAOA 2DI3A 4YY3H 1D8JA 4B8XA 4KUMA 4CO8A 2ADUA 3JAMW 3KAKA 1SMTA 4B3MH 2EA2A 4ZZDA 4LF9H 3EYYA 1VTNC 4TV7A 4UUVA 4YHHH 1R5HA 2VQFH 3GFMA 4B3RH 2PQ8A 3HSRA 5JR3A 1E4FT 3P7NA 2EV0A 1L3LA 2VN2A 3KZYA 4RAYA 1IRFA 3C3WA 2VC1A 5EEHA 1ZREA 2ZXJA 3IKVA 1DDNA 4OX9H 3GX4X 1A0IA 2UUAH 2XRNA 2UXBH 3M4IA 4EJUA 3NQOA 2FA5A 5HOOA 2HQNA 1P4AA 4CZZA 2M1BA 4FM9A 1ZGAA 2HS5A 1R7JA 5D5XB 5CJ9A 2Z99A 2IT0A 3WTZA 1R36A 2RNJA 4IRHA 2MCTA 1R22A 3ELKA 1XGMA 3E6BA 1HKSA 2VUGA 2KKOA 4HQMA 4WXCA 3HHHA 4G7HF 2QLZA 3N40P 2R7DA 2OZUA 4LFUA 5BR8H 1XSVA 2QYOA 1UFMA 3W6KB 2X0LA 2G7HA 4A5NA 2EV6A 4EM2A 1MZBA 3L09A 1H9GA 2CWEA 1B9NA 4UHTA 3RIZA 5DV5A 4A12A 1BGWA 2GXGA 1U5TC 1N36H 2C6YA 4ENJA 3QU3A 1Z6RA 2H6BA 1BBYA 1T0FA 4LLLA 4UCSA 3N44B 5AIQA 4RAZA 2HYFA 1FYLA 1XGNA 4BHCA 4MV7A 5FO5A 4J0MA 1QNTA 1XMKA 1TQPA 4MQVA 3J7AK 1SD7A 2P5VA 2VT3A 2F5CA 4Y15A 4LH6A 3F8FA 2P8TA 4ZZLA 1FWZA 4IHSA 4EJWA 4HYEA 1B1BA 1LDDA 3SHFA 1OPCA 4B3SH 3HSFA 1K78A 1O7FA 4K2EA 1FYKA 2Z9OA 4AIKA 2UUCH 3DV8A 3DPTA 2EK5A 4HV5A 1PP8F 3K9TA 3KP3A 4YIIA 2M45A 4BHBA 3Q9SA 5HDNA 3RPQA 2MH9A 2ZFWA 3IG0A 2FBIA 1KYWA 1KU7A 1B9MA 5ILVA 3FM3A 1HW2A 1RZ4A 3KALA 2LNBA 4HF0A 1ZHFA 2OAZA 3IL2A 1ZHSA 1F9NA 2CGPA 4Q48A 3LAJA 4N9IA 2NYXA 2KIFA 1W7PA 4IRGA 2BYVE 1BI1A 4L9VA 1E17A 3D0SA 1B59A 2UWMA 1TNSA 1U2WA 3UQ8A 2H6CA 2IA2A 5L3BA 3M1EA 2K02A 4RB0A 2D2WA 4UCVA 5F1RA 2DPDA 1WKMA 4RGXA 3E6CC 1U3EM 2LKPA 2VOPA 1V9PA 3BJAA 3BY6A 3F72A 1O75A 3R0JA 1Z91A 4B3TH 4JI0H 2L4AA 3RKYA 4AWXB 4OIRF 4I0BA 1W7PD 2XV4S 2LF8A 3RDIA 4A2AA 5E8GA 2HZTA 3WTSC 3QP5A 3TQNA 2F5DA 1BM9A 3U2RA 4MEYF 4EQQA 4IF4A 5CVJA 4HX4A 3T5XA 3AAFA 3PFIA 2VBWA 3I54A 3M8FA 4FX0A 1P2FA 3GO5A 2HVSA 1STZA 3BP8A 4G7ZF 4L5IA 2P7VB 4L9JA 3L7WA 3WGIA 4IXAA 3TOBA 1IZ1A 1YS7A 4L18B 1Z7UA 5FLXW 1IBLH 4IJAA 2FBHA 2CG4A 3RGXA 1IBKH 2GQQA 3WGHA 2NNYA 4U7BA 1J75A 1H0MA 2XAJA 1HKQA 4KMFA 2O61A 1ZHQA 1FJGH 2NAZA 4ETSA 1HBXG 1XNQH 5E1ZB 2D1VA 2JSCA 3RF2A 1ZYRF 3HRUA 5K1YA 4P55A 2W25A 4GO1A 2EV5A 4RB1A 2QBYB 3RYPA 1QO0D 3FHZA 1C0WA 4G8XA 4F7ZA 2Z5UA 1N33H 3ABTA 2HFHA 2O3FA 2EFWA 3QRFF 4KNYA 2PMUA 4OINF 2A07F 1CF7B 2XIGA 4M72A 2MH2A 1K7AA 3GFIA 2ESNA 4N9HA 2VBXA 2P6TA 4XSZF 4M9SA 3RPUA 2FQ3A 1O3QA 4HOBA 3EDPA 2EB7A 4EFEA 2O0YA 2RV8A 3DP7A 2HR3A 3EQLF 2L54A 4BNCA 4QWQA 1T38A 2PLYA 3VB2A 2RC4A 1D5VA 4KMUX 4DR3H 2NNNA 4DV4H 4DR2H 4N0BA 1IN5A 5LEKA 3C18A 4LGWA 1XB4A 2Z3YA 4KN7X 4M9ZA 1ON1A 2WDTA 5HLHA 3HRMA 1T98A 1SEIA 1GVJA 2MLGA 2QQ9A 2ZM6H 1R58A 2A3SA 1U8RA 3LA7A 1NHAA 1LEAA 2K86A 2IJLA 5EEGA 2PJPA 4EJVA 2WV0A 3ZPLA 1J9IA 1ZN2A 3QP6A 2HWVA 2WTEA 4EJOA 1QZZA 2RDPA 4NXNH 4A6DA 2H09A 2STTA 3IWFA 3I4PA 2HKXA 1OMIA 1LJ9A 4EMSA 2ZNYA 3L00A 2QQAA 1IW7F 3K69A 3KLNA 3VFZA 1DPUA 2NS0A 1FLIA 4IPAA 3C0FB 5FPOA 4BYYA 3J81K 1TQMA 4KDPA 2DO7A 2M30A 2X4HA 4UCUA 5IT9K 5DCMB 2ZMEA 3L2PA 1YIOA 3K1PA 3TO6A 4CDGA 3F22A 2L01A 4LF7H 1RUNA 1S03G 1IN6A 4I09A 2IVMA 4MTDA 4ZH4F 5LGTA 2XHKA 3B73A 2JRTA 5FLXK 4BHPA 2UXXA 1TA8A 4GXOA 4IAJA 3ROUA 3KE2A 3HIFA 1D8KA 1J0RA 3N42B 3FF5A 3T1YH 3ZMUA 3LAPA 4B09A 3GUDA 2IA1A 1G3WA 4ZYHA 2VT2A 3COAC 2CFXA 5D6FA 1P4WA 4ZYEA 3QPHA 1ODDA 4ESJA 3I0TA 2FNAA 1E4GT 2EFNA 1DP7P 2J5PA 3JTHA 5DYMA 2M87A 2RKHA 3GZ6A 1Z2NX 4DR6H 5L3GA 3IRQA 2XAHA 2VQEH 2V1DA 4NB5A 3E6MA 3G73A 2UUBH 2PI0A 2HGSA 1H9TA 4P96A 3PQJA 5E8IA 4CICA 3HXLA 1G3SA 4LG0A 4O5VA 2GZWA 5K5QA 4M9XA 5FPRA 2OWOA 1SMYF 4QLCU 4WK8F 2L4MA 5LMUH 1O7LA 2UXCH 2YPRA 2AS5F 4JI1H 2XASA 2Q2TA 4JBAA 3OTOH 2FSWA 4UNOA 3F8BA 3BDDA 4G6QA 2DPUA 2XAFA 1R00A 2EA4A 3Q9VA 4G94A 1SD6A 2HGCA 1P4XA 3TKYA 3IRRA 4UCRA 4GYGA 4WWCA 3B02A 1Z2PX 2STWA 2XUBA 5H6RA 4M71A 2GA2A 3JSLA 3CJNA 1ULYA 5D8KB 3GF2A 3T8TA 3J80Z 1S3JA 4X65H 3HSEA 3SZTA 1BN5A 2G9WA 3R4KA 1SD5A 1FVIA 2JPBA 3N43B 4A0XA 1LEBA 4ESFA 3GFJA 1W7PB 2MBFA 5FB2A 2GA1A 2K7LA 1Y0UA 1EV7A 3W6JB 4HX7A 1RI7A 5LRRA 3QAHA 2FEZA 5CYVA 2RQPA 2E7XA 2ACJA 3VODA 1P6RA 1TNTA 2A69F 4HQEA 4L9TA 1MJAA 4DUYH 3TO7A 1SFEA 1W5SA 4KHPH 3V7RA 3F8CA 1MJBA 4GYIA 2P7CB 4NXMH 5D6EA 2OA4A 4AD9A 4ENNA 5HS8A 5DUKA 2LSOA 3TOAA 3S2WA 1QGPA 3MZYA 2D45A 4RB2C 4GGGA 4HDVA 5JFRA 4YFXF 1KQ9A 3BABA 4YG2F 2O8XA 3IC7A 2UXDH 4KIBA 1DGSA 2H94A 4XRFA 3CUOA 2QQBA 4Q5SF 3GVAA 5D1OB 1HNZH 3KZZA 2A61A 1LDJA 2XAQA 3WU0A 1FY7A 3HUGA 1TQIA 1R1VA 1RUOA 1FKAH 3KP6A 5JHUA 2ELHA 1HXDA 3WGGA 1MKMA 3CUQA 3K1MA 1U5TB 4A0ZA 3BZ6A 4WCGA 1BC8C 4CC5A 4EM1A 3KLOA 3CLOA 4GLXA 3J80W 5CVVA