4RB2C

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-fur-mn2+-feoab1 operator
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
134
Chain Sequence
MVSRIEQRCIDKGMKMTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (25-MER)
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 34
structure length 134
sequence length 135
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb2C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb2C02
1U3EM 1BIAA 4F7ZA 1FY7A 5K5OA 3GO5A 3GWZA 2HQRA 2VN2A 2L4MA 4MQ9F 2IW5A 4HQMA 4FT8A 2IVMA 4P96A 2DTRA 5DD8A 2EFQA 3ZMSA 3CUQB 3WTWC 4BXUA 5FLXK 4IHTA 4XSZF 1SFUA 5EEGA 2A69F 4MTDA 4I0AA 1W7PB 2PLYA 2A6HF 5F1RA 1FC3A 2B0LA 5D4SA 1BI2A 4EMSA 3V7RA 3EYIA 3V7CA 4CXFA 1H0MA 4WCGA 3I4PA 2Z5UA 3DKWA 1ZGAA 5DYMA 1KQ9A 1FT9A 1D5VA 3VEPA 1S29A 1Z7UA 3ZMUA 4A0YA 4U7BA 2M87A 4ZYHA 2NNYA 5D6EA 4CICA 5LHGA 2VBWA 1RUOA 2XGXA 3OOPA 3LFKA 4JQFA 3ROUA 4O6JA 2DO7A 2H94A 2FE3A 4HW0A 5F64A 1ZRFA 2XHKA 2FU4A 3JTHA 4LFUA 2MLKA 1XN7A 2HEOA 2W24A 5DDGA 2FA5A 1KU7A 1W4MA 3K69A 5HOOA 4KN7X 4O5VA 4AIJA 2K27A 2P8TA 4LK0F 5L3EA 5CJ9A 1K79A 1YW8A 3K1MA 1YW7A 1P6RA 5D6FA 2LKPA 1F4KA 3GZ5A 4A5MA 4DQ2A 2YSRA 2W25A 4AVPA 1Z6RA 5D5VB 3WE3A 5ILVA 1LDKB 1K6OA 4RB0A 2L3DA 3BOQA 2ZMEB 2DU9A 1USTA 1J75A 4A6EA 4R1HA 5JVTA 3CO7C 1YW9A 4Y15A 4EM0B 2P6SA 2ZXJA 2J5PA 5DUIA 3I53A 5LGTA 2Q0OA 3FX3A 2RQPA 1SMYF 3ZMVA 2HWVA 5ICFA 3R61A 2W84A 3FF5A 3CJNA 5JHUA 2ZBKA 3M9AA 1TQIA 1GXQA 3KP2A 2HZTA 3HRSA 2VE9A 2HOEA 1FYMA 2PEXA 1D8KA 3N97A 3EYYA 1FP1D 3BROA 3KLNA 1YQAA 1J2XA 2ZNYA 4Y17A 3E3VA 3R0JA 4L9JA 2E7XA 4JBAA 3I59A 4WF2A 3PFIA 3BPVA 3SXYA 3L00A 1QNTA 3NEUA 1OR7A 4LG0A 1IF1A 3ELKA 3IRQA 3KLOA 2XAQA 4UVBA 1W5SA 5AIQA 2K02A 1MJ9A 3HRUA 4ZH4F 2ZJ2A 1XD7A 2G9WA 1ZYRF 3WU0A 5LHHA 2FMLA 4Q48A 1O3RA 2FMYA 1XDUA 3CLOA 4E70A 2QYOA 4K2EA 4IRIA 3DEUA 4Q5SF 3IHUA 3FZVA 1B9MA 4BHPA 5LGUA 2P4WA 2FEZA 1BOAA 4I01A 4ZZLA 2OZUA 4KFCA 2K7LA 3PQKA 3TDUC 5E8GA 2ZKZA 2OD5A 2CYYA 3REOA 2HYGD 2LSOA 1PP8F 2NNNA 2YX7A 1BM9A 1L0OC 2V1UA 3TO6A 2P5KA 2QM3A 2OZ6A 4GXOA 3DXJF 3RDIA 1R36A 5IT3A 1H9GA 1T0FA 1ONVA 5HDNA 1TQMA 1RI7A 3EQLF 1FPQA 4PGGA 1TQPA 1R1VA 1XCVA 2GA1A 4KYWA 1ZN2A 3G3ZA 2VE8A 1ZG3A 1LEAA 1KU9A 3QPTA 1HW5A 1WRJA 5K5QA 3D0SA 2HFHA 4MQVA 2CO5A 4UNOA 2UXNA 4I0BA 5D5XB 1Q1HA 4IHSA 4ZYGA 5CVJA 1Z05A 1R23A 2QBYB 2EJRA 1S8NA 2HTSA 1GXPA 5FFZA 4HX4A 5HVQC 3KZZA 2FBHA 1P4AA 4WK8F 3C1DA 4KA4A 4A2UA 1O3SA 1LEBA 4Q4ZF 3I0TA 4HA8A 3EUHA 3T5XA 4KN4X 5KK1A 2DQLA 5LGNA 1B4AA 4DNCA 1XSXA 1OYWA 4RAZA 5H6QA 1YS7A 4L5IA 1SMTA 2JRTA 3J80Z 3F72A 4IPAA 1Z9CA 5FB2A 4L0ZB 3T8TA 5CVRA 2WWYA 1IN6A 5HLIA 1FBQA 5AIPA 4UVAA 4LD5A 2LDUA 1LVAA 1ZRDA 4RB2C 5FFXA 1J0RA 2KKOA 4M73A 2EK5A 1T2KA 4NHJA 1YLFA 3R6SA 2BYVE 2ESHA 1E2XA 4NB5A 3MQ0A 1IRGA 3BPXA 3U9GA 1YO5C 4KNYA 3V7SA 1ZLKA 2R3SA 2GIVA 3FM5A 5ICCA 4HV5A 2HQNA 3MZHA 2PMHA 5D5WB 4GCVA 2XVCA 3E6MA 2PMUA 3GXOA 2RKHA 1UHMA 5E8IA 4L0YB 2D45A 4U88A 2ZFWA 1OYYA 5HS9A 1XMKA 1DP7P 4HF1A 3FXQA 5BMZA 1XB4A 1AWCA 2EFWA 4ZYDA 3HRTA 5BQTA 3H3UA 4EJUA 4HF0A 1R1TA 3T0YA 1U2WA 4A0ZA 2ZCWA 3MWMA 4IJAA 1B1BA 3ABTA 2VC0A 4G7ZF 4RS8A 1J7KA 2X4HA 4I02A 1PDNC 1HW1A 1STZA 4L9VA 4HLYA 2DK8A 1S7AA 4A5NA 2PFBA 3FMRA 4CZZA 4ON0A 2CWEA 3QP5A 4FHTA 4OIOF 1SAXA 2QZ8A 3KEOA 2F2EA 5H6RA 5ILSA 3FXUA 5E1WA 5CVUA 2YX4A 3TOBA 3I71A 4IRGA 4UV8A 1OMIA 1U5TB 3HYIA 1Y0UA 4YFNF 3T8RA 1U5TC 2V1XA 1UHWA 4EJWA 3K9TA 5E1XA 4EJTA 3GX4X 1TLHB 1MKMA 3D5LA 4IXAA 2AS5F 4XSXF 2KIMA 4A6DA 1KQ8A 2Y75A 3H92A 1TNSA 2K86A 1KYZA 1LB2A 3I54A 2R7FA 1KU3A 2VT3A 3CUQC 5HS7A 1G4DA 1MGTA 5ED4A 4AIHA 1CF7A 4MNUA 4ENNA 2DW4A 2YPRA 2VBXA 2HDCA 2IJLA 2NAZA 1IXCA 5ICEA 2H6BA 2J5OA 3R60A 4MGRA 4H0EA 2FF4A 2YR2A 4PGHA 1HQCA 4KICA 3IL2A 1IUYA 1LJ9A 4L9TA 1RNLA 3GYHX 1KYWA 3TQNA 1HKTA 3FWEA 5A2QZ 2A3SA 5J8FA 1TW3A 1NHAA 3QP6A 4B09A 2ZNZA 2FRHA 1W7PA 5DCMA 1BC8C 4ENKA 3KETA 2DFIA 1MZBA 4I09A 3K2ZA 3HTSB 1K78A 1U6GA 3SZTA 2XAFA 3JSPA 4U7DA 2TDXA 3P9CA 3DP7A 2UXXA 2MA3A 4IF4A 2VC1A 3WTTC 1D3YA 1BBYA 2L02A 4Y13A 1SD7A 2VBZA 1OPCA 3KP6A 1KQ0A 4XLPF 3SFZA 3BP8A 4A12A 1PUEE 2FBIA 1PP7U 2K4BA 4WXDA 3QU6A 1HXDA 3OV8A 2P5LC 2NS0A 3R4KA 2GAUA 2WC2A 3IC7A 3WTZA 1LNWA 1MJBA 2CW0F 1JHHA 4EGYA 4ZYEA 3BZ6A 2OQGA 1YFHA 1IW7F 2BE5F 4CYDA 2IT0A 2STWA 5HDGA 4KMUX 4RGXA 2VXZA 3CUOA 3WTSC 3LA2A 4WXCA 3BY6A 5L3FA 3IWZA 2CQKA 4JK1X 3V8LA 2ZMEA 2DPDA 3VFZA 2XKPA 5ILUA 2FSWA 5KVRA 4M74A 4EJOA 2XKOA 3QOPA 4BH9A 1ZREA 2XAJA 4BYYA 2M5WA 3M8EA 4EJVA 1TNTA 2Y0MA 3I5UA 3BDDA 4HX8A 1T39A 2MC3A 4QLCU 3ERED 4KIBA 3BJOA 3I59B 1KA8A 1P4XA 2BGCA 1ZLJA 3HOSA 1I1SA 1R00A 1O3QA 2RC4A 2JZYA 1R1UA 1U78A 5DEQA 4OOIA 1G3SA 2QQAA 3ZP5A 5BS6A 3HRMA 1ZRCA 3E6BA 2EV0A 1XCBA 2LNBA 2P5VA 2VT2A 3FM3A 3BJAA 4LJZF 5JFRA 3FXRA 2PJPA 1UCRA 5LHIA 2KIUA 2RN7A 4HBLA 2V9VA 2XUBA 1S3JA 3S2WA 2A07F 2H09A 1YG2A 2D1HA 2DPUA 2M45A 4CDGA 4N9HA 1DPUA 3QAHA 3F3XA 1KGSA 2V79A 4QWQA 3WTYC 2JPCA 2NRAC 4M9XA 1BI3A 1HBXG 1J5YA 2LF8A 3ZMZA 3ISPA 2NYXA 4HDVA 1W5TA 1XGOA 1EH7A 5L3GA 1YIOA 4WXHA 3CDHA 5K1YA 4BQAA 2EFPA 3HUGA 1YS6A 2DLLA 5D8KB 1SFEA 5IT9Z 2XAHA 2F5DA 1G3YA 4N9IA 1HW2A 2M1BA 5IT9K 3E6CC 2JTVA 1EH8A 1YTYA 2IA2A 4ENJA 4HAMA 5HLHA 3FMSA 1ULYA 2A68F 4HQEA 4UXNA 3WGGA 1BC7C 3IRRA 4HYEA 2OAZA 3G73A 2Q8KA 1MDMA 3K1NA 5FD6A 3GLXA 1FYLA 2DI3A 1XSDA 1F5TA 2GZWA 4G94A 4GGGA 1FP2A 3ZMDA 3ZN0A 2AXLA 4HV6A 4ETSA 5JI6A 2HGCA 4P9FA 4IVNA 1UFMA 3C3WA 3COAC 1JE8A 2RGVA 3RJPA 1HKSA 1WKMA 3O6BB 3WTUC 1SD6A 2KIFA 2IRFG 4CGZA 1E17A 1BJAA 1QO0D 1QPMA 2EA4A 4XRFA 3ZN1A 4RGSA 3C7JA 4HZFA 1RUNA 3JAMZ 2L4AA 1IAWA 3J81Z 4HOBA 4RB3C 3QRFF 1ON2A 1TTYA 2FXAA 2CFXA 3MFKA 1AOYA 4UHTA 1FSEA 3F8BA 4R8HA 3J80K 3LAPA 3ZPLA 4MTEA 5E17F 3TOAA 4BHCA 5AONA 4OMYA 4I7HA 2QWWA 1RIOH 2Y48A 3LQRA 1ZH5A 2H27A 2JPBA 4G7HF 1QBJA 2A61A 3GUDA 2E1NA 2RV8A 3ECHA 3O3KA 4G9YA 2EFNA 3MAJA 5E1ZB 2Z33A 4B8XA 4CO8A 2CG4A 1OKRA 1BI0A 2L01A 1T98A 2VODA 3GF2A 2FQ3A 3GFLA 5FD5A 1I1GA 2G7UA 1R7JA 2PG4A 2DBBA 3GFIA 2HYFA 2GA2A 5BPDA 1LDJA 2JSCA 1ZHFA 1B59A 5LBQA 1EV7A 4GO1A 1LQ1A 3JSOA 3HHGA 1P92A 4FX0A 1R5GA 4RGRA 4M72A 4KMFA 1RZ4A 2Z3YA 1T6SA 5BOXA 3I58A 3V8JA 3O2PE 1O57A 4I98B 4IRHA 2RNJA 3J7AO 1MJAA 1XGMA 4P5OA 3F8CA 2V1DA 2BV6A 3LWFA 1OYIA 3B73A 1X3UA 2P7VB 4TV7A 1FBSA 2GQQA 3P7NA 5ICGA 2RVCA 4WX9A 5BPIA 5LEKA 3TO7A 5CYVA 6PAXA 3WU1B 3V4GA 3P9KA 2F5EA 1P4WA 3JTGA 1ZGJA 3KP7A 3B02A 2C6YA 5FGMA 2DK5A 3VOEA 1S7OA 2D1VA 1ZAOA 1EH6A 3NRVA 3HHHA 4U0VA 1U8RA 4BNCA 2Z9OA 2O6GE 1CF7B 2LF7A 2EA2A 3F8MA 2GXGA 1IN7A 4G6DA 4BAYA 4S04A 2QENA 1U5TA 3KZYA 4N0BA 3Q9SA 1BI1A 1IXRC 2XROA 4LLNA 1IRFA 5FLXZ 1SFXA 1P2FA 1ODDA 1Z91A 1FZPB 2XV4S 1DPRA 3CUQA 2IPQX 5DCMB 2JT1A 1ZARA 5A2QK 3L9FA 1WI9A 2OBPA 3I64A 4EVIA 5LEJA 3GW2A 4RAYA 2BBYA 3RKYA 2O0YA 1DDNA 1F9NA 3EDPA 3GFMA 2GXBA 1K78B 4M71A 3L2CA 1FYKA 4MEYF 4ESFA 2MD5A 4ESJA 2R7DA 1I27A 4XLNF 1WSUA 4KT5C 3RKWA 2PBIA 4LLLA 4AWXB 5HLGA 3WGIA 2FNAA 5DV5A 5E20A 3NQOA 3SHFA 3HSEA 1XGSA 2ZO4A 1BN5A 5HDKA 1QZYA 3R0AA 4EV0A 1F1ZA 1QZZA 1QQIA 3M7GA 1G6NA 3TO9A 1JXSA 5CVVA 4ZZDA 4CHUA 2PN6A 1IN4A 4LK1F 3WE2A 3U1DA 4YG2F 5CVIA 2P6TA 3GEZA 2F5CA 1D8JA 4PZJA 3LAJA 4O3MA 2O8XA 1B9NA 2E1CA 5CLSA 2E7WA 4LB5A 3BJ6A 1USSA 2FNPA 4GYIA 4M9SA 4A0XA 5TRDA 4LB6B 3GVAA 2STTA 3E5XA 2UWMA 3RKXA 5DD4A 4PDKA 1GVJA 3RPQA 3VODA 5HS8A 4FX4A 1H9TA 3FHZA 5J8CA 3RPUA 2HS5A 3Q5FA 3F8NA 3TGNA 3ML6A 5D8LB 1XDSA 2L54A 1IZ1A 2P7CB 3CTAA 3C18A 2HKOA 3TDZC 2FOKA 4LG0B 1XGNA 1R5HA 4L9NA 4EGZA 3F21A 5D4RA 4OINF 3SQNA 5LLQA 1O3TA 2HTJA 4NQWA 5L3BA 1CGPA 1W7PD 3ZQ7A 3HIFA 3ECOA 2PI0A 1GHCA 1J59A 3DF8A 3DFGA 3WGHA 4LMYA 4WWCA 1BIBA 5K5RA 1FOKA 4RGUA 4Q47A 1ZG5A 1A04A 3KFWX 2Q2EA 1J9IA 2GWRA 5DCFA 2HKXA 1YYVA 3KE2A 2UZKA 3CO6C 3BWGA 1R58A 2XRNA 4AIKA 1WQ2A 2PQ8A 1SD4A 2YU3A 3HSRA 3M1EA 5J6XA 2CGPA 4ESBA 3SZPA 5TJJA 4G6QA 3PQJA 4KIFA 4L18B 4OIQF 3MEXA 2Z99A 4ASNA 1O7FA 1ON1A 3KP4A 4G8XA 4OMZA 3RIRA 2ACJA 2HR3A 4R79A 2M8EA 4MEXF 3RYPA 1MDMB 3JW4A 2QVOA 4KUMA 3E5UA 3GZ6A 2EWNA 4GYGA 2XAGA 1FLIA 1Z6TA 1G3WA 2OQRA 3WODF 2V6CA 2W57A 3F6VA 1G3TA 3AAFA 3E97A 2F5FA 1MD0A 2M30A 4M9ZA 4HF2A 4L5JA 2IA1A 5JR3A 3F23A 3W6JB 1L3LA 3F22A 2IA0A 3LA3A 2ELHA 2ESNA 4I2OA 3HTUA 2QLZA 5D5UB 2VOPA 4M6YA 3WG9A 3IWFA 4HDUA 4OU0A 2A5YB 4MHGA 1S6LA 4UVCA 1I6XA 1IN8A 4RB1A 2QQ9A 1HKQA 4PCQA 3QU3A 1K7AA 1TW2A 2KJCA 3LA7A 4OIPF 3IKVA 1C0WA 2A6EF 2KJBA 4G7OF 2QBYA 3DPLC 2DAOA 2VONA 3JAMK 1QGPA 3J81K 3P9IA 3KP3A 5ERIA 4YIFA 4AD9A 1XSVA 4ENMA 4EM1A 2XIGA 3MCZA 3Q9VA 1FNNA 4OIRF 2EB7A 4KDPA 2DT5A 4S05A 2VBYA 2DQRA 1UB9A 3L7WA 2RDPA 1I5ZA 3KP5A 3FMQA 4KIGA 1TBXA 2QUFA 1O7LA 3L09A 1FWZA 2WV0A 2MH2A 2KRFA 1FBUA 3U2RA 3HOTA 4LLGF 3F8FA 1VTNC 3KCCA 4M6XA 3RTRA 4U0WA 4XBFA 5L3DA 3IKTA 1V3FA 4EQQA 1DUXC 3T1BA 1KU2A 5L3CA 1REPC 1IXSB 4LGWA 3GFJA 4YFXF 2IP2A 3RYRA 5FO5A 2G7HA 2EV6A 5EEHA 1LDDA 3QPHA 2ISZA 1T38A 4D0PA 2H6CA 2O3FA 3RI4A 2COMA 1WWXA 1IN5A 2OU2A 3N4MA 1SD5A 1V4RA 3K1PA 3E6DA 5LRSA 3H3ZA 3M8FA 4P55A 2EV5A 2BEOA 1FSHA 4UUVA 4HX7A 2QQBA 4YIIA 3HSFA 3MZYA 5DUKA 1XMAA 3DPTA 4P9UA 4UV9A 3KEQA 3W6KB 3WTVC 4EM2A 3WTXC 1JHFA 3LSTA 1ZG1A 3F6OA 1R22A 3EETA 3TKYA 3VB2A 4U0YA 2ETHA 2VOOA 4HLXA 4BHBA 3ULQB 3V8KA 1Z1DA 2FBKA 3LQQA 2O61A 1B6AA 2EFOA 2CSOA 3E5QA 5LRRA 1FX7A 2MLGA 4YFKF 2O03A 2MBFA 3DV8A 5F6FA 3ABUA 5H20A 2MH9A 1HSJA 2D2WA 1HSTA 5E18F 2K4JA 4Z2YA 3ZMTA 2W85A 1JGSA 2ADUA 2WTEA 2OA4A 2ISYA 3DQVC 2X0LA 2XASA 3K0LA
chains in the Genus database with same CATH superfamily
2CMPA 2R7NA 3PNTA 1U3EM 5KG0A 2VUMJ 1BIAA 4BWSC 4YY3H 5KT6A 3GV7B 3TP0A 4DV0H 1EJ9A 2MCTA 3I12A 4F7ZA 1FY7A 5K5OA 1R6RA 3GO5A 3DWLE 2DA4A 3GWZA 4IQ4A 2HQRA 2E71A 4E6KG 2VN2A 4U7CA 4QJFA 2L4MA 4MQ9F 2F5VA 2DIKA 2IW5A 4CYCB 4R7RA 2VUGA 2UXCH 4HQMA 2ECBA 3DCFA 4FT8A 4E7SA 2IVMA 4XORA 1BGWA 2ATLA 5B1AH 2OF7A 2R93J 3MKLA 4P96A 5KKNB 4H4KC 4YHHH 2F4MB 1SAUA 2DTRA 4DGWB 1JIHA 2W8LA 5DD8A 4O2BF 2EFQA 3DBLB 2XPWA 2C28A 3ZMSA 3CUQB 3WTWC 4BXUA 5FLXK 3HOWG 4IHTA 4JV0A 2Z2SB 2LVSA 4DUYH 4RM3A 4XSZF 4XKVA 1SFUA 5EEGA 2CRGA 3FXJA 2A69F 3S14J 1KZHA 4MTDA 5L1IA 3JREA 4LF5H 4I0AA 1LKXA 1W7PB 2PLYA 1L2ZA 2I8DA 1J09A 2VASA 1Y56A 5CPRB 2A6HF 5F1RA 4FU0A 1FC3A 2K9SA 4A3CG 2B0LA 5D4SA 1BI2A 1ZK8A 2ME6A 4EMSA 2C35B 4GKKH 1VQNI 3V7RA 4YJ2F 3GTMJ 3EYIA 4FE4A 3V7CA 3OYJA 1EF4A 4YAKB 5C8YF 3RBDA 2RDJA 4LFBH 4CXFA 1H0MA 4WCGA 3I4PA 1YX5A 4ECZA 2DYSH 1K83J 4I99C 1FKAH 5JVLA 5KFSA 5KFAA 2Z5UA 3ABLH 3K4NA 2W9BB 2MGQA 1LVKA 2A05A 3DKWA 3L2QA 1SFOJ 5IYBG 1ZGAA 5DYMA 1KQ9A 1FT9A 1D5VA 4D7NA 2DMQA 1OCTC 2L9SA 3R5HA 1MMSA 3VEPA 2L9VA 1S29A 3CMEI 1Z7UA 5GADJ 2WA0A 4NBQA 4A0YA 3ZMUA 3HBLA 2M87A 4HNVA 4U7BA 3OIQA 3RAQA 4ZYHA 1P8LA 4YIRX 2NNYA 3K4MA 5D6EA 4CICA 5LHGA 2VBWA 4A3FJ 2XGXA 3OOPA 1RUOA 3LFKA 1KJ9A 4JQFA 3RV4A 2JA8G 2JUCA 2XPVA 3JRHA 3SDGA 2VUMG 3ROUA 2IBKA 4O6JA 3BZKA 2F4VH 1AN7A 2DO7A 2H94A 5DLFA 1WJAA 2FE3A 4HW0A 3N6XA 3ASNH 3WG7H 3PIPF 3VYSB 3HKZN 1QPIA 1N33H 1JDBB 5F64A 1ZRFA 2XHKA 1WVRA 2AQFA 5JLWA 4PUSA 2FU4A 3JTHA 5F27A 4A3LJ 4LFUA 2EH3A 4RDUA 2MLKA 4BJTA 2DLNA 2FPIB 1DGWY 1XN7A 2HEOA 4DL6A 3CP2A 2IBDA 4F91B 1DU0A 2R93G 2R84A 3IP4B 3OIPA 4JI0H 3D1NI 2W24A 5DDGA 2TCTA 3RGXA 3V6KA 2FA5A 1KU7A 1W4MA 3K69A 3QWLA 4C2MJ 3BTIA 3G8CA 4RU9A 4YR0A 5HOOA 4KN7X 4O5VA 4AIJA 2K27A 2P8TA 2R87A 4LK0F 2M7AA 5L3EA 2CKZB 1JJ8C 4O3RA 2R93A 5CJ9A 3AG1H 1C30A 3OL4A 1B8IA 1K79A 2HXOA 1JKRC 1A36A 1YW8A 2X6YA 3TW6A 1JI8A 2GLTA 3K1MA 3FIWA 3ESWB 3LOCA 2VOBA 1YW7A 1P6RA 4L1KA 1T08B 4NXNH 5D6FA 3KTMA 2LKPA 1F4KA 3GZ5A 3QYEA 3JRBA 3KAJA 3KHGA 3H9QA 2Y0SA 4A5MA 4DQ2A 1SYXB 2YSRA 5KG6A 2W25A 4CSWA 4AVPA 1Z6RA 3H0GJ 1JUSA 1BJZA 3B6AA 3RZOJ 5D5VB 1PJRA 3WE3A 5J4VA 1LDKB 5ILVA 2ZJPF 1K6OA 2RNGA 4M7EA 4RB0A 2L3DA 3BOQA 2ZMEB 4D5CA 2VJIA 2DU9A 1USTA 1MBEA 4UUTA 4CCOA 3OYHA 1J75A 1OCZH 3FXLA 4A6EA 5DGAA 3PNVA 1B6SA 2ZMEC 4R1HA 2EZIA 5JVTA 3CO7C 4IRCA 1AUVA 1YW9A 3GIQA 4Y15A 4EM0B 2P6SA 2ZXJA 2J5PA 1GDTA 3GTMA 1MMAA 5DUIA 2E2HJ 1TAEA 3I53A 3K4CA 5LGTA 2C00A 4J9PA 2Q0OA 3K7AJ 1KJJA 3FX3A 1K83A 3JZIA 3KPHA 4PJNA 2H8WA 3K70D 2ZJTA 2QK4A 2A5WA 2B9SA 4Y3OA 3TP3A 4A3FG 3HDDA 1RYSA 1X2NA 2RQPA 2JA5A 1SMYF 2FX0A 4AQYH 3ZMVA 2HWVA 2CV0A 4MO7A 2HXIA 1VZ0A 3FMAA 4IEJA 3OIOA 5ICFA 3R61A 2W84A 3UQ8A 3FF5A 3CJNA 5JHUA 2ZBKA 2R7OA 4NUBA 2VJ5A 3M9AA 2VQHA 4D7MA 3HL2A 4IAJA 1ZETA 4A3LG 1IG7A 1TQIA 4A2BA 5KG7A 1W1WE 4F92B 3KAKA 1GXQA 3KP2A 1ZGWA 3EPIA 1H89C 2DODA 2HZTA 3HRSA 2VE9A 2VJ4A 1JKPC 2HOEA 1FYMA 2PEXA 3M9NB 1D8KA 3N97A 1GLNA 3EYYA 5DQGA 3CESA 4XN3A 1FP1D 3BROA 3KLNA 1V4YA 4NQWB 1N77A 4HEA2 1B72B 3G6XA 1Q1VA 1V51A 5KFUA 4YJ3F 1ETXA 1JUPA 5KT3A 3CJRB 2XCPA 5EJCA 1YQAA 1J2XA 2ZNYA 5EZGA 5EZHA 4Y17A 3JRDA 4R8UB 1Y1WA 3T1YH 2BY0A 2FK2A 3BA9A 1HF0A 4FBTA 3E3VA 1GSAA 1S97A 2DCEA 3R0JA 4L9JA 2E7XA 5BR8H 2L7FP 1IBKH 4JBAA 1GV2A 5KT2A 3BABA 5K2MA 5IT9W 3I59A 2R5YA 1R49A 3H0GG 4UCUA 4WF2A 4OAZA 3PFIA 3T5JA 3BPVA 4V2FA 3SXYA 2Q2EB 3AG4H 4TV9F 3L00A 3H1CA 1SANA 2W6MA 1QNTA 3LSMA 2Z1DA 3NEUA 4FETA 1WI3A 3GTJJ 1N78A 1OR7A 4LG0A 1IF1A 2IAIA 3OY9A 3ELKA 3IRQA 2KDZA 4B3RH 3KLOA 2AHQA 2W7PA 2XAQA 3PW7A 2DT6A 4UVBA 1W5SA 2DFEA 5AIQA 5DLGA 1N25A 2K02A 3H0GA 4LF8H 1MJ9A 3HRUA 4ZH4F 4J9KA 2LLKA 4DZJA 2CUZA 5B66C 3TEDA 5JVDF 4MV6A 4BGDA 2OLSA 2ID6A 4J9QA 2VKVA 2V9WA 2ZJ2A 3LSJA 4XIDA 5KFMA 4RUCA 1XD7A 1T33A 2G9WA 1ZYRF 1JT0A 3ABKH 5GP9A 1B33N 3WU0A 5LHHA 1LFUP 2FMLA 2WDTA 4Q48A 1YRNA 3ZCOA 2Q2TA 1O3RA 3K2AA 4B3MH 2FMYA 1XDUA 3CLOA 3L4KA 2RQQA 2YRWA 2E2HA 1XMXA 1ZR4A 2IS2A 4E70A 3VPBA 2BVLA 2QYOA 4K2EA 4IRIA 1BR1A 3DEUA 4Q5SF 1ZHQA 3IHUA 2JJ7A 3HB9A 3FZVA 4LG3A 4BDYA 4EEQA 1OFCX 3KZIC 4GC6A 1KBLA 2L0KA 3CC2I 2DA5A 1B9MA 4BHPA 3PJRA 4RZQA 4NXMH 5LGUA 4ED0A 2P4WA 2VPRA 2FEZA 5K7HA 3PR4A 1BOAA 2C2EA 3RF2A 4RM2A 1Z21A 1RPWA 4I01A 5J1YA 3N41B 4ZZLA 1VQPI 3B6CA 2OZUA 2PVPA 4KFCA 2K7LA 3PQKA 2K3PA 3S32A 2O8KA 3TDUC 2QEXI 5E8GA 4PJMA 1XTAA 2ZKZA 4F55A 2OD5A 5D8DA 1PVEA 4LF4H 1QVUA 1G8XA 2CYYA 2H1LA 1QZEA 3REOA 1IRZA 2HYGD 2LR8A 2LSOA 2YU9A 4AUXA 4CCMA 4IR9A 4A2AA 1TP4A 2LBFB 2NNNA 5FKMA 1UG0A 1BM9A 1L0OC 2BVMA 2YX7A 1PP8F 3TO6A 2V1UA 3Q2OA 3VPDA 2P5KA 5IWAH 5B3SH 3JCUC 3SYTA 2QM3A 1R9TA 2X48A 3SEQA 2OZ6A 4GXOA 2RF4A 1MNEA 3ORRA 2LY9A 3DXJF 1RC9A 2LC2A 4G12A 1HNWH 3DKXA 3RDIA 5DM6F 1R36A 2M2EA 4MV3A 3GTPJ 4XONA 5IT3A 1H9GA 1T0FA 1ONVA 2R7XA 5HDNA 1TQMA 3CC4I 1RI7A 3EQLF 2UVRA 4X62H 1FPQA 2LYCA 1TQPA 4PGGA 5KT4A 1R1VA 1XCVA 2GA1A 4KYWA 1ZN2A 3J80W 3GTQJ 3CLQA 4ZI7F 3G3ZA 2VE8A 2VXDA 1ZG3A 4Q44A 1LEAA 1KU9A 4QW8A 4LF6H 4LFCH 3QPTA 1HW5A 1WRJA 5K5QA 3ETHA 1XNQH 3D0SA 2HFHA 4HG2A 1U9OA 4MQVA 2OH2A 3GIDA 4XLAA 3GTJA 1M0WA 3PR5B 2CO5A 4UNOA 4BEHA 3ORQA 2UXNA 3RPUD 4I0BA 3ZRGA 3U9SA 5D5XB 1FIPA 1Q1HA 3L2WA 4IHSA 3M1CA 4ZYGA 5CVJA 1Z05A 3MFHA 1R23A 2IS6A 2DOAA 3VDXA 4M6VA 2EJRA 2L7MP 1NK2P 2QBYB 1S8NA 2HTSA 4II2A 1GXPA 2CV2A 2QKLB 4E4HA 3CCYA 1U8BA 1JTXA 5FFZA 2W9CB 5GPCA 3JRGA 2NVUB 2XGCA 4GRIA 2DXIA 3CCRI 2XAUA 4HX4A 2OCEA 5HVQC 2DMNA 2GIZA 3KZZA 2FBHA 4GFBA 2IMWP 1P4AA 2KISA 1SEUA 4WK8F 2CW7A 3C1DA 1MNDA 1HNXH 4KA4A 4A2UA 4BDZA 2LKXA 3RB3A 3CF5F 2TRTA 1O3SA 1LEBA 4A3EJ 1BL0A 4BJ5C 4Q4ZF 3I0TA 2HZDA 4YEJA 1CQTA 4C5BA 1SEIA 2EZKA 1Z67A 4HA8A 1N34H 3BQ1A 4PJLA 3EUHA 3T5XA 1YIJI 2WAQE 3BCAA 4Q45A 5FKKA 2GBYA 5EG0B 1YX3A 1T36A 2LD5A 4ECRA 5BPFA 4KN4X 4XLEA 5KK1A 2FK1A 2DQLA 5LGNA 1D5YA 3RAXA 4UCOA 4XYMB 1B4AA 4DNCA 1XSXA 3QQAA 3JRAA 2Q2UA 3SI8A 3DLAA 3ZQLA 1OYWA 4BACA 4RAZA 5H6QA 1EYZA 1YS7A 3FK6A 1SMTA 2JRTA 4L5IA 3J80Z 4C5AA 4DUZH 3F72A 4IPAA 1Z9CA 1CS0A 2VR1A 5FB2A 4L0ZB 3TQ1A 1I3AA 3T8TA 5CAEB 1F43A 4DV3H 4AM3A 1QVTA 3RCOA 4QIWA 1V5FA 5CVRA 1I3QJ 2FJ1A 5KFCA 4B3TH 2WWYA 1IN6A 3KHLA 5KG3A 3BQ2A 2BXZA 2ASDA 5HLIA 2DA2A 1YI2I 2XC9A 5KG5A 5DG8A 1WHUA 3UNGC 3NWTA 2KIQA 2ZSHB 1KJQA 1FBQA 2COBA 2XB0X 3Q8PB 2W6PA 2HPMA 5AIPA 2L7KA 3S93A 4E7HA 4UVAA 4B1RA 1A9XA 4LD5A 2LDUA 5EOYA 1LVAA 2R86A 1WJFA 1ZRDA 4RB2C 4KJZA 2EBIA 3GTOA 5FFXA 3F9KA 3OTOH 1J0RA 2KKOA 4M73A 1FOXA 1VBGA 4JP0A 2EK5A 1T2KA 5KFDA 4RAGA 4NHJA 4IWYA 1N56A 2ZJRF 4B3SH 1YLFA 3BR2A 1X9NA 1LFPA 3R6SA 2BYVE 2ESHA 3VPCA 2CQYA 5KFTA 1E2XA 4JI4H 4NB5A 2KLOA 3FK7A 3MQ0A 1E4EB 1IRGA 3BPXA 3U9GA 1YO5C 1BJTA 4KNYA 3V7SA 3RZDJ 1ZLKA 2R3SA 4QTRA 4O3OA 1XMQH 2GIVA 2WE6A 3BA8A 3L2UA 3FM5A 5ICCA 1W0TA 3IUOA 2HDWA 2LH9A 4HV5A 2HQNA 2L2OA 3MZHA 4A3EG 4PJ0C 3LSIA 4PSXA 4X1EA 2PMHA 1WSCA 2IA6A 2I8CA 1F36A 1OQYA 5D5WB 4RNMA 4GCVA 1PUFA 3FDSA 2K3FA 1JGGA 2XVCA 2M0MA 2HI3A 3E6MA 1WZ2A 2DPIA 4OX9H 2PMUA 3GXOA 2HOTA 4X0GA 3CCSI 2RKHA 1UHMA 3SEZA 5E8IA 3DKYA 3BR1A 2D45A 2E35A 1WPKA 4L0YB 1MBFA 3GILA 4U88A 2ZFWA 1TT5B 1XX5A 3BAAA 1OYYA 2E1OA 3CJQB 4KT6A 5J2TF 5HS9A 2M34A 4I50F 3W6VA 1XMKA 1DP7P 4HF1A 3FXQA 3MN2A 5BMZA 1G2HA 5FKOA 1XB4A 2VQGA 5HLTA 1AWCA 2VKDA 3HXLA 2JRMA 4IHVA 2EFWA 2WB1A 4ZYDA 3HRTA 5KG2A 4JX5A 1OCPA 1K1SA 2OJED 3W2VA 5BQTA 4CUGA 2YYAA 4Y8VB 2NUAB 5EZYF 4C3HJ 2CU7A 3MMYB 3H3UA 3RKQA 4EJUA 4HF0A 1DQUA 1R1TA 4QPOA 3CF2A 3WO0A 3T0YA 3FDYA 1U2WA 2X51A 1H8AC 1N36H 3M9OB 4O3NA 2Y9ZA 3X2QH 4A0ZA 2ZCWA 3MWMA 1X3ZB 4IJAA 1OCOH 3L2PA 1B1BA 3P5JA 4A3MJ 2R7KA 3ABTA 2NU6B 2ICWG 2VC0A 3MKZA 4EFBA 5E3OA 4G7ZF 1W36D 4GC7A 2CQXA 4AIDA 4RS8A 4XRSG 5IP9J 3K4JA 2M4KA 1J7KA 5TGTA 1BR2A 4X65H 2X4HA 3FISA 4I02A 1PDNC 2CUEA 2J6SA 3DTIA 4AYBN 4PWQA 5FKLA 1WFXA 4QW9A 2V7FA 5FLXW 1HW1A 2DA7A 1STZA 4L9VA 3IV5A 4HLYA 4F50A 4DL3A 1ULZA 4CCLA 2DK8A 1FIAA 1S7AA 4TUYF 2B63J 4A5NA 1VBHA 5KFLA 2LREA 2XSDC 5KCMA 2PFBA 3FMRA 4CZZA 4XRSA 1RRJA 1N75A 1AU7A 2SCUB 5FPRA 1Z77A 4M3FA 4ON0A 1XPXA 1JJ6C 2CWEA 3GCMA 4HRIA 3GIMA 3U21A 1GSHA 5HBRB 1D0XA 2JA2A 3QP5A 4FHTA 3Q8QB 1VQMI 1SAXA 4OIOF 3I4NJ 2QZ8A 3KEOA 3M9MB 2F2EA 5H6RA 5ILSA 1K1QA 2BW3B 1LUJB 3FXUA 5E1WA 3S8PA 3K70C 5CVUA 1W96A 3G1OA 3GMEA 4UUSA 2YX4A 5A2QW 5FRMA 3TOBA 3I71A 4IRGA 1Z2PX 1BR4A 4UV8A 1D1AA 1OMIA 4JI1H 1U5TB 3HYIA 4IR1A 1VAJA 1Y0UA 5GPAA 2XCLA 2JK3A 4YFNF 3T8RA 2KMUA 1U5TC 2V1XA 1UHWA 2BY1A 1AKHA 4EJWA 1EHIA 3K9TA 5E1XA 4EJTA 3OL3A 1GVDA 5EEAA 1EKEA 3GX4X 3LSRA 4KISA 2JA8J 4A3KJ 1TLHB 3J7AK 1MKMA 3D5LA 1ZQ7A 2O7OA 5BMVF 4IXAA 1ETKA 1SVMA 3HEFA 2FPPB 2AS5F 4XSXF 2KIMA 4A6DA 3CJTB 4ZHQF 3GIKA 1KQ8A 2Y75A 3H92A 2JMWA 3RFCA 3E7LA 1BNCA 5BPHA 2FUG2 5DTDA 1TNSA 2DDAA 2K86A 4F4XA 3HKZE 1KYZA 4IHWA 1LB2A 3I54A 2R7FA 1FOWA 1KU3A 2VT3A 3CUQC 4IRDA 5HS7A 1G4DA 2IP4A 1MGTA 1UNNC 3OUZA 5ED4A 1BW6A 3OUUA 4AIHA 1CF7A 4MNUA 1ETOA 5I47A 1IV8A 4G3IA 3EPZA 4ENNA 4XL9A 4ED7A 4JX4A 4A3MG 2DW4A 2YPRA 3FXOA 3GLLA 2VBXA 2HDCA 2IJLA 3T1HH 3H36A 2NAZA 4IZZA 3AG2H 1IXCA 5ICEA 2H6BA 2J5OA 3HC7A 3R60A 4MGRA 4MIMA 5CKTA 3OS2A 4H0EA 5IP9G 3GQCA 5D1PA 1IOWA 2FF4A 2YR2A 2HOAA 3S2HJ 2DFHA 4PGHA 2DOFA 1GUUA 1HQCA 2E2IA 3O8HA 2EIJH 2NVYJ 2ZM6H 4KICA 4J9SA 3T5HA 4IZOA 1A6QA 3IL2A 1IUYA 1LJ9A 4L9TA 3MKWB 3CCLI 1RNLA 2B63G 1TT0A 4ZC3A 3GYHX 3BCBA 1KYWA 3V6HA 3TQNA 2W6OA 3M4OJ 1HKTA 3FWEA 4TQSA 4Q43A 5A2QZ 4DR2H 4ED3A 2FD5A 2A3SA 1MMGA 5J8FA 1OCCH 1TW3A 1B04A 1NHAA 5KFGA 3QP6A 4B09A 4ED6A 3MR6A 2ZNZA 2FRHA 5FLVA 1W7PA 2QSHX 3I4NG 1X58A 5DCMA 4XICA 1EZ1A 1UELB 1TWGA 2JN6A 4CCNA 2DYRH 3L2VA 1BC8C 2W70A 4ENKA 4IHXA 5KFQA 3FXMA 3VSKA 3KETA 2DFIA 2B63A 3SE7A 1MZBA 1SVOA 4Q0YA 1C3OA 3I3LA 4I09A 3BT9A 5DQIA 4JI2H 3TW7A 3G6VA 2AGQA 2V4JC 1X1AA 2AQEA 1T8IA 2BR0A 2E36A 3ZQGA 2JA6J 4RMNA 4RLQA 3K2ZA 2XF7A 2CUJA 3GZNB 4G6TB 5KFXA 3KYLA 3HOUJ 5KG4A 1S5LC 3HTSB 2PJRB 3IH2A 1K78A 1U6GA 3SZTA 1NK3P 3K3VA 2VLAA 3JRXA 4A3KG 2XAFA 2KZGA 2I5UA 4IL6C 2LKSA 3JSPA 4YB8B 2OTLI 2VUMA 4U7DA 3DEWA 2TDXA 3P9CA 3DP7A 2UXXA 1MBHA 1N48A 2MA3A 2HHHH 4IF4A 2VC1A 1B8IB 3WTTC 2EQRA 3ZR8X 1UJ8A 2E1MB 1MSFC 1KC7A 2FKLA 3BTLA 2F4OB 1D3YA 3G6EI 2CFOA 1BBYA 2HGSA 2L02A 4Y13A 1SD7A 4JV5H 2E1MC 4HNUA 2VBZA 3OS1A 3K4LA 1OPCA 5H80A 4X66H 1S0OA 3VPRA 3KP6A 1KQ0A 4F52A 2ZJQF 4XLPF 3IH3A 4EGJA 3TMOA 1AUXA 3SFZA 4ED2A 2DOEA 3BP8A 4YP3A 4FQGA 5LL6b 2YZNA 4F93B 4A12A 2JUGA 1PUEE 2FBIA 1PP7U 2K4BA 1UC8A 4WXDA 4BQQA 4LF7H 3PO2J 1KEEA 5GAHJ 3S3MA 3QU6A 2O9LA 2VPSA 4O2AF 1X4OA 4RNOA 1HXDA 2R7MA 3KXYT 2NS7A 3OV8A 1HDPA 2X1CA 2XGPA 3CCUI 2JVHA 2NU9B 1E4FT 1RJRA 1UHSA 2P5LC 2NS0A 3R4KA 1M1EB 2R4GA 4PDBA 4PFPA 2VA3A 2GAUA 2WC2A 5J47A 3FBIB 3IC7A 4XKBA 3WTZA 4Y4RA 2X1EA 1LNWA 1MJBA 3M8JA 2CW0F 1JHHA 4EGYA 4ZYEA 3HOZJ 2I87A 1I6UA 3BZ6A 2OQGA 4ED8A 3OYDA 1YFHA 1VS0A 3J7YJ 4IO9F 2NVXJ 4LIVA 4B43A 2HU9A 1IW7F 2BE5F 4CYDA 2IT0A 2STWA 2MFZA 2MW8A 4M3EA 5HDGA 3LNQA 2E5LH 4KMUX 4RGXA 2VXZA 3CUOA 4BJ6C 3WTSC 1JLLB 4XYLB 1SFOA 2VQEH 3LA2A 3MZ8A 1D0YA 4WXCA 1IO2A 3BY6A 3IWZA 2CQKA 4CZCA 5L3FA 2R7WA 4JK1X 3GTGJ 2JA6G 3V8LA 3VYUB 3LSKA 5J2UF 2ZMEA 2R7ZJ 2DPDA 3VFZA 2XKPA 3HOUG 1R5ID 5JQWA 5ILUA 4F4WA 3Q0UA 4FE7A 2ELKA 4IHJF 2R7QA 2FSWA 5KVRA 3S17J 4M74A 3IH4A 2FLNA 4EJOA 2XKOA 3QOPA 4U87A 3ETJA 4BH9A 2HJWA 1ZREA 3CCQI 3BG5A 4XX0B 3BR0A 2XAJA 3OMYA 4BYYA 2KQRA 2M5WA 3M8EA 2L7ZA 3VMMA 2EILH 2BQ3A 4EJVA 1TNTA 2Y0MA 3I5UA 5F04A 2I80A 5JUMA 3BDDA 2PN1A 2AU0A 1FMVA 4HX8A 2QGUA 4AVZA 1T39A 1VQLI 5IP7J 2VPLA 2MC3A 4QLCU 3ERED 4F4ZA 4KIBA 1M7JA 3BJOA 3I59B 2NS8A 1KA8A 1P4XA 2BGCA 2Y69H 2CQNA 1ZLJA 3HOSA 4QWCA 1I1SA 2ZC2A 1R00A 3T5KA 4C2MA 2HVQA 2JA7J 1O3QA 2RC4A 3BJYA 2JZYA 2UUAH 1R1UA 1U78A 1IDZA 5DEQA 3OHBA 5CA0F 2QCOA 3H9JA 2YS6A 3PO2G 4OOIA 5EYRA 1G3SA 2QQAA 3ZP5A 4I6ZA 1H88C 5BS6A 1OR7C 3HRMA 1ZRCA 3UFXB 3E6BA 2EV0A 2K85A 3PSIA 1LPQA 1XCBA 2W6NA 1TWFJ 4XOTA 2DDBA 2LNBA 2P5VA 2VT2A 3FM3A 3BJAA 4LJZF 4DV6H 4TQRA 1B72A 5JFRA 1ITYA 3FXRA 2PJPA 4UCRA 5KAFC 1WJEA 1UCRA 5LHIA 2KIUA 1JKJB 1OWTA 1S7EA 2RN7A 2UUZA 4HBLA 2V9VA 2XUBA 1MH3A 4XRMA 1S3JA 3GTLJ 3D5SC 1Y8QB 3HOZG 3S2WA 2M3AA 2A07F 1YRNB 2UUBH 2H09A 1YG2A 2D1HA 2EZHA 3KYCB 1IC8A 2DPUA 1Y1VJ 2M45A 1RK5A 3H35A 4QSHA 4ME6A 1EUCB 4CDGA 2Y0SN 4N9HA 4A3GJ 1BA5A 1DPUA 2EPFA 3QAHA 3F3XA 1G59A 1KGSA 2V79A 1GYFA 2QYZA 4ECTA 4QWQA 3BR3A 3WTYC 2R7ZG 1TWAJ 2JPCA 4FASD 2NRAC 2Y30A 2KFDA 4RBOA 3CQZJ 4EBCA 4M9XA 1D1BA 2KRHA 1BI3A 1HBXG 1J5YA 2ZFUA 3LL7A 3RB6A 3HG9A 1XMOH 5EGOA 2DMTA 2K40A 3HOVJ 3M4IA 1I50J 2LF8A 3ZMZA 2ZDHA 2WTFA 3ISPA 2NYXA 3G1MA 3GTGA 3OS0A 4HDVA 1W5TA 1XGOA 2R7VA 3R5XA 1JKQC 2R7LA 1EH7A 5L3GA 1YIOA 4UB8C 3S2DJ 3OWTA 1WR2A 2W71A 2R7ZA 2FLLA 1SFKA 4WXHA 1XC5A 5CQEA 2V9KA 3CDHA 5K1YA 1IRXA 5IOZA 5CA1F 2NU8B 3K4BA 4BQAA 1OCRH 2EFPA 3HUGA 1YS6A 2DLLA 5D8KB 1VQ8I 1SFEA 2R82A 4E7KA 5IP7G 5IT9Z 2XAHA 2F5DA 2R8IA 1G3YA 5DQHA 4N9IA 1HW2A 2M1BA 5IT9K 3E6CC 2JTVA 1EH8A 1YTYA 5F9LA 1X1DA 2IA2A 3SFIA 3BTJA 4F4YA 3BR6A 2CH0A 4ENJA 2DPJA 3BLYA 2MYSA 2W7OA 1YJWI 2JA7G 4HAMA 2DMPA 5KFIA 4BKXA 5HLHA 3FMSA 1ULYA 2A68F 2WYOA 3GTKJ 4LF9H 2IGKA 4NNJA 2A6TA 4V2GA 4DR7H 4HQEA 4UXNA 3JAMW 2CS3A 3WGGA 3J81W 1BC7C 2PMZA 2YUSA 3A01B 1Z3XA 1VQ6I 3G1LA 1SVLA 3IRRA 1T0FC 4HYEA 2K5CA 2R5ZB 1GT0C 2OAZA 3G73A 3E0JB 2DFFA 2Q8KA 1S0NA 3CDLA 2CQ7A 5M5XJ 3OSFA 3LSGA 2DZDA 1S0MA 1X1BA 4CCJA 4UY8I 5C1OA 1MBJA 1TWCJ 4DR5H 1MDMA 3K1NA 3TBIA 5FD6A 2HOSA 1ZHSA 3GLXA 1E4GT 3MKYB 5KFKA 3PW2A 1FYLA 2DI3A 1XSDA 1F5TA 2LY1A 3BQYA 2MG4A 3MR3A 2GZWA 2DT7B 4G94A 4XM3A 4MA0A 2IXSA 4GGGA 3H0DA 2R7UA 4YR2A 1FP2A 3ZMDA 1BXRA 1KJIA 1Y1VG 1U9NA 4MLOA 3ZN0A 1JUMA 3S1QJ 2AXLA 4HV6A 5HV6A 5J1UA 4ETSA 1W36C 4A3GG 2LBFA 5JI6A 3QZ7A 2HGCA 1KJ8A 1Z7LA 4B3XA 4P9FA 4IVNA 5IYDJ 1V54H 3CMMA 1X1CA 1UFMA 4DYRA 3VWBA 4YELA 3GTLA 4JYKA 2IS1A 3C3WA 2M4GA 3Q3SA 3COAC 3OOUA 1VI0A 4ECWA 4OAYA 1RKTA 3AL0B 1JE8A 1Y1VA 5D1OB 2RGVA 3LP8A 5KFYA 3RJPA 1HKSA 1WKMA 3O6BB 3WTUC 3AL0C 3HOYJ 1MMNA 2XC7A 4FCYA 3C2GA 4UCVA 4UCTA 1SD6A 5LXTF 1RYRA 2H8RA 2KIFA 2IRFG 4CGZA 3UKGA 1E17A 2IEKA 2AGOA 4I55F 4I4TF 1BJAA 3I55I 4A3JJ 2X0SA 1YOVB 1QO0D 2FMAA 1QPMA 3OYAA 2EA4A 4XRFA 2KHMA 3CQZA 3ZN1A 1EA3A 3RV3A 4O3SA 3LSHA 1JX4A 4RGSA 4LH7A 3GBGA 1TWHJ 3OYNA 1VQ9I 3C7JA 4HZFA 1I50A 1RUNA 5L1KA 3PUBA 4RNNA 3FKIJ 2L4AA 3JAMZ 3ZQFA 1IAWA 3J81Z 4HSTA 3G4SI 1NG7A 1VKZA 4HOBA 3BZCA 4RB3C 2FB9A 3QRFF 1ON2A 1I39A 2OPTA 2Q1ZB 2W9CA 1MH4A 2GM4A 2XGDA 1TTYA 4D9JA 5LMNH 2FXAA 2ECCA 2CFXA 3SZGA 4FBUA 2E60A 4J9OA 3MFKA 1AOYA 1BW5A 1POGA 1S9HA 2E5NA 3V6JA 4S0HB 4UHTA 4K0KH 1FSEA 3F8BA 2VPQA 4WBNF 1TC3C 4R8HA 3J80K 1LE8A 3LAPA 2QF7A 1RR8C 4MTEA 3ZPLA 5E17F 3DU6A 3TOAA 4YR3A 2V58A 4BHCA 2K9LA 4FS1A 5F0FA 5AONA 3LMLA 2QQ8A 4OMYA 5F08A 4I7HA 2QWWA 1RIOH 1E0EA 4DV7H 1IBMH 2XDVA 3LSPA 2QSFX 3CCVI 2Y48A 1CQJB 3LQRA 1ZH5A 1WJ5A 4QWAA 2WAEA 5M3MJ 2H27A 2JPBA 1ETVA 4YAJB 3GTPA 3QZ8A 4ZQIA 4E4TA 4G7HF 1TWCA 1QBJA 3N8DA 2A61A 3OYEA 4E7JA 3GUDA 1DGSA 2E1NA 4PSWA 2V6EA 1FOYA 2RV8A 3ECHA 5IYDG 3O3KA 4G9YA 2EFNA 3I9V2 4LSAA 3GTQA 4AU7A 3MAJA 4MV7A 1UZCA 4MFDA 3K3PA 3CCEI 3KIOA 4MV4A 4CC6A 3IAS2 2J6TA 5E1ZB 3I4MJ 2Z33A 4CC5A 4EEFG 2XCAA 4PFOA 2YL2A 3D5RC 5TISC 1WH5A 4B8XA 4JOMA 3HOYG 4CO8A 2XF5A 4TV8F 1GSOA 2L5QA 2HPIA 3HPHA 3DBHB 3LFUA 3KHRA 2CG4A 4RLFA 1WJCA 1PUFB 4APMA 4BXFA 1OKRA 4OWRB 1BI0A 2L01A 1T98A 4IX7A 2VODA 4A3JG 4QWBA 4ECVA 3GF2A 2FQ3A 4AYBE 3PW5A 3GFLA 4XOPA 2GPSA 5FD5A 3U9TA 1I1GA 1X19A 2IS4A 5EWFA 1LFBA 9ANTA 2G7UA 1R7JA 4ZYAA 4P1WA 3TIIA 2PG4A 5KFBA 2DBBA 1ZTRA 3GFIA 3OSGA 2B7EA 2YCHA 2V26A 4XN0A 2HYFA 3JRIA 2P0AA 2R7TA 2I10A 3FKIG 3JSNA 1DV2A 2Y31A 2GA2A 1FVIA 5BPDA 1MBGA 1LDJA 2JSCA 1ZHFA 1B59A 5LBQA 4ECUA 1EV7A 3HGGA 2NOGA 4GO1A 3ONQA 3JSOA 1LQ1A 2NU7B 4C5CA 3HHGA 1P92A 4FX0A 1E4EA 1QHHD 4J9LA 4BY7J 1R5GA 3RB0A 3PL8A 2YS7A 2NXNB 2VQDA 2OWOA 4RGRA 2W4SA 4M72A 4KMFA 1RZ4A 2AQ4A 2EINH 2Z3YA 3E1SA 1T6SA 4HYKA 1ORKA 3BQ0A 4DBRA 2WY8Q 2W6QA 1M0TA 2OCCH 2AXTC 5BOXA 3I58A 3V8JA 5BNGA 5L1LA 2X6OA 4M9UA 3O2PE 3KYDB 3S15J 4XZ3B 3OYKA 2R7RA 4JV1A 1O57A 2UXBH 4I98B 4NLGA 5KFRA 4IRHA 2RNJA 3BG3A 3CCMI 2XF6A 3QODA 5LFAA 3J7AO 1MJAA 1XGMA 4LH6A 2BQRA 4P5OA 2DJNA 2V1DA 3F8CA 2BV6A 5HNFA 1X1PA 3LWFA 1MBKA 4Q8EA 1P9QC 1OYIA 3B73A 2DA3A 1X3UA 5LP6F 3GIIA 3PFYA 1I3QA 2JEIA 1K4SA 2P7VB 3GIPA 4LSXA 4TV7A 1MNMC 1FBSA 4XLHA 2GQQA 4I76A 3K5HA 3P7NA 1MSEC 2WADA 2E5ZA 5FROA 4XKWA 2ASLA 2Z16A 5EWEA 1QHGA 4A3BJ 3I4MG 2LK2A 4QIWN 2RVCA 5ICGA 1R71A 3H4DA 3QPLA 3RQIA 4DL2A 4WX9A 1MIJA 1YJNI 4ECSA 4A3CJ 5BPIA 5DG9A 5LEKA 3DU5A 3TO7A 2UVWA 5CYVA 6PAXA 2ZSIB 4UUSB 2KDOA 3WHBA 4DV4H 3WU1B 3V4GA 3P9KA 2F5EA 1P4WA 1QRYA 3JTGA 1JDEA 2YZGA 4LFAH 2ID3A 2XB5A 4EBDA 4B44A 4Y52J 5M5YJ 1ZGJA 4KITB 2NOJB 4J9NA 4ECYA 1E3OC 3J7AY 4C2TA 3CD6I 3KP7A 4A3IJ 2HVSA 3WNZA 3B02A 2X85A 2C6YA 2FOWA 5FGMA 5K7ZA 2QA4I 2X6WA 3RJ0A 2DWCA 2DK5A 3VOEA 2ASJA 1S7OA 3TQTA 2GOMA 3AKZA 2D1VA 3JSLA 1ZAOA 1Z3YA 4YRVA 3EPGA 3H3VK 2AGPA 4W1UA 4EATA 2KPMA 4BBSJ 3DEEA 4XKCA 1JXLA 4C30A 5GONF 4IOCF 5F9NA 1B6RA 1EH6A 3NRVA 2VQLA 4MA5A 3HHHA 4U0VA 3AG3H 2W7NA 1U8RA 4BNCA 2UUCH 2Z9OA 4JI8H 3PNYA 1VQKI 4V19K 2O6GE 2VQFH 1CF7B 3OYGA 2LF7A 5C3EJ 2EA2A 2BW3A 1EUDB 4DYCA 1HNZH 3JR9A 3F8MA 2FK3A 2GXGA 3VYRB 1IN7A 4DL7A 4G6DA 4BAYA 1DIKA 4S04A 2LFBA 2QENA 3M3YJ 2IGOA 3HZJA 1U5TA 1DU6A 3ZOBA 3KZYA 3QFFA 3A0BC 1JKOC 3HM5A 3Q9SA 1BI1A 2FQ4A 4N0BA 3KALA 1IXRC 4IHYA 2XROA 5KFVA 1O75A 1ZR2A 4LLNA 1IRFA 3A03A 4EG0A 2VL8A 1AA7A 5FLXZ 1SFXA 1P2FA 1DV1A 1JT6A 1HLVA 1ODDA 3H4BA 5KFFA 1Z91A 4CYCA 4DV2H 2IGMA 2M8GX 1D1CA 2WB1N 3KX2A 4Y33A 1FZPB 2LOOA 3ZQQA 2XV4S 2HVRA 1DPRA 2KP6A 4D1QA 2VQCA 3WU2C 5KFPA 3GV5B 3RGZA 2ZDGA 3FXKA 5B5EC 4A3BG 3L2RA 3PN1A 3CUQA 5DG7A 5IPAA 4DYQA 4DBQA 3OSPA 1Y14B 1FEXA 4DIQA 3W2WA 4BE2A 3H40A 2IPQX 2MSYA 5EWGA 5DCMB 2JT1A 4D5FA 3CDIA 2O5RA 2WBMA 1FJGH 1ZARA 4NC7A 1YJ9I 4A3DJ 3Q0WA 2P81A 4N4OB 5A2QK 3L9FA 1WI9A 2OBPA 3I64A 4LITA 5F0CA 3SJMA 4L5EA 3IG0A 4ECXA 2BHZA 4EVIA 5GTIC 5LEJA 3GW2A 3EUAA 1TA8A 3W2AA 3RQ4A 4RAYA 4A3IG 2R8GA 2VI6A 2BBYA 2O0YA 3RKYA 5H2FC 1F9NA 3H9GA 1DDNA 4BY1J 3EDPA 3GFMA 1A0IA 1UC9A 2JA5J 2GXBA 1K78B 1RK6A 3EUKL 5JHFA 1O4XA 4C3JJ 3H5RA 1M6VA 4QWDA 4M71A 3L2CA 2R6FA 4FISA 1Z0XA 3RBEA 3DTKA 1FYKA 3ERMA 4MEYF 2W9BA 3K6GA 4BBSG 4ESFA 2MD5A 4ESJA 4AC0A 2R7DA 1I27A 3Q8RB 4XLNF 4XLFA 3IAM2 5KFNA 1WSUA 3MVPA 4A69C 4KT5C 4BU2A 3RKWA 2PBIA 4LLLA 4PK4A 4AWXB 5HLGA 3ZQIA 3WGIA 2FNAA 2KT0A 5KAIC 3AFHA 5DV5A 5C3EG 5E20A 1IJWC 2BZTA 2FPGB 3LWBA 3NQOA 1ENHA 4DL5A 2LG4A 2BY3A 3SHFA 2F4IA 4X64H 3QYBA 3HSEA 1CQIB 1XGSA 4FS2A 4BUPA 2ZO4A 1BN5A 5KFZA 5HDKA 3RSNA 2ZDQA 4IRKA 3H3VH 2XRLA 4EGQA 1QZYA 4XK4A 4Y7NJ 1Y1WJ 3HJEA 3R0AA 2PJRA 4EV0A 1F1ZA 2RDIA 1QZZA 4BS9A 1QQIA 1X2MA 3C0FB 4FTHA 1NTCA 3DTEA 3M7GA 5J4YA 1G6NA 5KFHA 3TO9A 1JXSA 2UXDH 1ZELA 5CVVA 3WO1A 3WHCA 4ZZDA 4CHUA 2F6CA 3N42B 5J1RA 1VQ7I 2V5AA 4E7IA 2PN6A 3H5AA 1IN4A 4LK1F 4QWEA 1NH3A 4B3AA 2R92J 2OC6A 4BE0A 3WE2A 3U1DA 3FHNA 2JQ7A 3A4CA 4YG2F 5CVIA 3BG6A 4A3DG 2W8KA 1HC8A 2P6TA 3GEZA 1RR7A 4DOZA 2F5CA 5KG1A 5KFWA 1MW7A 4EEYA 3S3NA 1D8JA 2NVYA 3CVZA 4B4CA 4PZJA 3LAJA 4II3A 2Y9YA 4O3MA 2O8XA 5EF6A 1B9NA 2E1CA 3RUPA 4BY1G 2K9NA 3G6YA 2DMUA 5CLSA 2E7WA 2JA5G 2R85A 4LB5A 3I56I 1VQ5I 2E2JJ 4WD3A 3NWSA 3PVXA 1XS9A 3BJ6A 5HODA 1USSA 4RUAA 4KHPH 2FNPA 3MFIA 3FBNB 4GYIA 4M9SA 4A0XA 4ED1A 5TRDA 4LB6B 3GVAA 4B48A 2V4QA 5J40A 4DL4A 4LOCA 2GXAA 5DGBA 2STTA 3E5XA 2UWMA 3RKXA 5DD4A 2Y0SE 3N43B 3GV8B 4PDKA 4Q8FA 1GVJA 5KNLA 3A02A 3UR3C 1GV5A 3RPQA 2JSPA 3VODA 5HS8A 5E3MA 4FX4A 1ETYA 1H9TA 3FHZA 2JA6A 5J8CA 3RPUA 1YE9A 1ZKGA 1OJLA 2K9MA 5HNHA 1MMDA 1ACIA 4NDLA 3H20A 4GKJH 1HCRA 5E3NA 2HS5A 5LD2C 3Q5FA 1N32H 2C2DA 3F8NA 1X3WB 3TGNA 3ML6A 5D8LB 1XDSA 2L54A 3A2KA 1W93A 1IZ1A 2X6XA 2LP0A 3CP8A 4XLCA 5FKNA 2UU9H 3BC8A 2R5YB 3E5NA 2P7CB 1Y1WG 3CTAA 1J5EH 3C18A 4DLKA 2HKOA 3N40P 3TDZC 4MV9A 2W9AA 4J9MA 3ABMH 4JI5H 4MFEA 2LRDA 2MABA 5JVGF 2FOKA 1P7JA 2YU9J 1Y8RB 4LG0B 1XGNA 3ASOH 5F0HA 2LY2A 1R5HA 4L9NA 4IWXA 4EGZA 3N44B 3F21A 5D4RA 2XSJC 1R9TJ 2M05A 4RA2A 4OINF 3SQNA 5LLQA 3ZQCA 3MR5A 2XPUA 1W0UA 2R92G 5KHDA 2MD0A 1O3TA 2HTJA 4IOAF 4NQWA 5L3BA 4RZRA 1CGPA 1W7PD 5FJ8J 3ZQ7A 2ZXHA 4A93J 2DTZA 4DR1H 3HIFA 3ECOA 3AYHB 4R8UA 3K10A 4F3QA 1FTZA 1HOMA 1NG6A 2V9PA 1TZLA 3QPSA 2PI0A 2XGEA 1GHCA 1J59A 3DF8A 4IQJA 3V42A 3DFGA 4ZOLF 4JX6A 3WGHA 4LMYA 4WWCA 4E7LA 2JVGA 5JH7F 1T3NA 1WGXA 1QA6A 2R92A 3MR2A 3PM1A 3CMAI 4C2UA 1BIBA 1U0JA 3BR5A 5K5RA 4YQWA 2WAFA 1A35A 1FOKA 4RGUA 4Q47A 1ZG5A 1A04A 2JEGA 3KFWX 4QPQA 1A31A 2Q2EA 3VSLA 1J9IA 2GWRA 2PBZA 2CZGA 2J9GA 1HA8A 5EGOB 5DCFA 2HKXA 4DZPA 1GGOA 5E79C 1YYVA 3KE2A 2UZKA 1A5JA 3PW0A 3CO6C 2W48A 1CE8A 1BOBA 3BWGA 2NVXA 2YS9A 1R58A 2XRNA 4J0MA 3G71I 4AIKA 5L1JA 2NVQJ 1WQ2A 2PQ8A 4O3PA 3JRWA 5L9XA 5C1PA 2M7BA 2JEFA 1SD4A 3DF7A 2YU3A 3HUGB 4ANJA 1AHDP 3CC7I 1XDNA 3BG7A 1IGNA 3FKJA 3HSRA 3M1EA 2ZXWH 3VYTB 5J6XA 2CGPA 4ESBA 2GOXB 3K4KA 1GLVA 1I7LA 5C5JA 3SZPA 3TL4X 4LIUA 5TJJA 4DJAA 3JRFA 4G6QA 3OHAA 3Q1KA 3PQJA 2E19A 4KIFA 4L18B 4OIQF 3MEXA 5EDWA 5CB4F 2EIMH 1VF9A 2Z99A 4ZTFA 4ASNA 4XQFA 1WH7A 3RIZA 1D0ZA 1O7FA 2VIXA 5LMUH 1ON1A 1V5GA 3CCJI 3S1MJ 3PO3J 2FP4B 3KP4A 2LTPA 4G8XA 4OMZA 2G0EA 5T14A 2FLPA 3RIRA 2ACJA 2OUMA 2UVUA 4BL0B 1IV6A 2E34A 2HR3A 4R79A 2BXYA 2M8EA 4E7ZA 4MEXF 2ELJA 2CJJA 3RYPA 1MDMB 4M3DA 4RAFA 4J00A 1HDDC 4ZDOA 3JW4A 2QVOA 5CQGA 4KUMA 1GO3E 3V4SA 1ZQ3P 4X6AJ 1X4PA 3E5UA 3GZ6A 1T94A 2EWNA 5FPOA 1OLTA 4GYGA 2XAGA 1FLIA 3CZ6A 1FMWA 1Z6TA 1FTTA 1G3WA 2OQRA 2L9NA 3TINA 2JWTA 2VKEA 3OR2C 4DR6H 2W1OA 1I6HJ 1UG2A 2P0WA 3WODF 4CH7A 2JA7A 1OISA 1UMQA 2V6CA 5FJ8G 2PX9A 1WJDA 4M3GA 3KEYA 3HPGA 4A93G 3H5NA 2W57A 4BEHB 2W6ZA 5GAGJ 3F6VA 1G3TA 3AAFA 4XNFA 3CMYA 1WCMJ 2BY2A 3E97A 2QKMB 2F5FA 1TWFA 1E3PA 1MD0A 2M30A 4M9ZA 2R8KA 4HPQA 4HF2A 1JTYA 4J9RA 2YRXA 3F0CA 3OYCA 2V4RA 2RREA 5KT5A 1W5CC 4L5JA 2IA1A 5JR3A 1SC7A 3F23A 4J19A 3W6JB 1L3LA 4JYAH 3GTOJ 1E3HA 4B47A 3F22A 3PIOF 3A01A 4EYHB 2IA0A 3LA3A 3GIJA 2V59A 3OYMA 2ELHA 2ESNA 2R5ZA 3HTUA 4I2OA 5KT7A 2BHYA 1A6IA 1V5EA 2WAQA 2QLZA 5D5UB 2VOPA 4M6YA 3HOXJ 3WG9A 2HNHA 3IWFA 4HDUA 5C4XJ 4OU0A 3RTXA 4PJJA 2A5YB 1ERDA 4MHGA 2V1NA 1S6LA 1I94H 3Q0VA 3O8GA 4DR3H 2YW2A 4UVCA 4JUZA 4XMYA 2CV1A 1IBLH 4ZTJA 3LMMA 3A0HC 1I6XA 4BE1A 4UCSA 1IN8A 4RB1A 2QQ9A 2PMZE 1HKQA 4PCQA 5GAEJ 5FLMJ 3QU3A 5IY5H 5C4JJ 1YHQI 2KZVA 4C3IJ 1TW2A 1Y39A 1K7AA 2KSWA 1TWAA 2F48A 4HSRA 2KL4A 3OYFA 2KJCA 2BOLA 2K9QA 2JEJA 3LA7A 1S9FA 4CA0A 3EUHC 3ZXSA 1S03G 3JRCA 5LA6F 5J3LA 2ME0A 4UFZA 5KFEA 1YITI 3IKVA 1C0WA 2A6EF 4OIPF 1RESA 2KJBA 4ZDPA 4G7OF 2QBYA 3DPLC 2CQQA 5E3LA 2DAOA 4U6PA 1PK8A 2EZLA 2VONA 3PO3G 3JAMK 1QGPA 3S1RJ 3J81K 4ECQA 2XD4A 2DA1A 5D1OA 4JV2A 3P9IA 3KP3A 3GLKA 2OV7A 5ERIA 3IN5A 3BG9A 4YIFA 2AO9A 3ZQHA 1LE8B 5EDNA 4AD9A 1XSVA 4ENMA 5F1JA 2GLOA 3BTCA 4ZJZA 2VKHA 1P7IA 4EM1A 2XIGA 3MCZA 3NGDA 3Q9VA 1FNNA 4OIRF 5LOVF 2DA6A 2EB7A 4KDPA 4BQOA 2DT5A 3C2HA 4EFEA 5C44J 2RGRA 3G2BA 4S05A 1K6YA 2VBYA 2DQRA 4MV1A 1UB9A 4GDFA 5IYZF 3W3CA 2ALZA 4DW6A 3L7WA 1RETA 2RDPA 1FJLA 1I5ZA 4XR6A 3GTKA 3KP5A 2ZXIA 3FMQA 2OTJI 3DLLF 5IYCJ 2R7SA 4KIGA 2X9DA 3SDBA 1TBXA 2QUFA 5EG0A 1WCMG 1O7LA 3L09A 1FWZA 2WV0A 5FRNA 3OYBA 4O4HF 2L9RA 4AYBA 2HDDA 2MH2A 2KRCA 2KRFA 3HGYA 5IP6A 3BQZA 1FBUA 3S3OA 3QOEA 3U2RA 4O3QA 2PMZN 3HOTA 4LLGF 2QSGX 5JLXA 3F8FA 1VTNC 1S68A 3KCCA 4M6XA 1APLC 1WCMA 1WJBA 3RTRA 3HOXG 2GPWA 4U0WA 5C4XG 4XBFA 2NVTJ 5L3DA 3IKTA 2CUFA 1V3FA 4EQQA 1DUXC 1WH2A 3T1BA 2W82A 1KU2A 5L3CA 3S1NJ 2BQUA 3A1YA 5M5WJ 5KFJA 4UB6C 1REPC 1ETQA 5FLMG 4W97A 3N05A 3R5FA 1IXSB 1IOVA 1IDYA 3GFJA 4LGWA 2IGNA 2IP2A 4YFXF 4GLXA 3OYIA 3OR1C 4NC8A 3RYRA 2Y2ZA 1VFCA 5FO5A 1UAAA 2G7HA 1V9PA 3R23A 4QIWE 2VJJA 2EV6A 5EEHA 5IOYA 4BBRJ 4DR4H 3PSFA 2M0CA 2UVVA 4ZDLA 2LMDA 1LDDA 2HQ5A 3QYFA 4O4LF 3DPUA 1RJPA 4EBEA 1PX2A 1PYVA 2MC4A 2WAQN 1Y6IA 3QPHA 2ISZA 3Q8SB 1T38A 4D0PA 4HQ6A 3C2BA 2DN0A 2H6CA 3MD2A 2O3FA 1VQOI 3RI4A 2COMA 1WWXA 2H1KA 4BXXJ 3DBRB 5KFOA 1IN5A 2OU2A 3U1KA 3J7ZI 3N4MA 4DV5H 2RAEA 2R8HA 1SD5A 1V4RA 3K1PA 4Z6YA 1RKWA 3PW4A 1TWHA 1ETWA 3E6DA 3KHHA 1K61A 5LRSA 3H3ZA 5K7FA 5KX5F 3FKIA 3M8FA 4ABZA 4JI3H 1QU3A 4P55A 3K5IA 5C44G 2EV5A 2BEOA 1FSHA 4UUVA 3L4JA 4HX7A 2QQBA 4YIIA 3PZPA 3HSFA 3MZYA 2C2RA 5IYCG 3S16J 1RJQA 5DUKA 1Z2OX 1XMAA 3RB4A 3PUFA 2HQAA 3DPTA 3ZGKA 4P9UA 5DM7F 2WY7Q 2X1DA 4UV9A 3KEQA 3W6KB 3WTVC 4EM2A 2VA2A 3WTXC 1JHFA 3LSTA 1ZG1A 1VQ4I 1KONA 3F6OA 4JI7H 3MJFA 1R22A 1SCUB 2CW8A 3HOWJ 3EETA 3T5LA 3NARA 4N4NB 1DP3A 4EYIB 3MWDA 5GTHC 4O4IF 1Y0NA 1XNRH 2D5VA 1HR0H 3TKYA 2VB6A 4MV8A 3VB2A 2DJIA 4U0YA 2ETHA 2WV1A 2E2IJ 2FJZA 2VOOA 4ITVA 3V4ZA 1T56A 2XGQA 4HLXA 4BHBA 5LYJF 3ULQB 4C9YA 4MAMA 3V8KA 2R0QC 1R4MB 3M07A 2M9HA 3TIGA 2C22A 1Z1DA 2HYJA 4IKFA 3OYLA 2WB1E 2FBKA 3LQQA 2O61A 1B6AA 4J01A 4BQNA 1S10A 2EFOA 2CSOA 3E5QA 4M3BA 5LRRA 1FX7A 2R8JA 2MLGA 2ZB9A 4NC6A 4YFKF 2YZMA 1TWGJ 2O03A 2N8GA 2EIKH 4BBRG 2MBFA 3DV8A 3HKZA 3NAUA 5F6FA 1AKHB 1T95A 5DS9A 3ABUA 1V55H 2W00A 1XG1A 5H20A 3MWEA 3OSNA 4YBZB 2MH9A 5IYBJ 4DV1H 1HSJA 2D2WA 1HSTA 5E18F 2K4JA 4JI6H 1TL8A 3HOVG 1VNDA 2J6UA 1K4TA 1IUFA 4BY7G 1S72I 4Z2YA 3ZMTA 5B1BH 4HR7A 4BXXG 4HNTA 2W85A 1JGSA 4FM9A 2ADUA 2WTEA 5M3FJ 1R4NB 2OA4A 2ISYA 3DQVC 3L1PA 1Z2NX 2X0LA 4CCKA 2UV1A 1DGRM 2XASA 1I7NA 3K0LA
chains in the Genus database with same CATH topology
1U3EM 4BWSC 4YY3H 1BIAA 4DV0H 2MCTA 4F7ZA 1FY7A 5K5OA 3GO5A 3GWZA 2HQRA 2VN2A 2L4MA 4MQ9F 2IW5A 4R7RA 2UXCH 2VUGA 4HQMA 4FT8A 2IVMA 1BGWA 4P96A 4YHHH 2DTRA 5DD8A 2EFQA 3ZMSA 3CUQB 3WTWC 4BXUA 5FLXK 4IHTA 4DUYH 4XSZF 1SFUA 5EEGA 2A69F 4MTDA 4LF5H 4I0AA 1W7PB 2PLYA 1L2ZA 2A6HF 5F1RA 1FC3A 2B0LA 5D4SA 1BI2A 4EMSA 4GKKH 3V7RA 3EYIA 3V7CA 4LFBH 4CXFA 1H0MA 4WCGA 3I4PA 1FKAH 2Z5UA 3DKWA 1ZGAA 5DYMA 1KQ9A 1FT9A 1D5VA 3VEPA 1S29A 1Z7UA 3ZMUA 4A0YA 4U7BA 2M87A 4ZYHA 1P8LA 2NNYA 5D6EA 4CICA 5LHGA 2VBWA 1RUOA 2XGXA 3OOPA 3LFKA 4JQFA 3ROUA 4O6JA 2F4VH 1AN7A 2DO7A 2H94A 2FE3A 4HW0A 3N6XA 1N33H 5F64A 1ZRFA 2XHKA 2FU4A 3JTHA 4LFUA 2MLKA 1XN7A 2HEOA 4JI0H 2W24A 5DDGA 3RGXA 2FA5A 1KU7A 1W4MA 3K69A 5HOOA 4KN7X 4O5VA 4AIJA 2K27A 2P8TA 4LK0F 5L3EA 5CJ9A 1K79A 1YW8A 2VOBA 3K1MA 4NXNH 1YW7A 1P6RA 5D6FA 2LKPA 1F4KA 3GZ5A 3KAJA 1SYXB 4A5MA 4DQ2A 2YSRA 2W25A 4AVPA 1Z6RA 5D5VB 3WE3A 5ILVA 1LDKB 1K6OA 4M7EA 4RB0A 2L3DA 3BOQA 2ZMEB 2DU9A 1USTA 1J75A 4A6EA 4R1HA 5JVTA 3CO7C 1YW9A 4Y15A 4EM0B 2P6SA 2ZXJA 2J5PA 5DUIA 1TAEA 3I53A 5LGTA 2Q0OA 3FX3A 2ZJTA 2RQPA 1SMYF 4AQYH 3ZMVA 2HWVA 3FMAA 5ICFA 3R61A 2W84A 3UQ8A 3FF5A 3CJNA 5JHUA 2ZBKA 4IAJA 3M9AA 1TQIA 4A2BA 3KAKA 1GXQA 3KP2A 2HZTA 3HRSA 2VE9A 2HOEA 1FYMA 2PEXA 1D8KA 3N97A 3EYYA 1FP1D 3BROA 3KLNA 1YQAA 1J2XA 2ZNYA 4Y17A 3T1YH 3BA9A 3E3VA 3R0JA 4L9JA 2E7XA 5BR8H 1IBKH 4JBAA 5IT9W 3BABA 3I59A 4UCUA 4WF2A 3PFIA 3BPVA 3SXYA 3L00A 1QNTA 3NEUA 1OR7A 4LG0A 1IF1A 3ELKA 3IRQA 4B3RH 3KLOA 2XAQA 4UVBA 1W5SA 5AIQA 2K02A 4LF8H 1MJ9A 3HRUA 4ZH4F 2ZJ2A 1XD7A 2G9WA 1ZYRF 3WU0A 5LHHA 2FMLA 2WDTA 4Q48A 2Q2TA 1O3RA 4B3MH 2FMYA 1XDUA 3CLOA 3L4KA 4E70A 2QYOA 4K2EA 4IRIA 3DEUA 4Q5SF 1ZHQA 3IHUA 4EEQA 3FZVA 1B9MA 4BHPA 4RZQA 4NXMH 5LGUA 2P4WA 2FEZA 1BOAA 3RF2A 4I01A 3N41B 4ZZLA 2OZUA 4KFCA 2K7LA 3PQKA 3TDUC 5E8GA 2ZKZA 4LF4H 2OD5A 2CYYA 3REOA 2HYGD 2LSOA 4A2AA 1PP8F 2NNNA 2YX7A 1BM9A 1L0OC 2V1UA 3TO6A 5IWAH 2P5KA 2QM3A 2OZ6A 4GXOA 3DXJF 1HNWH 3RDIA 1R36A 5IT3A 1H9GA 1T0FA 1ONVA 5HDNA 1TQMA 1RI7A 3EQLF 4X62H 1FPQA 4PGGA 1TQPA 1R1VA 1XCVA 2GA1A 4KYWA 1ZN2A 3J80W 3G3ZA 2VE8A 4LFCH 1ZG3A 1LEAA 1KU9A 4LF6H 3QPTA 1HW5A 1WRJA 5K5QA 1XNQH 3D0SA 2HFHA 4MQVA 1M0WA 2CO5A 4UNOA 2UXNA 4I0BA 5D5XB 1Q1HA 4IHSA 4ZYGA 5CVJA 1Z05A 1R23A 2QBYB 2EJRA 1S8NA 2HTSA 1GXPA 5FFZA 4HX4A 5HVQC 3KZZA 2FBHA 1P4AA 4WK8F 2CW7A 3C1DA 1HNXH 4KA4A 4A2UA 1O3SA 1LEBA 4Q4ZF 3I0TA 1SEIA 4HA8A 1N34H 3EUHA 3T5XA 4KN4X 5KK1A 2DQLA 5LGNA 4UCOA 1B4AA 4DNCA 1XSXA 2Q2UA 1OYWA 4RAZA 5H6QA 1YS7A 4L5IA 1SMTA 2JRTA 3J80Z 4DUZH 3F72A 4IPAA 1Z9CA 5FB2A 4L0ZB 3T8TA 4DV3H 5CVRA 4B3TH 2WWYA 1IN6A 5HLIA 1FBQA 5AIPA 4UVAA 4LD5A 2LDUA 5EOYA 1LVAA 1ZRDA 4RB2C 5FFXA 3OTOH 1J0RA 2KKOA 4M73A 2EK5A 1T2KA 4NHJA 4B3SH 1YLFA 1X9NA 3R6SA 2BYVE 2ESHA 1E2XA 4JI4H 4NB5A 3MQ0A 1IRGA 3BPXA 3U9GA 1YO5C 1BJTA 4KNYA 3V7SA 1ZLKA 2R3SA 1XMQH 2GIVA 2WE6A 3BA8A 3FM5A 5ICCA 4HV5A 2HQNA 3MZHA 2PMHA 5D5WB 4GCVA 2XVCA 3E6MA 4OX9H 2PMUA 3GXOA 2RKHA 1UHMA 5E8IA 4L0YB 2D45A 4U88A 2ZFWA 3BAAA 1OYYA 5HS9A 1XMKA 1DP7P 4HF1A 3FXQA 5BMZA 1XB4A 1AWCA 3HXLA 2EFWA 4ZYDA 3HRTA 5BQTA 3H3UA 4EJUA 4HF0A 1R1TA 3T0YA 1U2WA 1N36H 4A0ZA 2ZCWA 3MWMA 4IJAA 3L2PA 1B1BA 3ABTA 2VC0A 4EFBA 4G7ZF 4RS8A 1J7KA 4X65H 2X4HA 4I02A 1PDNC 5FLXW 1HW1A 1STZA 4L9VA 4HLYA 2DK8A 1S7AA 4A5NA 2PFBA 3FMRA 4CZZA 5FPRA 4ON0A 2CWEA 3QP5A 4FHTA 4OIOF 1SAXA 2QZ8A 3KEOA 2F2EA 5H6RA 5ILSA 3FXUA 5E1WA 5CVUA 2YX4A 5A2QW 3TOBA 3I71A 4IRGA 1Z2PX 4JI1H 4UV8A 1OMIA 1U5TB 3HYIA 1Y0UA 4YFNF 3T8RA 1U5TC 2V1XA 1UHWA 4EJWA 3K9TA 5E1XA 4EJTA 3GX4X 1TLHB 3J7AK 1MKMA 3D5LA 4IXAA 2AS5F 4XSXF 2KIMA 4A6DA 1KQ8A 2Y75A 3H92A 1TNSA 2K86A 1KYZA 1LB2A 3I54A 2R7FA 1KU3A 2VT3A 3CUQC 5HS7A 1G4DA 1MGTA 5ED4A 4AIHA 1CF7A 4MNUA 4ENNA 2DW4A 2YPRA 2VBXA 2HDCA 2IJLA 3T1HH 2NAZA 1IXCA 5ICEA 2H6BA 2J5OA 3R60A 4MGRA 4H0EA 5D1PA 2FF4A 2YR2A 4PGHA 1HQCA 2ZM6H 4KICA 3IL2A 1IUYA 1LJ9A 4L9TA 1RNLA 3GYHX 1KYWA 3TQNA 1HKTA 3FWEA 4DR2H 5A2QZ 2A3SA 5J8FA 1TW3A 1B04A 1NHAA 3QP6A 4B09A 2ZNZA 2FRHA 1W7PA 5DCMA 1BC8C 4ENKA 3KETA 2DFIA 1MZBA 4Q0YA 4I09A 4JI2H 3K2ZA 3HTSB 1K78A 1U6GA 3SZTA 3K3VA 2XAFA 3JSPA 4U7DA 2TDXA 3P9CA 3DP7A 2UXXA 2MA3A 2HHHH 4IF4A 2VC1A 3WTTC 1D3YA 1BBYA 2HGSA 2L02A 4Y13A 1SD7A 4JV5H 2VBZA 1OPCA 4X66H 3KP6A 1KQ0A 4XLPF 3SFZA 3BP8A 5LL6b 4A12A 1PUEE 2FBIA 1PP7U 2K4BA 4WXDA 4LF7H 3QU6A 2VPSA 1HXDA 3KXYT 3OV8A 1E4FT 2P5LC 2NS0A 3R4KA 4PDBA 2GAUA 2WC2A 3IC7A 3WTZA 1LNWA 1MJBA 2CW0F 1JHHA 4EGYA 4ZYEA 1I6UA 3BZ6A 2OQGA 1YFHA 1VS0A 1IW7F 2BE5F 4CYDA 2IT0A 2STWA 2E5LH 5HDGA 4KMUX 4RGXA 2VXZA 3CUOA 3WTSC 2VQEH 3LA2A 4WXCA 3BY6A 5L3FA 3IWZA 2CQKA 4JK1X 3V8LA 2ZMEA 2DPDA 3VFZA 2XKPA 5ILUA 2FSWA 5KVRA 4M74A 4EJOA 2XKOA 3QOPA 4BH9A 1ZREA 2XAJA 4BYYA 2M5WA 3M8EA 4EJVA 1TNTA 2Y0MA 3I5UA 3BDDA 4HX8A 1T39A 2MC3A 4QLCU 3ERED 4KIBA 3BJOA 3I59B 1KA8A 1P4XA 2BGCA 1ZLJA 3HOSA 1I1SA 1R00A 2HVQA 1O3QA 2RC4A 2JZYA 2UUAH 1R1UA 1U78A 5DEQA 4OOIA 1G3SA 2QQAA 3ZP5A 5BS6A 3HRMA 1ZRCA 3E6BA 2EV0A 1XCBA 2LNBA 2P5VA 2VT2A 3FM3A 3BJAA 4LJZF 4DV6H 5JFRA 3FXRA 2PJPA 4UCRA 1UCRA 5LHIA 2KIUA 2RN7A 4HBLA 2V9VA 2XUBA 1S3JA 3S2WA 2A07F 2UUBH 2H09A 1YG2A 2D1HA 2DPUA 2M45A 4CDGA 4N9HA 1DPUA 3QAHA 3F3XA 1KGSA 2V79A 1GYFA 4QWQA 3WTYC 2JPCA 2NRAC 4M9XA 1BI3A 1HBXG 1J5YA 1XMOH 3M4IA 2LF8A 3ZMZA 3ISPA 2NYXA 4HDVA 1W5TA 1XGOA 1EH7A 5L3GA 1YIOA 4WXHA 3CDHA 5K1YA 4BQAA 2EFPA 3HUGA 1YS6A 2DLLA 5D8KB 1SFEA 5IT9Z 2XAHA 2F5DA 1G3YA 4N9IA 1HW2A 2M1BA 5IT9K 3E6CC 2JTVA 1EH8A 1YTYA 2IA2A 4ENJA 4HAMA 5HLHA 3FMSA 1ULYA 2A68F 2WYOA 4LF9H 4DR7H 4HQEA 4UXNA 3JAMW 3WGGA 3J81W 1BC7C 3IRRA 4HYEA 2OAZA 3G73A 2Q8KA 4DR5H 1MDMA 3K1NA 5FD6A 1ZHSA 3GLXA 1E4GT 1FYLA 2DI3A 1XSDA 1F5TA 2GZWA 4G94A 4GGGA 1FP2A 3ZMDA 3ZN0A 2AXLA 4HV6A 4ETSA 5JI6A 2HGCA 4P9FA 4IVNA 1UFMA 3C3WA 3COAC 1JE8A 5D1OB 2RGVA 3RJPA 1HKSA 1WKMA 3O6BB 3WTUC 4UCVA 4UCTA 1SD6A 2KIFA 2IRFG 4CGZA 1E17A 1BJAA 1QO0D 1QPMA 2EA4A 4XRFA 3ZN1A 4RGSA 4LH7A 3C7JA 4HZFA 1RUNA 3JAMZ 2L4AA 1IAWA 3J81Z 4HOBA 4RB3C 3QRFF 1ON2A 1TTYA 5LMNH 2FXAA 2CFXA 3MFKA 1AOYA 4UHTA 4K0KH 1FSEA 3F8BA 4R8HA 3J80K 3LAPA 3ZPLA 4MTEA 5E17F 3TOAA 4BHCA 5AONA 3LMLA 4OMYA 4I7HA 2QWWA 1RIOH 4DV7H 1IBMH 2Y48A 3LQRA 1ZH5A