4RB2C

Crystal structure of magnetospirillum gryphiswaldense msr-1 semet-fur-mn2+-feoab1 operator
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
134
Chain Sequence
MVSRIEQRCIDKGMKMTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (25-MER)
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein/dna
total genus 34
structure length 134
sequence length 135
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rb2C01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rb2C02
4I7HA 2DPUA 3BJOA 3E5XA 3WTTC 3T0YA 1ZGJA 1HW2A 1B1BA 2H27A 4HDUA 2YR2A 4M73A 4D0PA 3G3ZA 1LDDA 3WG9A 1KGSA 2VC0A 2WV0A 4M9SA 3GF2A 1XDSA 1RNLA 2VE8A 2NAZA 1USSA 3E6MA 1ZG1A 3E3VA 1S3JA 2EFQA 4GGGA 1ZYRF 2E7WA 2EFOA 2O03A 3CTAA 2DI3A 1D8JA 4CICA 3ECHA 5JR3A 1J75A 1HW1A 3LSTA 2GA1A 1KA8A 1H9GA 3E5UA 2YX4A 4IHSA 1IXCA 3GVAA 3GXOA 1BOAA 1T0FA 1OYYA 1BN5A 5ILVA 3P9KA 3ZMVA 3RYPA 1HBXG 1DPUA 2QBYA 2MC3A 3HRTA 4R79A 3O3KA 3ISPA 1U5TC 2P8TA 3GEZA 1C0WA 4ESJA 4P55A 2UWMA 1T39A 1U8RA 4B8XA 2IPQX 3IRRA 2ZKZA 1KU9A 1KU3A 1MD0A 3R60A 1XD7A 4P5OA 3L7WA 4ENMA 4G94A 3E6DA 2LKPA 1IN8A 2M5WA 2M8EA 3V8LA 3DF8A 3D5LA 4KT5C 1T38A 2AS5F 1EH8A 2OZUA 4RS8A 1LDKB 2OD5A 4XSXF 3LAPA 3JSOA 2P5KA 2D2WA 4AIHA 3DV8A 2PI0A 4A6DA 4ESBA 1UHWA 2L4AA 4RB3C 4ZZLA 3MCZA 3QP5A 1IZ1A 1DDNA 2Q0OA 2F5FA 3HTUA 2O0YA 2ZJ2A 4R1HA 1SD5A 1J5YA 2L01A 1BIBA 3U9GA 2QENA 5DCFA 2WWYA 2QZ8A 4BQAA 4O3MA 3WGHA 1OYWA 5D8KB 4ZYHA 2Y0MA 3ZP5A 5TRDA 3KP5A 2KIMA 1LJ9A 1BI0A 1F5TA 3KP4A 1YW9A 2G7HA 4XRFA 1JXSA 1P2FA 2JZYA 1YO5C 5HLGA 3JSPA 3K9TA 2F5DA 2R7FA 1J2XA 4KA4A 3RKYA 2OQRA 1MDMA 2FQ3A 5F6FA 3WE3A 4XLPF 1ZAOA 1O3RA 1STZA 3ZMUA 1W7PA 4UNOA 1YS7A 1O3SA 4LD5A 2CQKA 3EDPA 3I64A 4JQFA 5HVQC 2H6BA 4A0XA 1QZYA 3CLOA 1BBYA 4BHCA 2PN6A 2DU9A 1J59A 5D5WB 3P9CA 4Y13A 2EA2A 4OIOF 2KJCA 3E5QA 3MWMA 1I6XA 2ISZA 2XUBA 4CZZA 1P4AA 3GFMA 1FZPB 4HDVA 4YG2F 2FOKA 2FF4A 4L0ZB 1FYMA 2VT3A 2RNJA 3R0JA 3WTZA 2V79A 1HKQA 3WTWC 3S2WA 2VBZA 5BS6A 3P9IA 3GW2A 1G6NA 2RKHA 2LDUA 2XAGA 3GLXA 1WI9A 1CGPA 2Z9OA 4RGSA 5D6FA 5CLSA 2P6SA 3FM3A 4G8XA 1FPQA 1EH7A 3QRFF 3CDHA 3J80K 2A07F 2DO7A 4HX4A 1JGSA 2G9WA 1BI3A 2ZMEB 3KE2A 2V9VA 4IRIA 3GYHX 3ELKA 5CJ9A 1CF7A 2PFBA 3M8EA 4P96A 2IP2A 3WODF 3C3WA 2FRHA 1A04A 4HW0A 5CYVA 1TNSA 5IT9Z 5TJJA 1Z6RA 4OIQF 3TO9A 3K69A 3LAJA 3IHUA 4ENKA 2L4MA 2OAZA 1G3WA 3ROUA 2QM3A 4HBLA 2DBBA 1Z1DA 2K02A 1BC8C 1XSDA 4UVCA 2P7CB 1Z9CA 3IRQA 3ULQB 5AONA 3F72A 2DT5A 4E70A 3M8FA 2O61A 2IRFG 4XBFA 2OBPA 1LNWA 1I5ZA 1D5VA 5H6QA 3FX3A 5FB2A 3GFIA 5JFRA 2J5OA 4KIBA 5LEJA 4KUMA 5H6RA 2XKOA 4WXCA 1FT9A 3BROA 5LHGA 1R58A 4PGGA 1HQCA 5HS8A 3FM5A 2X0LA 1YFHA 2EFPA 4A6EA 4RAZA 2A5YB 2RN7A 1U5TA 2W85A 4EJVA 1ON1A 4LB5A 3ZMTA 2PBIA 5AIQA 2VBYA 2EV6A 2ADUA 2VBWA 2W24A 4RGUA 3RKXA 5E1WA 2IA2A 3CUQB 2KJBA 3HHGA 3BJAA 3T5XA 2DW4A 4M6XA 2MD5A 2UXNA 2J5PA 2NYXA 2LF8A 4U0WA 1F1ZA 2FMYA 4PGHA 5DUKA 1USTA 3RYRA 3TOBA 3MZHA 5F1RA 2E1NA 5D4SA 2H94A 3GZ6A 3KETA 3SXYA 4LGWA 1TLHB 2XRNA 3L2CA 4Y17A 1R7JA 4S05A 2Q2EA 2K27A 5FFXA 4HZFA 1J9IA 2ZO4A 5D5UB 1IRGA 5HS9A 1R1VA 1RI7A 4WXHA 5ILUA 2FA5A 5FD5A 2FNAA 3VB2A 4IRGA 2M45A 1SMYF 2NRAC 3TO6A 3T8TA 3JW4A 5L3FA 5LEKA 2IW5A 2ZCWA 1L3LA 1I27A 1L0OC 2KIUA 3RJPA 4L18B 4UXNA 1T2KA 1B9MA 4LLNA 3KEQA 1QGPA 2HTJA 5ICEA 3QOPA 1HXDA 4BHBA 3J81Z 6PAXA 1SD4A 1IF1A 4U7BA 1XMKA 1KQ0A 1W5SA 4EMSA 3CUQA 2QBYB 4ETSA 4G7OF 2QWWA 2STTA 3GO5A 4EJWA 2FE3A 4UVAA 3B02A 4FX4A 3HSEA 4HV5A 1ZRFA 1B6AA 3ZMZA 2BGCA 3QP6A 2PG4A 4YIIA 1AOYA 4HLYA 2EK5A 3DP7A 3FXRA 4AIKA 3F8FA 1XGSA 1BC7C 1G3TA 2JT1A 2OA4A 5E1ZB 3ABUA 3QPTA 1Z6TA 3BPXA 3FZVA 1ZARA 4LK1F 4I01A 1GVJA 1B4AA 2DFIA 2K4BA 5DD8A 2IJLA 4BAYA 3EYYA 2E7XA 1S7AA 3TDZC 1Z05A 3KP2A 2CSOA 5FLXK 3F8NA 1MJBA 1RIOH 4LG0B 1YW7A 1F9NA 3GX4X 1IN7A 5HS7A 2W25A 4ON0A 4UHTA 1R5HA 2FXAA 3WTVC 2VBXA 1ZGAA 1ZHFA 2RV8A 2F5CA 2YX7A 2EWNA 2FBKA 5LHHA 3HOTA 1B9NA 2ELHA 1K78A 3H3ZA 4IVNA 3TGNA 4OINF 1REPC 5LGTA 4MNUA 4GYIA 3WTXC 3IKTA 5DV5A 4EVIA 4M74A 4EGZA 2IT0A 1XDUA 3I59A 3WGIA 3H3UA 4Q5SF 2DAOA 2RQPA 1RZ4A 2R7DA 2GAUA 4Q47A 1JHHA 4L9JA 2XIGA 1H9TA 1K7AA 1BM9A 1LVAA 1UB9A 5DUIA 4FT8A 1JHFA 1G3YA 2QQBA 3I54A 1I1GA 2JRTA 3F6OA 5E20A 1MDMB 2HWVA 3J81K 2O6GE 3C18A 2C6YA 5DYMA 2FBHA 1TNTA 1W7PB 5H20A 2ZBKA 2F5EA 4G7HF 4EQQA 1U3EM 4DQ2A 4U7DA 3U1DA 1DP7P 4M71A 4LG0A 1LQ1A 3TOAA 5ICCA 4GCVA 1LDJA 5LLQA 3E6BA 3HRSA 3HTSB 2HFHA 1SFUA 4S04A 3IC7A 4L5IA 2VODA 1R22A 1YLFA 1MZBA 5L3EA 2Q8KA 2ZNZA 4WX9A 5EEGA 3CUOA 3J80Z 2ETHA 5D5XB 2QLZA 4RB1A 4WK8F 1IUYA 2EA4A 2XASA 2XAQA 3B73A 4KDPA 1WKMA 1QPMA 1E17A 3FMRA 4G6QA 3PQJA 3HRMA 3SFZA 1SD6A 3TQNA 2GXBA 2HZTA 2XGXA 3M9AA 3Q9VA 3C7JA 4OU0A 2Y48A 1OYIA 4N9IA 2L54A 4HV6A 2UXXA 2COMA 2CGPA 4U0VA 2M30A 3FHZA 2GQQA 1KQ9A 3BJ6A 3IWFA 2HKOA 1PP8F 2A68F 4ZZDA 5LGUA 3W6JB 4HLXA 2FEZA 2VN2A 5EEHA 1CF7B 5J6XA 4RB2C 3PQKA 4CGZA 1ZG5A 1YW8A 1O57A 2XAFA 1FSEA 3CJNA 2FSWA 4CDGA 4CHUA 5L3CA 3MQ0A 1YIOA 4O5VA 3WU1B 1S6LA 1FYKA 5ILSA 3W6KB 2HR3A 2JPBA 2O3FA 1WRJA 2ZXJA 5BPDA 2OZ6A 2V1UA 4HX7A 3E6CC 2XV4S 5HOOA 4MTDA 2M87A 5JI6A 1R1UA 3EYIA 1HSJA 1IN4A 2V6CA 1R5GA 1SFEA 2P4WA 1P4XA 1X3UA 2GWRA 5HDKA 3SQNA 1RUNA 2PMHA 3KCCA 3ZMDA 2DLLA 3GFLA 4EM0B 2XAJA 3P7NA 1IRFA 4UV8A 1XB4A 1OR7A 2MH9A 4A5MA 4RB0A 2PJPA 2EFWA 2WC2A 4CO8A 1TQMA 2YPRA 1NHAA 4EJTA 3GWZA 4YFXF 4KICA 2HYFA 2M1BA 1VTNC 4IRHA 1U5TB 4PZJA 4LLLA 5LGNA 2B0LA 1LEBA 5CVJA 5BMZA 2O8XA 1ZLJA 4LFUA 3OOPA 5J8FA 1O7LA 4BNCA 2A6EF 3ECOA 5A2QZ 1ZG3A 2GA2A 5HDGA 5IT3A 2A6HF 2QVOA 2Z33A 1HW5A 2ISYA 3SHFA 3KP3A 1XSVA 1FYLA 5DEQA 1AWCA 1IW7F 3PFIA 5BQTA 2X4HA 1XGNA 1Z7UA 1ZRDA 1KYWA 1UHMA 5KK1A 4AIJA 2HKXA 5FO5A 1ZN2A 3DEUA 4BYYA 2NNNA 3LA3A 4WXDA 3LA2A 2CO5A 1Z91A 2KIFA 1O7FA 2HQRA 4WF2A 3HYIA 2CFXA 5D6EA 2G7UA 3NQOA 1V4RA 1G4DA 3JAMZ 2JPCA 3D0SA 4FHTA 2GIVA 1TBXA 2VC1A 2ESNA 1MKMA 1Q1HA 2XVCA 3I4PA 4NB5A 4HX8A 4YFNF 3I5UA 2KRFA 1O3QA 2F2EA 2CWEA 2P5LC 2FBIA 4Q4ZF 1W5TA 1ZREA 2DTRA 5JVTA 2HOEA 3HIFA 2P6TA 4HQMA 3V7SA 1ULYA 5FLXZ 5HLIA 3G73A 3WTYC 1T6SA 3DQVC 5DDGA 1D3YA 3KP7A 4G9YA 2DK5A 4ZYGA 4PDKA 2EB7A 4MGRA 4M72A 3GUDA 2EJRA 3BPVA 3BDDA 3L9FA 2ESHA 3DKWA 5HDNA 2LSOA 3HRUA 5LRSA 1WWXA 1IAWA 3C1DA 2XHKA 3U2RA 1EH6A 4N9HA 3N4MA 5E8GA 2MA3A 3IWZA 2QYOA 3MEXA 1J7KA 5A2QK 2OU2A 1XCBA 1HKSA 1FLIA 5K1YA 4L0YB 2AXLA 2JSCA 3IKVA 3FWEA 4YFKF 1XMAA 1QQIA 3QU3A 4AD9A 3ABTA 2FU4A 4B09A 2A3SA 3HSFA 2PLYA 3LWFA 2D1VA 2PEXA 1LEAA 1P4WA 3I58A 1FWZA 4EV0A 1FOKA 1KU7A 5E17F 3K2ZA 1K78B 1FC3A 1FBUA 4XSZF 3I53A 3JAMK 2RDPA 1Y0UA 3NEUA 3Q9SA 4XLNF 3I59B 2NNYA 1S8NA 4HF1A 3F3XA 3MFKA 3Q5FA 2V1DA 5K5QA 5HLHA 4G7ZF 3KZYA 5LHIA 3RKWA 3DXJF 2IA1A 3LA7A 4IJAA 1IXSB 3T1BA 4I09A 1E2XA 2QUFA 2VOPA 1DUXC 4ZH4F 3QPHA 1FBSA 4IPAA 1MJAA 4MQ9F 1KYZA 2PQ8A 2MLGA 3N97A 1LB2A 3WGGA 2BEOA 1R1TA 4LB6B 4KIFA 1GHCA 4QWQA 3F8BA 2VT2A 4KMUX 1JE8A 4TV7A 5AIPA 5E1XA 1QZZA 2YSRA 5ED4A 3ZMSA 5CVRA 1K79A 1P6RA 1RUOA 2EV5A 3WTUC 4H0EA 3ZN0A 4OIRF 2LF7A 5D5VB 4RGXA 1KU2A 4F7ZA 1QNTA 1S7OA 1GXQA 4HAMA 4MTEA 2IA0A 1BJAA 1FBQA 4RAYA 4IHTA 2QQ9A 4EM2A 4U0YA 1IN6A 1XSXA 3L09A 3TDUC 1QBJA 3COAC 1U78A 1XCVA 3F23A 5ERIA 2VONA 2DPDA 4CYDA 3SZPA 3V4GA 4I0AA 4BXUA 4M9XA 2VXZA 2STWA 4PCQA 2VE9A 4HYEA 2LNBA 4Q48A 3VFZA 3QU6A 2L02A 4KIGA 1F4KA 2BE5F 5LRRA 2K4JA 2D45A 3FF5A 1K6OA 3DPLC 3MZYA 2VOOA 3R4KA 3R61A 3F6VA 1WQ2A 3VOEA 3VODA 4IXAA 3WU0A 2DK8A 5ICFA 4ZYDA 4KNYA 1FY7A 4BHPA 3R6SA 2HDCA 2ACJA 4N0BA 1MJ9A 1D8KA 4KFCA 3KEOA 4HQEA 4LK0F 1W7PD 3HSRA 1UCRA 3RDIA 2DQRA 5BOXA 1UFMA 2D1HA 3F22A 2XKPA 3M1EA 3V7CA 3OV8A 3K1NA 3CUQC 2HGCA 3FMSA 1J0RA 2TDXA 3BZ6A 5FD6A 4OMZA 2CW0F 3HOSA 4KN7X 4QLCU 4A12A 4GXOA 1KQ8A 3LQRA 1PP7U 2A61A 2QQAA 3I71A 1IXRC 3K0LA 4JK1X 1XGOA 4EJOA 4L9NA 1WSUA 4I98B 2XROA 1TW2A 1FSHA 1PDNC 3WE2A 4KN4X 3FXUA 5D4RA 2MH2A 1TQPA 4ENJA 5CVUA 3K1PA 1W4MA 3QAHA 2RC4A 4GYGA 4MEXF 4NQWA 4L9VA 3DPTA 4WWCA 2H09A 3KZZA 3RI4A 2RVCA 2W84A 1OKRA 2UZKA 4AVPA 1G3SA 2P7VB 2V1XA 1R36A 3AAFA 4M6YA 3LQQA 3EQLF 4R8HA 2HTSA 4M9ZA 4EJUA 3DFGA 4LLGF 5F64A 1HKTA 4ENNA 5CVIA 4G6DA 5JHUA 5DD4A 2Z5UA 1YS6A 1YQAA 3SZTA 3EETA 1O3TA 3F8MA 1BIAA 1GXPA 1BI2A 2H6CA 1S29A 5E18F 4EGYA 2L3DA 1FP2A 4LMYA 3E97A 5LBQA 2CG4A 4ASNA 4P9FA 3RTRA 5K5OA 1SMTA 3J7AO 2K7LA 3H92A 5BPIA 1DPRA 4HF0A 1H0MA 4O6JA 3I0TA 4Z2YA 3HHHA 2HYGD 2JTVA 2DQLA 2WTEA 4KYWA 2FNPA 2HEOA 3IL2A 2YU3A 3ERED 3KLOA 2BYVE 5CVVA 5L3DA 3VEPA 4HF2A 5FGMA 4RGRA 4Y15A 2W57A 3BY6A 2EV0A 3O2PE 3KLNA 4A5NA 3WTSC 4A0YA 1I1SA 4YIFA 2Z99A 3KP6A 1ZLKA 1OMIA 2PMUA 2E1CA 4JBAA 1YTYA 2A69F 1FP1D 5J8CA 4IF4A 5K5RA 4WCGA 1YYVA 1PUEE 4I0BA 2ZFWA 3RPUA 3ZQ7A 4ESFA 4GO1A 1IN5A 4KMFA 1ZRCA 1QO0D 2Z3YA 4MHGA 5L3GA 4I2OA 1MGTA 2XAHA 2ZMEA 3JTGA 2K86A 3CO7C 1EV7A 3LFKA 3FMQA 2IVMA 1V3FA 4L5JA 4K2EA 2P5VA 3REOA 3RIRA 1R00A 1SFXA 4ZYEA 1U6GA 4OOIA 1R23A 3ZN1A 2RGVA 3K1MA 4I02A 5FFZA 4DNCA 1XGMA 3O6BB 3MAJA 4LJZF 5KVRA 1XN7A 4CXFA 2MLKA 3F8CA 2FMLA 1TW3A 4UVBA 5DCMB 3BWGA 1HSTA 3ML6A 1ZH5A 3JTHA 3NRVA 2HQNA 5E8IA 1FNNA 3R0AA 5L3BA 3KFWX 2KKOA 3M7GA 4AWXB 3T8RA 3ZPLA 4L9TA 2ZNYA 5IT9K 1B59A 3L00A 1SD7A 4EM1A 2HS5A 2NS0A 1TTYA 1T98A 1P92A 1ODDA 1BI1A 3F21A 4MEYF 4UV9A 4U88A 3V8KA 2OQGA 2Y75A 2BBYA 1OPCA 3TKYA 3FXQA 1FX7A 2R3SA 3HUGA 3EUHA 2GZWA 2BV6A 2MBFA 4A0ZA 2GXGA 1SAXA 4MQVA 3V7RA 1YG2A 3CO6C 3RPQA 4BH9A 3TO7A 3GFJA 4P9UA 1ON2A 4A2UA 1ONVA 4UUVA 4NHJA 4OIPF 1U2WA 3GZ5A 5D8LB 4HOBA 1TQIA 3BP8A 5DCMA 4OMYA 5ICGA 4FX0A 2EFNA 3V8JA 2CYYA 4HA8A 3BOQA
chains in the Genus database with same CATH superfamily
2KMUA 2KZVA 4IKFA 2JVGA 3ZOBA 4I7HA 2DPUA 3BJOA 3E5XA 2DFFA 2WTFA 3WTTC 3T0YA 3G6XA 2IS6A 4GKJH 1OCOH 1ZGJA 5EZGA 1HW2A 1WZ2A 1B1BA 4XM3A 4QSHA 4HDUA 2H27A 4FBUA 1RKTA 1E0EA 2M3AA 2YR2A 4M73A 3AYHB 1SFOJ 4BUPA 3G3ZA 4D0PA 2Y9ZA 4JV2A 4A3EG 2A6TA 3HPHA 1LDDA 1SCUB 2RF4A 1WI3A 3KHRA 2RGRA 2VUMJ 3WG9A 1KGSA 2VC0A 3K7AJ 2WV0A 3TL4X 5LL6b 4M9SA 3GF2A 3LP8A 2NUAB 1XDSA 1RNLA 2VE8A 2R7OA 1VQ6I 2XDVA 5HV6A 4LFBH 5EGOA 5C4XJ 4PDBA 2VQDA 1POGA 1XMOH 1D1CA 4EBEA 2NAZA 1USSA 3E6MA 3EUKL 1ZG1A 4X6AJ 3L4JA 3E3VA 2LREA 4XRSA 1N48A 1S3JA 2Y31A 3MWDA 1QVUA 2KZGA 5J1UA 5KFZA 4NDLA 3OUZA 2EFQA 2F5VA 3BQZA 4GGGA 4YEJA 1ZYRF 2E7WA 5FLMJ 4FS2A 2IEKA 1YRNB 2EFOA 2O03A 1AA7A 3CTAA 2DI3A 2UUZA 4XOTA 5F9NA 1D8JA 2EZHA 3DU5A 4CICA 3RGZA 3ECHA 5JR3A 1J75A 1HW1A 3LSTA 3U9TA 2GA1A 2R84A 3GIIA 1UNNC 4YAKB 4DL7A 1KA8A 1H9GA 3E5UA 1RR7A 3R5FA 1E3OC 2F4IA 1WH2A 5KFAA 1E3PA 2YX4A 4PSWA 4IHSA 4C3HJ 3BQYA 1R9TJ 4C2TA 4XRMA 1IXCA 3GVAA 3GXOA 3I9V2 3S2HJ 3OYNA 3LSJA 3BA8A 1BOAA 1T0FA 2R7QA 1JIHA 1OYYA 1BN5A 1ETWA 5JVDF 4MO7A 3P9KA 5ILVA 2W6OA 2LTPA 3D1NI 3G6YA 3ZMVA 5B66C 3RYPA 1OISA 1HBXG 1V9PA 3CF2A 1HNZH 2JA8G 1TWAA 2V58A 1DPUA 1QRYA 5C44J 2QBYA 2MC3A 2E5NA 3HRTA 3O3KA 4R79A 3ISPA 1U5TC 2P8TA 3GEZA 4A69C 5KFUA 5KG3A 3FBIB 4QIWA 1JT6A 5GP9A 2UVVA 3PR4A 3G1OA 1C0WA 1VQOI 3SFIA 3HKZE 5C5JA 3AFHA 3AG3H 4ESJA 4P55A 4UCSA 2UWMA 4XKCA 3CZ6A 2M34A 3WHBA 1Z3XA 2FPIB 2R82A 3OUUA 4J9LA 1W5CC 2JVHA 1XTAA 4BY7J 1U8RA 4B8XA 4E7LA 1T39A 2IPQX 3IRRA 3RBDA 5IYDJ 2ZKZA 4OAYA 4M7EA 1KU9A 1KU3A 4YRVA 4W1UA 3BTCA 3J7YJ 3WHCA 5HNFA 1MD0A 1ZHSA 2HOAA 3JREA 1IRZA 3HOWG 3R60A 4A3DG 1XD7A 4P5OA 5EZHA 2OWOA 3L7WA 2DA5A 1YJ9I 2CZGA 1A6QA 1RETA 4ENMA 4Q44A 4G94A 3CQZJ 3E6DA 2LKPA 1IN8A 2M5WA 1RK5A 2M8EA 2DA3A 3V8LA 3DF8A 3D5LA 3CC4I 1TWCA 2HVSA 2O9LA 3S1NJ 1GGOA 2V4RA 1V51A 3A01A 2OLSA 2NU8B 1WH7A 4KT5C 5KG6A 1MNMC 1CE8A 2V59A 1T38A 1SFKA 2EINH 2AS5F 1EH8A 2OZUA 4RS8A 1JKRC 1LDKB 2OD5A 4RLQA 4ED1A 2FK2A 4PJJA 4XSXF 3SE7A 1YRNA 3LAPA 3JSOA 2P5KA 3PIOF 4BQNA 2GBYA 3BR2A 2D2WA 3K4LA 4AIHA 3DV8A 3M07A 3QWLA 4XK4A 2PI0A 1G2HA 2JA5A 4IHYA 4A6DA 4ESBA 1JXLA 1UHWA 2L4AA 2X51A 2K9NA 2DODA 1WJ5A 2G0EA 4RB3C 5IYZF 4ZZLA 3CMEI 3MCZA 3QP5A 5IYBG 1IZ1A 1DDNA 2QEXI 2Q0OA 1W96A 2ASJA 2F5FA 2OUMA 1R49A 3OS1A 5EF6A 4I50F 3GTLJ 2QSHX 1DV1A 3HTUA 2O0YA 2ZJ2A 4R1HA 4NQWB 1SD5A 1J5YA 2L01A 3RQ4A 2Q1ZB 4NXNH 1BIBA 2KIQA 5FLMG 3RKQA 4I76A 2I5UA 1HC8A 2K9LA 4QWDA 3U9GA 2QENA 2VI6A 5DCFA 3RZOJ 2WWYA 2QZ8A 4BQAA 3BQ1A 3IH2A 4O3MA 3WGHA 2W70A 2ASLA 3D5SC 2IXSA 1OYWA 4QWBA 2XPWA 2DA1A 2L2OA 2QCOA 5D8KB 4C5BA 2KFDA 4ZYHA 3GMEA 2Y0MA 3CMMA 3L1PA 3ZP5A 3K6GA 4TQRA 5C3EG 2C22A 5TRDA 4LF4H 2VIXA 3FDYA 3KP5A 3PW2A 2KIMA 1LJ9A 3OS0A 1IV6A 5DG8A 1UHSA 1VQMI 1BI0A 3ZQGA 1V5EA 1LE8B 1K83J 4DR2H 2ELJA 1F5TA 3KP4A 1YW9A 4A3MJ 2G7HA 3ZQHA 5IP6A 4XRFA 1JXSA 1P2FA 3CCRI 2JZYA 3H9JA 4O3NA 3J80W 3FXLA 2Y0SA 2E19A 1YO5C 1D1BA 4G3IA 2E1MB 4M6VA 4ZQIA 5HLGA 1JI8A 1YX3A 1Y8RB 4X62H 1JDEA 4BEHA 3PW5A 3JSPA 3KPHA 2R7VA 2L9VA 3GTQA 3K9TA 2F5DA 2R7FA 1TT0A 3ZGKA 1Y1VA 5D1OB 1J2XA 2FQ4A 3RKYA 3G6EI 4KA4A 4K0KH 2WY7Q 2OQRA 4XKWA 1WSCA 1MDMA 2FQ3A 2K9SA 5F6FA 3WE3A 2Y69H 3W2VA 3OL4A 1T36A 2XPUA 4XLPF 3W2AA 1ZAOA 4HR7A 4B1RA 1O3RA 3M9MB 1STZA 2NVUB 5IP9J 3BJYA 2CQYA 2R5YA 1ZR4A 3ZMUA 1W7PA 1HF0A 4UNOA 2YZGA 3PM1A 1T56A 1K6YA 1YS7A 1O3SA 1B8IB 4LD5A 5IYDG 2CQKA 2C2EA 4GKKH 2DJIA 3EDPA 4XQFA 1Y0NA 3I64A 2XCPA 4JQFA 5HVQC 2H6BA 4A0XA 1MBKA 1T33A 1QZYA 1MBGA 3CLOA 5K7ZA 5F9LA 1OCCH 3QYFA 4QTRA 4F4WA 1BBYA 4CCMA 3VYTB 4BHCA 2E2IJ 2PN6A 4Q8EA 1U9NA 3FBNB 2BXYA 2ZDQA 3KALA 2DU9A 1J59A 5D5WB 3P9CA 4Y13A 1NK2P 2EA2A 1VAJA 3CCMI 2BY3A 3IAS2 4OIOF 2OJED 1OCZH 1JJ6C 3LNQA 2KJCA 3E5QA 3MWMA 2X6WA 1HCRA 1EA3A 1I6XA 2ISZA 3LSIA 3X2QH 2XGDA 2F4MB 2XUBA 5DM7F 3CCEI 2NVTJ 5KG5A 5EWGA 1I6UA 4CZZA 4IZOA 1P4AA 4ME6A 1AU7A 3GFMA 4JP0A 3PO2G 1QVTA 2HZDA 1FZPB 3NWSA 1MMAA 2ZDHA 1QHHD 4HDVA 3HKZN 4YG2F 1VKZA 1S03G 2FOKA 4LOCA 3RTXA 1IBLH 2FF4A 4ITVA 4L0ZB 4DL3A 1FYMA 3RB3A 2VT3A 3A4CA 2RNJA 3R0JA 3WTZA 1MH3A 2V79A 1HKQA 4AVZA 3WTWC 2AO9A 3IP4B 4RM2A 3S2WA 4HYKA 2VBZA 1FJLA 4G6TB 3FXJA 2Q2TA 2XF5A 5BS6A 4X66H 4DV4H 4JYKA 2XSDC 3OYDA 3I56I 2HOTA 4DUYH 3BZCA 2YU9A 3P9IA 1ORKA 3GW2A 1G6NA 1GSOA 1OJLA 2RKHA 2DA2A 3RSNA 2ID6A 2PJRB 4E7IA 3M4IA 2LDUA 2XAGA 4KHPH 4E7JA 2HXIA 3GLXA 1T08B 1WJDA 4CUGA 3H35A 1WI9A 1VFCA 3W2WA 2LBFA 1A9XA 3LSKA 1CGPA 1KBLA 3RIZA 2Z9OA 2W9BA 3F9KA 4RGSA 4R7RA 4LSXA 3MKYB 5D6FA 5CLSA 2P6SA 3FM3A 4KT6A 4G8XA 2HJWA 4LH6A 4O4IF 1WJAA 5KG2A 2QQ8A 1FPQA 1EH7A 3QRFF 3CDHA 3J80K 2A07F 2DO7A 4HX4A 1T3NA 2VUMA 1JGSA 2I87A 5KFKA 3KYLA 3JRXA 2G9WA 4AYBA 1VQLI 3A1YA 1S5LC 2FLNA 1BI3A 2ZMEB 3KYCB 4A3KG 3KE2A 2V9VA 5JLWA 1B8IA 4IRIA 1JKOC 3GYHX 5KG0A 2UUAH 2LKSA 3LSGA 3JSLA 1TP4A 3MZ8A 3ELKA 5CJ9A 4D1QA 3OYMA 3GTJJ 4A3GJ 2OTJI 3N40P 1CF7A 2W7PA 2PFBA 3JRGA 5DGAA 2JA6J 3L4KA 3M8EA 5B3SH 1SYXB 4P96A 2IP2A 1W93A 1Y14B 3WODF 2R92J 2E2JJ 4MA5A 3C3WA 4JI8H 1XMQH 2VQHA 4RNNA 4BU2A 2FRHA 1A04A 4HW0A 4YHHH 3RAXA 3Q3SA 5CYVA 3OYEA 1TNSA 2GIZA 5IT9Z 3T1HH 1V54H 5TJJA 1Z6RA 4XL9A 4UCRA 3HOXG 4OIQF 3TO9A 3K69A 4YIRX 3LAJA 3IHUA 4ENKA 1SC7A 1APLC 4UFZA 4ED6A 3G1MA 1S0NA 5D1PA 2L4MA 4ZHQF 3PJRA 1YX5A 2OAZA 5KFQA 3GTKJ 1G3WA 5EDWA 1I3QJ 3SYTA 3ROUA 2QM3A 4W97A 4HBLA 1R9TA 3B6AA 4YJ3F 1HOMA 2DYSH 3Q2OA 2MG4A 3DWLE 1A0IA 2DBBA 2LVSA 1Z1DA 2K02A 1BC8C 2UVWA 2ZC2A 4J19A 1XSDA 4UVCA 2K85A 5E79C 1TL8A 2P7CB 1Z9CA 2Z16A 4Y33A 5M3MJ 3IRQA 2P0WA 3ULQB 2I8CA 4HSRA 4CCOA 5AONA 3RF2A 3F72A 2DT5A 4E70A 3M8FA 5A2QW 2O61A 2IRFG 1VI0A 1X4PA 4UY8I 4BY1J 2ZJQF 2XAUA 2OBPA 1D1AA 1TWCJ 3LMMA 4XBFA 3GTGJ 1K1SA 1ZKGA 1KC7A 4X65H 1KJJA 3BLYA 4CSWA 1LNWA 1I5ZA 4PJMA 3BABA 4E7ZA 4O2BF 3LSMA 4V2FA 5JLXA 3DBRB 1D5VA 5DQGA 5H6QA 3BA9A 4YR2A 2Q2EB 3FX3A 3MMYB 3JRFA 3GV7B 3MJFA 2V6EA 5LXTF 4RZQA 5FB2A 3SEZA 3N05A 2H1KA 1C30A 4O3PA 3GFIA 4F93B 5JFRA 3VYSB 2J5OA 4XYMB 3K2AA 4KIBA 4MV7A 2DDAA 5LEJA 2WYOA 4KUMA 3CQZA 5FPOA 5GPCA 2W00A 5H6RA 2XKOA 2BOLA 3MKWB 3K70D 4WXCA 4B47A 3GIPA 3QZ8A 1FT9A 1EYZA 2R93G 3BROA 2WAFA 2J6UA 3HUGB 5LHGA 1X1PA 2EIMH 1R58A 2NVQJ 2M2EA 3G2BA 2PMZA 4PGGA 1HQCA 2R7LA 2HVQA 1ZTRA 4IO9F 3MR3A 3N41B 4A3BJ 3MR2A 2HU9A 3FM5A 5HS8A 2X0LA 2ZJRF 1YFHA 2EFPA 4A6EA 4RAZA 3WO0A 4DZJA 4DL5A 2A5YB 4B4CA 1ZQ3P 2RN7A 3CMAI 1U5TA 2DT6A 5KFWA 2W85A 4EJVA 1ON1A 2DTZA 4LB5A 2VKVA 3ZMTA 4B43A 9ANTA 2PBIA 3K4CA 4HRIA 5AIQA 1B6SA 2ELKA 5KKNB 2VBYA 3SI8A 4A2AA 1LFBA 4IQJA 2EV6A 2KT0A 2ADUA 3PVXA 4YQWA 4DV5H 2VBWA 1Z21A 2W24A 4RGUA 2FK3A 4ZTFA 3RKXA 5E1WA 4ZYAA 2CH0A 1IG7A 3C2HA 2IA2A 1VF9A 3CUQB 2KJBA 3HHGA 3GTLA 3BJAA 3T5XA 4CC5A 1UC9A 2DW4A 2R92G 4M6XA 2C35B 2MD5A 2UXNA 2J5PA 4D7NA 2NYXA 2LF8A 4U0WA 4CZCA 1F1ZA 2FMYA 4CCNA 2FP4B 4PGHA 5DUKA 2VA3A 1RK6A 1USTA 3RYRA 3TOBA 4BBRG 2VA2A 5B1AH 4ZJZA 4EEFG 5EG0A 3MZHA 3HOZG 2DMQA 5F1RA 1H89C 2E1NA 5D4SA 1N56A 1KJIA 2H94A 3GZ6A 2Q2UA 3KETA 2W71A 5EOYA 3SXYA 4J9KA 3S15J 2CQNA 4ECRA 4LGWA 5FLXW 2YUSA 5F04A 1MBHA 2HDDA 2R8HA 4YY3H 4D7MA 1TLHB 1X4OA 2XRNA 3FKJA 4XOPA 2L0KA 4Y17A 3L2CA 2UVRA 5LD2C 1R7JA 2JA7G 4S05A 3OIPA 3IH4A 5EGOB 2Q2EA 2K27A 2VPLA 3OSGA 3S3OA 4XZ3B 5FFXA 3OL3A 1X1BA 2B63G 1ULZA 2FJZA 1AKHA 2KSWA 4HZFA 1J9IA 2ZO4A 5D5UB 1EUDB 2JWTA 4DV2H 1IRGA 5HS9A 1R1VA 1RI7A 4WXHA 5ILUA 4J9NA 2FA5A 5FD5A 2F48A 2FNAA 4HNVA 4TQSA 3VB2A 1O4XA 4O4HF 2R5ZA 3FIWA 5K7HA 4IRGA 1JKJB 2M45A 2R7ZG 1SMYF 2NRAC 3TO6A 3T8TA 4DL4A 4NXMH 3CCUI 3JW4A 2O7OA 2JA2A 5L3FA 5LEKA 3V6HA 1ZETA 2IW5A 2ZCWA 4A3CJ 2F6CA 1L3LA 1E4GT 2Z1DA 2J6TA 1I27A 1L0OC 2KIUA 5KFFA 1VQ8I 3T5JA 3RJPA 2VJ5A 4UXNA 3FISA 1B9MA 1T2KA 1DU0A 4L18B 4LLNA 2R86A 4Q0YA 3KEQA 4ED7A 1A35A 4UCTA 1QGPA 2HTJA 4HEA2 4LFCH 2BQ3A 5ICEA 5KT7A 4IR1A 3QOPA 3TIGA 1HXDA 4DLKA 2W8LA 2E2IA 5CA1F 4BHBA 5DQHA 2BW3B 3J81Z 4X0GA 3CCQI 4MA0A 3EPZA 6PAXA 1SD4A 2R7TA 2QGUA 1IF1A 4U7BA 3GCMA 2B7EA 1XMKA 1F36A 1LFUP 1KQ0A 5B5EC 1BA5A 1W5SA 4LF8H 4EMSA 3CUQA 4BKXA 4A3DJ 2RREA 2QBYB 3C2GA 4ETSA 2XCAA 4G7OF 4QWAA 2QWWA 2STTA 3DBLB 2O8KA 3ERMA 5JQWA 4II2A 3AL0B 3ZR8X 2DOFA 3GO5A 4F91B 4I99C 1S97A 1Y8QB 1IBKH 3DU6A 4EJWA 1VQ9I 2FE3A 4UVAA 3J81W 2DMPA 2R87A 3OIOA 4KJZA 3HOVG 3B02A 4HV5A 3HSEA 4FX4A 1ZRFA 1B6AA 3OMYA 2BGCA 3QP6A 3ZMZA 2FMAA 3BG3A 2P0AA 2PG4A 4YIIA 1AOYA 2WB1E 4HLYA 2EK5A 2QSGX 5L1LA 3DP7A 3FXRA 4AIKA 3F8FA 3MR6A 1XGSA 1BC7C 1DU6A 1G3TA 4S0HB 1YITI 2JT1A 2OA4A 4JOMA 5E1ZB 4ANJA 2X1DA 3ONQA 2QKMB 3ABUA 3CMYA 3QPTA 4M3BA 4FE7A 1Z6TA 2PN1A 2TRTA 2AXTC 3BPXA 3FZVA 1ZARA 4LK1F 4I01A 1B4AA 1GVJA 2DFIA 5EEAA 1BJTA 2K4BA 5DD8A 3BC8A 5IYBJ 2N8GA 2IJLA 5JVGF 4GDFA 1K4SA 4BAYA 4QIWE 2YCHA 4A93G 3A01B 5IPAA 3EYYA 3CCVI 2NOJB 2E7XA 3GLLA 5M5XJ 2KDOA 5KNLA 1S7AA 3TDZC 4JV0A 3L2WA 1Z05A 5I47A 3KP2A 2R0QC 2CSOA 4IEJA 5FLXK 2KP6A 3F8NA 2BVMA 1MJBA 3E5NA 1RIOH 1IGNA 2HQAA 1DIKA 4Q8FA 4LG0B 1HDPA 1YW7A 1F9NA 2V1NA 2BHYA 4YJ2F 3GX4X 3QYEA 1IN7A 5HS7A 2BR0A 3QQAA 2W25A 4ON0A 5KG4A 4BE2A 2L9SA 3L2QA 4F55A 2RNGA 1ERDA 3OIQA 4C30A 4UHTA 5C3EJ 5B1BH 1R5HA 2W6ZA 2FXAA 1ETXA 3WTVC 3ETHA 5TISC 3N6XA 3GTJA 2VBXA 1ZGAA 4QPOA 1FTTA 1IV8A 2JA6A 5KFEA 4WBNF 5F0CA 1B72A 5HBRB 4EBDA 2R92A 1ZHFA 3DEWA 2RV8A 1OCTC 2F5CA 3CP2A 2YX7A 5KFVA 2BW3A 2EWNA 2FBKA 3BTJA 2BXZA 5GTIC 4QW9A 5LHHA 5FPRA 5CKTA 1R4NB 3HOTA 4QW8A 1QHGA 1B9NA 3BG9A 1P7JA 5H2FC 2ELHA 2EIKH 1K78A 4BBSG 3H3ZA 4IVNA 3TGNA 4OINF 1REPC 1H88C 5LGTA 1ZR2A 1GDTA 2JEIA 3JRHA 3S1RJ 2XGQA 4MNUA 4GYIA 3WTXC 3RGXA 4BJTA 3IKTA 4RZRA 1SFOA 4A3CG 5DV5A 3GTMJ 1Y1WG 4EVIA 3RB4A 4M74A 3GTKA 1SVLA 1R71A 4EGZA 1I3QA 1TWGJ 2E71A 2IT0A 1XDUA 1K4TA 3I59A 5EDNA 3SEQA 3WGIA 3H3UA 4Q5SF 2QSFX 2DAOA 2RQPA 3H5NA 3PFYA 2IBKA 4C2UA 1RZ4A 4XNFA 2R7DA 2XGPA 2VKEA 2GAUA 2JA7A 3ZQIA 1GLVA 4YP3A 3IN5A 2XSJC 1OCPA 4AUXA 4Q47A 1JHHA 4L9JA 2L9RA 2XIGA 1H9TA 2YS7A 1I50J 2MSYA 1BM9A 1LVAA 1K7AA 1UB9A 3J7AK 5DUIA 4FT8A 4BEHB 1JHFA 1G3YA 3K70C 3VPBA 2NVXJ 1HLVA 2QQBA 3I54A 2V4JC 2IAIA 1I1GA 2HNHA 2JRTA 4B3MH 2QF7A 3F6OA 2ZXHA 1X1AA 5E20A 4JI5H 1MDMB 4E7KA 2HWVA 4Q45A 4EATA 3J81K 1KJQA 1Z7LA 2O6GE 3VPDA 5JVLA 3GTGA 3C18A 2HPIA 2C6YA 1VZ0A 1Z77A 2R7ZA 5DYMA 2FBHA 5KFMA 3K4MA 3PSIA 2WV1A 2X85A 2R5YB 2FK1A 1TNTA 1W7PB 5E3NA 5H20A 2DXIA 2GPSA 2ZBKA 2F5EA 1VBGA 4G7HF 1I6HJ 4PJNA 4EQQA 4FS1A 1A6IA 4LF9H 1U3EM 2Y30A 3VPCA 4DQ2A 4U7DA 2K9QA 3U1DA 1DP7P 4M71A 4LG0A 1LQ1A 2CUJA 3PO2J 1MMSA 1DGWY 2YZMA 3EUAA 3TOAA 5ICCA 4GCVA 2HXOA 5GAGJ 1LDJA 3CD6I 3V4SA 4ZTJA 2XD4A 5LLQA 3E6BA 3HRSA 4E6KG 3HTSB 2ZXIA 4RUAA 3RAQA 2HFHA 4RM3A 2OCCH 1SFUA 4S04A 2GM4A 3IC7A 4LFAH 3LFUA 4MV6A 2GPWA 4L5IA 2VODA 1YJWI 1R22A 4HPQA 1YLFA 4YBZB 2AQ4A 1MZBA 4JI4H 2M4GA 4XLCA 4BXFA 3ASOH 3NWTA 5L3EA 1E4EA 2Q8KA 3HOYG 2ZNZA 2LKXA 3S3NA 4WX9A 3OYFA 3A0BC 1TT5B 1ACIA 2KLOA 5EEGA 4A3IG 5GAEJ 3CUOA 2DN0A 3J80Z 1KONA 2ETHA 3AG2H 5D5XB 3HKZA 2UXCH 3VYUB 4B3XA 2QLZA 1WJEA 3OR2C 4RB1A 5J1RA 4WK8F 2EA4A 1IUYA 3KAJA 1PUFA 2XASA 2XAQA 3B73A 4DYCA 1EUCB 4FE4A 3LL7A 4KDPA 2DOAA 1WKMA 3V6JA 3BTIA 2UVUA 3CCJI 2QA4I 1QPMA 1E17A 2YS9A 3FKIJ 4ZC3A 1XNQH 3FMRA 3EUHC 3PQJA 4G6QA 4DR7H 2WB1N 3HRMA 3AG1H 2IS4A 3SFZA 4OAZA 1I7LA 5LFAA 1SD6A 3TQNA 4IL6C 2GXBA 2NOGA 2FLPA 3HB9A 2E5ZA 1BL0A 2HZTA 4UCUA 2XGXA 3IH3A 5TGTA 3GV8B 4A3KJ 4RAFA 1E3HA 3M4OJ 3BCAA 3QPSA 3M9AA 5KFIA 1X3ZB 3Q9VA 1ETOA 3C7JA 4OU0A 2Y48A 1OYIA 4N9IA 4QIWN 2DPIA 2LBFB 4C2MJ 2L54A 2ZSHB 2A05A 2LY2A 4HV6A 2GXAA 2UXXA 2H8WA 3QODA 1RRJA 2COMA 2CGPA 2CMPA 2L5QA 4CYCA 3C0FB 2W9BB 1YJNI 4U0VA 2KPMA 3A0HC 2M30A 2GQQA 3FHZA 1KQ9A 3H5AA 3BJ6A 5FLVA 4XX0B 3IWFA 2HKOA 5JH7F 1M6VA 5KFXA 4H4KC 4JV1A 3HOXJ 1PP8F 2A68F 4O3QA 5KT2A 3H0GG 4ZZDA 4YELA 3W6JB 5LGUA 2JUCA 3I4NJ 1GSHA 4DYRA 3EPGA 1VNDA 2DA4A 4HLXA 2FEZA 4DGWB 4BXXG 2VN2A 4CCKA 5EEHA 1PJRA 1FMWA 1Y39A 3OSFA 1CF7B 4BGDA 5J6XA 3BTLA 4RB2C 2R7KA 3PQKA 1RESA 4CGZA 2I80A 2W6MA 3OHAA 1ZG5A 5M5YJ 3BG6A 2ZXWH 1YW8A 3PW0A 1O57A 2IGOA 2XAFA 4CA0A 1A31A 2FPGB 1FSEA 4DV6H 3MD2A 1WFXA 1W0UA 1QPIA 1ZGWA 3CJNA 2XGEA 2FSWA 4ABZA 4CDGA 3LSPA 1UG2A 1TZLA 4CHUA 5L3CA 3MQ0A 2V9KA 2AQFA 2JUGA 1YIOA 1X1DA 1M1EB 1Y1WA 3PO3G 1M0WA 2UV1A 3RV3A 1LKXA 2WY8Q 2KDZA 1JUPA 2XB5A 4O5VA 2HGSA 2VQGA 4AYBE 2E5LH 2CU7A 3WU1B 1S6LA 1FYKA 4O3SA 5ILSA 2DFEA 1CQIB 3W6KB 2HR3A 3D5RC 3VSLA 2XF7A 2VPSA 4DUZH 2JPBA 3DKXA 2O3FA 1NTCA 3H9GA 4IOAF 1WRJA 2ZXJA 3N43B 1OCRH 2LLKA 2W7NA 4TUYF 3C2BA 4O4LF 2F4VH 5BPDA 4FCYA 2OZ6A 1DP3A 2V1UA 3KTMA 3QOEA 4QWEA 1VBHA 4HX7A 4J9MA 3E6CC 3HM5A 1XNRH 3FMAA 2HI3A 2PX9A 2DLNA 3PW4A 2XV4S 3PUFA 5HOOA 4RLFA 1WJCA 2C2RA 4DZPA 4ZI7F 5EWEA 5HLTA 3PSFA 2UU9H 3NAUA 2M87A 4MTDA 3GTOJ 4O2AF 3NARA 5CQGA 5L1KA 1W1WE 3GLKA 5JI6A 1R1UA 3EYIA 1HSJA 1IN4A 2D5VA 1FTZA 1QA6A 1SAUA 2R93J 3QYBA 3CCLI 2BVLA 1IOVA 3PL8A 3LMLA 2V9WA 1UAAA 2V6CA 1R5GA 1SFEA 2P4WA 1FEXA 3GIKA 1P4XA 1AUXA 2M0MA 4RDUA 5DG7A 3I12A 4ZDPA 3TP3A 1X3UA 2GWRA 4E7SA 1T0FC 3KXYT 4XONA 5HDKA 1Q1VA 3SQNA 2K3PA 1RUNA 2PMHA 3KCCA 3ZMDA 2DA6A 2DLLA 2KL4A 3GFLA 1BW5A 3FKIG 1XPXA 4E7HA 4Q43A 3GIJA 4EM0B 2XAJA 2DYRH 2JRMA 3DPUA 3P7NA 1IRFA 5DG9A 2DA7A 1VQPI 4UV8A 3DTIA 3OYLA 4J9QA 4UCVA 2Y0SN 1XS9A 2V5AA 1S10A 3Q8PB 1XB4A 1OR7A 2MH9A 4A5MA 4XR6A 4FU0A 4RB0A 2PJPA 3TQ1A 2EFWA 2HDWA 4EGQA 3AL0C 1X3WB 2L7KA 2LG4A 1WCMG 2COBA 4NC7A 2WC2A 3JRIA 2JMWA 4ECUA 1C3OA 4CO8A 4PK4A 1TQMA 2YPRA 1NHAA 4EJTA 2ZB9A 3GWZA 4YFXF 4KICA 4EGJA 2HYFA 5LOVF 2M1BA 1VTNC 4IRHA 1U5TB 1DGRM 4DIQA 5IY5H 4ECQA 1TWFJ 4J9PA 4PZJA 4LLLA 4BBRJ 5LGNA 2M05A 1FMVA 2B0LA 1FOWA 3Q0VA 5IP7J 3E7LA 3DLLF 3M1CA 4B3AA 1GSAA 5CQEA 1LEBA 3HOZJ 5CVJA 5F08A 1DGSA 5BMZA 1M7JA 2O8XA 3H36A 1ZLJA 4B48A 4JX4A 4LFUA 4B3TH 2W82A 3I4NG 3OOPA 5J8FA 1O7LA 4BNCA 2A6EF 3ECOA 2PBZA 2M8GX 1V5FA 3A2KA 3OY9A 5K2MA 5A2QZ 3CVZA 1ZG3A 5DLFA 1LFPA 2GA2A 3TW7A 5HDGA 5IT3A 4DR6H 1JDBB 2A6HF 2QVOA 1XG1A 3LWBA 2Z33A 1HW5A 2ISYA 2JA7J 3SHFA 1LUJB 3KP3A 1XSVA 3WU2C 5GTHC 4LF7H 2I8DA 1VQ5I 1FYLA 3K10A 5DEQA 3I55I 1AWCA 1IW7F 3PFIA 1MSEC 2WAQE 5BQTA 3OTOH 2X4HA 5KFSA 1XGNA 2B63J 1Z7UA 3ZQFA 5EG0B 1ZRDA 1XX5A 1KYWA 1UHMA 1U9OA 3K4BA 3RPUD 3G4SI 4DR5H 4LF6H 5KK1A 4AIJA 3GTMA 5KT4A 2HKXA 2VOBA 5KAFC 3MKZA 1YOVB 4J0MA 3IG0A 5FO5A 1ZN2A 5CPRB 2E36A 1TWGA 3DEUA 4BYYA 4HSTA 2XCLA 3HXLA 5C4JJ 2NNNA 4ZOLF 4DOZA 3LA3A 4WXDA 2FUG2 4LSAA 3LA2A 2R7ZJ 2CO5A 1Z91A 2KIFA 1O7FA 2HQRA 4WF2A 3HYIA 4PJ0C 5M3FJ 2CFXA 3ETJA 4OWRB 5D6EA 3JRBA 1RJRA 1I50A 1RYSA 2G7UA 5LP6F 4UB8C 3NQOA 1V4RA 2A5WA 3PNTA 2VLAA 3ZXSA 3I4MG 3HZJA 3HPGA 2NVXA 1MSFC 1G4DA 1AKHB 4P1WA 3JAMZ 5KT3A 4MV9A 2JPCA 3D0SA 3IUOA 4FHTA 3TBIA 4D5FA 1PX2A 2AGPA 3AKZA 1IUFA 2GIVA 1TBXA 2VC1A 4A2BA 2ESNA 3PNVA 3CJRB 3N44B 2CV2A 5KFNA 1RC9A 2R5ZB 3UNGC 2CQXA 1MKMA 3HBLA 3OS2A 3VWBA 5KG1A 2OV7A 4F4YA 1Q1HA 2HQ5A 2XVCA 3I4PA 2IS2A 3F0CA 2XRLA 3HGGA 4CH7A 4LF5H 4NB5A 2YL2A 4HX8A 4YFNF 3I5UA 2KRFA 1S72I 2NS8A 3JAMW 1OLTA 2NXNB 4AYBN 3KHLA 5KFLA 4UUSA 1O3QA 2K5CA 2F2EA 2MD0A 2CWEA 2P5LC 3HOVJ 3T5KA 2FBIA 4Q4ZF 1W5TA 1ZREA 2DTRA 5JVTA 3V4ZA 3VYRB 3WG7H 2HOEA 3HIFA 5FKLA 2XPVA 2O5RA 2P6TA 4HQMA 3V7SA 2FB9A 2ME6A 2W7OA 1N77A 1ENHA 1ULYA 3VMMA 1U0JA 5FLXZ 3Q1KA 2VQEH 2MCTA 5HLIA 3G73A 5BPFA 4BL0B 3RUPA 3WTYC 1T6SA 3DQVC 1LPQA 4ECWA 3RCOA 5DDGA 1D3YA 2ZM6H 1V5GA 3KP7A 4G9YA 2DK5A 3BR3A 4ZYGA 4PDKA 2WA0A 4A93J 2YRXA 5IP7G 4DJAA 2EB7A 5DTDA 4MGRA 4C3JJ 3JRDA 4M72A 3L2VA 4CC6A 3HOUG 3GUDA 4FASD 2EJRA 4ECSA 5J4VA 3BPVA 2LOOA 3ZQCA 3BDDA 4JYAH 3L9FA 2ESHA 2L7FP 3DKWA 5EWFA 1CQTA 5HDNA 3SJMA 2LSOA 3FKIA 3HRUA 3K3VA 3BR6A 3Q8RB 1SVMA 5LRSA 2DPJA 1WWXA 2MABA 5HODA 1IAWA 3C1DA 4JUZA 2XHKA 4NNJA 3U2RA 4FETA 1EH6A 4N9HA 3N4MA 5E8GA 1P9QC 1MIJA 2MA3A 2WADA 4II3A 5J4YA 4L5EA 3N42B 1PVEA 3IWZA 3CDLA 4WD3A 2QYOA 3MEXA 2R7NA 1J7KA 4D5CA 1RR8C 5A2QK 2EZKA 2OU2A 2LC2A 3CP8A 2XC9A 4C2MA 1XCBA 1HKSA 2HVRA 1FLIA 3ZRGA 5K1YA 1RKWA 1TA8A 5KT6A 1Z3YA 5LMNH 4L0YB 2AXLA 2NVYJ 4KISA 5K7FA 2JSCA 3IKVA 2LY1A 4BBSJ 4NUBA 4C9YA 3FWEA 4J9SA 4YFKF 2R7WA 2WDTA 4QPQA 4EFEA 2HHHH 1XMAA 1QQIA 1NG6A 3H5RA 3QU3A 1GLNA 4MFEA 3OYAA 2OTLI 4PWQA 4ECTA 5J47A 3T1YH 4JI3H 4AD9A 3ABTA 5KHDA 1Y1WJ 2FU4A 5KFCA 2IMWP 2LFBA 3TW6A 2ECCA 3MWEA 3FXKA 4B09A 1B33N 2E1MC 2A3SA 4Y8VB 3O8HA 3HSFA 3MN2A 1B72B 2PLYA 2VQFH 3LWFA 4GFBA 3ABLH 2D1VA 2PEXA 3DEEA 1VQKI 2R7SA 1FOXA 5BMVF 1LEAA 1P4WA 1K1QA 3I58A 1FWZA 4EV0A 1X58A 1FOKA 3AG4H 1KU7A 5E17F 3K2ZA 4LG3A 2FKLA 2WE6A 2JEFA 2PMZN 2XF6A 1K78B 2J9GA 1F43A 1FC3A 2EPFA 2B9SA 1P8LA 3GV5B 3FXOA 2TCTA 1FBUA 4F52A 5EZYF 5KFYA 1WR2A 4XSZF 4A3LG 3I53A 1ITYA 1YI2I 2WAQN 5F27A 4ED0A 4DR4H 2VL8A 2ME0A 4BDZA 3VPRA 3DBHB 4YAJB 3JAMK 2RDPA 1N33H 5KT5A 3RZDJ 4XN0A 2CW8A 3DTEA 1FJGH 4E4TA 3CCSI 1Y0UA 3NEUA 3Q9SA 4XLNF 2IA6A 3I59B 1HDDC 3DKYA 3OR1C 2F4OB 2IGKA 2NNYA 1S8NA 4HF1A 3F3XA 2Y9YA 3O8GA 3MFKA 2VJIA 2EZIA 1XMXA 1Z0XA 1N36H 1MH4A 2V1DA 3Q5FA 1BW6A 3DLAA 4PFPA 5K5QA 5HLHA 4G7ZF 3GTPJ 5FRNA 3KZYA 4XICA 1AN7A 5C1OA 1N78A 4AM3A 1Z2NX 3MR5A 2E1OA 4JI6H 3RKWA 1PYVA 5LHIA 3DXJF 3FK6A 3GTOA 2EH3A 1T94A 1UMQA 3UKGA 2CQ7A 3H20A 2AHQA 3UQ8A 2IA1A 3LA7A 4IJAA 3OOUA 1IXSB 3T1BA 4I09A 3CCYA 2R93A 3T5LA 1WJFA 4DBQA 1MMNA 3HL2A 3CJTB 1E2XA 1MNDA 2VJJA 3MVPA 2QUFA 2RDJA 2VOPA 3HOYJ 5EJCA 5KFJA 4J01A 1DUXC 2NU9B 2JQ7A 1GVDA 4BDYA 4IRKA 4ZH4F 3QPHA 4A3IJ 4QWCA 5DGBA 1FBSA 4IPAA 1X2NA 3BG7A 4XMYA 4F3QA 3JRWA 5FROA 5F0HA 1MJAA 4MQ9F 1KYZA 2PQ8A 3H3VH 2VR1A 2VQLA 2MLGA 3N97A 1LB2A 4V19K 1BR2A 1MBFA 3WGGA 4MV1A 1SANA 2BEOA 1UZCA 4XN3A 2CUZA 2Y2ZA 1R1TA 2DMTA 4LB6B 4TV8F 3UR3C 4JI2H 4KIFA 1GHCA 4APMA 4QWQA 3EPIA 4A3FG 5IYCG 1TAEA 1ETYA 2VASA 1Y1VG 2X0SA 1W36D 4ECZA 2BY2A 3SDBA 3PZPA 3OSPA 3F8BA 2VT2A 1E4EB 4KMUX 4F92B 2W9AA 2MGQA 1NH3A 3FHNA 2GLTA 1JE8A 4UCOA 1S9HA 4M9UA 2R6FA 1N34H 2E2HJ 1K61A 1TWFA 4DL6A 2OC6A 4TV7A 4U87A 5AIPA 5E1XA 3CC2I 1R5ID 4JI7H 1QZZA 2YSRA 2CRGA 1PUFB 5ED4A 3ZMSA 5CVRA 1K79A 1EHIA 4GRIA 3Q0UA 5FKKA 1P6RA 1P7IA 2CQQA 2HYJA 3U21A 2HPMA 4GC7A 1RUOA 2EV5A 2ZMEC 3WTUC 4DV7H 2FLLA 2WB1A 1BJZA 5J40A 3DF7A 4RU9A 1V55H 2H1LA 4MLOA 4DBRA 4H0EA 5CB4F 4IWXA 3ZN0A 4EFBA 4N4NB 3S17J 4AIDA 2BQUA 2DT7B 3RJ0A 3R23A 3H0GJ 4E4HA 5GADJ 3K4JA 4OIRF 1B6RA 2LF7A 5D5VB 3K5HA 4RGXA 1MMDA 1KU2A 3L2UA 4JX5A 4XLHA 4BXXJ 4F7ZA 1WJBA 2E60A 2B63A 2WAEA 3FXMA 4LIVA 2CUFA 3M9NB 1QNTA 1UELB 4ZDLA 3ZQLA 1T8IA 3CC7I 3PN1A 3G6VA 1S7OA 3TP0A 1GXQA 4HAMA 4MTEA 2IA0A 1BJAA 3OWTA 4CYCB 1GV5A 1FBQA 1Z2OX 1D0YA 2X6OA 4RAYA 4IHTA 2QQ9A 4EM2A 4U0YA 4EEQA 2C28A 3TMOA 3MFIA 1IN6A 1XSXA 3L09A 3TDUC 1QBJA 3COAC 5FKOA 1S7EA 1MBJA 5GONF 3PO3J 1U78A 1XCVA 3SDGA 3F23A 3S1MJ 1FVIA 5IWAH 5ERIA 2ZDGA 1AUVA 2VONA 2DPDA 3V6KA 2XB0X 4CYDA 3ZCOA 3KIOA 2Y0SE 3L2PA 3SZPA 2CW7A 5J3LA 3V4GA 3K4KA 4I0AA 4BXUA 4M9XA 3N8DA 2VXZA 2X9DA 1A5JA 2VKHA 3WNZA 2STWA 4J9OA 1OWTA 3JZIA 4EYIB 2ICWG 1N75A 2VKDA 2BZTA 3R5HA 2CV0A 3BR1A 4PCQA 2VE9A 1MMGA 3CJQB 3H3VK 4HYEA 2LNBA 3JSNA 2FD5A 4BACA 4DW6A 1X19A 1DV2A 1CS0A 4Q48A 3VFZA 3QU6A 3PR5B 2L02A 4KIGA 4IOCF 1F4KA 1EKEA 2BE5F 3KEYA 5LRRA 1JUSA 2W4SA 3JR9A 1VQ4I 2K4JA 1JKQC 2D45A 1Z2PX 2SCUB 3HG9A 3FF5A 1K6OA 3DPLC 2VUMG 3MZYA 1IOWA 1BGWA 2VOOA 3H1CA 2CUEA 3ASNH 1IDYA 5D8DA 1Y56A 3R4KA 2V9PA 3R61A 3F6VA 1WQ2A 2ZFUA 4HG2A 3VOEA 5C4XG 4HNTA 5FKNA 3VODA 3BR5A 4IXAA 3WU0A 1S0MA 5E3LA 2DMUA 4XORA 3KZIC 2DK8A 2VQCA 2M4KA 5ICFA 4DYQA 1FIAA 4ZYDA 3L2RA 2C2DA 4KNYA 3M8JA 1QZEA 1FY7A 3IV5A 4BHPA 5DM6F 2EBIA 2M7AA 3TQTA 3R6SA 2HDCA 5T14A 3H4DA 2ACJA 1UJ8A 4DV0H 4N0BA 3GIMA 3ZQQA 4ZDOA 4V2GA 3CF5F 1MJ9A 1D8KA 3MKLA 5KG7A 4BE1A 4KFCA 2UUCH 4ECVA 2VPQA 3S16J 4NLGA 3HC7A 3KEOA 2P81A 1XC5A 4HQEA 3NGDA 4LK0F 1W7PD 3HSRA 1UCRA 3RDIA 2RQQA 2NU7B 1BOBA 1WCMJ 4Y7NJ 2W9CB 2DQRA 5M5WJ 1UFMA 5BOXA 4D9JA 2IS1A 5LMUH 1AHDP 2D1HA 2BY0A 3F22A 5L1JA 1A36A 3KAKA 2XKPA 3M1EA 3V7CA 3OV8A 2R8GA 1ZHQA 3QFFA 4J9RA 3HDDA 2W48A 3HEFA 1U8BA 5BR8H 3K1NA 1HR0H 3CUQC 4IHJF 3JRAA 4XKBA 2HGCA 3FMSA 1J0RA 2TDXA 4MV3A 4GLXA 5KFTA 5HNHA 4BQQA 3BZ6A 5FD6A 1SEUA 2X1EA 5BPHA 5C44G 4OMZA 1SVOA 4TV9F 2CW0F 3HOSA 1RJQA 2YW2A 4RNMA 3GBGA 5J1YA 3M9OB 4KN7X 4QLCU 4BS9A 3J7ZI 4A12A 4GXOA 5J2UF 1KQ8A 3LQRA 1LVKA 3G8CA 1PP7U 2LMDA 2OF7A 2A61A 2QQAA 3CDIA 2NVYA 4IHWA 3I71A 1IXRC 1GUUA 2BY1A 3K0LA 4JK1X 2C00A 3HGYA 3BT9A 4BY7G 1XGOA 4EJOA 3VSKA 3BG5A 1RPWA 4L9NA 1TC3C 1WSUA 3H40A 2DMNA 4I98B 1JJ8C 3PW7A 2XROA 4G12A 1TWHJ 5DQIA 1TW2A 4FQGA 2W1OA 1FSHA 1RYRA 2ID3A 5LA6F 1M0TA 2GOMA 1PDNC 2HOSA 3WE2A 3H9QA 4KN4X 3RBEA 4F4ZA 3FXUA 5D4RA 2MH2A 2ASDA 3OYJA 2BQRA 4Y52J 3ABMH 1VQ7I 1TQPA 4ENJA 2FPPB 3JCUC 2IBDA 5CVUA 2EQRA 4ED3A 3K1PA 4FBTA 1W4MA 3QAHA 2RC4A 4GYGA 4MEXF 4L1KA 3GQCA 4NQWA 4L9VA 5FJ8J 2J6SA 2M7BA 2KQRA 3DPTA 4WWCA 3I4MJ 4X64H 2VXDA 2H09A 3KZZA 2DWCA 1R4MB 3RI4A 5F1JA 4N4OB 1OQYA 4KITB 2RVCA 1S68A 2W84A 4BJ6C 1OKRA 4B3SH 1R6RA 4XLFA 2UZKA 4AVPA 3RV4A 5E3MA 1YIJI 2LRDA 1G3SA 2YZNA 2R8IA 1FIPA 2P7VB 2V1XA 1G59A 2CV1A 1QU3A 2CJJA 1YE9A 4M3GA 4JI0H 2W9CA 1R36A 2CFOA 4I4TF 2ZJPF 3GTPA 3Q8SB 4UUTA 3AAFA 1JKPC 2JEJA 1LE8A 1I3AA 4DV1H 2LY9A 4M6YA 2UUBH 3MFHA 3PUBA 2CS3A 3LQQA 2R7RA 3EQLF 3GIQA 4MV4A 4R8HA 2MFZA 5EYRA 2VUGA 1IC8A 2QKLB 1X1CA 2HTSA 4M9ZA 4EJUA 2M9HA 3DFGA 2EILH 4LLGF 5F64A 1HKTA 4IR9A 5E3OA 1IBMH 4ENNA 1IJWC 5CVIA 2ATLA 1W36C 4G6DA 5JHUA 2W6NA 1HA8A 2W8KA 4DR1H 1UG0A 5DD4A 2ZJTA 2Z5UA 3PIPF 5D1OA 2AU0A 1D0ZA 4MIMA 2MC4A 4RUCA 1YS6A 1YQAA 3SZTA 3EETA 5KFGA 4M3FA 3ABKH 4C3IJ 4IQ4A 4XYLB 1O3TA 2X48A 3F8MA 1BIAA 1GXPA 1BI2A 1XDNA 4A3MG 2H6CA 1JUMA 2LK2A 1S29A 5DS9A 1KEEA 5KFDA 2DFHA 5E18F 1ZELA 4EGYA 1MBEA 2JK3A 1GO3E 1PK8A 3OHBA 4FM9A 2L3DA 1FP2A 4C5CA 4LMYA 3E97A 4RA2A 4UUSB 3HOUJ 2GLOA 3RFCA 5LBQA 2RDIA 1T95A 2CG4A 4ASNA 4P9FA 3RTRA 2R8JA 1J09A 5K5OA 1SMTA 3W6VA 1JGGA 3J7AO 2K7LA 3H92A 3IAM2 3S3MA 1DPRA 5BPIA 1KJ8A 2R4GA 4HF0A 1ETVA 1H0MA 2X1CA 4O6JA 2LD5A 2EIJH 2XGCA 3G1LA 3I0TA 5KFBA 3BCBA 4Z2YA 1JLLB 3ORRA 4C5AA 2GOXB 3HHHA 1WPKA 1N25A 2HYGD 3J7AY 4NC8A 2JN6A 3P5JA 2PMZE 2H8RA 1D0XA 4GC6A 2Z2SB 2JTVA 2K3FA 3V42A 2DQLA 3S1QJ 2WTEA 5IP9G 3S32A 4KYWA 2E2HA 4J00A 1BR1A 1TWAJ 2FNPA 3LOCA 2V7FA 2HEOA 2ZSIB 2DJNA 3IL2A 5KFRA 2YU3A 3BZKA 2YRWA 2E34A 2K40A 3BAAA 1NK3P 5L1IA 5CAEB 2JEGA 3ERED 3FDSA 3U9SA 1ZQ7A 2X6XA 3KLOA 3E1SA 4B3RH 3CESA 2BYVE 1MNEA 5CVVA 2UXDH 5L3DA 3VEPA 4XLEA 4HF2A 1ETQA 5IT9W 4AC0A 5FGMA 5JHFA 4RGRA 4Y15A 4IAJA 2W57A 3BY6A 2EV0A 4YR3A 3H0GA 3O2PE 2LR8A 2VPRA 1I39A 4HQ6A 3KLNA 4A5NA 4BWSC 3WTSC 4A0YA 3H4BA 2AGOA 5FJ8G 1I1SA 4YIFA 4I55F 3QZ7A 3GILA 2Z99A 2LP0A 3KP6A 2IP4A 1OFCX 1ZLKA 1OMIA 2PMUA 2E1CA 2DZDA 4M3DA 5KFHA 2PJRA 5KCMA 4JBAA 1CQJB 4IRCA 3OYIA 1YTYA 2A69F 1FP1D 1ZK8A 5J8CA 3RB0A 4Z6YA 1IDZA 5C1PA 4IF4A 5K5RA 4WCGA 1YYVA 2VB6A 1I7NA 3KYDB 4LH7A 1IRXA 4PUSA 4YR0A 1PUEE 4I0BA 2ZFWA 4F4XA 3TINA 2JJ7A 3RPUA 4A3LJ 4FTHA 3ZQ7A 1HNXH 4FISA 5KFPA 4ESFA 1E4FT 4GO1A 2CKZB 3ESWB 1IN5A 2PVPA 3BQ2A 2L7ZA 4KMFA 4ED2A 4RAGA 2W6PA 4R8UB 5H80A 1ZRCA 2JA5J 1QO0D 2Z3YA 4MHGA 2L9NA 5L3GA 2XC7A 2R7MA 2L7MP 4XKVA 4I2OA 4XIDA 2YS6A 3R5XA 4JX6A 3S93A 1MGTA 2XAHA 2ZMEA 3JTGA 4IHXA 5JUMA 3OYBA 2UXBH 4I6ZA 2K86A 3A02A 4DR3H 2JSPA 3U1KA 3CO7C 1EV7A 4MAMA 4A3JJ 3LFKA 3FMQA 2IVMA 1V3FA 4L5JA 4K2EA 2P5VA 3REOA 3RIRA 3T5HA 1RJPA 3K3PA 1EZ1A 4XRSG 1O75A 1WHUA 2I10A 2LYCA 3I3LA 1R00A 1SFXA 4ZYEA 2AGQA 2WAQA 1J5EH 1U6GA 4OOIA 2KRCA 1BR4A 1R23A 2NS7A 1W0TA 2W6QA 3ZN1A 4HNUA 1Y6IA 2R7UA 5F0FA 2RGVA 2VJ4A 3K1MA 1B04A 4DV3H 4I02A 4ECXA 5FFZA 2WBMA 5FKMA 4DNCA 4IHVA 2X6YA 4MFDA 1XGMA 4NC6A 5GPAA 4RNOA 3O6BB 2V4QA 1BXRA 3MAJA 2M0CA 2EZLA 5C8YF 4LJZF 5KVRA 5L9XA 3M3YJ 5BNGA 4BQOA 1V4YA 4EG0A 4JI1H 1XN7A 4CXFA 3OYCA 4A3GG 3OYGA 2KRHA 2MLKA 2OPTA 4PFOA 4U7CA 2FX0A 3K5IA 2ALZA 2K9MA 3F8CA 4A3EJ 5KFOA 2JA6G 2FMLA 1JTXA 4B44A 1TW3A 4UVBA 5DCMB 3BQ0A 2DIKA 3H0DA 4ECYA 3OYHA 1N32H 3BWGA 1HSTA 3JRCA 2QK4A 3ML6A 1ZH5A 4PJLA 3DTKA 3S8PA 1JX4A 2DDBA 4RBOA 4EBCA 3B6CA 3JTHA 3NRVA 2HQNA 5GAHJ 1SEIA 4EEYA 4Y4RA 3RQIA 3W3CA 5E8IA 4OX9H 4X1EA 1FNNA 3R0AA 1ETKA 3GTQJ 5L3BA 5KX5F 4A3FJ 3KFWX 3KX2A 5IYCJ 2IGMA 1Y1VJ 1DQUA 2KKOA 4RMNA 1WCMA 3SZGA 2RAEA 1G8XA 3M7GA 4IX7A 3K4NA 4PSXA 4AWXB 3T8RA 3LSRA 3ZPLA 4IWYA 2R85A 4L9TA 1K83A 4DL2A 3Q8QB 2FOWA 4LIUA 3S14J 2NU6B 2ZNYA 2KHMA 3ORQA 5IT9K 4MV8A 1B59A 3L00A 3BR0A 3RB6A 1SD7A 3OSNA 4CCLA 4EM1A 2HS5A 2NS0A 1TTYA 4AQYH 3TEDA 1T98A 5KAIC 3GIDA 1P92A 1ODDA 1BI1A 3F21A 4BE0A 5IOYA 3WO1A 1X2MA 1EJ9A 4MEYF 4IRDA 1FKAH 3TIIA 4UV9A 4U88A 2MW8A 1D5YA 3V8KA 2IGNA 1JTYA 4R8UA 4U6PA 1I94H 2OQGA 2R8KA 2Y75A 4Y3OA 2BBYA 3CLQA 2MYSA 3FK7A 3QPLA 1X9NA 1OPCA 3TKYA 3FXQA 1EF4A 1L2ZA 4O3OA 4M3EA 3VDXA 1FX7A 2R3SA 1BNCA 4BY1G 4AU7A 3HUGA 3EUHA 2GZWA 2BV6A 4EYHB 2MBFA 1GV2A 3GZNB 3PNYA 3Q0WA 4A0ZA 3KHHA 1H8AC 4LITA 2GXGA 1SAXA 2JA8J 4MQVA 4QJFA 1YHQI 2LH9A 3V7RA 1YG2A 3CO6C 3RPQA 5LYJF 4BH9A 2DCEA 3TO7A 5DLGA 3GFJA 1VS0A 5J2TF 4YB8B 2YYAA 4JV5H 4UB6C 4P9UA 1TWHA 1ON2A 2ECBA 3DCFA 4F50A 3LSHA 4BJ5C 5IOZA 1HNWH 1OR7C 4CCJA 2JA5G 4O3RA 4A2UA 5FRMA 2E35A 1WH5A 1MW7A 2FJ1A 4IZZA 1ONVA 4UUVA 2V26A 1IO2A 2AQEA 4NHJA 1VQNI 3UFXB 4A3JG 1KJ9A 3KHGA 3HOWJ 1S9FA 1FOYA 4OIPF 1JT0A 1WGXA 1U2WA 2OCEA 2BHZA 3GZ5A 5D8LB 5CA0F 2OH2A 4A3BG 4HOBA 1UC8A 2R7XA 1TQIA 3BP8A 3E0JB 5DCMA 4OMYA 1GT0C 5ICGA 1WVRA 4NBQA 4FX0A 3S2DJ 2YU9J 1NG7A 3HJEA 3OYKA 3G71I 1GYFA 2QYZA 4XLAA 1Z67A 2EFNA 3V8JA 2CYYA 2DOEA 4ED8A 2KISA 4HA8A 1S0OA 1KZHA 3BOQA 3A03A
chains in the Genus database with same CATH topology
4I7HA 2DPUA 3BJOA 3E5XA 3WTTC 3T0YA 4GKJH 1ZGJA 1HW2A 1B1BA 2H27A 4HDUA 2YR2A 4M73A 4D0PA 3G3ZA 1LDDA 2RGRA 3WG9A 1KGSA 2VC0A 2WV0A 5LL6b 4M9SA 3GF2A 1XDSA 1RNLA 2VE8A 4LFBH 4PDBA 1XMOH 2NAZA 1USSA 3E6MA 1ZG1A 3L4JA 3E3VA 1S3JA 2EFQA 4GGGA 1ZYRF 2E7WA 2EFOA 2O03A 3CTAA 2DI3A 1D8JA 4CICA 3RGZA 3ECHA 5JR3A 1J75A 1HW1A 3LSTA 2GA1A 1KA8A 1H9GA 3E5UA 1WH2A 2YX4A 4IHSA 1IXCA 3GVAA 3GXOA 3BA8A 1BOAA 1T0FA 1OYYA 1BN5A 5ILVA 3P9KA 3ZMVA 3RYPA 1HBXG 1V9PA 1HNZH 1DPUA 2QBYA 2MC3A 3HRTA 4R79A 3O3KA 3ISPA 1U5TC 2P8TA 3GEZA 1C0WA 4ESJA 4P55A 4UCSA 2UWMA 1T39A 1U8RA 4B8XA 2IPQX 3IRRA 4M7EA 2ZKZA 1KU9A 1KU3A 1MD0A 1ZHSA 3R60A 1XD7A 4P5OA 2OWOA 3L7WA 4ENMA 4G94A 3E6DA 2LKPA 1IN8A 2M5WA 2M8EA 3V8LA 3DF8A 3D5LA 2HVSA 4KT5C 1T38A 2AS5F 1EH8A 2OZUA 4RS8A 1LDKB 2OD5A 4XSXF 3LAPA 3JSOA 2P5KA 2D2WA 4AIHA 3DV8A 2PI0A 4A6DA 4ESBA 1UHWA 2L4AA 4RB3C 4ZZLA 3MCZA 3QP5A 1IZ1A 1DDNA 2Q0OA 2F5FA 3HTUA 2O0YA 2ZJ2A 4R1HA 1SD5A 1J5YA 2L01A 4NXNH 1BIBA 3U9GA 2QENA 5DCFA 2WWYA 2QZ8A 4BQAA 4O3MA 3WGHA 1OYWA 5D8KB 4ZYHA 2Y0MA 3ZP5A 5TRDA 4LF4H 3KP5A 2KIMA 1LJ9A 1BI0A 4DR2H 1F5TA 3KP4A 1YW9A 2G7HA 4XRFA 1JXSA 1P2FA 2JZYA 3J80W 1YO5C 5HLGA 4X62H 3JSPA 3K9TA 2F5DA 2R7FA 5D1OB 1J2XA 4KA4A 3RKYA 4K0KH 2OQRA 1MDMA 2FQ3A 5F6FA 3WE3A 4XLPF 1ZAOA 1O3RA 1STZA 3ZMUA 1W7PA 4UNOA 1YS7A 1O3SA 4LD5A 2CQKA 4GKKH 3EDPA 3I64A 4JQFA 5HVQC 2H6BA 4A0XA 1QZYA 3CLOA 1BBYA 4BHCA 2PN6A 3KALA 2DU9A 1J59A 5D5WB 3P9CA 4Y13A 2EA2A 4OIOF 2KJCA 3E5QA 3MWMA 1I6XA 2ISZA 2XUBA 1I6UA 4CZZA 1P4AA 3GFMA 1FZPB 4HDVA 1S03G 4YG2F 2FOKA 3RTXA 1IBLH 2FF4A 4L0ZB 1FYMA 2VT3A 2RNJA 3R0JA 3WTZA 2V79A 1HKQA 3WTWC 3S2WA 2VBZA 2Q2TA 5BS6A 4X66H 4DV4H 4DUYH 3P9IA 3GW2A 1G6NA 2RKHA 3M4IA 2LDUA 2XAGA 4KHPH 3GLXA 1WI9A 1CGPA 3RIZA 2Z9OA 4RGSA 4R7RA 4LSXA 5D6FA 5CLSA 2P6SA 3FM3A 4LH6A 4G8XA 1FPQA 1EH7A 3QRFF 3CDHA 3J80K 2A07F 2DO7A 4HX4A 1JGSA 2G9WA 1BI3A 2ZMEB 3KE2A 2V9VA 4IRIA 3GYHX 2UUAH 2VQFH 3JSLA 3ELKA 5CJ9A 3N40P 1CF7A 2PFBA 3L4KA 3M8EA 1SYXB 4P96A 2IP2A 3WODF 3C3WA 4JI8H 1XMQH 2FRHA 1A04A 4HW0A 4YHHH 5CYVA 1TNSA 5IT9Z 3T1HH 5TJJA 1Z6RA 4UCRA 4OIQF 3TO9A 3K69A 3LAJA 3IHUA 4ENKA 4UFZA 5D1PA 2L4MA 2OAZA 1G3WA 3ROUA 2QM3A 4HBLA 1A0IA 2DBBA 1Z1DA 2K02A 1BC8C 1XSDA 4UVCA 2P7CB 1Z9CA 3IRQA 3ULQB 5AONA 3RF2A 3F72A 2DT5A 4E70A 3M8FA 5A2QW 2O61A 2IRFG 4XBFA 2OBPA 4X65H 1LNWA 1I5ZA 3BABA 1D5VA 5H6QA 3BA9A 3FX3A 4RZQA 5FB2A 3GFIA 5JFRA 2J5OA 4KIBA 4MV7A 5LEJA 2WYOA 4KUMA 5FPOA 5H6RA 2XKOA 4WXCA 1FT9A 3BROA 5LHGA 1R58A 4PGGA 1HQCA 2HVQA 3N41B 5HS8A 3FM5A 2X0LA 1YFHA 2EFPA 4A6EA 4RAZA 2A5YB 2RN7A 1U5TA 2W85A 4EJVA 1ON1A 4LB5A 3ZMTA 2PBIA 5AIQA 2VBYA 4A2AA 2EV6A 2ADUA 4DV5H 2VBWA 2W24A 4RGUA 3RKXA 5E1WA 2IA2A 3CUQB 2KJBA 3HHGA 3BJAA 3T5XA 4CC5A 2DW4A 4M6XA 2MD5A 2UXNA 2J5PA 2NYXA 2LF8A 4U0WA 1F1ZA 2FMYA 4PGHA 5DUKA 1USTA 3RYRA 3TOBA 3MZHA 5F1RA 2E1NA 5D4SA 2H94A 3GZ6A 2Q2UA 3KETA 5EOYA 3SXYA 4LGWA 5FLXW 4YY3H 1TLHB 2XRNA 3L2CA 4Y17A 1R7JA 4S05A 2Q2EA 2K27A 5FFXA 2KSWA 4HZFA 1J9IA 2ZO4A 5D5UB 4DV2H 1IRGA 5HS9A 1R1VA 1RI7A 4WXHA 5ILUA 2FA5A 5FD5A 2FNAA 3VB2A 4IRGA 2M45A 1SMYF 2NRAC 3TO6A 3T8TA 4NXMH 3JW4A 5L3FA 5LEKA 2IW5A 2ZCWA 1L3LA 1E4GT 1I27A 1L0OC 2KIUA 3RJPA 4L18B 4UXNA 1T2KA 1B9MA 4Q0YA 4LLNA 3KEQA 4UCTA 1QGPA 2HTJA 4LFCH 5ICEA 3QOPA 1HXDA 4BHBA 3J81Z 6PAXA 1SD4A 1IF1A 4U7BA 1XMKA 1KQ0A 1W5SA 4LF8H 4EMSA 3CUQA 2QBYB 4ETSA 4G7OF 2QWWA 2STTA 3GO5A 1IBKH 4EJWA 2FE3A 4UVAA 3J81W 3B02A 4FX4A 3HSEA 4HV5A 1ZRFA 1B6AA 3ZMZA 2BGCA 3QP6A 2PG4A 4YIIA 1AOYA 4HLYA 2EK5A 3DP7A 3FXRA 4AIKA 3F8FA 1XGSA 1BC7C 1G3TA 2JT1A 2OA4A 5E1ZB 3ABUA 3QPTA 1Z6TA 3BPXA 3FZVA 1ZARA 4LK1F 4I01A 1GVJA 1B4AA 2DFIA 1BJTA 2K4BA 5DD8A 2IJLA 4BAYA 2YCHA 3EYYA 2E7XA 1S7AA 3TDZC 1Z05A 3KP2A 2CSOA 5FLXK 3F8NA 1MJBA 1RIOH 4LG0B 1YW7A 1F9NA 3GX4X 1IN7A 5HS7A 2W25A 4ON0A 4UHTA 1R5HA 2FXAA 3WTVC 3N6XA 2VBXA 1ZGAA 1ZHFA 2RV8A 2F5CA 2YX7A 2EWNA 2FBKA 5LHHA 5FPRA 3HOTA 1B9NA 2ELHA 1K78A 3H3ZA 4IVNA 3TGNA 4OINF 1REPC 5LGTA 4MNUA 4GYIA 3WTXC 3RGXA 3IKTA 5DV5A 4EVIA 4M74A 4EGZA 2IT0A 1XDUA 3I59A 3WGIA 3H3UA 4Q5SF 2DAOA 2RQPA 1RZ4A 2R7DA 2GAUA 4Q47A 1JHHA 4L9JA 2XIGA 1H9TA 1K7AA 3J7AK 1BM9A 1LVAA 1UB9A 5DUIA 4FT8A 1JHFA 1G3YA 2QQBA 3I54A 1I1GA 2JRTA 4B3MH 3F6OA 5E20A 4JI5H 1MDMB 2HWVA 3J81K 2O6GE 3C18A 2C6YA 5DYMA 2FBHA 1TNTA 1W7PB 5H20A 2ZBKA 2F5EA 4G7HF 4EQQA 4LF9H 1U3EM 4DQ2A 4U7DA 3U1DA 1DP7P 4M71A 4LG0A 1LQ1A 3TOAA 5ICCA 4GCVA 1LDJA 5LLQA 3E6BA 3HRSA 3HTSB 2HFHA 1SFUA 4S04A 3IC7A 4LFAH 4L5IA 2VODA 1R22A 4JI4H 1YLFA 1MZBA 5L3EA 2Q8KA 2ZNZA 4WX9A 5EEGA 3CUOA 3J80Z 2ETHA 5D5XB 2UXCH 2QLZA 4RB1A 4WK8F 1IUYA 3KAJA 2EA4A 2XASA 2XAQA 3B73A 4KDPA 1WKMA 1QPMA 1E17A 1XNQH 3FMRA 4G6QA 3PQJA 4DR7H 3HRMA 3SFZA 1SD6A 3TQNA 2GXBA 4UCUA 2HZTA 2XGXA 3M9AA 3Q9VA 3C7JA 4OU0A 2Y48A 1OYIA 4N9IA 2L54A 4HV6A 2UXXA 3C0FB 2COMA 2CGPA 4U0VA 2M30A 3FHZA 2GQQA 1KQ9A 3BJ6A 3IWFA 2HKOA 1PP8F 2A68F 4ZZDA 5LGUA 3W6JB 4HLXA 2FEZA 2VN2A 5EEHA 1CF7B 5J6XA 4RB2C 3PQKA 4CGZA 1ZG5A 1YW8A 1O57A 2XAFA 1FSEA 4DV6H 3CJNA 2FSWA 4CDGA 4CHUA 5L3CA 3MQ0A 1YIOA 1M0WA 4O5VA 2HGSA 2E5LH 3WU1B 1S6LA 1FYKA 5ILSA 3W6KB 2HR3A 2VPSA 4DUZH 2JPBA 2O3FA 4DR1H 1WRJA 2ZXJA 3N43B 2F4VH 5BPDA 2OZ6A 2V1UA 4HX7A 3E6CC 1XNRH 3FMAA 2XV4S 5HOOA 2UU9H 4MTDA 2M87A 5JI6A 1R1UA 3EYIA 1HSJA 1IN4A 3LMLA 2V6CA 1R5GA 1SFEA 2P4WA 1P4XA 1X3UA 2GWRA 3KXYT 5HDKA 3SQNA 1RUNA 2PMHA 3KCCA 3ZMDA 2DLLA 3GFLA 4EM0B 2XAJA 3P7NA 1IRFA 4UV8A 4UCVA 1XB4A 1OR7A 2MH9A 4A5MA 4RB0A 2PJPA 2EFWA 2WC2A 4CO8A 1TQMA 2YPRA 1NHAA 4EJTA 3GWZA 4YFXF 4KICA 2HYFA 2M1BA 1VTNC 4IRHA 1U5TB 4PZJA 4LLLA 5LGNA 2B0LA 1LEBA 5CVJA 1DGSA 5BMZA 2O8XA 1ZLJA 4B3TH 4LFUA 3OOPA 5J8FA 1O7LA 4BNCA 2A6EF 3ECOA 5A2QZ 3CVZA 1ZG3A 2GA2A 5HDGA 5IT3A 4DR6H 2A6HF 2QVOA 2Z33A 1HW5A 2ISYA 3SHFA 3KP3A 1XSVA 4LF7H 1FYLA 5DEQA 1AWCA 1IW7F 3PFIA 5BQTA 3OTOH 2X4HA 1XGNA 1Z7UA 1ZRDA 1KYWA 1UHMA 4DR5H 4LF6H 5KK1A 4AIJA 2HKXA 2VOBA 4J0MA 3IG0A 5FO5A 1ZN2A 3DEUA 4BYYA 3HXLA 2NNNA 3LA3A 4WXDA 4LSAA 3LA2A 2CO5A 1Z91A 2KIFA 1O7FA 2HQRA 4WF2A 3HYIA 2CFXA 5D6EA 2G7UA 3NQOA 1V4RA 1G4DA 3JAMZ 4MV9A 2JPCA 3D0SA 4FHTA 2GIVA 1TBXA 2VC1A 4A2BA 2ESNA 3N44B 1MKMA 1Q1HA 2XVCA 3I4PA 4LF5H 4NB5A 4HX8A 4YFNF 3I5UA