4RB2C

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-fur-mn2+-feoab1 operator
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
134
Chain Sequence
b'MVSRIEQRCIDKGMKMTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (25-MER)
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 34
structure length 134
sequence length 135
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb2C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb2C02
1XGSA 1JGSA 3MQ0A 1XGMA 1L3LA 1EH6A 1ODDA 3GO5A 2VOPA 1TQIA 3CTAA 1KU2A 4JK1X 1MKMA 3B02A 3DPTA 1JHFA 3I54A 1QZZA 3CUQC 1TNSA 1IW7F 2A6HF 2NNYA 4M73A 1XGOA 2EK5A 1ZH5A 5ICCA 3GFIA 2P5VA 5CVUA 1IXRC 2D1VA 5L3FA 2DPDA 4L5JA 4A5NA 3KP4A 4L5IA 4EJVA 3ZMUA 2LF7A 2DBBA 3IWFA 5EEHA 3GZ5A 3BJ6A 2ZJ2A 2DLLA 2BBYA 4KIBA 5DD4A 4ZYDA 3MCZA 1ULYA 1QPMA 2M45A 2QBYB 4Y17A 1G3TA 3KEOA 1FX7A 4MGRA 3RI4A 2YR2A 2LDUA 1QGPA 2ESNA 4FT8A 4GCVA 5FFZA 2Q0OA 3SFZA 5DEQA 4HLYA 1IN6A 4D0PA 3M7GA 5DV5A 4RB3C 1B4AA 2HOEA 2A69F 4F7ZA 4CICA 4KMFA 1YS6A 2JSCA 2HTSA 5LLQA 1FSHA 1IN4A 3TO6A 4EJOA 1E17A 3QAHA 1QBJA 3KETA 3R61A 4Y15A 2DK8A 2ADUA 5ICFA 2A3SA 2H6BA 5CJ9A 4XSXF 2O6GE 1Z05A 1ZRFA 5BQTA 3RPQA 2HYGD 2CYYA 5LGTA 4M9XA 1FYLA 3MAJA 3PQJA 5BMZA 3IKVA 1RUNA 5LEJA 4N0BA 3FZVA 2HQRA 3WE2A 5HDGA 4KMUX 2CQKA 4HYEA 1Y0UA 1BC8C 1P4WA 3F23A 1IXSB 3R0JA 2V79A 2JZYA 3ERED 4BH9A 3HRUA 1AWCA 5HS7A 3CJNA 5DUIA 1QO0D 2XAJA 3DQVC 3P9KA 1PUEE 1QNTA 4GYIA 4WWCA 4JQFA 3QP5A 5BS6A 4UUVA 1OR7A 3BPXA 1ZRCA 2L01A 4I98B 4KYWA 5L3CA 1O3QA 5LGNA 3RYPA 4YFXF 4WF2A 1KU9A 1FNNA 5FO5A 3R6SA 2EV5A 3HSEA 2JT1A 2FBKA 3QP6A 5HOOA 2GZWA 2F5CA 5DD8A 5FGMA 2M87A 3VOEA 1IN5A 4I2OA 4CZZA 2DFIA 1HXDA 3E3VA 1DUXC 2FOKA 2IA1A 1LDJA 2NAZA 5ILSA 1W4MA 4LLGF 2Y48A 3NEUA 3LA3A 4A6EA 4MQVA 4CYDA 3KEQA 1WI9A 2EFWA 3FXQA 3HRTA 3MZYA 5ILUA 2RC4A 2XGXA 3DXJF 4WXCA 2GIVA 1D5VA 1YFHA 1EH8A 2V6CA 4G6QA 5BPDA 4EGYA 4HW0A 1SD4A 1Z9CA 4AIHA 1R7JA 3DF8A 2GAUA 5F6FA 4I01A 2NYXA 1O3SA 4G7ZF 1GXQA 3M8EA 2MA3A 3BROA 1F4KA 2H27A 3M9AA 3I59B 3E6MA 1USTA 3HHGA 3WG9A 5D5UB 1ONVA 3P7NA 2QUFA 2GA2A 4HF2A 4Y13A 5HLGA 1DPRA 1A04A 2A07F 2R3SA 2VXZA 3I0TA 3DV8A 3ML6A 1FPQA 1FSEA 1B9NA 2DQRA 2EWNA 2X0LA 2OZUA 2P6TA 4YFKF 2QQBA 1S8NA 2VOOA 5J6XA 3B73A 1T98A 2W57A 3V7CA 3V4GA 1S3JA 2VN2A 3CO6C 4UV9A 2FSWA 2E7XA 2VBYA 1T6SA 4AIJA 3I59A 1I27A 2QYOA 2IPQX 5HS8A 2TDXA 1BIAA 4FX4A 1B9MA 3RKYA 4IXAA 3TQNA 1K79A 2A5YB 3K69A 5JVTA 4L18B 3DEUA 2VBXA 1B59A 2DQLA 3FXUA 4KA4A 4XLNF 4KN4X 1I5ZA 5BOXA 4KN7X 3EQLF 4MEXF 3Q9VA 1IZ1A 1J0RA 4HX7A 1KYWA 4IHSA 5FLXK 3HTSB 2FMLA 4YFNF 2ELHA 5L3EA 1HW5A 1FOKA 3ZMZA 1TQPA 1XGNA 1W7PB 2HTJA 4OINF 4RAYA 4U7BA 3FHZA 1ZARA 4LG0B 2HKOA 2ESHA 4HQMA 4OMZA 4RGXA 4UHTA 2ZKZA 1ZLJA 3SQNA 4UVAA 4H0EA 2UXXA 4DQ2A 2E1NA 4HF0A 1V3FA 2F5EA 2V9VA 3KE2A 2K02A 4IHTA 4LFUA 3F6OA 3F22A 3HOSA 2Z3YA 4XRFA 2A68F 4BNCA 3KP6A 2CO5A 1WRJA 5DCMA 2P5KA 5F1RA 1XD7A 1W7PA 4M6XA 2WWYA 3F8BA 3SZTA 1RIOH 1L0OC 4UXNA 2GWRA 1KU3A 1BI0A 3F3XA 1MJ9A 1RI7A 4G6DA 4G8XA 2QZ8A 4AIKA 1FBSA 4OIOF 3GLXA 4UVBA 3RDIA 2VE8A 3BPVA 1E2XA 2OBPA 4BYYA 2B0LA 2O3FA 2QWWA 4R8HA 1ZAOA 4BAYA 2HGCA 2OAZA 4Q48A 4ESJA 1B6AA 4ON0A 3I4PA 2IW5A 2V1XA 4HA8A 3O3KA 4U88A 3TOBA 3ECHA 3WTXC 2OQRA 3J80Z 2F5FA 1X3UA 2QQ9A 2YPRA 1EV7A 3RTRA 4HDUA 3MZHA 1S7OA 4LD5A 4OIPF 3QPHA 4P55A 3BOQA 3FM5A 4L0ZB 4KT5C 2BGCA 4M71A 2WC2A 3GZ6A 4LJZF 1OPCA 2BYVE 4BHCA 1HBXG 5ERIA 1YIOA 4B09A 3CUOA 3R4KA 2DW4A 1OKRA 5E8GA 4A12A 1SMYF 5D4SA 3HHHA 1WQ2A 2EB7A 4LK0F 4XBFA 5IT9Z 1P92A 3OOPA 1XB4A 3FX3A 2X4HA 1F9NA 3WU1B 3BP8A 3V7RA 2K4BA 5FD6A 1U8RA 4PCQA 5LBQA 5DDGA 2LKPA 3TDUC 2XUBA 2W85A 3IC7A 4OIQF 2KIFA 5AONA 3WGIA 4P9UA 1ON1A 4EM2A 3E5UA 2EFQA 2ZBKA 1UFMA 3L09A 1R00A 2P7CB 3RYRA 4N9IA 3E97A 4EGZA 1YO5C 1K78B 1K7AA 1H9TA 1U5TB 3E5QA 1G3SA 5ILVA 1B1BA 3CO7C 5H20A 1BM9A 1UB9A 4CXFA 1LVAA 3K9TA 3QOPA 2XIGA 3L7WA 3S2WA 3ZMVA 4EVIA 4MNUA 2W84A 4L0YB 1SMTA 3SHFA 1UCRA 1I1GA 5DUKA 3DP7A 4HX4A 3V8JA 2XROA 2J5PA 2PJPA 2EJRA 4NB5A 1J2XA 3GFMA 3IKTA 2Z5UA 3Q9SA 1K78A 1U5TA 1OYWA 2JTVA 3LSTA 4O5VA 1O3TA 3QU6A 2RGVA 4LK1F 1MDMB 2EFOA 1FYMA 1RUOA 1IN7A 2M30A 2O03A 2Q2EA 2XV4S 2CW0F 4FX0A 3H3UA 5AIQA 1WSUA 2G9WA 3GEZA 1J75A 2D2WA 5CLSA 2D1HA 1ZREA 2FBIA 4RS8A 2O0YA 3OV8A 2XKPA 3WE3A 3F8NA 4P9FA 1HKSA 3JTGA 1BJAA 4O3MA 3EDPA 2XAHA 1D3YA 3BWGA 3JAMZ 3K0LA 3D0SA 3K2ZA 3DKWA 2UZKA 3QRFF 3EYIA 3J81Z 1MDMA 4ESBA 3BJAA 2HYFA 2MLGA 1O57A 4EJUA 3IHUA 2A61A 1FBUA 2JPCA 4I0BA 2DI3A 1H0MA 4MQ9F 2P6SA 1T39A 1XMAA 1SAXA 2PFBA 2HZTA 1LJ9A 2WV0A 4KDPA 2H09A 4U0WA 3U9GA 3KP2A 3DFGA 3T8TA 3LAPA 3ZQ7A 1ZLKA 4QWQA 2GQQA 2FE3A 5E1WA 2G7HA 2IA2A 4TV7A 4LLNA 3LWFA 5J8FA 2ETHA 4LLLA 1G4DA 1W5SA 4KIGA 1BIBA 5L3DA 1O3RA 3V7SA 3T1BA 5D4RA 3F6VA 3KZZA 1STZA 1HW1A 2FF4A 2STTA 2AS5F 2MH2A 4IF4A 4RB0A 4A2UA 2DTRA 1CF7A 2XKOA 4PDKA 2STWA 1R1VA 4ZZDA 3E6BA 4YIFA 1XSXA 4L9TA 1BI1A 3H3ZA 3JSOA 2FNAA 3V8KA 5HLHA 2RQPA 1FWZA 2RVCA 1YTYA 1SD7A 2MBFA 1DDNA 1BBYA 1GVJA 1I1SA 5E17F 3I58A 1ZRDA 3QU3A 1T2KA 2DO7A 3WTYC 1KGSA 2Z99A 3KZYA 1IN8A 3ULQB 1XCBA 1CGPA 1YW7A 1I6XA 5BPIA 2D45A 4FHTA 5HDKA 4LMYA 1XDUA 4NQWA 3ZP5A 3W6KB 1J7KA 4AVPA 4OOIA 4UVCA 2RKHA 4U0YA 4G9YA 3GWZA 2MH9A 3ZN0A 1KU7A 2PMUA 1R1UA 2HEOA 4EJTA 3RPUA 4WXHA 5K5QA 3O2PE 1S6LA 4GYGA 1FP1D 2GXGA 2ZO4A 2VODA 3L2CA 2RN7A 1BN5A 1R1TA 2JRTA 1BOAA 3I64A 3V8LA 3C7JA 1SFUA 2IVMA 5E8IA 1FT9A 2P4WA 1LEBA 3MFKA 3CLOA 3ABUA 5FFXA 1USSA 3BJOA 1O7LA 5KK1A 1D8JA 2LNBA 1S7AA 4JBAA 1XCVA 4XSZF 4I0AA 3U2RA 3ZN1A 3U1DA 3PFIA 5J8CA 5ICEA 4EM0B 1KYZA 4ENMA 2HQNA 1ZN2A 1IAWA 1W5TA 1OYYA 2CSOA 3ZMDA 4U7DA 1R5GA 2DU9A 4S04A 4HAMA 5LGUA 2MLKA 1QZYA 5DCMB 1FP2A 4G7HF 4ZYGA 4PGHA 3WTTC 3W6JB 2CG4A 4ENKA 2HWVA 3KP7A 1YYVA 5L3BA 2FXAA 4KUMA 1LEAA 3I5UA 2DAOA 3IL2A 3HRSA 4R79A 5CVIA 5JR3A 3ZMSA 4WXDA 1G3YA 5CVVA 4ENNA 1F1ZA 1PDNC 1XN7A 3BZ6A 1TNTA 5H6QA 2BE5F 2XVCA 1YLFA 1YQAA 5CVRA 4ETSA 1REPC 3ISPA 3T5XA 3R0AA 4I02A 2L02A 1U3EM 4WCGA 4RGUA 5K5OA 2BEOA 5A2QZ 3LA2A 3E5XA 1HKQA 3C3WA 4A0YA 2VE9A 1TW3A 5ED4A 1UHMA 2PN6A 1F5TA 4MEYF 1VTNC 2RDPA 4ESFA 4MHGA 2LSOA 1ZGAA 1Z7UA 3LQRA 1RZ4A 1QQIA 5D6FA 4MTDA 5LHHA 3O6BB 1SFXA 2OD5A 1O7FA 2Q8KA 1LDKB 2HR3A 3HIFA 3WU0A 1R22A 2K27A 4LB5A 4OMYA 4Q47A 3BY6A 1Z6RA 4A5MA 4E70A 4CGZA 4EM1A 4RB2C 1U6GA 3VODA 3J7AO 4EMSA 2V1DA 1IUYA 3COAC 2A6EF 3F8FA 4U0VA 1JHHA 1R36A 4UV8A 2V1UA 1YW8A 3Q5FA 3H92A 3FMQA 1FYKA 1BI3A 2VBWA 5D6EA 5HLIA 3K1PA 1XMKA 2VC1A 2L4MA 1FY7A 2UXNA 1ZGJA 2EFPA 2DK5A 4BHBA 4WK8F 2P8TA 5JI6A 2XASA 5CYVA 2ZFWA 2PBIA 2JPBA 1YS7A 4BQAA 2IA0A 2OA4A 4IPAA 3I53A 4Q4ZF 4LB6B 1HSJA 5EEGA 4Q5SF 3ABTA 3WODF 4HV6A 5LHIA 4G94A 3JW4A 3R60A 3PQKA 1LB2A 4EQQA 2ZNYA 1XDSA 3LA7A 3REOA 4YIIA 4I7HA 1YW9A 1J9IA 4GO1A 4AD9A 1U78A 2XAGA 4KIFA 2M5WA 2FBHA 4R1HA 4B8XA 4ASNA 2RNJA 3HUGA 3C18A 1WKMA 1R5HA 3E6DA 2L3DA 1PP7U 4L9VA 3RKXA 3NRVA 2K86A 1YG2A 4HZFA 4KICA 2MD5A 3RJPA 5LHGA 2KRFA 4IJAA 3WTUC 1NHAA 2YU3A 1HQCA 3N4MA 1R23A 2XAQA 2F5DA 1RNLA 1ZHFA 2PI0A 2VT2A 1ZYRF 2OQGA 5KVRA 1W7PD 2BV6A 3GYHX 4AWXB 1J59A 2HS5A 4YG2F 3FWEA 2VC0A 3D5LA 6PAXA 2QBYA 5DCFA 3HYIA 1PP8F 5H6RA 2M8EA 2W24A 1HW2A 3GX4X 2OZ6A 2IP2A 1SD5A 2E7WA 1ZG3A 3M8FA 1GHCA 4PGGA 4P5OA 3QPTA 3ECOA 4ZZLA 4GXOA 1MJAA 1TTYA 3CUQB 1JXSA 3G3ZA 3GVAA 3JAMK 5IT3A 3ELKA 4EV0A 1MD0A 1P2FA 5LRSA 4L9NA 2Z9OA 3J81K 2QM3A 2QQAA 1Z1DA 3KP3A 4HX8A 2K4JA 3FM3A 1HSTA 1K6OA 2AXLA 1J5YA 1KQ9A 3KLNA 2DPUA 2FU4A 1ON2A 2PG4A 3VEPA 3F8CA 2ACJA 3EYYA 3F72A 1CF7B 2ZMEB 2IRFG 5K5RA 4BXUA 3MEXA 1UHWA 4I09A 3IWZA 3CUQA 3FF5A 5D5WB 1MGTA 5E20A 3F21A 4XLPF 1LQ1A 3TGNA 1FBQA 3EUHA 4ZYEA 2KIUA 2ISYA 4A6DA 2NS0A 2VT3A 2Z33A 1WWXA 3DPLC 4CDGA 2QVOA 1R58A 3SZPA 2LF8A 2QLZA 3RKWA 2KIMA 1TW2A 3LQQA 3GW2A 2ZNZA 2VONA 1P4XA 2EFNA 2ZMEA 3T0YA 1OYIA 3F8MA 3FXRA 2YX7A 3ROUA 4DNCA 4MTEA 3CDHA 3T8RA 2HFHA 1LDDA 1XSVA 5L3GA 2OU2A 3HSRA 2IJLA 1G6NA 4Z2YA 3L9FA 3TOAA 4ENJA 2O8XA 4N9HA 3IRRA 5ICGA 3N97A 4ZH4F 5JHUA 1TLHB 2J5OA 4RAZA 2FNPA 4ZYHA 4LGWA 1LNWA 1P6RA 1DP7P 4HQEA 4CHUA 3TDZC 5D5VB 4IRHA 3FMRA 5TRDA 3GUDA 4IRIA 2E1CA 2PQ8A 4BHPA 3TKYA 5E18F 3WTWC 2CGPA 1GXPA 2NRAC 4HF1A 1H9GA 1AOYA 1BC7C 4HV5A 4NHJA 1KQ0A 5AIPA 1TBXA 1U2WA 3GF2A 2EA4A 2L54A 2GXBA 1ZG1A 5LRRA 2XHKA 5FD5A 2FQ3A 2Y0MA 4HLXA 1SFEA 1OMIA 3ZMTA 3KP5A 3FMSA 3WGGA 2G7UA 5JFRA 3I71A 2R7FA 2HKXA 1EH7A 1FLIA 3KCCA 3L00A 2FEZA 2KJBA 3KLOA 2O61A 3K1NA 2EA2A 3JSPA 4OIRF 2CFXA 4OU0A 1V4RA 2YX4A 4S05A 1IXCA 4M72A 2H6CA 2QENA 2MC3A 3M1EA 3WTVC 2M1BA 3K1MA 1BI2A 2NNNA 2DT5A 5K1YA 2C6YA 4UNOA 1Z6TA 1ZG5A 5LEKA 3HSFA 2CWEA 2ISZA 1IRGA 2R7DA 3LFKA 1G3WA 5DYMA 1P4AA 2KKOA 1MJBA 1JE8A 5FLXZ 2ZCWA 4HBLA 4A0XA 3TO7A 2FRHA 4L9JA 3RIRA 3KFWX 3P9CA 5D8KB 1DPUA 2EV6A 1KA8A 1IF1A 4RGRA 3WGHA 3IRQA 3VFZA 2KJCA 4QLCU 1T0FA 5D5XB 1XSDA 3BDDA 3WTSC 4HDVA 5D8LB 2L4AA 5F64A 1IRFA 2EV0A 2PLYA 5HVQC 3SXYA 3GFJA 4M9SA 3VB2A 3ZPLA 4KNYA 3AAFA 2PEXA 4O6JA 2WTEA 2H94A 1TQMA 5HDNA 1D8KA 2VBZA 4A0ZA 5E1ZB 2YSRA 4CO8A 5A2QK 2Y75A 4RGSA 3HTUA 1FC3A 1U5TC 4M74A 1KQ8A 3G73A 4LG0A 1FZPB 4PZJA 2HDCA 2XRNA 4P96A 4HOBA 3NQOA 1Q1HA 3WTZA 4G7OF 4M9ZA 2P5LC 3EETA 3HOTA 3HRMA 2GA1A 1SD6A 1Z91A 4WX9A 5CVJA 3J80K 2W25A 3P9IA 2FMYA 2XAFA 1HKTA 2UWMA 3GXOA 1C0WA 4EJWA 2COMA 4KFCA 3JTHA 4IRGA 2K7LA 5FB2A 2ZXJA 4M6YA 3C1DA 2FA5A 5HS9A 2PMHA 4K2EA 3LAJA 2IT0A 4GGGA 2P7VB 4RB1A 4IVNA 1MZBA 3GFLA 1T38A 3TO9A 3MWMA 5TJJA 1S29A 2RV8A 2F2EA 5IT9K 5E1XA 3E6CC
chains in the Genus database with same CATH superfamily
1J09A 4M6VA 1LPQA 1FKAH 1XGSA 1K61A 4X1EA 2QKMB 4EBEA 2LKXA 1JGSA 3OSNA 2W6NA 3L2UA 3FDYA 1XGMA 3MQ0A 3WHCA 4YELA 1L3LA 3S16J 1T36A 1EH6A 4ED6A 5EZYF 1ODDA 3J7YJ 5KT3A 3GO5A 2VOPA 2KISA 2DOAA 1TQIA 3CTAA 1KU2A 4LF9H 1D0ZA 4JK1X 2XC7A 3RBDA 3QYBA 1MKMA 5EZHA 1UZCA 3B02A 3DPTA 3OSPA 1JHFA 3I54A 1QZZA 3CUQC 2CZGA 4MFEA 3VWBA 4MV8A 3U9SA 3BCAA 2TCTA 1TNSA 2DA6A 1IW7F 2A6HF 2NNYA 4M73A 4BEHA 1XGOA 4F55A 2EK5A 1ZH5A 2JSPA 5JLWA 3JAMW 5KFCA 3DLLF 5ICCA 1GDTA 3GFIA 2P5VA 2FPGB 5CVUA 2GLTA 3GV7B 1FTZA 2KPMA 3C0FB 1Y14B 1IXRC 2D1VA 3J81W 5L3FA 2XRLA 2DPDA 4OAZA 2IBKA 3KYDB 5IP9J 4L5JA 4A5NA 1ETYA 3KP4A 3Q3SA 4L5IA 2Y0SN 4DYCA 5IYDJ 3BABA 3BC8A 4EJVA 5E79C 4QW8A 3PSFA 3VPBA 3ZMUA 2LF7A 4LF6H 3PJRA 2DBBA 3IWFA 5EEHA 2CW7A 3RSNA 3GIDA 3GZ5A 1CQJB 4DUYH 1G8XA 4D5CA 3BJ6A 2VPSA 4PFPA 2AXTC 2ZJ2A 2DLLA 4N4OB 1SCUB 2BBYA 3HL2A 1PK8A 4KIBA 5IP7J 2XD4A 5KT6A 4DL7A 2CS3A 2W9AA 4O3SA 2PMZE 1ZELA 5L9XA 2HOAA 5DD4A 4BE2A 4UY8I 3GTPJ 4UB8C 2W82A 2W8LA 2LC2A 4ZYDA 2K5CA 3MCZA 3Q0VA 1ULYA 1QPMA 2E2HJ 2R7MA 4YBZB 2M45A 2QBYB 4Y17A 4E4HA 1F36A 3ZQHA 1T94A 2WE6A 3G8CA 1G3TA 2COBA 2X6YA 1FX7A 3KEOA 2HVSA 1V51A 1N25A 4MGRA 3RI4A 2YR2A 4AUXA 4YR3A 2LDUA 1QGPA 1PVEA 2ESNA 3DBRB 2E71A 4FT8A 4GCVA 5FFZA 3H9QA 2Q0OA 4IOAF 3QFFA 5M3MJ 3OHBA 3SFZA 2XCPA 2NS7A 3JRXA 5DLFA 3FXKA 5DEQA 3MKWB 4HLYA 1IN6A 2VA2A 1JGGA 3H4BA 4O3PA 3BG6A 4D0PA 3J7ZI 3M7GA 3BG9A 1A36A 1JTXA 1SANA 3FK6A 5DV5A 2BZTA 3PNYA 1SFOA 4RB3C 1B4AA 2P0AA 2HOEA 2A69F 4AVZA 2GXAA 3X2QH 4E7KA 4F7ZA 4CICA 1J5EH 3L4KA 3JCUC 3E7LA 4KMFA 4Q43A 1AN7A 1YS6A 1YX5A 2JSCA 2HTSA 1Y0NA 4BU2A 3PUBA 2EZHA 1O4XA 1ACIA 4O3NA 5LLQA 1FSHA 1IN4A 3A1YA 3TO6A 4EJOA 1E17A 3HPHA 4RM2A 1N75A 2A6TA 2L7KA 1BXRA 4A3DG 3QAHA 5FROA 1QBJA 3G4SI 4Y33A 3BZKA 3KETA 3R61A 4Y15A 5B5EC 2DK8A 3W2AA 3RAQA 1S10A 5KFBA 2ADUA 5HNFA 5JHFA 5ICFA 4YQWA 2PN1A 3DKYA 5F0FA 2A3SA 2E2JJ 2X6XA 2YS9A 1JI8A 2C28A 2HQ5A 1I6HJ 4PJMA 5C3EG 2GPWA 2EINH 2H6BA 3I4NG 3IH4A 5CJ9A 2DFFA 4XSXF 2O6GE 1Z05A 1ZRFA 5BQTA 4QWAA 4C9YA 1FIAA 3RPQA 4J9SA 4DIQA 2HYGD 4HNVA 1LFUP 2CYYA 4IZOA 5LGTA 4M9XA 2M7BA 5JH7F 5CQEA 3W3CA 2YYAA 1E0EA 1FYLA 3CC7I 5LOVF 4DL2A 2RQQA 3MAJA 3ZXSA 2CH0A 2PX9A 5EWFA 1AU7A 3PQJA 5BMZA 3IKVA 5B3SH 2BVLA 3AYHB 1RUNA 5LEJA 1Y1WJ 4N0BA 3FZVA 3RCOA 2HQRA 1Z77A 1TAEA 3WE2A 5HDGA 2E1MC 2CQKA 4HYEA 3AG1H 2KLOA 4KMUX 4ECXA 1Y0UA 5F9NA 1BC8C 1P4WA 2BHYA 3F23A 3BJYA 4JI3H 1IXSB 3DBLB 4EYIB 2QGUA 3R0JA 3RB6A 2HXOA 2V79A 3GTOJ 4KHPH 1KJ8A 3PSIA 3IUOA 2JZYA 2LOOA 5LD2C 1P9QC 2NXNB 4DYQA 2B7EA 2I5UA 3ERED 4BH9A 3VDXA 1XMQH 2W6ZA 2R7ZG 1XS9A 5T14A 3HRUA 4BXFA 3KHHA 2OTJI 2R8JA 1AWCA 5HS7A 3CJNA 5DUIA 2LK2A 4XKBA 3ZRGA 4AC0A 2AGPA 1QO0D 2WV1A 2XAJA 3OR1C 4S0HB 2XCAA 3DQVC 3P9KA 1PUEE 3OSGA 1QNTA 2VQEH 4YHHH 1IBLH 1I94H 4GYIA 2R7RA 3UQ8A 4WWCA 2XGCA 5DQHA 4JQFA 5DM6F 2YU9A 2IGKA 2UUZA 2DTZA 3QP5A 5BS6A 4UUVA 3HOYG 4IQ4A 4O4IF 1OR7A 3BPXA 1ZRCA 2XF7A 2LLKA 2L01A 1D5YA 3S8PA 4RAFA 4I6ZA 2FJ1A 4I98B 4KYWA 2DN0A 1UAAA 3EUKL 3LNQA 5L3CA 1O3QA 2DYSH 3I12A 5IPAA 3JSNA 2WB1A 3S3MA 3K2AA 2LY1A 4RLQA 3RYPA 5LGNA 4F50A 4X6AJ 2I87A 1T95A 4YFXF 1BNCA 1X1BA 2ZXIA 5TISC 2R7QA 3PO3J 2K9MA 4WF2A 5E3OA 2VQGA 4ED3A 3OHAA 3H3VH 3JRIA 1MMAA 1I50J 5JVLA 4MV3A 2W7NA 3ZOBA 4DV0H 1YIJI 1W0TA 4FS1A 2K9QA 1KU9A 4A3DJ 3RV3A 1TA8A 4NDLA 5M5WJ 1FNNA 5FO5A 3R6SA 2EV5A 3A01B 4PJ0C 4J0MA 2DWCA 1APLC 1FIPA 3CMYA 2EH3A 3HSEA 2JT1A 4EBDA 2FBKA 3QP6A 3FISA 5HOOA 2K3PA 2GZWA 1TT0A 3DWLE 4J9MA 1B8IB 4ZTJA 3TL4X 2F5CA 5DD8A 5FGMA 2JVGA 2M87A 3VOEA 2MABA 2HDWA 1IN5A 4I2OA 2CQ7A 4CZZA 4DBRA 2DFIA 1T0FC 3L2RA 3QPLA 1OCCH 4Z6YA 1HXDA 3S3OA 3E3VA 1DUXC 2KRHA 1VQ4I 2FOKA 2IA1A 2K9LA 1LDJA 2NAZA 4LSXA 4Y8VB 5ILSA 1W4MA 4LLGF 2Y48A 3NEUA 3VPRA 3LA3A 3U1KA 4XLEA 4A6EA 4MQVA 4XORA 4XR6A 4CYDA 3KEQA 1WI9A 1E3PA 5DQGA 2QSFX 2Q1ZB 2EZIA 5GONF 2EFWA 4EEYA 1RYSA 2WA0A 3FXQA 2OF7A 3HRTA 4BACA 1KJJA 2Y31A 1IBKH 3MZYA 5ILUA 2RC4A 2XGXA 3DXJF 1WZ2A 3BAAA 4WXCA 4E7SA 3U9TA 3GTLA 1W0UA 4V19K 2WAQE 3CDIA 1VQ8I 2ZC2A 2PVPA 1X58A 5FLXW 1VI0A 2GIVA 1D5VA 3GTQA 2DA3A 1V9PA 1YFHA 1EH8A 4DV4H 1A0IA 4M3BA 2V6CA 4ZJZA 4RU9A 5F04A 2R7ZJ 4JYKA 1B8IA 1POGA 4G6QA 1GV5A 2X1DA 5BPDA 3M9OB 4EGYA 4HW0A 5KG4A 1SD4A 1Z9CA 5KFMA 3KHRA 4AIHA 2X48A 1R7JA 1RKTA 5TGTA 3S2DJ 3Q8SB 3DF8A 2GAUA 5F6FA 4TV8F 3CJTB 4I01A 2NYXA 1FTTA 1U9OA 2X9DA 1O3SA 2FD5A 4G7ZF 1GXQA 3M8EA 5KFSA 2MA3A 1XX5A 3BROA 3JRWA 3T5HA 1F4KA 3SDBA 1BL0A 2H27A 3M9AA 2GIZA 3JREA 4ECVA 3I59B 4XX0B 3E6MA 5J1YA 5J2TF 4GC6A 5EWEA 2W71A 4Q44A 1USTA 3PL8A 3HHGA 3WG9A 5D5UB 4C2UA 3S1MJ 2BQRA 1ONVA 3G6EI 3P7NA 2QUFA 2GA2A 2XB5A 2NU6B 4HF2A 4GKKH 1TWCJ 2E5ZA 1WJAA 2IP4A 4II2A 4HRIA 1LVKA 4FM9A 4X62H 2WADA 1S9FA 4B44A 4GKJH 5EG0B 3LSMA 1DPRA 4Y13A 5HLGA 1A04A 2A07F 3S14J 2R3SA 3VYRB 5LP6F 2VXZA 2UUAH 3I0TA 2RGRA 3DV8A 1VAJA 3PR4A 3ML6A 1TWFA 3N43B 4HR7A 1KEEA 1MMGA 5A2QW 4ECSA 1BR2A 1FPQA 1FSEA 4ECQA 1B9NA 3H20A 2DQRA 3TINA 2DMPA 2EWNA 2X0LA 1T33A 2OZUA 2P6TA 4YFKF 5IWAH 4C5BA 2QQBA 4MA5A 1S8NA 3HM5A 2R82A 4XLFA 2Q2TA 2VOOA 1KJQA 1MBGA 5IOZA 2FX0A 3F9KA 5C5JA 1MNMC 5J6XA 3B73A 1T98A 2W57A 3V7CA 3V4GA 1S3JA 3RQIA 1RR8C 2VN2A 2VB6A 3CO6C 2WTFA 4UV9A 2FSWA 4M7EA 2E7XA 2VBYA 1T6SA 3K70D 3PFYA 3BTIA 4AIJA 1RETA 3I59A 1YI2I 1I27A 1S0OA 2VL8A 2QYOA 1HNXH 2IPQX 4RMNA 1WJCA 4BY7G 5HS8A 1Z2PX 2TDXA 1NK3P 1BIAA 2M4KA 1BW6A 4BQNA 1B9MA 3RKYA 4FX4A 2I8CA 1MMNA 4IXAA 3TQNA 1ETQA 1K79A 2MCTA 4M9UA 3V6KA 3PM1A 1IO2A 2A5YB 4I4TF 5EG0A 3K69A 5J3LA 5JVTA 4L18B 2VPRA 2ZJPF 2WAQN 4A3CG 3DEUA 2VBXA 3AG4H 5KT5A 2AGOA 2GOMA 1B59A 2E34A 4NXNH 2DQLA 3FXUA 4KA4A 4XLNF 2XPWA 4YP3A 4KN4X 2V58A 1I5ZA 4FTHA 5BOXA 3PN1A 2Y69H 1R6RA 4KN7X 2IGOA 2W48A 1GO3E 2J9GA 3EQLF 4MEXF 3KEYA 3Q9VA 4ED8A 1UG0A 1IZ1A 1J0RA 4QTRA 1S72I 4HX7A 2V9KA 3JRAA 1KYWA 1MH4A 4IHSA 3FMAA 5E3MA 5DG7A 5FLXK 4XZ3B 1SEIA 3W2VA 1UJ8A 3HTSB 2FMLA 1X3ZB 2V26A 4YFNF 4ED1A 2ELHA 4B3AA 4YY3H 5L3EA 3N44B 1ZQ3P 1HW5A 3QWLA 2CV2A 1UMQA 1FOKA 3ZMZA 1TQPA 2VIXA 1XGNA 3NARA 3RFCA 3FBIB 1W7PB 2HTJA 4OINF 1ZR4A 3SEQA 4RAYA 5J4VA 4U7BA 3C2GA 2KL4A 2AQFA 3FHZA 3ZQIA 1M0TA 1ZARA 3K6GA 2YCHA 4LG0B 3J7AK 2M05A 1V5EA 2HKOA 1P7IA 2ESHA 3NAUA 4HQMA 4OMZA 4DOZA 4RGXA 4UHTA 2ZKZA 1WJDA 4ZOLF 4X65H 1ZLJA 3SQNA 4UVAA 5L1LA 5GPAA 3N40P 4H0EA 3CCVI 2UXXA 2I10A 1VQNI 4LFCH 4DQ2A 5BR8H 2E1NA 1IG7A 4HF0A 3JZIA 1V3FA 2AO9A 1VQ6I 5KFZA 2F5EA 2V9VA 3PIOF 1MBJA 3KE2A 2QSGX 1TT5B 5FLMJ 1MBEA 2K02A 3RJ0A 1SAUA 3RZDJ 2F4VH 4IHTA 3MKLA 4LFUA 3F6OA 2VKDA 3TBIA 3F22A 2FMAA 1X2NA 3HOSA 2V7FA 2L5QA 4MIMA 5KFFA 2Z3YA 1W5CC 1Z3XA 3V6JA 1NK2P 4LIUA 3BTJA 4XRFA 3JRFA 2A68F 3KYLA 2W6MA 3TW7A 4QJFA 1VQ9I 4BNCA 3K7AJ 3KP6A 4I55F 2CO5A 1LFPA 2DA1A 4FE7A 1WRJA 4TQSA 2R7KA 5DCMA 2P5KA 5F1RA 4JI1H 1XD7A 2VQHA 1W7PA 2Y9YA 4M6XA 4M3EA 4BJ5C 2WWYA 3F8BA 1RJQA 1B04A 3K5IA 4JUZA 3GTMA 4A3EG 3SZTA 1RIOH 3H36A 1L0OC 4UXNA 1AKHB 2GWRA 1KU3A 4IRKA 2FK1A 1GVDA 3J7AY 1BI0A 3F3XA 1MJ9A 1RI7A 4LFAH 4G6DA 4C30A 4G8XA 2QZ8A 2X6OA 4AIKA 2R7TA 1FBSA 4OIOF 5L1KA 4J9QA 3GLXA 4UVBA 3OIQA 5HODA 3T1YH 2XPVA 1WJBA 3RDIA 1EUCB 3ESWB 3TIGA 2LP0A 2VE8A 3GIMA 2J6SA 3BPVA 5KFNA 1E2XA 1K6YA 5DQIA 2OBPA 4A3CJ 4BYYA 1E4FT 4K0KH 2B0LA 1D1CA 2O3FA 2QWWA 2XF6A 3QYFA 4QIWE 4EEQA 1X1AA 4R8HA 1ZAOA 4BAYA 4DR6H 2HGCA 4BBSG 2OAZA 4Q48A 2FLPA 4ESJA 1B6AA 4ON0A 3I4PA 2IW5A 4XMYA 2FB9A 4RM3A 4XK4A 3OOUA 4JP0A 3TQ1A 2V1XA 5KCMA 4BKXA 3I4MG 5C1OA 4HA8A 3O3KA 2IEKA 2K40A 4U88A 3TOBA 3ECHA 3WTXC 3TEDA 4JV0A 3ERMA 2OQRA 3J80Z 4Y7NJ 3SEZA 4KJZA 2FKLA 4HQ6A 2H8WA 1LUJB 2F5FA 2R4GA 5C4JJ 1X3UA 3TIIA 4CZCA 5BPHA 3OYKA 2QQ9A 1SFOJ 2YPRA 1FMVA 4A3FG 2XGEA 1AKHA 3RPUD 2BY1A 1EV7A 3RTRA 3T5LA 3OSFA 2HOSA 1ORKA 4HDUA 3K70C 3MZHA 1IUFA 4QWCA 3HG9A 1S7OA 1YHQI 4LD5A 4OIPF 5FJ8G 2JA7G 2YRXA 1BR1A 4MV9A 5K7HA 2BQUA 2NVUB 5F27A 3QPHA 4P55A 3A2KA 3BOQA 3OYCA 2JN6A 3FM5A 1LE8B 2EBIA 2LH9A 3PW4A 3GIKA 3G1LA 3A0HC 1JIHA 2Y30A 5EDWA 4DLKA 4L0ZB 2R7OA 4KT5C 2BGCA 2B63A 4M71A 1VF9A 4BS9A 2KQRA 3IV5A 2WC2A 1H8AC 5KT4A 1KJ9A 1Y1VA 1CS0A 4RUAA 3GZ6A 3CJQB 4BWSC 4LJZF 1OPCA 2BYVE 3R5HA 3OY9A 2R0QC 3MKZA 3FIWA 4BHCA 3BR3A 1HBXG 5M3FJ 2I80A 5ERIA 1YIOA 4B09A 3CUOA 2ELJA 3U21A 3HGGA 5KFHA 1NG6A 3R4KA 1BW5A 1RC9A 4OAYA 3GTJJ 2DW4A 2FLLA 1OKRA 5E8GA 4A12A 1SMYF 1EJ9A 3BTLA 2JK3A 3LFUA 5KG0A 3ZR8X 5D4SA 5FPOA 1QVTA 4A93J 4A3MJ 3HHHA 3OYGA 4IRCA 1DQUA 2X85A 2PMZA 1WQ2A 5KFKA 2EB7A 4LK0F 4XBFA 5IT9Z 1K1SA 1X2MA 1K83A 1P92A 5IY5H 2M34A 3OOPA 5KFQA 1XB4A 3FX3A 3WHBA 2FPPB 4JI5H 2O5RA 2X4HA 4JV2A 2LKSA 1F9NA 4YB8B 4HYKA 1SVLA 1A6QA 3HDDA 1K1QA 3WU1B 3BP8A 4PUSA 3V7RA 4JI4H 4A3JJ 4A2AA 3TP3A 2K4BA 1E4GT 5FD6A 1LE8A 1I7LA 4B47A 4PCQA 1U8RA 5D8DA 4B3MH 3PW7A 3VPCA 3C2BA 3R5XA 5LBQA 1WI3A 1IV6A 3EUHC 5DDGA 2LKPA 2JJ7A 3TDUC 5CAEB 3HKZN 1N36H 2VA3A 2XUBA 2W85A 3IC7A 3LSGA 5I47A 4OIQF 1WH5A 2A5WA 3L2WA 2KIFA 5AONA 1B72A 3WGIA 3C2HA 2DDBA 3UNGC 4P9UA 2MYSA 4CCMA 4YAJB 1ON1A 2IA6A 4EM2A 4QIWN 2R5ZA 2Y2ZA 3E5UA 2EFQA 2FK3A 1VQOI 3K4BA 4CCOA 4EYHB 2P81A 5J40A 3A03A 2ZBKA 4FETA 2YL2A 1SC7A 5KG3A 3UFXB 1UFMA 2ZDQA 2W7OA 3L09A 1R00A 2OJED 5DGAA 2P7CB 2ZJTA 4J9PA 4HG2A 1A9XA 3RYRA 5H80A 1ZHSA 5GTIC 2VJ4A 3BG5A 4N9IA 3E97A 5IYDG 4EGZA 1YO5C 1K78B 3EPIA 1K7AA 2K85A 2P0WA 2WAFA 1U5TB 1H9TA 3WNZA 3E5QA 3BQ2A 1G3SA 5ILVA 1DV2A 4LH7A 2OCEA 3ASNH 2V4QA 2ZMEC 3OYDA 1B1BA 3CO7C 3KALA 3KAJA 1BJZA 2JUCA 2MSYA 5H20A 1BM9A 2HPIA 1UB9A 4CXFA 4LSAA 2RAEA 1LVAA 5KHDA 4ECUA 4RDUA 4NNJA 3K9TA 1S0MA 3G1OA 3QOPA 2XIGA 2F4IA 4F4XA 3L7WA 3S2WA 2W4SA 3ZMVA 4EATA 4EVIA 3CJRB 3QODA 3QQAA 1V4YA 2CQNA 5FJ8J 4MNUA 5DGBA 3Q0WA 2W84A 4DL6A 2BR0A 2VQLA 5FLVA 1Z7LA 4L0YB 2VKVA 2G0EA 2QQ8A 1SMTA 3ZQLA 1Z2OX 3SHFA 2LVSA 1WPKA 1UCRA 5F0CA 3OYHA 1I1GA 5DUKA 3DP7A 4J19A 1T56A 4HX4A 1OCRH 1CQIB 1JUPA 3V8JA 2XROA 2J5PA 3MR2A 2PJPA 2EJRA 2V1NA 4FISA 1J2XA 4NB5A 3GFMA 3IKTA 2R92A 4CSWA 4MO7A 5BPFA 2Z5UA 4XRSG 2R87A 3PO2G 3Q9SA 2DLNA 1SFKA 2KSWA 2BVMA 3IAS2 2LREA 1K78A 4HPQA 4CC5A 2CJJA 4IO9F 1U5TA 1VKZA 4DR5H 1BR4A 2BY2A 1OYWA 2X1CA 1E4EB 4JI7H 4QPQA 5KAFC 2QSHX 5GAGJ 2JTVA 5JVGF 3KTMA 2ECBA 1HCRA 2KP6A 3LSTA 2ICWG 4O5VA 4R7RA 5KFRA 3GIIA 3KAKA 4XKVA 5J1RA 2CQQA 1O3TA 4J9NA 3K10A 3QU6A 2VPLA 1WSCA 4IR1A 2DA4A 4G12A 4R8UB 5KFOA 2CUZA 2RGVA 1RK5A 2ECCA 4LK1F 1B6SA 4EG0A 4C2MA 3DEEA 2PBZA 2YZGA 4XLAA 3IP4B 1MDMB 3CD6I 2DXIA 2EFOA 3MKYB 4XKWA 3ABKH 1FYMA 4QWBA 4JX6A 3BT9A 1RUOA 2XGQA 1GSHA 3MR5A 1IN7A 2FUG2 1ETOA 2M30A 2O03A 2Q2EA 4CUGA 2XV4S 4IKFA 2LG4A 4D7MA 2XPUA 2CW0F 2JVHA 4PFOA 4FX0A 4RUCA 1VNDA 2NS8A 3H3UA 4C3JJ 3GTLJ 5AIQA 1WSUA 4Y3OA 4PJJA 2G9WA 3GEZA 1J75A 2D2WA 5KFVA 3GTQJ 5M5XJ 4ED2A 5GP9A 5CLSA 1EA3A 2D1HA 1ZREA 3ETHA 3RV4A 2FBIA 4RS8A 4QPOA 3N41B 2KZGA 3LMLA 3WO0A 2WYOA 2O0YA 3IN5A 2ZJRF 1E4EA 4XOPA 3OV8A 2XKPA 3WE3A 3F8NA 3ONQA 2MC4A 4P9FA 4O4HF 2V4RA 1HKSA 3JTGA 1BJAA 2ID3A 2LD5A 1X1PA 4A69C 1SVOA 4MV4A 4HSTA 4F91B 5FKOA 3EDPA 3L2VA 4ZTFA 4O3MA 1P8LA 2XAHA 1D3YA 5C44G 3BWGA 3K0LA 3JAMZ 2DFHA 3D0SA 5F1JA 5GTHC 4DR1H 3K2ZA 3DKWA 2UZKA 4R8UA 3QRFF 5JVDF 2VJJA 1D1BA 1TWGA 3HB9A 1S68A 3FDSA 3EYIA 4XQFA 3J81Z 4XICA 5KFDA 3OS0A 1MDMA 1W93A 4ESBA 5IYCG 3BJAA 2HYFA 3V4SA 2MLGA 1O57A 3GIQA 4EJUA 3IHUA 2LY2A 1RK6A 2SCUB 2A61A 2NU9B 5KFIA 3B6AA 1Y8RB 3BTCA 3S1NJ 1FBUA 3K4MA 1GSOA 2JPCA 4I0BA 3N05A 4FE4A 2DI3A 5KFLA 2Z2SB 3QZ7A 2W6OA 2DMUA 2JEFA 1H0MA 2H1LA 2P6SA 4MQ9F 2HVQA 1T39A 1N32H 3DU5A 5KG2A 1XMAA 1SAXA 1WCMG 1WVRA 2PFBA 2HZTA 4APMA 4JX5A 1LJ9A 5HNHA 4A3KG 2V6EA 3JSLA 4EGJA 4JV1A 1TWFJ 2XSDC 2AQ4A 2WV0A 2J6TA 4KDPA 5D1PA 2PJRB 2H09A 4U0WA 5GAHJ 4Q0YA 3U9GA 3KP2A 2YZMA 3KXYT 4U7CA 1HLVA 3DFGA 4ABZA 2DMTA 3T8TA 3LAPA 3ZQ7A 2ME0A 2JA7A 1ZLKA 3PO2J 1ULZA 4QWQA 2GQQA 2M9HA 2HYJA 3OYEA 3JRDA 3AG3H 5B1AH 2DA7A 3AL0B 3GMEA 1K4TA 4JI0H 3GTGA 4BY1G 1X9NA 2FE3A 5E1WA 2G7HA 1V55H 2IA2A 3KHGA 1FMWA 3OWTA 4TV7A 2ID6A 5BNGA 3WO1A 4ZI7F 3DTEA 4LLNA 3FKIA 3CDLA 4Y52J 5CQGA 1Y8QB 3CVZA 3LWFA 1I3QA 3GTKA 3FXJA 2IS6A 5J8FA 2ETHA 4LLLA 2W9BB 2JUGA 4G6TB 1VQPI 1G4DA 5LMUH 3L2QA 1UG2A 1W5SA 3ZGKA 1EF4A 2VUMA 4KIGA 4TUYF 3ZCOA 1BIBA 4ITVA 5L3DA 5C3EJ 2X1EA 3M4IA 2BQ3A 3I4NJ 1O3RA 3V7SA 3T1BA 2DFEA 4LITA 3F6VA 3KZZA 5FKNA 5D4RA 4JX4A 1STZA 1HW1A 2FF4A 1Y39A 2STTA 2AS5F 2MH2A 4B3SH 4IF4A 1XPXA 2PJRA 1VQLI 5L1IA 1RJRA 4RB0A 4A2UA 2CQXA 2DTRA 1CF7A 2VUGA 2XKOA 4PDKA 3KZIC 4JOMA 2STWA 1JT0A 2DA5A 3PVXA 1R1VA 4YEJA 4ZZDA 4F4ZA 3E6BA 3MN2A 2V59A 2NVYA 3KHLA 3HOZG 4YIFA 1XSXA 3TP0A 4L9TA 4QW9A 1BI1A 4BDYA 1KJIA 4FASD 3H5NA 1QVUA 3HBLA 3H3ZA 3JSOA 2HGSA 3NGDA 2FNAA 3V8KA 4RBOA 1LFBA 3VSKA 4MFDA 5HLHA 2RQPA 1FWZA 5EGOA 3SE7A 2RVCA 2V9WA 1YTYA 1SD7A 2MBFA 3I3LA 1BJTA 4DGWB 1DDNA 1BBYA 1GVJA 1PYVA 2L9RA 5C44J 5E17F 1I1SA 2W9BA 1QA6A 2VASA 3I58A 1ZRDA 1TWHA 2L2OA 5FKKA 4I99C 4BJ6C 5EEAA 3QU3A 1MIJA 5DS9A 1T2KA 2DO7A 5IYCJ 1HDDC 3HOVG 1QU3A 3WTYC 1KGSA 2E35A 1DIKA 2Z99A 3R23A 2B63G 4J00A 3KZYA 1IN8A 2C35B 1Y1VG 4QSHA 2NVQJ 4MLOA 3ULQB 1XCBA 4BQOA 2DCEA 1CGPA 1YW7A 2R6FA 1WFXA 1I6XA 3SI8A 3UKGA 2UVUA 5BPIA 1YITI 3RGZA 2D45A 4QWEA 2OPTA 4FHTA 5HDKA 4LMYA 4ECWA 1XDUA 3HOYJ 4NQWA 3PNVA 3ZP5A 2KDOA 3W6KB 3OL4A 5KNLA 1IOVA 1Y1WA 2LTPA 1KC7A 4A3KJ 1J7KA 1W36C 4LIVA 4AVPA 3LSIA 4OOIA 1ZTRA 2RKHA 4UVCA 4U0YA 4G9YA 3GWZA 2MH9A 4Q8EA 3ZN0A 1KU7A 2PMUA 3VSLA 4O3QA 1R1UA 2HEOA 4UFZA 3GTOA 3M8JA 1JJ8C 4EJTA 3RPUA 4XLHA 5J4YA 4WXHA 5K5QA 2ZB9A 1GYFA 2DMQA 1VBHA 3O2PE 1ZK8A 1XG1A 1S6LA 4ZYAA 2C2EA 2VPQA 4ZDOA 4RLFA 5CA1F 3GTMJ 4GYGA 2H1KA 2C00A 4AM3A 1IOWA 1FP1D 2GXGA 4TQRA 2ZO4A 2CV1A 5E3LA 2VODA 1X1DA 4XRSA 3L2CA 2VQFH 2BY0A 1G59A 2RN7A 1BN5A 1R1TA 5KT7A 2JRTA 1BOAA 3I64A 3V8LA 4UCUA 4Y4RA 1Z2NX 1U9NA 4AU7A 2IS4A 3C7JA 1SFUA 2IVMA 4ECTA 4A3IG 1OLTA 2VKHA 3VPDA 3GZNB 1FOXA 3H5AA 1TC3C 4QWDA 3LSKA 5E8IA 1FT9A 3S3NA 3N6XA 1QRYA 3L2PA 2P4WA 2E1OA 3D5SC 1LEBA 1X4PA 3MFKA 4IHVA 3CLOA 2R85A 3ABUA 5FFXA 4UUSB 5KG6A 1USSA 3BJOA 1YX3A 3F0CA 2BXYA 1O7LA 2JMWA 4PWQA 1YE9A 5KK1A 1D8JA 3HOZJ 1N48A 2LNBA 4I76A 1TWAA 4FBTA 1S7AA 2EIKH 4JBAA 5J47A 1XCVA 2E19A 4XSZF 3RBEA 2KT0A 4RNMA 2H8RA 4C3IJ 3ZQCA 5LMNH 2JA6G 1RJPA 2WB1N 2K9SA 3BQZA 4I0AA 4IHJF 3U2RA 3ZN1A 1RKWA 1HR0H 3U1DA 3PFIA 3R5FA 1ZQ7A 4EEFG 5J8CA 5M5YJ 5ICEA 1E3HA 2Z1DA 1M1EB 4AYBA 4EM0B 1KYZA 2MGQA 4ENMA 2HQNA 3K3PA 3HOUG 1ZN2A 1IAWA 1W5TA 1OYYA 2CSOA 3OIOA 3ZMDA 4U7DA 4YAKB 3VYTB 1R5GA 4GC7A 1N33H 3HOVJ 1TP4A 2MFZA 3VMMA 1OCOH 2DU9A 2X6WA 4S04A 2LR8A 4HAMA 2B63J 4IR9A 5LGUA 2MLKA 3H5RA 2R7LA 3GILA 1HNWH 3A0BC 3W6VA 2YUSA 4LF5H 1QZYA 1Y1VJ 4PK4A 3VYSB 3CMMA 2R92G 2LYCA 2VOBA 5DCMB 4IZZA 4NBQA 2CRGA 4C5CA 3BLYA 4UUSA 2E2IJ 1FP2A 4G7HF 4ZYGA 5KG7A 4PGHA 2L9VA 3G71I 3WTTC 2FPIB 2NVXA 4IEJA 3W6JB 2CG4A 4ENKA 1XNQH 2HWVA 1RPWA 3KP7A 1D0XA 1NH3A 2ALZA 1YYVA 5CPRB 1D0YA 3NWSA 2B9SA 2XC9A 1R9TA 5L3BA 3Q0UA 2FXAA 4KUMA 1K83J 3BQYA 2JWTA 4KT6A 3CCJI 1LEAA 2HI3A 3CCQI 3I5UA 2DAOA 3IAM2 3IL2A 1WCMA 4ED7A 2QYZA 3HRSA 1EYZA 2KZVA 2OCCH 4R79A 5CVIA 5JR3A 1YJWI 2Y0SA 3I9V2 4X66H 1ZR2A 3ZMSA 1OCZH 1G3YA 4WXDA 5CKTA 5CVVA 4ENNA 2GPSA 2WAEA 3CP8A 1F1ZA 5GPCA 2ME6A 4BDZA 1Z0XA 4CCKA 1PDNC 4I50F 1XN7A 3BZ6A 5F9LA 5FKMA 1TNTA 5H6QA 3CCEI 2BE5F 2R7VA 2XVCA 4Q8FA 1YLFA 3DF7A 1YQAA 4LOCA 3HJEA 5CVRA 2CV0A 4ETSA 4W97A 1REPC 3ISPA 4A3IJ 2HJWA 3GCMA 3T5XA 9ANTA 1UELB 3R0AA 4IOCF 4I02A 2L02A 4B3TH 2R8GA 1U3EM 4WCGA 4RGUA 4BY7J 4DV6H 3MR6A 5K5OA 2BEOA 5A2QZ 2XF5A 3LA2A 3O8GA 3E5XA 3C3WA 1HKQA 3E1SA 2OV7A 4CCNA 3HKZE 5GADJ 5FRNA 2L7ZA 4A0YA 2VE9A 1JJ6C 1D1AA 4RZRA 1TW3A 3KIOA 3TMOA 5ED4A 2YS7A 1VQKI 1UHMA 2PN6A 1V5FA 1DP3A 2UVWA 4EFBA 3OYAA 1W1WE 4F93B 1WJFA 3RZOJ 5LYJF 1TL8A 1M7JA 1F5TA 4MEYF 5KKNB 3BR5A 1VTNC 2OH2A 2RDPA 4AQYH 4ESFA 4E7IA 1YRNB 2FOWA 3EUAA 4A3LG 3CF2A 4MHGA 5KX5F 2DPJA 1VQ5I 2OUMA 3JRBA 2LSOA 1ZGAA 1Z7UA 2BW3B 3CQZA 3LQRA 1FEXA 2ZDHA 1RZ4A 1WH7A 1QQIA 4XNFA 5D6FA 2XDVA 2HU9A 4MTDA 4W1UA 1ETWA 4DJAA 5LHHA 1ZKGA 3O6BB 1SFXA 2OD5A 3K4LA 3SDGA 3BA9A 3Q8PB 1O7FA 2Q8KA 4F92B 4O4LF 2JEGA 1LDKB 1OFCX 2CUJA 4HSRA 2HR3A 2M2EA 3HIFA 1SYXB 2KHMA 5LL6b 2DOEA 1VZ0A 1R22A 2K27A 3WU0A 4LB5A 2W6PA 4IAJA 2R92J 4OMYA 5IP7G 4Q47A 3L4JA 1JX4A 1R4NB 5HLTA 1XMXA 3BY6A 4EGQA 3WG7H 1S0NA 3HGYA 3K4JA 4ECYA 1Z6RA 2YZNA 1N78A 5JUMA 1KBLA 4A5MA 4E70A 2VJIA 1L2ZA 1VS0A 1MBFA 4ZQIA 4RA2A 1MNEA 4E7LA 2BOLA 4CGZA 3M3YJ 4EM1A 3FKIG 2VJ5A 4RB2C 5EOYA 3FK7A 4B43A 2DT6A 1B72B 3H0GA 1U6GA 3VODA 3J7AO 3W2WA 4EMSA 1BGWA 2V1DA 4TV9F 5KFUA 1HDPA 3GQCA 4LF8H 1DGWY 2R5ZB 2CUFA 3COAC 1BOBA 1IUYA 2A6EF 1AUVA 1S03G 2VUMG 3F8FA 4U0VA 5KFGA 1JHHA 1YRNA 5KFWA 1R36A 4DL3A 2UVRA 4UV8A 2V1UA 1X3WB 2IXSA 1DGSA 1YW8A 1IDYA 3ORRA 3Q5FA 2BW3A 3H92A 1S9HA 4UB6C 2LBFB 4F4WA 3FMQA 4M3FA 2GLOA 2K9NA 4PJNA 1FYKA 2YS6A 1BI3A 2VBWA 3KYCB 2XSJC 2KMUA 5D6EA 5HLIA 2O9LA 2FJZA 5KT2A 4X0GA 2JA2A 3RB4A 3LL7A 3K1PA 1IRZA 2JA5A 2DJIA 1XMKA 2VC1A 3CC4I 1RESA 2L7FP 4UCVA 4ECRA 1WJEA 2KFDA 3CZ6A 2L4MA 1MMSA 2R8KA 3RKQA 3OYLA 1FY7A 1OR7C 2UXNA 2WY8Q 4RZQA 2DA2A 3LWBA 4DUZH 4A3EJ 1HOMA 4U87A 2W9CB 1BA5A 4PSXA 1AUXA 1ZGJA 2EFPA 3CCYA 3IG0A 2DK5A 5F08A 5KFAA 4LG3A 4BHBA 3HUGB 4WK8F 2P8TA 3LSHA 2TRTA 4NC8A 5IP6A 4FS2A 1FVIA 1X19A 5JI6A 4XLCA 2XASA 4J9LA 3DKXA 5CYVA 2ZFWA 4ED0A 2R7SA 2EILH 2JPBA 2CMPA 1YS7A 3BR1A 4F3QA 2IA0A 1OCTC 2OA4A 4IPAA 4BQAA 3RF2A 2R8IA 1XNRH 1TWGJ 4A3BG 2HNHA 3I53A 4Q4ZF 4LB6B 4B3RH 3SZGA 3TQTA 1HSJA 1SVMA 2LY9A 4XL9A 3ABTA 5EEGA 4Q5SF 5DLGA 3WODF 4HV6A 1UC9A 5JQWA 3S1QJ 4CCLA 2LBFA 4BBSJ 5LHIA 2HHHH 2VKEA 4YR2A 4G94A 3JW4A 3R60A 3PQKA 2KDZA 1LB2A 5C1PA 4EQQA 2AQEA 1MBHA 2ZNYA 2VQDA 1XDSA 3LA7A 4A3LJ 3REOA 1IDZA 4YIIA 4I7HA 2DMNA 2YU9J 5HV6A 2R93A 2NVTJ 2FK2A 3I4MJ 1YW9A 1J9IA 1Y1WG 1AHDP 4MA0A 2IBDA 4GO1A 4AD9A 1U78A 2OLSA 1U8BA 4O3OA 1GSAA 1AA7A 2XAGA 3PW0A 2ZSIB 2M5WA 4KIFA 5KFTA 1JXLA 3PZPA 3LSPA 2FBHA 2DOFA 2JA6A 4R1HA 4F52A 4B8XA 3AKZA 4GRIA 4ASNA 4A3FJ 2JRMA 4GLXA 2W9CA 4P1WA 2RREA 4O2BF 2ASDA 3BQ1A 2RNJA 3IH3A 4BQQA 4YRVA 4ECZA 1H89C 2X51A 3HUGA 2JA7J 3C18A 1WKMA 4CC6A 1R5HA 1UHSA 4NC7A 2F48A 4N4NB 2RF4A 1JUMA 3E6DA 2Q2EB 1IGNA 3GTGJ 2L3DA 1DV1A 4CYCB 1PP7U 1CE8A 1QHGA 4L9VA 5FRMA 1T08B 2EQRA 3AL0C 4IX7A 3RKXA 2HDDA 3JRCA 3FKIJ 4XKCA 4PJLA 2M7AA 1I6UA 5HBRB 3OS2A 3NRVA 1I3QJ 3GTKJ 2QCOA 2K86A 5KG1A 2M4GA 4FCYA 1JUSA 1YG2A 4HZFA 4KICA 2I8DA 2F5VA 2MD5A 2NOJB 2VUMJ 2Z16A 3RJPA 5LHGA 4X64H 3D5RC 2KRFA 4IJAA 2DJNA 1JKQC 3WTUC 1R71A 1NHAA 2YU3A 5LA6F 1HQCA 3N4MA 1JKOC 4DR4H 1R23A 1VQMI 1R5ID 3H9GA 2XAQA 4U6PA 2F5DA 5KFPA 3GV8B 1RNLA 5JLXA 1WR2A 3PR5B 1LKXA 1ZHFA 1JKRC 3P5JA 2PI0A 2VT2A 3ASOH 1A5JA 5K2MA 1ZYRF 5BMVF 5FPRA 2L0KA 2OQGA 3MD2A 4NC6A 3G1MA 2DPIA 1JKJB 2R7UA 4J9OA 1GT0C 4J01A 1CQTA 1ERDA 5KVRA 3PO3G 1W7PD 4XIDA 1HF0A 5B66C 2BV6A 3GYHX 4AWXB 1J59A 4MV7A 3H1CA 2NVYJ 5J1UA 2HS5A 4YG2F 3MWDA 2OWOA 3FWEA 3GV5B 4FU0A 1FOYA 1VFCA 1K4SA 2VC0A 3D5LA 3AG2H 4CYCA 6PAXA 1DGRM 2QBYA 5DCFA 3HYIA 4UCTA 1PP8F 5H6RA 3MZ8A 3M9MB 2M8EA 2R7NA 1MMDA 2W24A 2ZDGA 3OYJA 1A35A 1WHUA 1W36D 3M4OJ 2CFOA 1HW2A 3GX4X 2OZ6A 1X4OA 1TWHJ 2M0MA 4BJTA 2IP2A 4A3BJ 5CA0F 3GTJA 3QOEA 1SD5A 2E7WA 4V2FA 1ZG3A 3M8FA 1GHCA 4DV7H 4PGGA 2ATLA 4P5OA 3QPTA 2OC6A 2RNGA 3HOXG 3FXLA 3ECOA 3G6XA 4XRMA 2CUEA 2W70A 4UCOA 2JEIA 4ZZLA 4GXOA 1MJAA 1TTYA 3CUQB 1M6VA 3Q2OA 2HPMA 1JXSA 3G6YA 3G3ZA 3GVAA 3JAMK 1A31A 2HQAA 2WY7Q 5IT3A 3ELKA 4EV0A 4LH6A 1MD0A 1P2FA 5LRSA 4NUBA 4L9NA 3FHNA 1JKPC 2Z9OA 3J81K 3SFIA 2BXZA 2QM3A 2QQAA 1Z1DA 3BG7A 4MAMA 2PMZN 4A3GG 2AHQA 3KP3A 2E5LH 3BR6A 3JRHA 1UNNC 1W96A 2R8HA 4HX8A 2K4JA 3FM3A 1HSTA 1K6OA 3ZQGA 2AXLA 3FBNB 3BZCA 2DYRH 1J5YA 1KQ9A 4MV1A 5B1BH 4HEA2 3H9JA 3CC2I 3KLNA 3S2HJ 4MV6A 4UUTA 5K7ZA 1IRXA 2ZSHB 3SJMA 3S93A 3S1RJ 1ZHQA 2YW2A 4IHYA 2DPUA 2KRCA 2ELKA 1ON2A 2FU4A 2PG4A 3A4CA 3F8CA 3VEPA 4B48A 1IV8A 2ACJA 2HVRA 3EYYA 4XN3A 3TW6A 3F72A 1X1CA 1CF7B 3FXMA 2ZMEB 2IRFG 5K5RA 3BG3A 4BXUA 4IQJA 1V54H 1UHWA 3MEXA 4I09A 2GM4A 4E7JA 3IWZA 3LSJA 3GTPA 1OJLA 1QZEA 3CUQA 3QZ8A 3HC7A 3FF5A 5D5WB 4IWXA 3H40A 1FOWA 1YOVB 1MGTA 4B3XA 5E20A 1UC8A 3F21A 4XLPF 2KIQA 4DW6A 2E2HA 3S32A 4RNOA 1LQ1A 4BBRG 5EGOB 3TGNA 3VYUB 1IC8A 1WH2A 1FBQA 1F43A 1GGOA 5D1OB 3EUHA 4ZYEA 4WD3A 2L9NA 2WAQA 1XMOH 2HXIA 2UXDH 2VR1A 3T1HH 2KIUA 3V4ZA 3BQ0A 2BHZA 1MSEC 2ISYA 4A6DA 1E3OC 2NS0A 3RQ4A 2VT3A 2EZLA 5L1JA 1N34H 1ETXA 1WGXA 2FLNA 1C30A 2Z33A 1WWXA 3DPLC 3OIPA 2QVOA 4CDGA 1TWAJ 2R84A 4L1KA 2LRDA 1R58A 3SZPA 3OL3A 2LF8A 2QLZA 3RKWA 3PIPF 2J6UA 4JYAH 2KIMA 3MFHA 1TW2A 3LQQA 3CMAI 2IS1A 3Q8QB 3ZQFA 5IYBG 3GW2A 2ZNZA 2VONA 1OQYA 4H4KC 1R49A 4NQWB 1EUDB 3BA8A 2XGPA 1N77A 1GLVA 1OCPA 1P4XA 2EFNA 2W1OA 2ZMEA 3DBHB 4IL6C 3BR0A 3T0YA 1OYIA 3QPSA 3F8MA 3FXRA 2YX7A 3ROUA 1EKEA 4DNCA 3OUZA 4XYMB 2NU7B 3KX2A 4MTEA 4LFBH 3CDHA 3T8RA 1H88C 2HFHA 3S15J 3ZQQA 1LDDA 4YJ3F 1XSVA 3DLAA 5L3GA 3HOXJ 2MD0A 2R7WA 2W7PA 2OU2A 3RB0A 2IGMA 3HSRA 4XOTA 2IJLA 1G6NA 4F4YA 4Z2YA 1KONA 2Y9ZA 2D5VA 3L9FA 5D1OA 3TOAA 2OTLI 1KZHA 2VI6A 3L1PA 4ENJA 2WB1E 3G6VA 4RAGA 5EYRA 2O8XA 4N9HA 3IRRA 2VLAA 4J9RA 2QKLB 2IMWP 5ICGA 1JDBB 2DODA 4LF4H 3N97A 4O2AF 4ZH4F 2RDIA 4BUPA 5JHUA 1TLHB 2J5OA 2CKZB 2NVXJ 4RAZA 2DZDA 3DEWA 2FNPA 4UCRA 4ZYHA 4A3GJ 2AGQA 3OYMA 4LGWA 1LNWA 1WJ5A 1P6RA 1R9TJ 5EJCA 4DBQA 3DPUA 4E7HA 1DP7P 3LSRA 3H0GG 4HQEA 2JQ7A 4CHUA 3A01A 1JLLB 3TDZC 5D5VB 2C22A 4IRHA 3V42A 2MG4A 4D9JA 5KFXA 4DZJA 1HA8A 4M3GA 3FMRA 1PJRA 5TRDA 1WCMJ 3GUDA 4IRIA 2E1CA 3JRGA 2PQ8A 3DU6A 3K4NA 3MMYB 3TKYA 4BHPA 4V2GA 2E1MB 5E18F 3CCRI 4BE0A 2NOGA 4Q45A 3O8HA 4ZDLA 1JT6A 3WTWC 1JTYA 2CGPA 2JEJA 1GXPA 1XDNA 2F4MB 4DL5A 1HNZH 1FJGH 1RYRA 2NRAC 1QHHD 3FKJA 5F0HA 4HF1A 1H9GA 4C2TA 3MVPA 1SEUA 1MBKA 1V5GA 1IBMH 1U0JA 1M0WA 1AOYA 2E5NA 2L7MP 1MSFC 2JA5G 1BC7C 3OYIA 1T8IA 1MH3A 4HV5A 3WU2C 4XONA 4NHJA 1KQ0A 5AIPA 4BE1A 4BY1J 2EIMH 4G3IA 3GLLA 2XGDA 4B1RA 1TBXA 1U2WA 3OYFA 3CLQA 4BBRJ 3CCMI 2UVVA 3GF2A 2EA4A 2L54A 3A02A 2GXBA 2ASJA 1GLNA 2ZFUA 4DV1H 3BR2A 3H35A 4XM3A 1ZG1A 2HOTA 2C2RA 5LRRA 1I7NA 3DTKA 4M3DA 4B4CA 2XHKA 2UXCH 5FD5A 2FQ3A 4FQGA 2IAIA 2Y0MA 4HLXA 3OUUA 1SFEA 3S17J 3OTOH 1OMIA 4GDFA 4E7ZA 3ZMTA 3M9NB 3KP5A 4IWYA 3FMSA 4C5AA 1S5LC 3MWEA 4OWRB 5KFYA 5FLMG 1A6IA 4NLGA 3WGGA 2O8KA 2G7UA 2ZM6H 1I3AA 3DCFA 5JFRA 3I71A 2BY3A 2R7FA 4ZDPA 2HKXA 1G2HA 1EH7A 1FLIA 3NWTA 3K4CA 3KCCA 3L00A 5EZGA 5FKLA 2FEZA 5IYBJ 4NXMH 4EFEA 2KJBA 1PUFB 3G2BA 2EPFA 3KLOA 4D5FA 2O61A 4GFBA 3E0JB 4IHWA 3K1NA 4DR3H 2EA2A 1I50A 3JSPA 2R93G 2X0SA 4PSWA 3CQZJ 1VBGA 4OIRF 2CFXA 4OU0A 2WBMA 3KPHA 4JI8H 3HOWG 2UXBH 1V4RA 1Z3YA 5C8YF 2A05A 2YX4A 3PUFA 4S05A 1IXCA 1ETKA 1RR7A 4M72A 3K4KA 3OS1A 4YR0A 1C3OA 2H6CA 5C4XG 5LXTF 2QENA 3CP2A 1Z67A 3MJFA 3J80W 2MC3A 4FBUA 4JI6H 3M1EA 4YJ2F 1I39A 3WTVC 4DL4A 3N8DA 2JA8G 3RUPA 3Q8RB 2XB0X 3GIJA 2M1BA 2ASLA 3K1MA 2W6QA 1GV2A 1BI2A 2NNNA 4II3A 4LF7H 2DT5A 4BXXG 3MR3A 5K1YA 3AFHA 2C6YA 4UNOA 1TZLA 2F4OB 1Z6TA 3ORQA 1Y6IA 3DTIA 1ZG5A 2IS2A 3RAXA 2VXDA 4E6KG 1ITYA 4O3RA 3H0GJ 5LEKA 2NU8B 1DU6A 3HSFA 2XCLA 2CWEA 2ISZA 1IRGA 4D1QA 2R7DA 1IJWC 3LFKA 3QYEA 1YJ9I 4DV3H 1PUFA 4E4TA 5K7FA 2W00A 3EPGA 4DZPA 1G3WA 5DYMA 3CCUI 2W8KA 3OYBA 1P4AA 3PW5A 2KKOA 5KFJA 3PNTA 1MJBA 1JE8A 2CU7A 5H2FC 5FLXZ 2E60A 4XYLB 2ZCWA 4D7NA 1QPIA 5DG8A 4HBLA 2M8GX 4A0XA 1B6RA 5J2UF 3ABLH 3CESA 4KISA 3TO7A 2FRHA 4L9JA 3D1NI 2CW8A 4A2BA 1O75A 2LMDA 3RIRA 2ZJQF 3KFWX 3P9CA 5D8KB 1DPUA 2EV6A 1KA8A 3HKZA 2JA5J 1IF1A 2V4JC 4RGRA 1XC5A 3WGHA 2ZXHA 5DM7F 2UU9H 2R7ZA 3IRQA 1EZ1A 3ABMH 3VFZA 2IGNA 2KJCA 5EF6A 4QLCU 4QIWA 1T0FA 5D5XB 2M0CA 4ME6A 5IT9W 1XSDA 3BDDA 3WTSC 4HDVA 3HZJA 3K3VA 1ENHA 5D8LB 2K3FA 4RNNA 3BCBA 1ETVA 3M1CA 3T5JA 2L4AA 3ETJA 4JI2H 5F64A 1IRFA 2EV0A 2PLYA 2FQ4A 3E5NA 4ANJA 2DIKA 3OMYA 3SXYA 3GFJA 4M9SA 5HVQC 2N8GA 1T3NA 2QA4I 3VB2A 3T5KA 1XTAA 4AYBE 3I55I 3ZPLA 4KNYA 3K5HA 2HZDA 3AAFA 3CCSI 2M3AA 3H3VK 2PEXA 2MW8A 4IHXA 1OWTA 2V5AA 4O6JA 3IH2A 3JR9A 2WTEA 1ZETA 2H94A 5KG5A 1TQMA 4A93G 5HDNA 1TWCA 4A3MG 1D8KA 1NTCA 2VBZA 4A0ZA 2F6CA 2R5YB 4PDBA 1MNDA 3GLKA 3CF5F 2DT7B 1PX2A 2GBYA 4IRDA 5E1ZB 1JDEA 4YIRX 2YSRA 4CO8A 4HNUA 5A2QK 4J9KA 1S97A 1P7JA 2R93J 4CA0A 3FXOA 2Y75A 4RGSA 3HTUA 1FC3A 1R4MB 1U5TC 2QF7A 4M74A 3HOWJ 2LFBA 1KQ8A 1Y56A 1FJLA 4A3JG 4DYRA 3G73A 1S7EA 4LG0A 2O7OA 2ZXWH 4ZC3A 1FZPB 4PZJA 5DTDA 2HDCA 2JA6J 2V9PA 3V6HA 4DR7H 2XRNA 3HEFA 4P96A 5C4XJ 5CB4F 2NUAB 4HOBA 5KAIC 4EBCA 3NQOA 1Q1HA 3WTZA 3N42B 2WDTA 4G7OF 4BL0B 5IYZF 3HOUJ 3LOCA 3UR3C 2L9SA 5IP9G 2GOXB 4M9ZA 2P5LC 3EETA 1EHIA 3HOTA 4DV2H 2JA8J 4XN0A 3HRMA 3GBGA 3LP8A 3RIZA 5KFEA 2C2DA 3B6CA 2AU0A 2YRWA 2GA1A 3H0DA 1SD6A 2UV1A 1Z91A 4WX9A 4BXXJ 5CVJA 3Q1KA 3J80K 1Q1VA 3E6CC 2Y0SE 2UUCH 2W25A 3P9IA 2FMYA 4CH7A 5LFAA 2EIJH 2XAFA 3H4DA 1HKTA 2UWMA 3GXOA 2VQCA 2XAUA 1C0WA 4JV5H 2EZKA 4EJWA 2R5YA 2COMA 4AIDA 5E3NA 5EDNA 1NG7A 3PW2A 4ZHQF 3EPZA 4CCJA 4KFCA 4DR2H 3JTHA 3SYTA 3OR2C 4IRGA 2K7LA 5FB2A 3OYNA 2ZXJA 1HC8A 2E36A 1YJNI 4M6YA 3C1DA 3LMMA 2FA5A 2UUBH 4OX9H 5HS9A 2FP4B 2PMHA 2CQYA 3RB3A 4K2EA 2QEXI 4HNTA 2R7XA 3HPGA 3LAJA 2QK4A 3RGXA 5DG9A 1N56A 2RDJA 2Q2UA 2DDAA 4KITB 5GAEJ 1Z21A 2IT0A 3RTXA 4GGGA 5IOYA 1MW7A 1OISA 3CMEI 3HXLA 2P7VB 4C2MJ 3MFIA 4RB1A 4IVNA 1GUUA 4BEHB 3M07A 4L5EA 1B33N 3CCLI 1MZBA 3GFLA 1T38A 3TO9A 3MWMA 4C3HJ 2R86A 1DU0A 4DV5H 5TJJA 1S29A 4BGDA 2RV8A 1VQ7I 4AYBN 3I56I 2F2EA 4UCSA 3GIPA 1ZGWA 5IT9K 5E1XA 5EWGA 2E2IA 1RRJA 2PBIA 4WBNF
chains in the Genus database with same CATH topology
1FKAH 1XGSA 1JGSA 3MQ0A 1XGMA 1L3LA 1EH6A 1ODDA 3GO5A 2VOPA 1TQIA 3CTAA 1KU2A 4LF9H 4JK1X 1MKMA 3B02A 3DPTA 1JHFA 3I54A 1QZZA 3CUQC 1TNSA 1IW7F 2A6HF 2NNYA 4M73A 1XGOA 2EK5A 1ZH5A 3JAMW 5ICCA 3GFIA 2P5VA 5CVUA 3C0FB 1IXRC 2D1VA 3J81W 5L3FA 2DPDA 4L5JA 4A5NA 3KP4A 4L5IA 3BABA 4EJVA 3ZMUA 2LF7A 4LF6H 2DBBA 3IWFA 5EEHA 2CW7A 3GZ5A 4DUYH 3BJ6A 2VPSA 2ZJ2A 2DLLA 2BBYA 4KIBA 5DD4A 4ZYDA 3MCZA 1ULYA 1QPMA 2M45A 2QBYB 4Y17A 2WE6A 1G3TA 3KEOA 2HVSA 1FX7A 4MGRA 3RI4A 2YR2A 2LDUA 1QGPA 2ESNA 4FT8A 4GCVA 5FFZA 2Q0OA 3SFZA 5DEQA 4HLYA 1IN6A 4D0PA 3M7GA 5DV5A 4RB3C 1B4AA 2HOEA 2A69F 4F7ZA 4CICA 1J5EH 3L4KA 4KMFA 1AN7A 1YS6A 2JSCA 2HTSA 5LLQA 1FSHA 1IN4A 3TO6A 4EJOA 1E17A 3QAHA 1QBJA 3KETA 3R61A 4Y15A 2DK8A 2ADUA 5ICFA 2A3SA 2H6BA 5CJ9A 4XSXF 2O6GE 1Z05A 1ZRFA 5BQTA 3RPQA 2HYGD 2CYYA 5LGTA 4M9XA 1FYLA 3MAJA 3PQJA 5BMZA 3IKVA 1RUNA 5LEJA 4N0BA 3FZVA 2HQRA 1TAEA 3WE2A 5HDGA 4KMUX 2CQKA 4HYEA 1Y0UA 1BC8C 1P4WA 3F23A 4JI3H 1IXSB 3R0JA 2V79A 4KHPH 2JZYA 3ERED 4BH9A 1XMQH 3HRUA 1AWCA 5HS7A 3CJNA 5DUIA 1QO0D 2XAJA 3DQVC 3P9KA 1PUEE 2VQEH 1QNTA 1IBLH 4YHHH 4GYIA 3UQ8A 4WWCA 4JQFA 3QP5A 5BS6A 4UUVA 1OR7A 3BPXA 1ZRCA 2L01A 4I98B 4KYWA 5L3CA 1O3QA 3JSNA 5LGNA 3RYPA 4YFXF 4WF2A 4DV0H 1KU9A 1TA8A 1FNNA 5FO5A 3R6SA 2EV5A 4J0MA 3HSEA 2JT1A 2FBKA 3QP6A 5HOOA 2GZWA 2F5CA 5DD8A 5FGMA 2M87A 3VOEA 1IN5A 4I2OA 4CZZA 2DFIA 1HXDA 3E3VA 1DUXC 2FOKA 2IA1A 1LDJA 2NAZA 4LSXA 5ILSA 1W4MA 4LLGF 2Y48A 3NEUA 3LA3A 4A6EA 4MQVA 4CYDA 3KEQA 1WI9A 2EFWA 3FXQA 3HRTA 3MZYA 5ILUA 2RC4A 2XGXA 3DXJF 3BAAA 4WXCA 5FLXW 2GIVA 1D5VA 1V9PA 1YFHA 1EH8A 4DV4H 1A0IA 2V6CA 4G6QA 5BPDA 4EGYA 4HW0A 1SD4A 1Z9CA 4AIHA 1R7JA 3DF8A 2GAUA 5F6FA 4I01A 2NYXA 1O3SA 4G7ZF 1GXQA 3M8EA 2MA3A 3BROA 1F4KA 2H27A 3M9AA 3I59B 3E6MA 1USTA 3HHGA 3WG9A 5D5UB 1ONVA 3P7NA 2QUFA 2GA2A 4HF2A 4GKKH 4FM9A 4X62H 4GKJH 4Y13A 5HLGA 1DPRA 1A04A 2A07F 2UUAH 2R3SA 2VXZA 2RGRA 3I0TA 3DV8A 3ML6A 3N43B 5A2QW 1FPQA 1FSEA 1B9NA 3H20A 2DQRA 2EWNA 2X0LA 2OZUA 2P6TA 4YFKF 5IWAH 2QQBA 1S8NA 2Q2TA 2VOOA 5J6XA 3B73A 1T98A 2W57A 3V7CA 3V4GA 1S3JA 2VN2A 3CO6C 4UV9A 2FSWA 4M7EA 2E7XA 2VBYA 1T6SA 4AIJA 3I59A 1I27A 2QYOA 1HNXH 2IPQX 5HS8A 1Z2PX 2TDXA 1BIAA 4FX4A 1B9MA 3RKYA 4IXAA 3TQNA 1K79A 2MCTA 2A5YB 3K69A 5JVTA 4L18B 3DEUA 2VBXA 1B59A 4NXNH 2DQLA 3FXUA 4KA4A 4XLNF 4KN4X 1I5ZA 5BOXA 3PN1A 4KN7X 3EQLF 4MEXF 3Q9VA 1IZ1A 1J0RA 4HX7A 1KYWA 4IHSA 3FMAA 5FLXK 1SEIA 3HTSB 2FMLA 4YFNF 2ELHA 4YY3H 5L3EA 3N44B 1HW5A 1FOKA 3ZMZA 1TQPA 1XGNA 1W7PB 2HTJA 4OINF 4RAYA 4U7BA 1M0TA 3FHZA 1ZARA 2YCHA 4LG0B 3J7AK 2HKOA 2ESHA 4HQMA 4OMZA 4RGXA 4UHTA 2ZKZA 4X65H 1ZLJA 3SQNA 4UVAA 3N40P 4H0EA 2UXXA 4LFCH 4DQ2A 5BR8H 2E1NA 4HF0A 1V3FA 2F5EA 2V9VA 3KE2A 2K02A 3RJ0A 2F4VH 4IHTA 4LFUA 3F6OA 3F22A 3HOSA 2Z3YA 4XRFA 2A68F 4BNCA 3KP6A 2CO5A 1WRJA 5DCMA 2P5KA 5F1RA 4JI1H 1XD7A 1W7PA 4M6XA 2WWYA 3F8BA 1B04A 3SZTA 1RIOH 1L0OC 4UXNA 2GWRA 1KU3A 1BI0A 3F3XA 1MJ9A 1RI7A 4LFAH 4G6DA 4G8XA 2QZ8A 4AIKA 1FBSA 4OIOF 3GLXA 4UVBA 3T1YH 3RDIA 2VE8A 3BPVA 1E2XA 2OBPA 4BYYA 1E4FT 4K0KH 2B0LA 2O3FA 2QWWA 4EEQA 4R8HA 1ZAOA 4BAYA 4DR6H 2HGCA 2OAZA 4Q48A 4ESJA 1B6AA 4ON0A 3I4PA 2IW5A 2V1XA 4HA8A 3O3KA 4U88A 3TOBA 3ECHA 3WTXC 2OQRA 3J80Z 2F5FA 1X3UA 2QQ9A 2YPRA 1EV7A 3RTRA 4HDUA 3MZHA 1S7OA 4LD5A 4OIPF 4MV9A 3QPHA 4P55A 3BOQA 3FM5A 4L0ZB 4KT5C 2BGCA 4M71A 2WC2A 3GZ6A 4BWSC 4LJZF 1OPCA 2BYVE 4BHCA 1HBXG 5ERIA 1YIOA 4B09A 3CUOA 3R4KA 2DW4A 1OKRA 5E8GA 4A12A 1SMYF 5D4SA 5FPOA 3HHHA 1WQ2A 2EB7A 4LK0F 4XBFA 5IT9Z 1P92A 4JI5H 3OOPA 1XB4A 3FX3A 2X4HA 1F9NA 3WU1B 3BP8A 3V7RA 4JI4H 4A2AA 2K4BA 1E4GT 5FD6A 1U8RA 4PCQA 4B3MH 5LBQA 5DDGA 2LKPA 3TDUC 1N36H 2XUBA 2W85A 3IC7A 4OIQF 2KIFA 5AONA 3WGIA 4P9UA 1ON1A 4EM2A 3E5UA 2EFQA 2ZBKA 1UFMA 3L09A 1R00A 2P7CB 2ZJTA 3RYRA 1ZHSA 4N9IA 3E97A 4EGZA 1YO5C 1K78B 1K7AA 1H9TA 1U5TB 3E5QA 1G3SA 5ILVA 4LH7A 1B1BA 3CO7C 3KALA 3KAJA 5H20A 1BM9A 1UB9A 4CXFA 4LSAA 1LVAA 3K9TA 3QOPA 2XIGA 3L7WA 3S2WA 3ZMVA 4EVIA 4MNUA 2W84A 4L0YB 1Z2OX 1SMTA 3SHFA 1UCRA 1I1GA 5DUKA 3DP7A 4HX4A 3V8JA 2XROA 2J5PA 2PJPA 2EJRA 4NB5A 1J2XA 3GFMA 3IKTA 2Z5UA 3Q9SA 2KSWA 1K78A 4CC5A 1U5TA 4DR5H 1OYWA 4JI7H 2JTVA 3LSTA 4O5VA 4R7RA 3KAKA 1O3TA 3QU6A 2RGVA 4LK1F 1I94H 1MDMB 2EFOA 1FYMA 1RUOA 1IN7A 2M30A 2O03A 2Q2EA 2XV4S 2CW0F 4FX0A 3H3UA 5AIQA 1WSUA 2G9WA 3GEZA 1J75A 2D2WA 5CLSA 2D1HA 1ZREA 2FBIA 4RS8A 3N41B 3LMLA 2WYOA 2O0YA 3OV8A 2XKPA 3WE3A 3F8NA 4P9FA 1HKSA 3JTGA 1BJAA 4O3MA 3EDPA 1P8LA 2XAHA 1D3YA 3BWGA 3JAMZ 3K0LA 3D0SA 4DR1H 3K2ZA 3DKWA 2UZKA 3QRFF 1S68A 3EYIA 3J81Z 1MDMA 4ESBA 3BJAA 2HYFA 2MLGA 1O57A 4EJUA 3IHUA 2A61A 1IBKH 1FBUA 2JPCA 4I0BA 2DI3A 1H0MA 4MQ9F 2P6SA 2HVQA 1T39A 1N32H 1XMAA 1SAXA 4APMA 2PFBA 2HZTA 1LJ9A 3JSLA 2WV0A 4KDPA 5D1PA 2H09A 4U0WA 4Q0YA 3U9GA 3KP2A 3KXYT 3DFGA 3T8TA 3LAPA 3ZQ7A 1ZLKA 4QWQA 2GQQA 4JI0H 1X9NA 2FE3A 5E1WA 2G7HA 2IA2A 4TV7A 4LLNA 3CVZA 3LWFA 5J8FA 2ETHA 4LLLA 1G4DA 5LMUH 1W5SA 4KIGA 1BIBA 5L3DA 3M4IA 1O3RA 3V7SA 3T1BA 5D4RA 3F6VA 3KZZA 1STZA 1HW1A 2FF4A 2STTA 2AS5F 2MH2A 4B3SH 4IF4A 4RB0A 4A2UA 2DTRA 1CF7A 2VUGA 2XKOA 4PDKA 2STWA 1R1VA 4ZZDA 3E6BA 4YIFA 1XSXA 4L9TA 1BI1A 2HGSA 3H3ZA 3JSOA 2FNAA 3V8KA 5HLHA 2RQPA 1FWZA 2RVCA 1YTYA 1SD7A 2MBFA 1BJTA 1DDNA 1BBYA 1GVJA 1I1SA 5E17F 3I58A 1ZRDA 3QU3A 1T2KA 2DO7A 3WTYC 1KGSA 2Z99A 3KZYA 1IN8A 3ULQB 1XCBA 1CGPA 1YW7A 1I6XA 5BPIA 3RGZA 2D45A 4FHTA 5HDKA 4LMYA 1XDUA 4NQWA 3ZP5A 3W6KB 1J7KA 4AVPA 4OOIA 4UVCA 2RKHA 4U0YA 4G9YA 3GWZA 2MH9A 3ZN0A 1KU7A 2PMUA 1R1UA 2HEOA 4UFZA 4EJTA 3RPUA 4WXHA 5K5QA 1GYFA 3O2PE 1S6LA 4GYGA 1FP1D 2GXGA 2ZO4A 2VODA 3L2CA 2VQFH 2RN7A 1BN5A 1R1TA 2JRTA 1BOAA 3I64A 3V8LA 4UCUA 1Z2NX 3C7JA 1SFUA 2IVMA 5E8IA 1FT9A 3N6XA 3L2PA 2P4WA 1LEBA 3MFKA 3CLOA 3ABUA 5FFXA 1USSA 3BJOA 1O7LA 5KK1A 1D8JA 2LNBA 1S7AA 4JBAA 1XCVA 4XSZF 5LMNH 4I0AA 3U2RA 3ZN1A 1HR0H 3U1DA 3PFIA 5J8CA 5ICEA 4EM0B 1KYZA 4ENMA 2HQNA 1ZN2A 1IAWA 1W5TA 1OYYA 2CSOA 3ZMDA 4U7DA 1R5GA 1N33H 2DU9A 4S04A 4HAMA 5LGUA 2MLKA 1HNWH 4LF5H 1QZYA 2VOBA 5DCMB 1FP2A 4G7HF 4ZYGA 4PGHA 3WTTC 3W6JB 2CG4A 4ENKA 1XNQH 2HWVA 3KP7A 1YYVA 5L3BA 2FXAA 4KUMA 1LEAA 3I5UA 2DAOA 3IL2A 3HRSA 4R79A 5CVIA 5JR3A 4X66H 3ZMSA 4WXDA 1G3YA 5CVVA 4ENNA